1QVGO

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1qvgO03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1qvgO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1qvgO02
2OTJP 3G71P 1Q7YQ 1W2BO 3I55P 1KC8Q 1KQSO 1JJ2O 1NJIQ 1VQ6P 1Q81Q 1YJNP 2QEXP 1QVFO 1N8RQ 1VQMP 3CCQP 3I56P 3CCEP 1YHQP 1YJ9P 3G4SP 3CD6P 1VQPP 3CCRP 1YITP 3CCMP 1VQ4P 1M90Q 1K9MQ 1Q82Q 1VQ9P 3CC7P 1VQNP 3CCSP 3CXCO 1VQOP 1VQ8P 1VQKP 3OW2O 2QA4P 3CCJP 1VQLP 3CMAP 1VQ5P 1S72P 1YIJP 3CMEP 3CCUP 3CCLP 3G6EP 1K73Q 2OTLP 1KD1Q 1K8AQ 1QVGO 3CCVP 3CC2P 1Q86Q 1VQ7P 3CC4P 1M1KQ 3CPWO 1YI2P 1YJWP
chains in the Genus database with same CATH superfamily
1KILD 1RQVA 2OYIB 3QWOC 3G71P 5JPAA 3D6ZA 2WSCJ 2HLOA 4ASWA 1R8EA 3L72G 3VP9A 2WSFH 1DNYA 2KODA 3A3YB 2KOPA 2JO1A 4COPA 3L74E 1NTKG 3II6A 3CL3D 4U0AA 2J5UA 3Q2YA 3WU2H 4WBAA 3H32B 1P84E 1VDFA 4IPYA 3H1HJ 4WB4A 1IK9A 4OVNF 1LTTC 4N6JA 2C0WA 1BAJA 1GK6A 4JQ0D 4BPGA 1MZ9A 3AE2C 2BCCG 5KLVD 1GU4A 3H32A 1G2CB 1M6EX 3VMAA 3L70D 5AVWB 1PPJG 5CCGC 1SQQG 2KGAA 2WITA 3TGUD 2BUOA 2CWOA 3WBHA 3V2PA 2IZ0A 1FE6A 4Y99C 1NQ4A 2OTLP 3RL0B 3MP7B 1G2CA 1N7SC 2KG9A 2XV6A 2QJPC 2YMKA 3RK3D 2OTJP 5KP6B 1EDLA 3SWFA 3AECC 1ZP0C 2XNDH 1NTKK 4M3LA 5C39A 1VQMP 3TNUB 1LGHB 1HF9A 1L0NJ 3NXSA 3O8ZA 4L74A 4B86A 3EWKA 5AW0B 2Q3IA 2AVAA 1N73B 1JEKA 1EMVA 1Y9BA 2JEEA 2Z46A 2JU1A 1URQC 2QEXP 2ZAEB 3NMDA 3V2NA 4PJ0E 4MN4C 3LIEA 4IZ6A 1N73A 2X2BA 3I5CA 1VQKP 2QA4P 4I1LA 1SQQK 3EJBA 4TLFA 4UB6E 1JY3O 1PZQA 1SQVE 5E79E 5APWA 1FAVA 3MUDA 3O6QB 2M8PA 1D7MA 1SQXE 1VQPP 1FJKA 1CI6B 2NPSC 2GZGA 2IFNA 2IYOA 2K0DX 1RO2A 5APTA 2Y9ZA 1N7LA 1ZV8A 1BSHA 2PEQA 1NHLA 1USDA 3O6QA 1CI6A 2FYUG 5CBOA 3CCQP 1M7LA 1M6NA 1OWAA 1X9VA 3BCCJ 3GF7A 1KYOD 3H1JG 1M57D 2XXMA 2YXRB 2BCCD 3TK1A 5HVCA 1EDJA 1SQPE 2VLPA 2XV5A 3A2AA 1KFMA 2JR8A 2DW3A 1ZRTD 4WY4D 2LMLA 1PP9J 3JSVC 3L74J 2QE7H 1S5LX 3P8CE 2BQ1E 3IN6A 3JCUE 1G1IA 3EFFK 3CXHE 1HY8A 2IZ1A 5TISE 3JCUH 1VF5B 4D6TE 3H1HD 3TDKA 2JYLA 3LIDA 1HWTC 2ZFCA 1QLED 3VP8A 2YKOA 3RGUA 1JY2P 3GKLC 4IOIH 4WWIA 2XZ1C 1T8KA 3CMAP 3L4FA 2C0XA 1L0IA 1Q2NA 2O1JA 3E7KA 3CLQA 5KAIE 3W67A 1ZOYC 2O01N 4HH2A 4OGQB 4W7YA 1JM0A 4A7PA 1ZLLA 3E1IA 5KP7B 1JTHB 2NZ2A 3CCRP 5APQA 1L2PA 3CWBG 3PJSK 1L0ND 2YMYA 4U7JA 2QG4A 1L0LG 1LWUC 4BPHA 2E5TA 2FQ1A 1GL2C 2E76B 1QX8A 1NO4A 4AUWA 1JTHA 1SQBG 3RK2B 1BGYE 2QM8A 3GMAA 2EIAA 3G0VA 2VLOA 1VL2A 1GW3A 5KLVE 2AXCA 3L71G 4YXDC 3N4XA 3PLNA 2KK7A 5APVA 3S4RA 4IFFA 1HJ0A 3BRVB 2M5AB 2N1TB 3AEGC 2M8RA 3CX5E 4WYMA 5CCHC 1DV5A 1SQVJ 2KUBA 1ZXGA 3WUTA 5AVXB 3HD7C 1AUMA 4I7ZC 2GZFA 2VSQA 1K30A 3OA7A 4K3AA 2M5AA 4HKZH 2IBZD 1EC5A 1L0LK 1JJ2O 3AEDC 4PD4H 2GM4A 1S9KD 1SQBK 4BXLA 1JUNA 1PEMA 1BSNA 4OH8B 5F2NA 2P9XA 1FZAA 3L73E 2M0BA 2WZ7A 1DD3A 1VF5D 5CMZA 1L4AB 2QJYC 1SQPJ 4DT0A 3GW6A 4PV1B 2WPRA 2QM7A 1FJPA 1FZFA 3SFEC 1KILC 1AVOA 2E75B 3AEBC 3EFGA 3KZIH 3KQGA 4GIFA 1LTAC 3GZLA 4D6TJ 2XDJA 2KI7B 3SWYA 2FVAA 2GDWA 4DJGA 1VHNA 1JY2N 1SVFA 1M90Q 2KOQA 3VMXA 1LP1B 5KKZC 2GZIA 2R5DA 5KTBA 2L9FA 1SQBD 1N2DC 1VKUA 3BRTB 1RF1A 2M8LA 5AW4B 4U0EA 2BCCE 3M06A 1HQBA 3HTKB 2AXTE 1LP1A 2E76D 1QEXA 2IX7C 3RK2D 2AXTH 3L35A 4L76A 3G9RA 1RY3A 1SQQE 1JY3P 2O01J 3P05A 1NWQA 1U57A 1Y8AA 3HTKA 1IO4A 1NJIQ 1MV8A 4W80A 1J1DC 1EOQA 4XFYA 3I56P 2FFDB 1BGYJ 1LTJC 3HZQA 1RNIA 3ABVC 3RK3C 5CBNA 3CCJP 5H2FE 1JCCA 3VYIA 5KLVJ 1OVRA 3CC2P 3S1KA 2JDIH 1RHZB 1RE3A 1OXZA 1AQTA 1ZMBA 2PGDA 2FFDA 1RE4C 3AEAC 2LL8A 2QRXA 1ACPA 1JMBA 3GG2A 4I6MC 5F2KA 1MUUA 1SQVD 1GK4A 1FZCA 4QNBA 3H1IG 1M1KQ 1YHQP 1SLQA 1SQXD 2Z44A 3LW5J 1FOSF 4U0BA 3H25A 3L75G 2Z4EA 1JO5A 3NY7B 1KQLA 2ZXEB 2XT1A 2E75D 5GTIH 4YTPC 3I55P 2I8DA 5APXA 1GXGA 1L0HA 3AE9C 2AFEA 2KOSA 3L73J 4LGDE 2HR3A 1GXHA 1SQPD 3LRYA 2YKPA 1Q90D 1KB9I 3Q3DA 2KOOA 1AFOA 2BEQD 3GHGC 3H1JE 3P8CD 1OVUA 1Q7YQ 2R44A 1ZR4A 1A02F 3CXHD 4EOTA 5DJUB 1U7JA 1SFCA 1HBWA 4C46A 2JB0A 1LT9C 4JBZA 4HYTB 2GUVA 1NTMG 4WY4C 5HGOA 2Q7CA 1JB0J 5AW1B 1LNQA 2CNRA 1R5LA 2HODB 4PD4I 2L0QA 5HGNA 3G28A 5DJTB 2PEKA 4O9BA 3HE4B 2BCCJ 5L8RJ 2HPCB 3CCSP 1PGJA 1JY3N 5KLIC 2OYIA 1NOHA 3FXDA 1RQUA 2D2CB 2ITAA 2PENA 4UB8E 1SQQJ 3HE4A 3TSIA 3WU2E 5AW7B 1FU1A 4UB8H 4BWNA 3U1CA 4H0LD 1OZHA 2AEJA 2YIUC 3NTNA 3DPHA 5HGLA 3F89A 3G26A 1OW8A 1BGYD 3KYQA 2JQ4A 3H4EA 2QJKC 2L5GB 4IFDK 5KJ7A 1L0LE 3H1KD 2YNYA 2OYHB 2JAZA 2OTKE 2RKLA 2ZYDA 1ZW0A 1SQBE 1BE3D 1T8ZA 2Y0CA 2ZXXA 1VQ4P 3MUDC 2ZT9B 2L4BA 1J1EB 1M1JB 1OMIA 1DEEG 1ZR2A 2OYHA 3L71E 1H0TB 1IFPA 2I1JA 1YJWP 4R0MA 3CX5D 1NKZB 2MY5A 4GKGA 3G1GA 3FX0A 2CGQA 4IL6X 1KQGB 3Q5SA 2IDBA 4GR2A 1H0TA 2KZIA 5AVZB 1PEQA 3B8EB 3HUSC 3V2RA 3GLMA 2JU2A 2MD9A 4L75A 2BASA 3HYBA 1SFCD 4NPEA 3TNUA 3LMOA 4TT3H 5M1BA 2L22A 1USEA 1IFDA 3L73D 1LT1A 4F37A 2QVAA 1MFZA 1EZVG 5BS1A 2W6BA 2M3EA 4JYCA 1NU1G 3B5NC 4PWVB 1KMIZ 4H13B 2N5IA 3H1JJ 3L72D 4DZOA 2N9BA 4JPZB 1KZUB 3CD6P 3SWKA 1EIAA 3FXEA 3CE7A 1YYCA 2KB7P 2UWJE 2N9YB 3H47A 1ZMEC 1NTKD 1EZVI 2QJPB 2Y0EA 2LTEA 2WPQA 4I2LC 2FXMA 1HVVA 2D2CD 5B5EE 5CCGA 3MHVA 1FZBA 2K37A 2WSSH 4DOJA 5B5EH 1H8AA 1LJ2A 2MR8A 4C7RA 1AJYA 2WSFJ 1NAFA 1OR5A 3D6YA 2RMZA 3W68A 1LTGC 2CQ8A 2J58A 4ZMDA 1URQB 3CI9A 3C8VA 2YKQA 1PPJD 1SQQD 2WPTA 1NU1K 1PGPA 1PGOA 3B5IA 4GDOA 3WUVA 3HE5B 5B66E 1LTBC 2E76C 3CCVP 2ZT9D 1KFNA 1URQA 2V7QH 3G29A 1YI2P 3RK2C 5B66H 3OAKA 1OIPA 1BDDA 3QH9A 2MJZA 2M3BA 2K93A 1NYHA 4QMAA 3AE6C 3RL0D 1AF8A 1QVFO 1L0LJ 2A45H 1IJDB 1PL5A 3HE5A 3Q5PA 1SQBJ 4GOEA 2FYUK 1K04A 1RF0A 1FDIA 5AW2B 3Q20A 2WSEH 3BCCG 2Y0DA 3U43A 1OW6A 2W90A 2HYNA 2FVEA 3G3ZA 1BCCG 2WWWA 1OX3A 1PP9G 1NVOA 3PP5A 2QIWA 1AQ5A 2M5RA 3B71A 3WUUA 2FYNC 3H1LG 3H1KE 3C9IA 3L75E 3DTJA 1S1CX 3S9OA 4U0DA 2FY8A 4H13D 2KSJA 1KB9E 1BE3E 4WVZA 1KB9H 2G3AA 1NAYA 4U0CA 2C9LY 4AQRD 2FYUD 4U0FA 1NTZG 2K92A 1AYIA 1KN7A 3BATA 1AA0A 3H1JD 1FZGA 3CCMP 2LXBA 2E75C 3VMYA 2K0XA 1MFTA 1SQXJ 2OGUA 1Q86Q 1HTLC 3M9HA 4GOFA 3RL0g 2N1TA 3C1LA 4PD4E 1RF1C 2R3SA 3P8MC 4YXWH 2N98A 2KZJA 1CSBA 1NKNA 1YITP 2V4HA 2KLUA 3IF4A 2GYKA 2FAEA 2K88A 2KGDA 3L36A 1FZEA 1LWUB 1S3JA 1NGMB 5AW6B 2PRRA 2KGCA 1GL2B 2H88C 1BDCA 2JYGA 2EHTA 3M0DC 1IMPA 1IK7A 1WMKA 3NFQA 2WTYA 2PAJA 2CPSA 4GT1A 1F80D 2R3CA 1MZ8A 5CJ0A 1LWUA 3KZIE 1NTZK 3KHUA 3L72E 3OW2O 4HB1A 1EDIA 3KXDA 5GTHH 1L4AA 5AW8B 5TJHA 1YTZT 4LLHA 1NTKE 5AW3B 4MRTC 3B4QA 4Z1MH 2VLQA 3CWBD 2JBGA 4OGQD 1GPJA 2KIKA 1E79H 1L0LD 2JGPA 4PXHB 3HD7B 4I7ZB 5CJ4A 3MIWA 4H0LC 4LC1A 3JC22 1FZCC 2R5BA 4XFJA 2XZRA 2GA1A 3HD7A 3L71D 2OQQA 3V2QA 4OWFA 3U1AA 4KHXA 2E74B 4R4MA 3VTPC 5HGMA 4U3FG 1GZLA 4K35A 2FBWC 1E6JP 1PPJE 2A06G 2PY8A 2DNWA 5F2OA 2WSCH 1D1DA 2A45G 1KYOH 2P1JA 2QJYB 3EQ2A 5AVTB 2JJLA 3GZMA 1FOSE 1DD4A 4D6TG 1KILB 1Q82Q 2N1TD 1BXIA 3CCUP 3H1KJ 1QVGO 2PEOA 1CW5A 4YPCA 5BVZA 1EXIA 1BE3J 2YXQB 1S2EA 2A45I 4NEOA 2E43A 2E5YA 5AW9B 2H43A 2H89C 3AE1C 5KKZB 1E5WA 1SFCC 1NH4A 4HKGA 2K2QA 1U7MA 1EZVE 2OYOA 1RH5B 3GF3A 1NU1E 5APYA 2CPBA 5APSA 5K5GB 2W6JH 2LIUA 1S5LH 1LTSC 1L4AD 1ZN5A 1VQ8P 3P7KA 1HGZA 4PV1D 2WPVB 1IZNB 3G6EP 1SS1A 5GTIE 2VLNA 1LTIC 2OYIC 1DIPA 1A43A 2KG8A 3RG6C 2P2UA 1XTCC 5EFWB 4RJTA 5KLVG 1OVVA 4N78E 2FQ0A 2EG5A 1J1DB 4H44B 1N8RQ 4EI2A 1LTJB 2FYUE 3L70G 3ITKA 5DCKA 4KJMA 2D2CC 3TGUG 3ZDMA 3CC4P 3HD7D 3L72J 1QL1A 2K9YA 3D71A 2ZJSE 2LR2A 2PEIA 2B87B 5BU8B 1NTKJ 3M9BA 1YQ4C 2POHA 2G8YA 1H89A 4NPFX 2FKWB 2XU6A 4R4LA 1X22A 2LIWA 2E74D 3VMZA 2PNGA 2LKMA 5KAFE 2B87A 2WPSA 2YO3A 5KAFH 3A7OA 5KLVK 2FVFA 2LF4A 1VQNP 2HODA 3RL0C 2GUSA 1YQ3C 2KLVA 1N86A 5EJDA 3BCCE 2RN0A 2HPCA 4CPGA 1BCCE 1IFIA 1K9MQ 1IUQA 2XZ0D 3H1ID 1YIJP 1PP9E 4RO0A 1K73Q 3GHGB 1N73C 3CWBE 1YTZI 2O1KA 2N50A 2B89A 3L75D 1PEUA 1NTMK 2KW2A 1JMMA 2Q3EA 3DS3A 2P10A 2K9JB 1KB9D 3G21A 4NPDA 1FDOA 2HG5D 4XRQA 3H1LE 1AVYA 3GHGA 1P84H 1PEOA 1LT9B 1VQOP 2IPPA 3L37A 4CA3A 4WY4B 2Q5UA 1IFMA 4UHPB 4XFXA 3CPWO 2K9JA 3R4YA 3RBXA 4H13C 1T2KD 1QGKB 2J59M 1IMQA 4IFMA 3PHLA 2MVUA 1M1JA 1LT9A 4PH0A 4WY4A 2JP3A 1NTZE 3AE4C 3H0DA 4H44D 1NU1J 4PD4D 2HFED 5KLIB 1A02J 3WMM0 2EHSA 1UNKA 3H1HG 3F5HA 1KYOI 3EJDA 2YIUB 1UIXA 2L6EA 1KTMA 3BVHA 1TU3F 1NTMD 2O3JA 3PTZA 2MVVA 2FXPA 5EW5E 4EYYQ 2QJKB 1WRGA 2E1MA 1K8AQ 1GD2E 2BEZF 2FYUJ 1GMJA 4M0IA 1W2BO 3DS5A 1UJZA 2QSIA 2CG5B 2MKVA 2ROQA 4PJ0H 2WVRA 1T3JA 1VF5C 4Y99B 5BU5A 1DX7A 1L0NG 1N7SB 1RF0C 3A0BE 1UIIA 4UB6H 2JWAA 3DS4A 2Z5HA 3FGAD 5E79H 3A0BH 2KG6A 2KS1B 4PH1A 5BS2A 1YJ9P 5AVUB 3A0HE 5KJ7D 3CC7P 1VPCA 1N7SA 1FBMA 1HGVA 3A0HH 3HUSB 2KORA 3AE5C 2W83C 4OGQC 2KS1A 1DH3A 1PIXA 2M8NA 3HUSA 1S4XA 3E2DA 4JYBA 2PEMA 3MGEA 2NRGA 2H7HA 2KWLA 1VQLP 1VQ5P 4U3FE 1BCCJ 2YO2A 2A06E 3HRNA 3IFMA 2GZJA 2PP6A 3B5NB 3FWLA 2GDYA 3PRJA 2IBZG 1L0NK 3CWBJ 2ZYGA 2WT7B 3H6PA 5I4TG 2NO8A 4ASVA 1EDKA 2NPSB 3A5TA 3CXHH 5TISH 2KNCB 2ZYAA 3T97B 1HH0A 2N6YA 2JKVA 2KSEA 3B5NA 4KT0J 3H1LJ 1GTWA 2I1KA 1ZNVA 1W5CE 2WT7A 4N3YB 3UIAA 1IFJA 2W27A 4AYCA 2N1TC 1YJNP 3L71J 4XROA 1IC2A 3RG2A 1KILE 1M56D 2NPSA 2IBZI 2KNCA 1EZVD 4GR6A 3T97A 1CZQA 3L74G 5HV8A 2FACA 3KDPB 1NU1D 1NTZJ 5AVRB 1OFCX 3Q1MA 5KAIH 1KQSO 2LXCB 3H1IE 2O01H 3MTUE 4XA4A 3DS0A 2Z45A 5AVQB 1JNMA 4N78D 1T3UA 2AEFA 5CCGD 1PFIA 2K5XA 1FR2A 3M0AA 5AVVB 1L4AC 3N7NA 4DCKA 1Z56A 2RH0A 4XE5B 2AFDA 3V4WA 4PV1C 1N7SD 1A8OA 2MF4A 1R5SA 1P84I 4ZKUA 2QNWA 2ERHA 2AF8A 2K1AA 3SFDC 3L70E 4EDFA 4RESB 2KYVA 2B9BA 1GW4A 3TGUE 2K94A 1Q81Q 2FADA 1M74A 4W7ZA 3RK3E 4ZKPA 2P7JA 3CX5H 2N5HA 1URQD 2L91A 3V4QA 1JOCA 1T6AA 3MD0A 3LW5H 1OW7A 3Q5RA 1Y47A 1NTME 3EJEA 2FYNB 3E1RA 3VOPA 2W8ZA 2Y9YA 2FQ2A 2LPKA 2E42A 4BRYB 4BPFA 2E74C 3B5ND 2PEJA 2K0YA 1JCDA 1GU5A 1Z6MA 5GTHE 1GL2A 1FDMA 3BCCD 2R32A 1KD1Q 1VQ7P 1SQVG 2C9NY 3M1MA 2LOLA 2NPSD 2W6AA 1BCCD 2XNXA 4BRYA 2V7QJ 2P67A 4U3FJ 1SQXG 1RE3C 4COCA 2IFMA 4IL6E 1DEBA 1PP9D 2FFDC 3L74D 3R2PA 2K3RA 3AEFC 4IL6H 3CXCO 2KXPB 3DS1A 2DGYA 2Q1KA 4ZNCA 2Q6QA 1RO0A 1XTGB 1P84D 2FYZA 4RKUJ 1X8YA 3K5BA 1KC8Q 1RF1B 3H1LD 4EIJA 4QKOA 2GZEA 5CCHA 2WSEJ 2H8PD 3U59A 2ZVNB 3AE7C 1J2JB 2KOGA 2AEMA 1G1JA 2KP8A 3M91A 1X79B 1SQPG 1EQ7A 1S72P 1FS0E 1FC2C 3OJAB 1KYOE 1WT6A 2IYPA 2JWDA 1NTZD 4L73A 1SQVK 3V6IA 1X3OA 2ZVOB 1PV3A 1ZRTE 1SQXK 3H1IJ 3NTEA 3D70A 3PH0A 5APUA 1T2KC 2Z5IA 2JO0A 3L75J 2VRSA 3M0DA 3AE8C 1VQ6P 3VN0A 3H1HE 4H44C 2BHVA 2WMMA 4JF7A 1KILA 2PFXA 4DG9A 2LKIA 1K05A 3CXHI 1VQ9P 3DS2A 3VRLC 3USSA 3MGNA 5KP8B 4H0LB 1EXJA 5H2FH 1SQPK 1FZCB 3IAOA 3L70J 3BASA 2FHSC 2SPZA 3TGUJ 1S5LE 3CCEP 1GL2D 4H2XC 1W2EA 1M8OB 1CEIA 1AV1A 3CCLP 2Q9IA 1BGYG 2MR7A 4XFZA 4H2WC 1KORA 1L0NE 3M9QA 2ONTA 3H1KG 1YBKA 3AE3C 2GDXA 1NTMJ 3RBZA 3B4SA 4GODA 1BE3G 3GJNA 1JY2O 3RK3B 3V5BA 2P58A 5CCHD 4H2YC 3AEEC 2B88A 5KJ7C 5CHXA 2OARA 1E0HA 1HUCA 1LTJA 2EFJA 3G1IA 3TYYA 4U3FD 2XKMA 4HJGH 2A06D 3SSUA 1SP4A 4C7NB 5CZDB 1MKMA 1KQFB 1SFCB 5AVYB 5AW5B 2KR5A 1KLPA 2OYHC 1RE4A 3MZWB 1QL2A 3KPEA 2WQYC 1KV4A 1IFNA 1H88A 1HJBA 3FWNA 1GDTA 2FXOA 4C7NA 4D6TD 2IBZE 3CX5I 3G4SP 3IR9A 2KGEA 2N6ZA 2ZT9C 3TF5A 3P32A 1J1EC 1M1JC 4Y28J 1S9KE 3L73G 1PGQA 7CEIA 3CMEP 1QRJA 2CK3H 1X0TA 5AVSB
chains in the Genus database with same CATH topology
2Z46A 1PEUA 1A43A 3DS4A 3RG6C 5JPAA 3G71P 1Q7YQ 1KQSO 1JJ2O 1NJIQ 3DS3A 2QEXP 3G1GA 2EG5A 4COCA 1EOQA 3G21A 1N8RQ 4U0FA 4XFYA 3I56P 4PH1A 5BS2A 1YJ9P 3CCEP 4XRQA 3CCMP 1PEMA 3HZQA 1RNIA 4GR2A 5HGMA 3DS0A 2Z45A 3B5IA 3CC7P 1PEOA 5F2NA 3CXCO 3DS1A 1E6JP 2P9XA 2KODA 3CCJP 2QA4P 2DGYA 5DCKA 3CMAP 1VQKP 1PEQA 5HGOA 3CCLP 2PY8A 4COPA 3CCVP 3CC2P 1RO0A 1Q86Q 4XFXA 3CC4P 3G29A 3CPWO 1YI2P 4XFZA 5F2OA 1ZMBA 3HYBA 5HGNA 1KC8Q 4U0AA 1D1DA 3G28A 2ONTA 2PEKA 1QVFO 2M8NA 1A8OA 2M8PA 4PH0A 1VQPP 4IPYA 3CCRP 2PEIA 1YITP 3E2DA 3H0DA 2PEMA 3MGEA 1Q82Q 3CCSP 5F2KA 1VQLP 1RO2A 1VQ5P 1S72P 3CCUP 1BAJA 5BS1A 1QVGO 4QNBA 2PEOA 2PEQA 1M1KQ 3Q20A 1YHQP 2PENA 2Z44A 2EIAA 2JYGA 1M6EX 1Q81Q 4U0BA 2OARA 3G0VA 1M74A 2EFJA 5I4TG 3CCQP 3DPHA 3G1IA 3CD6P 1EIAA 1M6NA 2L6EA 5HGLA 1M90Q 3NTEA 2LF4A 3G26A 1VQNP 2BUOA 2CWOA 3WBHA 3H47A 2XXMA 3OW2O 3H4EA 1VQOP 2JO0A 2OTLP 2E1MA 1K8AQ 2XT1A 2XV6A 4M0IA 2OTJP 1VQ6P 2M8LA 1W2BO 3I55P 4U0EA 2BHVA 1YJNP 3DS5A 4XROA 1VQMP 3G4SP 3DTJA 4WYMA 2BQ1E 4U0DA 1VQ4P 3LRYA 1K9MQ 4GR6A 2PEJA 1VQ9P 3DS2A 1AUMA 1IUQA 3VRLC 1VQ8P 3P05A 1YIJP 3CMEP 1QRJA 3G6EP 1K73Q 1KD1Q 1K30A 2JYLA 1VQ7P 4U0CA 3M1MA 1YJWP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ P;  3G71 P;  1Q7Y Q;  1W2B O;  3I55 P;  1KC8 Q;  1KQS O;  1JJ2 O;  1NJI Q;  1VQ6 P;  1Q81 Q;  1YJN P;  2QEX P;  1QVF O;  1N8R Q;  1VQM P;  3CCQ P;  3I56 P;  3CCE P;  1YHQ P;  1YJ9 P;  3G4S P;  3CD6 P;  1VQP P;  3CCR P;  1YIT P;  3CCM P;  1VQ4 P;  1M90 Q;  1K9M Q;  1Q82 Q;  1VQ9 P;  3CC7 P;  1VQN P;  3CCS P;  3CXC O;  1VQO P;  1VQ8 P;  1VQK P;  3OW2 O;  2QA4 P;  3CCJ P;  1VQL P;  3CMA P;  1VQ5 P;  1S72 P;  1YIJ P;  3CME P;  3CCU P;  3CCL P;  3G6E P;  1K73 Q;  2OTL P;  1KD1 Q;  1K8A Q;  1QVG O;  3CCV P;  3CC2 P;  1Q86 Q;  1VQ7 P;  3CC4 P;  1M1K Q;  3CPW O;  1YI2 P;  1YJW P; 
#chains in the Genus database with same CATH topology
 1KIL D;  1RQV A;  2OYI B;  3QWO C;  3G71 P;  5JPA A;  3D6Z A;  2WSC J;  2HLO A;  4ASW A;  1R8E A;  3L72 G;  3VP9 A;  2WSF H;  1DNY A;  2KOD A;  3A3Y B;  2KOP A;  2JO1 A;  4COP A;  3L74 E;  1NTK G;  3II6 A;  3CL3 D;  4U0A A;  2J5U A;  3Q2Y A;  3WU2 H;  4WBA A;  3H32 B;  1P84 E;  1VDF A;  4IPY A;  3H1H J;  4WB4 A;  1IK9 A;  4OVN F;  1LTT C;  4N6J A;  2C0W A;  1BAJ A;  1GK6 A;  4JQ0 D;  4BPG A;  1MZ9 A;  3AE2 C;  2BCC G;  5KLV D;  1GU4 A;  3H32 A;  1G2C B;  1M6E X;  3VMA A;  3L70 D;  5AVW B;  1PPJ G;  5CCG C;  1SQQ G;  2KGA A;  2WIT A;  3TGU D;  2BUO A;  2CWO A;  3WBH A;  3V2P A;  2IZ0 A;  1FE6 A;  4Y99 C;  1NQ4 A;  2OTL P;  3RL0 B;  3MP7 B;  1G2C A;  1N7S C;  2KG9 A;  2XV6 A;  2QJP C;  2YMK A;  3RK3 D;  2OTJ P;  5KP6 B;  1EDL A;  3SWF A;  3AEC C;  1ZP0 C;  2XND H;  1NTK K;  4M3L A;  5C39 A;  1VQM P;  3TNU B;  1LGH B;  1HF9 A;  1L0N J;  3NXS A;  3O8Z A;  4L74 A;  4B86 A;  3EWK A;  5AW0 B;  2Q3I A;  2AVA A;  1N73 B;  1JEK A;  1EMV A;  1Y9B A;  2JEE A;  2Z46 A;  2JU1 A;  1URQ C;  2QEX P;  2ZAE B;  3NMD A;  3V2N A;  4PJ0 E;  4MN4 C;  3LIE A;  4IZ6 A;  1N73 A;  2X2B A;  3I5C A;  1VQK P;  2QA4 P;  4I1L A;  1SQQ K;  3EJB A;  4TLF A;  4UB6 E;  1JY3 O;  1PZQ A;  1SQV E;  5E79 E;  5APW A;  1FAV A;  3MUD A;  3O6Q B;  2M8P A;  1D7M A;  1SQX E;  1VQP P;  1FJK A;  1CI6 B;  2NPS C;  2GZG A;  2IFN A;  2IYO A;  2K0D X;  1RO2 A;  5APT A;  2Y9Z A;  1N7L A;  1ZV8 A;  1BSH A;  2PEQ A;  1NHL A;  1USD A;  3O6Q A;  1CI6 A;  2FYU G;  5CBO A;  3CCQ P;  1M7L A;  1M6N A;  1OWA A;  1X9V A;  3BCC J;  3GF7 A;  1KYO D;  3H1J G;  1M57 D;  2XXM A;  2YXR B;  2BCC D;  3TK1 A;  5HVC A;  1EDJ A;  1SQP E;  2VLP A;  2XV5 A;  3A2A A;  1KFM A;  2JR8 A;  2DW3 A;  1ZRT D;  4WY4 D;  2LML A;  1PP9 J;  3JSV C;  3L74 J;  2QE7 H;  1S5L X;  3P8C E;  2BQ1 E;  3IN6 A;  3JCU E;  1G1I A;  3EFF K;  3CXH E;  1HY8 A;  2IZ1 A;  5TIS E;  3JCU H;  1VF5 B;  4D6T E;  3H1H D;  3TDK A;  2JYL A;  3LID A;  1HWT C;  2ZFC A;  1QLE D;  3VP8 A;  2YKO A;  3RGU A;  1JY2 P;  3GKL C;  4IOI H;  4WWI A;  2XZ1 C;  1T8K A;  3CMA P;  3L4F A;  2C0X A;  1L0I A;  1Q2N A;  2O1J A;  3E7K A;  3CLQ A;  5KAI E;  3W67 A;  1ZOY C;  2O01 N;  4HH2 A;  4OGQ B;  4W7Y A;  1JM0 A;  4A7P A;  1ZLL A;  3E1I A;  5KP7 B;  1JTH B;  2NZ2 A;  3CCR P;  5APQ A;  1L2P A;  3CWB G;  3PJS K;  1L0N D;  2YMY A;  4U7J A;  2QG4 A;  1L0L G;  1LWU C;  4BPH A;  2E5T A;  2FQ1 A;  1GL2 C;  2E76 B;  1QX8 A;  1NO4 A;  4AUW A;  1JTH A;  1SQB G;  3RK2 B;  1BGY E;  2QM8 A;  3GMA A;  2EIA A;  3G0V A;  2VLO A;  1VL2 A;  1GW3 A;  5KLV E;  2AXC A;  3L71 G;  4YXD C;  3N4X A;  3PLN A;  2KK7 A;  5APV A;  3S4R A;  4IFF A;  1HJ0 A;  3BRV B;  2M5A B;  2N1T B;  3AEG C;  2M8R A;  3CX5 E;  4WYM A;  5CCH C;  1DV5 A;  1SQV J;  2KUB A;  1ZXG A;  3WUT A;  5AVX B;  3HD7 C;  1AUM A;  4I7Z C;  2GZF A;  2VSQ A;  1K30 A;  3OA7 A;  4K3A A;  2M5A A;  4HKZ H;  2IBZ D;  1EC5 A;  1L0L K;  1JJ2 O;  3AED C;  4PD4 H;  2GM4 A;  1S9K D;  1SQB K;  4BXL A;  1JUN A;  1PEM A;  1BSN A;  4OH8 B;  5F2N A;  2P9X A;  1FZA A;  3L73 E;  2M0B A;  2WZ7 A;  1DD3 A;  1VF5 D;  5CMZ A;  1L4A B;  2QJY C;  1SQP J;  4DT0 A;  3GW6 A;  4PV1 B;  2WPR A;  2QM7 A;  1FJP A;  1FZF A;  3SFE C;  1KIL C;  1AVO A;  2E75 B;  3AEB C;  3EFG A;  3KZI H;  3KQG A;  4GIF A;  1LTA C;  3GZL A;  4D6T J;  2XDJ A;  2KI7 B;  3SWY A;  2FVA A;  2GDW A;  4DJG A;  1VHN A;  1JY2 N;  1SVF A;  1M90 Q;  2KOQ A;  3VMX A;  1LP1 B;  5KKZ C;  2GZI A;  2R5D A;  5KTB A;  2L9F A;  1SQB D;  1N2D C;  1VKU A;  3BRT B;  1RF1 A;  2M8L A;  5AW4 B;  4U0E A;  2BCC E;  3M06 A;  1HQB A;  3HTK B;  2AXT E;  1LP1 A;  2E76 D;  1QEX A;  2IX7 C;  3RK2 D;  2AXT H;  3L35 A;  4L76 A;  3G9R A;  1RY3 A;  1SQQ E;  1JY3 P;  2O01 J;  3P05 A;  1NWQ A;  1U57 A;  1Y8A A;  3HTK A;  1IO4 A;  1NJI Q;  1MV8 A;  4W80 A;  1J1D C;  1EOQ A;  4XFY A;  3I56 P;  2FFD B;  1BGY J;  1LTJ C;  3HZQ A;  1RNI A;  3ABV C;  3RK3 C;  5CBN A;  3CCJ P;  5H2F E;  1JCC A;  3VYI A;  5KLV J;  1OVR A;  3CC2 P;  3S1K A;  2JDI H;  1RHZ B;  1RE3 A;  1OXZ A;  1AQT A;  1ZMB A;  2PGD A;  2FFD A;  1RE4 C;  3AEA C;  2LL8 A;  2QRX A;  1ACP A;  1JMB A;  3GG2 A;  4I6M C;  5F2K A;  1MUU A;  1SQV D;  1GK4 A;  1FZC A;  4QNB A;  3H1I G;  1M1K Q;  1YHQ P;  1SLQ A;  1SQX D;  2Z44 A;  3LW5 J;  1FOS F;  4U0B A;  3H25 A;  3L75 G;  2Z4E A;  1JO5 A;  3NY7 B;  1KQL A;  2ZXE B;  2XT1 A;  2E75 D;  5GTI H;  4YTP C;  3I55 P;  2I8D A;  5APX A;  1GXG A;  1L0H A;  3AE9 C;  2AFE A;  2KOS A;  3L73 J;  4LGD E;  2HR3 A;  1GXH A;  1SQP D;  3LRY A;  2YKP A;  1Q90 D;  1KB9 I;  3Q3D A;  2KOO A;  1AFO A;  2BEQ D;  3GHG C;  3H1J E;  3P8C D;  1OVU A;  1Q7Y Q;  2R44 A;  1ZR4 A;  1A02 F;  3CXH D;  4EOT A;  5DJU B;  1U7J A;  1SFC A;  1HBW A;  4C46 A;  2JB0 A;  1LT9 C;  4JBZ A;  4HYT B;  2GUV A;  1NTM G;  4WY4 C;  5HGO A;  2Q7C A;  1JB0 J;  5AW1 B;  1LNQ A;  2CNR A;  1R5L A;  2HOD B;  4PD4 I;  2L0Q A;  5HGN A;  3G28 A;  5DJT B;  2PEK A;  4O9B A;  3HE4 B;  2BCC J;  5L8R J;  2HPC B;  3CCS P;  1PGJ A;  1JY3 N;  5KLI C;  2OYI A;  1NOH A;  3FXD A;  1RQU A;  2D2C B;  2ITA A;  2PEN A;  4UB8 E;  1SQQ J;  3HE4 A;  3TSI A;  3WU2 E;  5AW7 B;  1FU1 A;  4UB8 H;  4BWN A;  3U1C A;  4H0L D;  1OZH A;  2AEJ A;  2YIU C;  3NTN A;  3DPH A;  5HGL A;  3F89 A;  3G26 A;  1OW8 A;  1BGY D;  3KYQ A;  2JQ4 A;  3H4E A;  2QJK C;  2L5G B;  4IFD K;  5KJ7 A;  1L0L E;  3H1K D;  2YNY A;  2OYH B;  2JAZ A;  2OTK E;  2RKL A;  2ZYD A;  1ZW0 A;  1SQB E;  1BE3 D;  1T8Z A;  2Y0C A;  2ZXX A;  1VQ4 P;  3MUD C;  2ZT9 B;  2L4B A;  1J1E B;  1M1J B;  1OMI A;  1DEE G;  1ZR2 A;  2OYH A;  3L71 E;  1H0T B;  1IFP A;  2I1J A;  1YJW P;  4R0M A;  3CX5 D;  1NKZ B;  2MY5 A;  4GKG A;  3G1G A;  3FX0 A;  2CGQ A;  4IL6 X;  1KQG B;  3Q5S A;  2IDB A;  4GR2 A;  1H0T A;  2KZI A;  5AVZ B;  1PEQ A;  3B8E B;  3HUS C;  3V2R A;  3GLM A;  2JU2 A;  2MD9 A;  4L75 A;  2BAS A;  3HYB A;  1SFC D;  4NPE A;  3TNU A;  3LMO A;  4TT3 H;  5M1B A;  2L22 A;  1USE A;  1IFD A;  3L73 D;  1LT1 A;  4F37 A;  2QVA A;  1MFZ A;  1EZV G;  5BS1 A;  2W6B A;  2M3E A;  4JYC A;  1NU1 G;  3B5N C;  4PWV B;  1KMI Z;  4H13 B;  2N5I A;  3H1J J;  3L72 D;  4DZO A;  2N9B A;  4JPZ B;  1KZU B;  3CD6 P;  3SWK A;  1EIA A;  3FXE A;  3CE7 A;  1YYC A;  2KB7 P;  2UWJ E;  2N9Y B;  3H47 A;  1ZME C;  1NTK D;  1EZV I;  2QJP B;  2Y0E A;  2LTE A;  2WPQ A;  4I2L C;  2FXM A;  1HVV A;  2D2C D;  5B5E E;  5CCG A;  3MHV A;  1FZB A;  2K37 A;  2WSS H;  4DOJ A;  5B5E H;  1H8A A;  1LJ2 A;  2MR8 A;  4C7R A;  1AJY A;  2WSF J;  1NAF A;  1OR5 A;  3D6Y A;  2RMZ A;  3W68 A;  1LTG C;  2CQ8 A;  2J58 A;  4ZMD A;  1URQ B;  3CI9 A;  3C8V A;  2YKQ A;  1PPJ D;  1SQQ D;  2WPT A;  1NU1 K;  1PGP A;  1PGO A;  3B5I A;  4GDO A;  3WUV A;  3HE5 B;  5B66 E;  1LTB C;  2E76 C;  3CCV P;  2ZT9 D;  1KFN A;  1URQ A;  2V7Q H;  3G29 A;  1YI2 P;  3RK2 C;  5B66 H;  3OAK A;  1OIP A;  1BDD A;  3QH9 A;  2MJZ A;  2M3B A;  2K93 A;  1NYH A;  4QMA A;  3AE6 C;  3RL0 D;  1AF8 A;  1QVF O;  1L0L J;  2A45 H;  1IJD B;  1PL5 A;  3HE5 A;  3Q5P A;  1SQB J;  4GOE A;  2FYU K;  1K04 A;  1RF0 A;  1FDI A;  5AW2 B;  3Q20 A;  2WSE H;  3BCC G;  2Y0D A;  3U43 A;  1OW6 A;  2W90 A;  2HYN A;  2FVE A;  3G3Z A;  1BCC G;  2WWW A;  1OX3 A;  1PP9 G;  1NVO A;  3PP5 A;  2QIW A;  1AQ5 A;  2M5R A;  3B71 A;  3WUU A;  2FYN C;  3H1L G;  3H1K E;  3C9I A;  3L75 E;  3DTJ A;  1S1C X;  3S9O A;  4U0D A;  2FY8 A;  4H13 D;  2KSJ A;  1KB9 E;  1BE3 E;  4WVZ A;  1KB9 H;  2G3A A;  1NAY A;  4U0C A;  2C9L Y;  4AQR D;  2FYU D;  4U0F A;  1NTZ G;  2K92 A;  1AYI A;  1KN7 A;  3BAT A;  1AA0 A;  3H1J D;  1FZG A;  3CCM P;  2LXB A;  2E75 C;  3VMY A;  2K0X A;  1MFT A;  1SQX J;  2OGU A;  1Q86 Q;  1HTL C;  3M9H A;  4GOF A;  3RL0 g;  2N1T A;  3C1L A;  4PD4 E;  1RF1 C;  2R3S A;  3P8M C;  4YXW H;  2N98 A;  2KZJ A;  1CSB A;  1NKN A;  1YIT P;  2V4H A;  2KLU A;  3IF4 A;  2GYK A;  2FAE A;  2K88 A;  2KGD A;  3L36 A;  1FZE A;  1LWU B;  1S3J A;  1NGM B;  5AW6 B;  2PRR A;  2KGC A;  1GL2 B;  2H88 C;  1BDC A;  2JYG A;  2EHT A;  3M0D C;  1IMP A;  1IK7 A;  1WMK A;  3NFQ A;  2WTY A;  2PAJ A;  2CPS A;  4GT1 A;  1F80 D;  2R3C A;  1MZ8 A;  5CJ0 A;  1LWU A;  3KZI E;  1NTZ K;  3KHU A;  3L72 E;  3OW2 O;  4HB1 A;  1EDI A;  3KXD A;  5GTH H;  1L4A A;  5AW8 B;  5TJH A;  1YTZ T;  4LLH A;  1NTK E;  5AW3 B;  4MRT C;  3B4Q A;  4Z1M H;  2VLQ A;  3CWB D;  2JBG A;  4OGQ D;  1GPJ A;  2KIK A;  1E79 H;  1L0L D;  2JGP A;  4PXH B;  3HD7 B;  4I7Z B;  5CJ4 A;  3MIW A;  4H0L C;  4LC1 A;  3JC2 2;  1FZC C;  2R5B A;  4XFJ A;  2XZR A;  2GA1 A;  3HD7 A;  3L71 D;  2OQQ A;  3V2Q A;  4OWF A;  3U1A A;  4KHX A;  2E74 B;  4R4M A;  3VTP C;  5HGM A;  4U3F G;  1GZL A;  4K35 A;  2FBW C;  1E6J P;  1PPJ E;  2A06 G;  2PY8 A;  2DNW A;  5F2O A;  2WSC H;  1D1D A;  2A45 G;  1KYO H;  2P1J A;  2QJY B;  3EQ2 A;  5AVT B;  2JJL A;  3GZM A;  1FOS E;  1DD4 A;  4D6T G;  1KIL B;  1Q82 Q;  2N1T D;  1BXI A;  3CCU P;  3H1K J;  1QVG O;  2PEO A;  1CW5 A;  4YPC A;  5BVZ A;  1EXI A;  1BE3 J;  2YXQ B;  1S2E A;  2A45 I;  4NEO A;  2E43 A;  2E5Y A;  5AW9 B;  2H43 A;  2H89 C;  3AE1 C;  5KKZ B;  1E5W A;  1SFC C;  1NH4 A;  4HKG A;  2K2Q A;  1U7M A;  1EZV E;  2OYO A;  1RH5 B;  3GF3 A;  1NU1 E;  5APY A;  2CPB A;  5APS A;  5K5G B;  2W6J H;  2LIU A;  1S5L H;  1LTS C;  1L4A D;  1ZN5 A;  1VQ8 P;  3P7K A;  1HGZ A;  4PV1 D;  2WPV B;  1IZN B;  3G6E P;  1SS1 A;  5GTI E;  2VLN A;  1LTI C;  2OYI C;  1DIP A;  1A43 A;  2KG8 A;  3RG6 C;  2P2U A;  1XTC C;  5EFW B;  4RJT A;  5KLV G;  1OVV A;  4N78 E;  2FQ0 A;  2EG5 A;  1J1D B;  4H44 B;  1N8R Q;  4EI2 A;  1LTJ B;  2FYU E;  3L70 G;  3ITK A;  5DCK A;  4KJM A;  2D2C C;  3TGU G;  3ZDM A;  3CC4 P;  3HD7 D;  3L72 J;  1QL1 A;  2K9Y A;  3D71 A;  2ZJS E;  2LR2 A;  2PEI A;  2B87 B;  5BU8 B;  1NTK J;  3M9B A;  1YQ4 C;  2POH A;  2G8Y A;  1H89 A;  4NPF X;  2FKW B;  2XU6 A;  4R4L A;  1X22 A;  2LIW A;  2E74 D;  3VMZ A;  2PNG A;  2LKM A;  5KAF E;  2B87 A;  2WPS A;  2YO3 A;  5KAF H;  3A7O A;  5KLV K;  2FVF A;  2LF4 A;  1VQN P;  2HOD A;  3RL0 C;  2GUS A;  1YQ3 C;  2KLV A;  1N86 A;  5EJD A;  3BCC E;  2RN0 A;  2HPC A;  4CPG A;  1BCC E;  1IFI A;  1K9M Q;  1IUQ A;  2XZ0 D;  3H1I D;  1YIJ P;  1PP9 E;  4RO0 A;  1K73 Q;  3GHG B;  1N73 C;  3CWB E;  1YTZ I;  2O1K A;  2N50 A;  2B89 A;  3L75 D;  1PEU A;  1NTM K;  2KW2 A;  1JMM A;  2Q3E A;  3DS3 A;  2P10 A;  2K9J B;  1KB9 D;  3G21 A;  4NPD A;  1FDO A;  2HG5 D;  4XRQ A;  3H1L E;  1AVY A;  3GHG A;  1P84 H;  1PEO A;  1LT9 B;  1VQO P;  2IPP A;  3L37 A;  4CA3 A;  4WY4 B;  2Q5U A;  1IFM A;  4UHP B;  4XFX A;  3CPW O;  2K9J A;  3R4Y A;  3RBX A;  4H13 C;  1T2K D;  1QGK B;  2J59 M;  1IMQ A;  4IFM A;  3PHL A;  2MVU A;  1M1J A;  1LT9 A;  4PH0 A;  4WY4 A;  2JP3 A;  1NTZ E;  3AE4 C;  3H0D A;  4H44 D;  1NU1 J;  4PD4 D;  2HFE D;  5KLI B;  1A02 J;  3WMM 0;  2EHS A;  1UNK A;  3H1H G;  3F5H A;  1KYO I;  3EJD A;  2YIU B;  1UIX A;  2L6E A;  1KTM A;  3BVH A;  1TU3 F;  1NTM D;  2O3J A;  3PTZ A;  2MVV A;  2FXP A;  5EW5 E;  4EYY Q;  2QJK B;  1WRG A;  2E1M A;  1K8A Q;  1GD2 E;  2BEZ F;  2FYU J;  1GMJ A;  4M0I A;  1W2B O;  3DS5 A;  1UJZ A;  2QSI A;  2CG5 B;  2MKV A;  2ROQ A;  4PJ0 H;  2WVR A;  1T3J A;  1VF5 C;  4Y99 B;  5BU5 A;  1DX7 A;  1L0N G;  1N7S B;  1RF0 C;  3A0B E;  1UII A;  4UB6 H;  2JWA A;  3DS4 A;  2Z5H A;  3FGA D;  5E79 H;  3A0B H;  2KG6 A;  2KS1 B;  4PH1 A;  5BS2 A;  1YJ9 P;  5AVU B;  3A0H E;  5KJ7 D;  3CC7 P;  1VPC A;  1N7S A;  1FBM A;  1HGV A;  3A0H H;  3HUS B;  2KOR A;  3AE5 C;  2W83 C;  4OGQ C;  2KS1 A;  1DH3 A;  1PIX A;  2M8N A;  3HUS A;  1S4X A;  3E2D A;  4JYB A;  2PEM A;  3MGE A;  2NRG A;  2H7H A;  2KWL A;  1VQL P;  1VQ5 P;  4U3F E;  1BCC J;  2YO2 A;  2A06 E;  3HRN A;  3IFM A;  2GZJ A;  2PP6 A;  3B5N B;  3FWL A;  2GDY A;  3PRJ A;  2IBZ G;  1L0N K;  3CWB J;  2ZYG A;  2WT7 B;  3H6P A;  5I4T G;  2NO8 A;  4ASV A;  1EDK A;  2NPS B;  3A5T A;  3CXH H;  5TIS H;  2KNC B;  2ZYA A;  3T97 B;  1HH0 A;  2N6Y A;  2JKV A;  2KSE A;  3B5N A;  4KT0 J;  3H1L J;  1GTW A;  2I1K A;  1ZNV A;  1W5C E;  2WT7 A;  4N3Y B;  3UIA A;  1IFJ A;  2W27 A;  4AYC A;  2N1T C;  1YJN P;  3L71 J;  4XRO A;  1IC2 A;  3RG2 A;  1KIL E;  1M56 D;  2NPS A;  2IBZ I;  2KNC A;  1EZV D;  4GR6 A;  3T97 A;  1CZQ A;  3L74 G;  5HV8 A;  2FAC A;  3KDP B;  1NU1 D;  1NTZ J;  5AVR B;  1OFC X;  3Q1M A;  5KAI H;  1KQS O;  2LXC B;  3H1I E;  2O01 H;  3MTU E;  4XA4 A;  3DS0 A;  2Z45 A;  5AVQ B;  1JNM A;  4N78 D;  1T3U A;  2AEF A;  5CCG D;  1PFI A;  2K5X A;  1FR2 A;  3M0A A;  5AVV B;  1L4A C;  3N7N A;  4DCK A;  1Z56 A;  2RH0 A;  4XE5 B;  2AFD A;  3V4W A;  4PV1 C;  1N7S D;  1A8O A;  2MF4 A;  1R5S A;  1P84 I;  4ZKU A;  2QNW A;  2ERH A;  2AF8 A;  2K1A A;  3SFD C;  3L70 E;  4EDF A;  4RES B;  2KYV A;  2B9B A;  1GW4 A;  3TGU E;  2K94 A;  1Q81 Q;  2FAD A;  1M74 A;  4W7Z A;  3RK3 E;  4ZKP A;  2P7J A;  3CX5 H;  2N5H A;  1URQ D;  2L91 A;  3V4Q A;  1JOC A;  1T6A A;  3MD0 A;  3LW5 H;  1OW7 A;  3Q5R A;  1Y47 A;  1NTM E;  3EJE A;  2FYN B;  3E1R A;  3VOP A;  2W8Z A;  2Y9Y A;  2FQ2 A;  2LPK A;  2E42 A;  4BRY B;  4BPF A;  2E74 C;  3B5N D;  2PEJ A;  2K0Y A;  1JCD A;  1GU5 A;  1Z6M A;  5GTH E;  1GL2 A;  1FDM A;  3BCC D;  2R32 A;  1KD1 Q;  1VQ7 P;  1SQV G;  2C9N Y;  3M1M A;  2LOL A;  2NPS D;  2W6A A;  1BCC D;  2XNX A;  4BRY A;  2V7Q J;  2P67 A;  4U3F J;  1SQX G;  1RE3 C;  4COC A;  2IFM A;  4IL6 E;  1DEB A;  1PP9 D;  2FFD C;  3L74 D;  3R2P A;  2K3R A;  3AEF C;  4IL6 H;  3CXC O;  2KXP B;  3DS1 A;  2DGY A;  2Q1K A;  4ZNC A;  2Q6Q A;  1RO0 A;  1XTG B;  1P84 D;  2FYZ A;  4RKU J;  1X8Y A;  3K5B A;  1KC8 Q;  1RF1 B;  3H1L D;  4EIJ A;  4QKO A;  2GZE A;  5CCH A;  2WSE J;  2H8P D;  3U59 A;  2ZVN B;  3AE7 C;  1J2J B;  2KOG A;  2AEM A;  1G1J A;  2KP8 A;  3M91 A;  1X79 B;  1SQP G;  1EQ7 A;  1S72 P;  1FS0 E;  1FC2 C;  3OJA B;  1KYO E;  1WT6 A;  2IYP A;  2JWD A;  1NTZ D;  4L73 A;  1SQV K;  3V6I A;  1X3O A;  2ZVO B;  1PV3 A;  1ZRT E;  1SQX K;  3H1I J;  3NTE A;  3D70 A;  3PH0 A;  5APU A;  1T2K C;  2Z5I A;  2JO0 A;  3L75 J;  2VRS A;  3M0D A;  3AE8 C;  1VQ6 P;  3VN0 A;  3H1H E;  4H44 C;  2BHV A;  2WMM A;  4JF7 A;  1KIL A;  2PFX A;  4DG9 A;  2LKI A;  1K05 A;  3CXH I;  1VQ9 P;  3DS2 A;  3VRL C;  3USS A;  3MGN A;  5KP8 B;  4H0L B;  1EXJ A;  5H2F H;  1SQP K;  1FZC B;  3IAO A;  3L70 J;  3BAS A;  2FHS C;  2SPZ A;  3TGU J;  1S5L E;  3CCE P;  1GL2 D;  4H2X C;  1W2E A;  1M8O B;  1CEI A;  1AV1 A;  3CCL P;  2Q9I A;  1BGY G;  2MR7 A;  4XFZ A;  4H2W C;  1KOR A;  1L0N E;  3M9Q A;  2ONT A;  3H1K G;  1YBK A;  3AE3 C;  2GDX A;  1NTM J;  3RBZ A;  3B4S A;  4GOD A;  1BE3 G;  3GJN A;  1JY2 O;  3RK3 B;  3V5B A;  2P58 A;  5CCH D;  4H2Y C;  3AEE C;  2B88 A;  5KJ7 C;  5CHX A;  2OAR A;  1E0H A;  1HUC A;  1LTJ A;  2EFJ A;  3G1I A;  3TYY A;  4U3F D;  2XKM A;  4HJG H;  2A06 D;  3SSU A;  1SP4 A;  4C7N B;  5CZD B;  1MKM A;  1KQF B;  1SFC B;  5AVY B;  5AW5 B;  2KR5 A;  1KLP A;  2OYH C;  1RE4 A;  3MZW B;  1QL2 A;  3KPE A;  2WQY C;  1KV4 A;  1IFN A;  1H88 A;  1HJB A;  3FWN A;  1GDT A;  2FXO A;  4C7N A;  4D6T D;  2IBZ E;  3CX5 I;  3G4S P;  3IR9 A;  2KGE A;  2N6Z A;  2ZT9 C;  3TF5 A;  3P32 A;  1J1E C;  1M1J C;  4Y28 J;  1S9K E;  3L73 G;  1PGQ A;  7CEI A;  3CME P;  1QRJ A;  2CK3 H;  1X0T A;  5AVS B; 
#chains in the Genus database with same CATH homology
 2Z46 A;  1PEU A;  1A43 A;  3DS4 A;  3RG6 C;  5JPA A;  3G71 P;  1Q7Y Q;  1KQS O;  1JJ2 O;  1NJI Q;  3DS3 A;  2QEX P;  3G1G A;  2EG5 A;  4COC A;  1EOQ A;  3G21 A;  1N8R Q;  4U0F A;  4XFY A;  3I56 P;  4PH1 A;  5BS2 A;  1YJ9 P;  3CCE P;  4XRQ A;  3CCM P;  1PEM A;  3HZQ A;  1RNI A;  4GR2 A;  5HGM A;  3DS0 A;  2Z45 A;  3B5I A;  3CC7 P;  1PEO A;  5F2N A;  3CXC O;  3DS1 A;  1E6J P;  2P9X A;  2KOD A;  3CCJ P;  2QA4 P;  2DGY A;  5DCK A;  3CMA P;  1VQK P;  1PEQ A;  5HGO A;  3CCL P;  2PY8 A;  4COP A;  3CCV P;  3CC2 P;  1RO0 A;  1Q86 Q;  4XFX A;  3CC4 P;  3G29 A;  3CPW O;  1YI2 P;  4XFZ A;  5F2O A;  1ZMB A;  3HYB A;  5HGN A;  1KC8 Q;  4U0A A;  1D1D A;  3G28 A;  2ONT A;  2PEK A;  1QVF O;  2M8N A;  1A8O A;  2M8P A;  4PH0 A;  1VQP P;  4IPY A;  3CCR P;  2PEI A;  1YIT P;  3E2D A;  3H0D A;  2PEM A;  3MGE A;  1Q82 Q;  3CCS P;  5F2K A;  1VQL P;  1RO2 A;  1VQ5 P;  1S72 P;  3CCU P;  1BAJ A;  5BS1 A;  1QVG O;  4QNB A;  2PEO A;  2PEQ A;  1M1K Q;  3Q20 A;  1YHQ P;  2PEN A;  2Z44 A;  2EIA A;  2JYG A;  1M6E X;  1Q81 Q;  4U0B A;  2OAR A;  3G0V A;  1M74 A;  2EFJ A;  5I4T G;  3CCQ P;  3DPH A;  3G1I A;  3CD6 P;  1EIA A;  1M6N A;  2L6E A;  5HGL A;  1M90 Q;  3NTE A;  2LF4 A;  3G26 A;  1VQN P;  2BUO A;  2CWO A;  3WBH A;  3H47 A;  2XXM A;  3OW2 O;  3H4E A;  1VQO P;  2JO0 A;  2OTL P;  2E1M A;  1K8A Q;  2XT1 A;  2XV6 A;  4M0I A;  2OTJ P;  1VQ6 P;  2M8L A;  1W2B O;  3I55 P;  4U0E A;  2BHV A;  1YJN P;  3DS5 A;  4XRO A;  1VQM P;  3G4S P;  3DTJ A;  4WYM A;  2BQ1 E;  4U0D A;  1VQ4 P;  3LRY A;  1K9M Q;  4GR6 A;  2PEJ A;  1VQ9 P;  3DS2 A;  1AUM A;  1IUQ A;  3VRL C;  1VQ8 P;  3P05 A;  1YIJ P;  3CME P;  1QRJ A;  3G6E P;  1K73 Q;  1KD1 Q;  1K30 A;  2JYL A;  1VQ7 P;  4U0C A;  3M1M A;  1YJW P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...