1QVGO

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1qvgO03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1qvgO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1qvgO02
1YJWP 1M1KQ 1K73Q 3CC7P 3G71P 2QEXP 3CXCO 1QVGO 1YIJP 1M90Q 3OW2O 1VQOP 1VQPP 1Q7YQ 1VQ6P 3CCUP 3CCJP 1NJIQ 3CPWO 1VQ7P 3G6EP 1VQMP 3G4SP 3CD6P 1QVFO 1Q86Q 3CC2P 3CMAP 3CC4P 1K9MQ 2QA4P 1S72P 1VQ4P 1K8AQ 1Q82Q 1YJ9P 1YITP 1KD1Q 3CCRP 1N8RQ 1VQLP 1W2BO 1VQKP 1VQ9P 1YJNP 1YI2P 1KQSO 1VQ8P 1VQ5P 1JJ2O 1VQNP 2OTLP 3CCQP 3I56P 3CCSP 3CCMP 3I55P 1Q81Q 1KC8Q 3CCLP 2OTJP 3CCVP 3CMEP 3CCEP 1YHQP
chains in the Genus database with same CATH superfamily
2EFJA 5APSA 2AXCA 1OW8A 2FYUG 5AVYB 1SFCD 2KGAA 1GW4A 4PD4E 4ZKUA 2IX7C 2OTKE 2PFXA 5AVTB 3B5IA 1NTZD 1P84H 3CLQA 4WB4A 4AYCA 2GUVA 2GUSA 3OJAB 2JYLA 1AA0A 3GF3A 1JCCA 1SFCB 5H2FH 4W7YA 3HE4B 3FXDA 3JC22 2LPKA 2CGQA 1P84E 1HJBA 2JAZA 2VLOA 2Z44A 2XV6A 2WPRA 5AW7B 1M8OB 2PEKA 2NPSD 3CL3D 2ITAA 3GW6A 2WSEH 3M91A 4U0FA 5AVWB 1BGYD 2VLPA 1FZAA 3H1JJ 2N50A 1AVOA 1DEBA 2MR7A 1PV3A 1KZUB 4QMAA 2XT1A 1SFCA 1NGMB 4K3AA 1M57D 2HFED 4PV1B 4HKZH 5KJ7C 1M56D 2ZXXA 1T3UA 1NTZE 2M5AB 4H2WC 1VQPP 1FJKA 1NTKJ 1NH4A 2K88A 3CX5E 1BCCG 2Z5HA 2QJPC 3PTZA 3H32B 2WSFH 2QJKB 1WT6A 4DZOA 3HYBA 3H1IG 4IFFA 1YHQP 4IPYA 2YO2A 2W6BA 3MZWB 1VQOP 1LJ2A 5M1BA 4ASVA 1L0LG 1LTBC 1VPCA 2DW3A 1R8EA 1H88A 3ABVC 1K8AQ 3G3ZA 3O6QA 2E76C 3AEAC 1HH0A 2D2CB 3CX5D 1AYIA 2WQYC 3DS5A 1SVFA 3CCVP 4WY4C 3PH0A 5KAFH 1FZCB 2CG5B 5AVRB 1PIXA 1ZMEC 1N8RQ 1IFJA 1VQ5P 5KAIH 2WSSH 1RE3A 1ACPA 3L72D 1CZQA 2G3AA 1S4XA 2OYOA 5I4TG 4JBZA 1L0NJ 1RF0C 1X8YA 2HG5D 2P58A 3CXHE 2K94A 1PPJE 1ZN5A 1KILD 1SP4A 3CCRP 3A0HE 2LTEA 2O1JA 3KXDA 1SQVG 1QRJA 2LXCB 3I56P 2A06E 2OYHC 2Q6QA 4L76A 1S2EA 1JY2O 4W7ZA 4PV1C 4PD4I 3M06A 3RL0D 2PGDA 2WVRA 2RMZA 1VHNA 3FXEA 2QA4P 3L71E 3D71A 4XRQA 1PPJG 2OARA 4OH8B 2RKLA 2FVAA 5CBOA 2IYOA 1MV8A 4NPEA 2FVFA 1VF5D 3TGUJ 2JYGA 4COCA 2V4HA 2KODA 4HKGA 2KG6A 3PJSK 3G1IA 1OVUA 1RHZB 3PHLA 2M0BA 2PAJA 2WSCH 1PL5A 5CCHC 4ZNCA 1MFZA 3W68A 2E76B 1PP9G 2D2CC 4WBAA 1XTGB 2K37A 3VOPA 2HPCB 1SLQA 1OVRA 1S72P 3AE5C 1FZCC 1P84I 1NOHA 2QJYC 5HGOA 3GMAA 4IFMA 2FFDB 5E79E 1AUMA 3HD7A 5F2OA 2XXMA 1LTAC 5DJUB 2Z46A 2IBZE 1BGYG 1NTMG 1HVVA 3T97B 5L8RJ 3L75E 2M3BA 5CCGA 1NTMJ 1RE3C 5TISE 3RK2D 3DPHA 3H1KG 2AEMA 3BCCG 3JCUE 2GDXA 3C9IA 3RG2A 1L4AB 3B4SA 2WSEJ 1J1EB 2O1KA 2KSEA 4N78D 4H0LD 4H13D 2Q9IA 1KYOH 2OYHB 1MZ8A 1HJ0A 3L35A 1IO4A 3AEBC 3TNUA 2BASA 2JJLA 1GU5A 2E74C 1BDDA 5GTHH 2EHSA 1A02F 2IFMA 4HJGH 1NTKK 1NVOA 1PGPA 1SQPJ 4GODA 3DS0A 2LL8A 1VQ6P 5AW8B 3G4SP 2K1AA 2PY8A 4AUWA 4JYBA 4N78E 1SQBG 3BRVB 1LNQA 2Y0EA 3RG6C 4Y28J 2MJZA 3NTNA 3TDKA 3VN0A 2P67A 3FWNA 1NTMK 2IFNA 5KLVG 2ONTA 2GZIA 1ZRTD 3RK3B 1KFMA 3KPEA 1IFMA 1KB9H 5AVVB 1QL2A 1YI2P 3HTKA 5APVA 2Q1KA 3L73E 2I8DA 2V7QH 5BS1A 1S1CX 1NTMD 4YPCA 2M8LA 5GTIE 5KLVE 2JBGA 4U3FE 5KLVJ 1CSBA 3LW5J 1BE3D 2E5YA 2POHA 3L71D 1JCDA 5BVZA 2QM7A 3VYIA 1EDJA 2M5AA 2QG4A 3M1MA 2XV5A 2M3EA 1R5SA 1U7JA 3HE5B 3A2AA 1NTKD 1GL2D 4TLFA 2BCCE 1NJIQ 2P2UA 4U0AA 1S5LX 5KJ7A 2D2CD 3EFGA 1Q90D 3MD0A 3FX0A 1PPJD 4LC1A 1X79B 4YXWH 4C7RA 4EOTA 2E75D 3B71A 3II6A 2ROQA 3P7KA 2E74B 2Q3EA 1T2KD 2KWLA 3AE3C 4UB6H 1FDIA 2IDBA 3G26A 3JSVC 1QL1A 5GTIH 5HVCA 1RF1B 3CWBJ 3H1JG 2KNCB 4K35A 1GL2B 2CWOA 4QNBA 1EQ7A 1JTHB 1BE3J 1GXHA 2KGCA 2IBZI 1L0LE 2FYZA 2JQ4A 3RK3C 2A06D 3V4WA 5CCGC 4EYYQ 4JYCA 3Q20A 1RNIA 2N5IA 3SSUA 1IK9A 5HGLA 3P8CE 2QE7H 2KGDA 2JKVA 1AF8A 3B5ND 4U0EA 1GZLA 3CXHH 1JM0A 3K5BA 3MGEA 1DD3A 1MFTA 1YYCA 2BEZF 3R2PA 4NPFX 2NZ2A 1H0TB 2E75B 3OAKA 3G1GA 3RK3D 2LIUA 4WY4B 1L4AA 4KHXA 4IL6X 1JY3N 2E42A 1R5LA 2HLOA 5KAFE 4R0MA 3GZLA 1SQVJ 3T97A 1NKZB 2QM8A 3TSIA 3BASA 2KNCA 2LF4A 1MKMA 4IL6E 3OA7A 4C7NA 1AQTA 2QVAA 1VQ4P 5CJ0A 1SQPE 2YNYA 3EFFK 1VQLP 3E1IA 1LTSC 3V2QA 3VP9A 3I55P 3PP5A 2GA1A 2JB0A 2FQ0A 3EJDA 3E1RA 1N73B 3CWBD 2KS1A 4GDOA 5HV8A 1E79H 2VSQA 3N7NA 1Q86Q 1LWUA 4PD4D 1JY2N 1YJ9P 1T6AA 3AEFC 1QGKB 2FQ2A 5CZDB 1SQBJ 5F2KA 3M0DA 1KN7A 1CW5A 3IAOA 2WPSA 1OW7A 2KOGA 1LT9A 2KZJA 2FYNB 1L0NE 2N98A 1OFCX 2L91A 3TK1A 1EIAA 4RJTA 1M1JC 3I5CA 1QX8A 4IZ6A 3AE9C 2C9NY 4LLHA 5AW5B 5BU5A 2GDWA 1VQ8P 1K05A 1X3OA 3N4XA 2PEOA 3AECC 3C8VA 1LP1B 3HZQA 2CK3H 1N7SD 4O9BA 2VLNA 5GTHE 4EDFA 1KILA 5KLIC 2FADA 3H1HJ 2K9JB 2Y9ZA 2N9YB 1G1JA 1N7SB 2O3JA 2KLUA 2YIUC 2KUBA 2OTJP 1EZVD 1J1DC 2C0XA 3MIWA 1RH5B 1EMVA 5AW2B 1FOSE 2AXTE 3V2RA 3A3YB 1ZR4A 2O01N 1KQGB 5HGMA 2R3CA 1JOCA 3W67A 5CJ4A 1Q81Q 1L4AC 2X2BA 1IUQA 1EZVE 4N6JA 2OYIB 5EFWB 2XNDH 3MHVA 2OYHA 1N7SA 4H2YC 5JPAA 1N73C 1LP1A 5CCHD 1NTZJ 1W2BO 2PEQA 1BGYJ 3GLMA 3VTPC 3U59A 1T8KA 3V2NA 1KB9D 4BRYA 3D6ZA 1NU1K 2GDYA 4R4LA 1BAJA 3U1AA 4EIJA 1IC2A 3BCCJ 4W80A 2FYNC 3H32A 1OZHA 2ZXEB 2L0QA 3A0BH 2FVEA 1NTZK 2R5BA 2ZVOB 3WMM0 1VQNP 1LT9B 2ZVNB 5CBNA 1FDOA 1KQLA 1S9KD 1RE4A 2J58A 2YO3A 4XFJA 3RL0B 1YTZT 4U3FG 4BPFA 5B66H 3L70G 1SQPD 3L74J 1N7LA 3LRYA 1LT1A 3AE7C 2K5XA 1LTIC 1KORA 3SFDC 2JWDA 2OYIA 2JR8A 2FACA 2O01H 2FY8A 2EHTA 1FZBA 1E5WA 3B8EB 3F89A 4GT1A 1PGQA 3CCUP 3MGNA 3L73J 4ASWA 3AEGC 1J1DB 1A43A 2KP8A 3H1HE 2KOSA 4C7NB 4AQRD 5AW0B 1L0LJ 3ZDMA 1DNYA 3L70J 3L72E 3ITKA 1LTTC 5APUA 2SPZA 2I1KA 4UB8H 4MRTC 7CEIA 3Q1MA 4U0CA 3L75G 1FZGA 3IN6A 4WY4A 2OYIC 2DGYA 4PV1D 2N9BA 4JF7A 4BRYB 1EDIA 1JMBA 5APQA 2JEEA 1OVVA 4XFZA 2KORA 2Y0CA 1YJNP 2MR8A 2E43A 5H2FE 3S9OA 1M6EX 1KILC 1YQ4C 3CXCO 3VMXA 2PENA 3H1ID 3RK3E 1JMMA 1T2KC 3GHGC 4U3FJ 5AVQB 3VRLC 1VL2A 3VMZA 1SQQJ 3V4QA 1AQ5A 2E1MA 1L0LD 1BGYE 4GR2A 1USDA 1VF5C 1ZLLA 3AE2C 3H1LD 1J2JB 1RF1C 2KB7P 4DG9A 2WZ7A 5AVZB 2MF4A 1GL2C 2B89A 2HODA 2W8ZA 3G6EP 1ZP0C 1KILE 3RBXA 4RKUJ 2MKVA 1G2CB 1FZFA 2FXMA 1IJDB 2I1JA 2L5GB 4RESB 3RL0C 1EZVI 2K93A 3LMOA 3H1LE 2MVVA 1GL2A 2OTLP 1ZR2A 3CCEP 3L75J 1GW3A 1S5LH 1BE3G 1HWTC 1AJYA 1SQBK 1FC2C 3DS2A 2LMLA 1CEIA 2QSIA 3UIAA 3WUVA 1H8AA 1KQSO 1U57A 3B5NC 2FYUK 1IFDA 3AEEC 2M8PA 2E75C 3Q2YA 3EJBA 1YBKA 1ZOYC 2GZGA 1LTJA 4D6TD 4WYMA 3BRTB 4MN4C 4I7ZB 3P32A 5KJ7D 4M3LA 3JCUH 2HODB 4BWNA 1FS0E 2FXOA 4WWIA 3TGUE 1PEUA 2WWWA 2Z4EA 1EXIA 1S3JA 4PXHB 3AE4C 2L4BA 2A45H 2NPSA 2ZFCA 3GHGB 1GPJA 3H1KD 1KYOD 3BCCD 1M7LA 2WPQA 3SWFA 1D1DA 2B87B 3V6IA 3L70E 2NPSC 2IZ1A 1M1JA 3CCLP 4UB8E 2YMYA 5F2NA 1Y8AA 2XU6A 3L75D 1EDLA 3FWLA 1KFNA 2IBZG 2KOQA 3HTKB 3MTUE 5KAIE 1VQ7P 1QVFO 3VMYA 4CPGA 4BPGA 2WMMA 4XROA 4PH1A 3M0AA 1OR5A 3NY7B 1SQXK 4DT0A 3EJEA 3M9BA 1JEKA 4M0IA 1L4AD 2H89C 5AVXB 1PEQA 1X22A 3KYQA 1BCCE 2L9FA 1PZQA 2Z5IA 3L74E 2WT7B 3CPWO 2NO8A 3C1LA 2AVAA 1PEOA 2NRGA 3BVHA 1K9MQ 4DOJA 2FAEA 3L37A 1M1JB 2R44A 1T3JA 1SQQE 3G29A 3H4EA 2FQ1A 3G0VA 3GHGA 5EJDA 3GF7A 2FKWB 1PP9D 1SQXD 2KK7A 2H88C 1PEMA 2E74D 1CI6B 3KHUA 1RY3A 5KLVD 2FYUE 3BCCE 1DX7A 5KLIB 1XTCC 1NU1E 3MUDC 3A0HH 3H1JE 1N7SC 1HF9A 1U7MA 1ZV8A 2YIUB 1L0NK 1BXIA 3G21A 3H0DA 1USEA 3D6YA 2BEQD 3QH9A 2KZIA 3L4FA 3CE7A 3GZMA 1KB9I 2FBWC 3CXHI 1K30A 3G9RA 1ZW0A 2KGEA 2WPTA 2QEXP 2C0WA 1NU1J 2JO0A 1KYOE 2IBZD 1RQUA 1FDMA 2ZT9D 3EWKA 2Z45A 1SQQK 5B5EE 1KQFB 1HY8A 4IL6H 2AXTH 1H89A 3WUUA 3D70A 1EDKA 3IR9A 3AEDC 2UWJE 4KT0J 1T8ZA 2CNRA 2JU2A 2FYUD 4H0LC 4H13C 2FHSC 1Y9BA 3USSA 5KKZB 1SQXE 4H44B 1NTZG 5APYA 3HRNA 2BCCG 3SWYA 2L6EA 1LTGC 1E6JP 2K92A 1GMJA 2Q7CA 4BXLA 5KP6B 1OIPA 1VKUA 3CMEP 2JO1A 2EG5A 2JP3A 1QLED 2ZYAA 1LT9C 1IFNA 1OX3A 1GK6A 3L36A 2J5UA 2XKMA 2IYPA 4OGQB 1JO5A 4I2LC 2FXPA 2KXPB 3NXSA 3KQGA 1JY3P 4U0BA 4OWFA 1M74A 3L72G 1BCCJ 2C9LY 2HR3A 5CCHA 1ZXGA 5AVSB 2ZAEB 2JU1A 1WRGA 1HUCA 1W2EA 3V2PA 2BQ1E 2R32A 1SQVD 3CXHD 1FJPA 5BS2A 1NTKG 2J59M 5CCGD 3L71J 2R5DA 3P8CD 1NO4A 2ZYGA 3LIDA 1BDCA 2W6AA 3MP7B 1A8OA 3CMAP 3L74G 1YTZI 2H43A 4RO0A 4UB6E 3H1HD 3GJNA 1SQBE 3LW5H 2XDJA 4Y99B 1YQ3C 3IF4A 4H44D 2K9JA 3AE6C 1OWAA 2A06G 3CWBE 2LIWA 1KILB 2E76D 4F37A 3RBZA 2V7QJ 2P9XA 2GZEA 4PJ0H 2K0YA 1YITP 4H44C 3FGAD 3EQ2A 3L72J 2ZT9B 2WITA 2YMKA 3HUSB 1N73A 3H25A 1VF5B 2IPPA 1UIIA 5E79H 1GD2E 1SQPK 1HQBA 5APWA 3CWBG 3DS4A 1VQMP 3CC4P 1SQXJ 3WU2H 1M6NA 3GKLC 1SQVE 4DJGA 4JPZB 4C46A 4D6TJ 1VQKP 1LTJC 4OGQC 4HYTB 1URQC 2E5TA 1FU1A 2P10A 1FR2A 3TF5A 2FFDA 3NMDA 5B5EH 2QIWA 5APTA 2K0DX 2IZ0A 4WY4D 4PWVB 2PNGA 2OGUA 1CI6A 1AFOA 2N1TB 2KS1B 2GZFA 1W5CE 1VDFA 2CQ8A 4B86A 2YKOA 5AW1B 2K0XA 1NU1D 1IZNB 1L2PA 3A5TA 3B5NB 3F5HA 3SFEC 2O01J 3RGUA 2YKPA 3TGUG 1K04A 1KB9E 3H1IE 4HB1A 3E7KA 1NTME 2WT7A 2EIAA 1NAYA 3CI9A 5AW9B 3IFMA 3PRJA 1JTHA 4UHPB 3H1HG 1JJ2O 4I7ZC 1UNKA 2K3RA 1TU3F 3HE4A 1GDTA 1L0IA 2GYKA 5C39A 4Y99C 1JB0J 1EC5A 1HBWA 3DS3A 1JY3O 4KJMA 1DEEG 1SQVK 2BCCD 5DCKA 3CD6P 2FYUJ 4L75A 2Y9YA 3M0DC 2PEIA 1PP9J 1LWUC 2KR5A 2NPSB 1GTWA 1L0NG 2HYNA 1RF1A 1QVGO 1M90Q 3HUSC 3QWOC 2PEJA 1ZMBA 5CMZA 1IK7A 3S4RA 3U43A 3B5NA 2JDIH 4TT3H 2KYVA 3CCMP 5KTBA 2KI7B 2PEMA 3HE5A 1LTJB 1NQ4A 2KSJA 3WUTA 4A7PA 5KP7B 3CC2P 4GR6A 3RK2C 1Z56A 4IOIH 2RN0A 1Q2NA 1KTMA 2XZ0D 1HTLC 1NU1G 2W83C 1FBMA 3CX5I 1K73Q 1RF0A 2CPBA 4L74A 1DD4A 3L74D 3H47A 3CX5H 2XZ1C 2AEFA 4COPA 2PRRA 2L22A 5BU8B 3LIEA 1MUUA 2AF8A 1MZ9A 1L0HA 3VMAA 1SQQD 3L70D 1SQPG 2PP6A 4I6MC 2VLQA 5AW3B 2Q5UA 3O8ZA 1Y47A 1IFIA 3E2DA 1RO0A 3H1IJ 1Q7YQ 3L71G 2LOLA 2Y0DA 2N1TD 5AVUB 2N5HA 4GOFA 1URQA 1DIPA 3L73G 4XFYA 3TGUD 1G2CA 3NTEA 4U7JA 1BE3E 1Z6MA 3OW2O 1L0ND 2AFEA 2QJPB 3HD7C 1NYHA 2N6ZA 5TJHA 3TNUB 3PLNA 2LR2A 4ZKPA 1EXJA 2KG9A 3Q3DA 2BCCJ 5APXA 2WSCJ 5TISH 5KLVK 1AVYA 4D6TE 4H0LB 4H13B 3M9HA 2M8RA 2MVUA 4GIFA 3NFQA 5KKZC 3MUDA 4IFDK 1G1IA 2LKMA 3H1JD 1BSHA 2N1TA 2WSFJ 2AFDA 3RK2B 1URQD 4OGQD 1IFPA 4NEOA 2KOOA 1HGZA 3H1KE 4U3FD 3KDPB 4EI2A 1A02J 3TYYA 3KZIH 3AE8C 2HPCA 4PH0A 2B88A 1F80D 3CCSP 2ZJSE 2KW2A 1ZNVA 4BPHA 3M9QA 3G71P 3A7OA 3HUSA 4ZMDA 1YIJP 3DTJA 2A45I 3CCJP 1D7MA 2YXRB 1OXZA 3SWKA 1LGHB 2WTYA 1FAVA 2KLVA 1IMPA 2M5RA 1JY2P 1FZEA 2QRXA 4JQ0D 2ERHA 1N86A 2W90A 3HD7D 1E0HA 2B9BA 2KOPA 4H2XC 1GXGA 3AE1C 4NPDA 1DV5A 1SQQG 2JGPA 2RH0A 1WMKA 3H1LJ 1PGOA 2LXBA 2P1JA 3HD7B 2DNWA 2GM4A 5B66E 2H7HA 3WBHA 1UJZA 1KLPA 2LKIA 2H8PD 1YJWP 2BHVA 1SS1A 1P84D 2K2QA 2ZYDA 5KP8B 2MD9A 3L73D 4LGDE 2JWAA 3GG2A 5AW4B 2BUOA 1KD1Q 4QKOA 2M8NA 3Q5RA 2Q3IA 3H1LG 3P8MC 1NKNA 4L73A 1PFIA 2GZJA 3BATA 3KZIE 1SQBD 5HGNA 1X0TA 1RE4C 2ZT9C 1EOQA 4XE5B 2B87A 1H0TA 3B4QA 4HH2A 3Q5PA 5AW6B 4PD4H 3Q5SA 2W27A 2QJYB 1AV1A 2FFDC 1Q82Q 4I1LA 3WU2E 2QNWA 1URQB 2XZRA 1PP9E 3U1CA 4CA3A 2YXQB 4N3YB 1OW6A 3P05A 3O6QB 2YKQA 2N1TC 3S1KA 1L0LK 4PJ0E 1SFCC 2CPSA 5EW5E 1PGJA 1VQ9P 1RO2A 1RQVA 1J1EC 1GU4A 1FZCA 2K9YA 2R3SA 1N2DC 4XFXA 2XNXA 4WVZA 2KG8A 2MY5A 1SQXG 4D6TG 1FOSF 3H1KJ 3R4YA 1HGVA 1KMIZ 1BCCD 4Z1MH 1QEXA 1KC8Q 4YTPC 2G8YA 1M1KQ 1KYOI 3A0BE 1FE6A 1ZRTE 1NTKE 1BSNA 4U0DA 2P7JA 3V5BA 1UIXA 3G28A 1DH3A 2VRSA 1OMIA 4XA4A 1S5LE 1S9KE 1X9VA 2W6JH 4R4MA 3CCQP 5DJTB 4OVNF 3VP8A 1NAFA 2KIKA 1LWUB 3CC7P 1JNMA 2N6YA 2QJKC 3H6PA 1NHLA 1IMQA 4GOEA 2A45G 1KV4A 1JUNA 1NWQA 5K5GB 5CHXA 4GKGA 3DS1A 2WPVB 4YXDC 1EZVG 3RL0g 2OQQA 1GK4A 2AEJA 4DCKA
chains in the Genus database with same CATH topology
1PEQA 2EFJA 2LF4A 3E2DA 3G71P 1YIJP 1RO0A 1VQOP 3DTJA 3DS0A 3P05A 1Q7YQ 1VQ6P 3CCUP 3CCJP 3DS3A 3CPWO 3G4SP 2JYGA 5DCKA 3CD6P 1PEOA 4COCA 2PY8A 2P9XA 3DS2A 1K9MQ 1A43A 3B5IA 1VQ4P 1K8AQ 2PEIA 3G26A 2KODA 2L6EA 1YITP 3RG6C 5HGMA 1VQLP 1VQ9P 1RO2A 1E6JP 3G29A 1KQSO 3G1IA 3H4EA 4XFYA 3G0VA 2JYLA 3I55P 1Q81Q 3DS5A 4XFXA 3CCVP 1IUQA 2M8PA 3CMEP 3NTEA 2EG5A 1PEMA 1QVGO 1M90Q 2CWOA 4QNBA 3OW2O 2ONTA 3DS4A 4U0CA 1VQMP 2PEJA 2DGYA 5JPAA 1Q86Q 3CC4P 1ZMBA 1M6NA 2Z44A 2XV6A 4WYMA 1S72P 1YJ9P 4XFZA 5HGOA 1N8RQ 1VQKP 1AUMA 2PEQA 1W2BO 2PEKA 1YI2P 1YJNP 1VQ5P 5F2KA 5F2OA 2XXMA 3CCMP 2Z46A 1KC8Q 1M6EX 3WBHA 4U0FA 1PEUA 3Q20A 2PEMA 4U0BA 5BS1A 1YJWP 1M1KQ 1M74A 1RNIA 2BHVA 3G21A 3CXCO 5I4TG 3H0DA 2M8LA 5HGLA 2PENA 1BAJA 4U0DA 4U0EA 1EIAA 3VRLC 3CC2P 4GR6A 3G28A 3DPHA 3MGEA 2BUOA 2XT1A 1KD1Q 2BQ1E 3CCRP 2M8NA 1VQ8P 2E1MA 1QRJA 1D1DA 3CCQP 1K30A 3I56P 4GR2A 2PEOA 3G1GA 3M1MA 5HGNA 3CCLP 5F2NA 5BS2A 1VQNP 1EOQA 3HZQA 1K73Q 3CC7P 2QEXP 2JO0A 1VQPP 2EIAA 1NJIQ 1A8OA 3H47A 3G6EP 4U0AA 1VQ7P 1QVFO 3CMAP 2Z45A 2QA4P 4COPA 4XROA 4XRQA 1Q82Q 4PH1A 2OARA 3DS1A 1JJ2O 3LRYA 4PH0A 3CCSP 3HYBA 4M0IA 2OTJP 2OTLP 3CCEP 1YHQP 4IPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW P;  1M1K Q;  1K73 Q;  3CC7 P;  3G71 P;  2QEX P;  3CXC O;  1QVG O;  1YIJ P;  1M90 Q;  3OW2 O;  1VQO P;  1VQP P;  1Q7Y Q;  1VQ6 P;  3CCU P;  3CCJ P;  1NJI Q;  3CPW O;  1VQ7 P;  3G6E P;  1VQM P;  3G4S P;  3CD6 P;  1QVF O;  1Q86 Q;  3CC2 P;  3CMA P;  3CC4 P;  1K9M Q;  2QA4 P;  1S72 P;  1VQ4 P;  1K8A Q;  1Q82 Q;  1YJ9 P;  1YIT P;  1KD1 Q;  3CCR P;  1N8R Q;  1VQL P;  1W2B O;  1VQK P;  1VQ9 P;  1YJN P;  1YI2 P;  1KQS O;  1VQ8 P;  1VQ5 P;  1JJ2 O;  1VQN P;  2OTL P;  3CCQ P;  3I56 P;  3CCS P;  3CCM P;  3I55 P;  1Q81 Q;  1KC8 Q;  3CCL P;  2OTJ P;  3CCV P;  3CME P;  3CCE P;  1YHQ P; 
#chains in the Genus database with same CATH topology
 2EFJ A;  5APS A;  2AXC A;  1OW8 A;  2FYU G;  5AVY B;  1SFC D;  2KGA A;  1GW4 A;  4PD4 E;  4ZKU A;  2IX7 C;  2OTK E;  2PFX A;  5AVT B;  3B5I A;  1NTZ D;  1P84 H;  3CLQ A;  4WB4 A;  4AYC A;  2GUV A;  2GUS A;  3OJA B;  2JYL A;  1AA0 A;  3GF3 A;  1JCC A;  1SFC B;  5H2F H;  4W7Y A;  3HE4 B;  3FXD A;  3JC2 2;  2LPK A;  2CGQ A;  1P84 E;  1HJB A;  2JAZ A;  2VLO A;  2Z44 A;  2XV6 A;  2WPR A;  5AW7 B;  1M8O B;  2PEK A;  2NPS D;  3CL3 D;  2ITA A;  3GW6 A;  2WSE H;  3M91 A;  4U0F A;  5AVW B;  1BGY D;  2VLP A;  1FZA A;  3H1J J;  2N50 A;  1AVO A;  1DEB A;  2MR7 A;  1PV3 A;  1KZU B;  4QMA A;  2XT1 A;  1SFC A;  1NGM B;  4K3A A;  1M57 D;  2HFE D;  4PV1 B;  4HKZ H;  5KJ7 C;  1M56 D;  2ZXX A;  1T3U A;  1NTZ E;  2M5A B;  4H2W C;  1VQP P;  1FJK A;  1NTK J;  1NH4 A;  2K88 A;  3CX5 E;  1BCC G;  2Z5H A;  2QJP C;  3PTZ A;  3H32 B;  2WSF H;  2QJK B;  1WT6 A;  4DZO A;  3HYB A;  3H1I G;  4IFF A;  1YHQ P;  4IPY A;  2YO2 A;  2W6B A;  3MZW B;  1VQO P;  1LJ2 A;  5M1B A;  4ASV A;  1L0L G;  1LTB C;  1VPC A;  2DW3 A;  1R8E A;  1H88 A;  3ABV C;  1K8A Q;  3G3Z A;  3O6Q A;  2E76 C;  3AEA C;  1HH0 A;  2D2C B;  3CX5 D;  1AYI A;  2WQY C;  3DS5 A;  1SVF A;  3CCV P;  4WY4 C;  3PH0 A;  5KAF H;  1FZC B;  2CG5 B;  5AVR B;  1PIX A;  1ZME C;  1N8R Q;  1IFJ A;  1VQ5 P;  5KAI H;  2WSS H;  1RE3 A;  1ACP A;  3L72 D;  1CZQ A;  2G3A A;  1S4X A;  2OYO A;  5I4T G;  4JBZ A;  1L0N J;  1RF0 C;  1X8Y A;  2HG5 D;  2P58 A;  3CXH E;  2K94 A;  1PPJ E;  1ZN5 A;  1KIL D;  1SP4 A;  3CCR P;  3A0H E;  2LTE A;  2O1J A;  3KXD A;  1SQV G;  1QRJ A;  2LXC B;  3I56 P;  2A06 E;  2OYH C;  2Q6Q A;  4L76 A;  1S2E A;  1JY2 O;  4W7Z A;  4PV1 C;  4PD4 I;  3M06 A;  3RL0 D;  2PGD A;  2WVR A;  2RMZ A;  1VHN A;  3FXE A;  2QA4 P;  3L71 E;  3D71 A;  4XRQ A;  1PPJ G;  2OAR A;  4OH8 B;  2RKL A;  2FVA A;  5CBO A;  2IYO A;  1MV8 A;  4NPE A;  2FVF A;  1VF5 D;  3TGU J;  2JYG A;  4COC A;  2V4H A;  2KOD A;  4HKG A;  2KG6 A;  3PJS K;  3G1I A;  1OVU A;  1RHZ B;  3PHL A;  2M0B A;  2PAJ A;  2WSC H;  1PL5 A;  5CCH C;  4ZNC A;  1MFZ A;  3W68 A;  2E76 B;  1PP9 G;  2D2C C;  4WBA A;  1XTG B;  2K37 A;  3VOP A;  2HPC B;  1SLQ A;  1OVR A;  1S72 P;  3AE5 C;  1FZC C;  1P84 I;  1NOH A;  2QJY C;  5HGO A;  3GMA A;  4IFM A;  2FFD B;  5E79 E;  1AUM A;  3HD7 A;  5F2O A;  2XXM A;  1LTA C;  5DJU B;  2Z46 A;  2IBZ E;  1BGY G;  1NTM G;  1HVV A;  3T97 B;  5L8R J;  3L75 E;  2M3B A;  5CCG A;  1NTM J;  1RE3 C;  5TIS E;  3RK2 D;  3DPH A;  3H1K G;  2AEM A;  3BCC G;  3JCU E;  2GDX A;  3C9I A;  3RG2 A;  1L4A B;  3B4S A;  2WSE J;  1J1E B;  2O1K A;  2KSE A;  4N78 D;  4H0L D;  4H13 D;  2Q9I A;  1KYO H;  2OYH B;  1MZ8 A;  1HJ0 A;  3L35 A;  1IO4 A;  3AEB C;  3TNU A;  2BAS A;  2JJL A;  1GU5 A;  2E74 C;  1BDD A;  5GTH H;  2EHS A;  1A02 F;  2IFM A;  4HJG H;  1NTK K;  1NVO A;  1PGP A;  1SQP J;  4GOD A;  3DS0 A;  2LL8 A;  1VQ6 P;  5AW8 B;  3G4S P;  2K1A A;  2PY8 A;  4AUW A;  4JYB A;  4N78 E;  1SQB G;  3BRV B;  1LNQ A;  2Y0E A;  3RG6 C;  4Y28 J;  2MJZ A;  3NTN A;  3TDK A;  3VN0 A;  2P67 A;  3FWN A;  1NTM K;  2IFN A;  5KLV G;  2ONT A;  2GZI A;  1ZRT D;  3RK3 B;  1KFM A;  3KPE A;  1IFM A;  1KB9 H;  5AVV B;  1QL2 A;  1YI2 P;  3HTK A;  5APV A;  2Q1K A;  3L73 E;  2I8D A;  2V7Q H;  5BS1 A;  1S1C X;  1NTM D;  4YPC A;  2M8L A;  5GTI E;  5KLV E;  2JBG A;  4U3F E;  5KLV J;  1CSB A;  3LW5 J;  1BE3 D;  2E5Y A;  2POH A;  3L71 D;  1JCD A;  5BVZ A;  2QM7 A;  3VYI A;  1EDJ A;  2M5A A;  2QG4 A;  3M1M A;  2XV5 A;  2M3E A;  1R5S A;  1U7J A;  3HE5 B;  3A2A A;  1NTK D;  1GL2 D;  4TLF A;  2BCC E;  1NJI Q;  2P2U A;  4U0A A;  1S5L X;  5KJ7 A;  2D2C D;  3EFG A;  1Q90 D;  3MD0 A;  3FX0 A;  1PPJ D;  4LC1 A;  1X79 B;  4YXW H;  4C7R A;  4EOT A;  2E75 D;  3B71 A;  3II6 A;  2ROQ A;  3P7K A;  2E74 B;  2Q3E A;  1T2K D;  2KWL A;  3AE3 C;  4UB6 H;  1FDI A;  2IDB A;  3G26 A;  3JSV C;  1QL1 A;  5GTI H;  5HVC A;  1RF1 B;  3CWB J;  3H1J G;  2KNC B;  4K35 A;  1GL2 B;  2CWO A;  4QNB A;  1EQ7 A;  1JTH B;  1BE3 J;  1GXH A;  2KGC A;  2IBZ I;  1L0L E;  2FYZ A;  2JQ4 A;  3RK3 C;  2A06 D;  3V4W A;  5CCG C;  4EYY Q;  4JYC A;  3Q20 A;  1RNI A;  2N5I A;  3SSU A;  1IK9 A;  5HGL A;  3P8C E;  2QE7 H;  2KGD A;  2JKV A;  1AF8 A;  3B5N D;  4U0E A;  1GZL A;  3CXH H;  1JM0 A;  3K5B A;  3MGE A;  1DD3 A;  1MFT A;  1YYC A;  2BEZ F;  3R2P A;  4NPF X;  2NZ2 A;  1H0T B;  2E75 B;  3OAK A;  3G1G A;  3RK3 D;  2LIU A;  4WY4 B;  1L4A A;  4KHX A;  4IL6 X;  1JY3 N;  2E42 A;  1R5L A;  2HLO A;  5KAF E;  4R0M A;  3GZL A;  1SQV J;  3T97 A;  1NKZ B;  2QM8 A;  3TSI A;  3BAS A;  2KNC A;  2LF4 A;  1MKM A;  4IL6 E;  3OA7 A;  4C7N A;  1AQT A;  2QVA A;  1VQ4 P;  5CJ0 A;  1SQP E;  2YNY A;  3EFF K;  1VQL P;  3E1I A;  1LTS C;  3V2Q A;  3VP9 A;  3I55 P;  3PP5 A;  2GA1 A;  2JB0 A;  2FQ0 A;  3EJD A;  3E1R A;  1N73 B;  3CWB D;  2KS1 A;  4GDO A;  5HV8 A;  1E79 H;  2VSQ A;  3N7N A;  1Q86 Q;  1LWU A;  4PD4 D;  1JY2 N;  1YJ9 P;  1T6A A;  3AEF C;  1QGK B;  2FQ2 A;  5CZD B;  1SQB J;  5F2K A;  3M0D A;  1KN7 A;  1CW5 A;  3IAO A;  2WPS A;  1OW7 A;  2KOG A;  1LT9 A;  2KZJ A;  2FYN B;  1L0N E;  2N98 A;  1OFC X;  2L91 A;  3TK1 A;  1EIA A;  4RJT A;  1M1J C;  3I5C A;  1QX8 A;  4IZ6 A;  3AE9 C;  2C9N Y;  4LLH A;  5AW5 B;  5BU5 A;  2GDW A;  1VQ8 P;  1K05 A;  1X3O A;  3N4X A;  2PEO A;  3AEC C;  3C8V A;  1LP1 B;  3HZQ A;  2CK3 H;  1N7S D;  4O9B A;  2VLN A;  5GTH E;  4EDF A;  1KIL A;  5KLI C;  2FAD A;  3H1H J;  2K9J B;  2Y9Z A;  2N9Y B;  1G1J A;  1N7S B;  2O3J A;  2KLU A;  2YIU C;  2KUB A;  2OTJ P;  1EZV D;  1J1D C;  2C0X A;  3MIW A;  1RH5 B;  1EMV A;  5AW2 B;  1FOS E;  2AXT E;  3V2R A;  3A3Y B;  1ZR4 A;  2O01 N;  1KQG B;  5HGM A;  2R3C A;  1JOC A;  3W67 A;  5CJ4 A;  1Q81 Q;  1L4A C;  2X2B A;  1IUQ A;  1EZV E;  4N6J A;  2OYI B;  5EFW B;  2XND H;  3MHV A;  2OYH A;  1N7S A;  4H2Y C;  5JPA A;  1N73 C;  1LP1 A;  5CCH D;  1NTZ J;  1W2B O;  2PEQ A;  1BGY J;  3GLM A;  3VTP C;  3U59 A;  1T8K A;  3V2N A;  1KB9 D;  4BRY A;  3D6Z A;  1NU1 K;  2GDY A;  4R4L A;  1BAJ A;  3U1A A;  4EIJ A;  1IC2 A;  3BCC J;  4W80 A;  2FYN C;  3H32 A;  1OZH A;  2ZXE B;  2L0Q A;  3A0B H;  2FVE A;  1NTZ K;  2R5B A;  2ZVO B;  3WMM 0;  1VQN P;  1LT9 B;  2ZVN B;  5CBN A;  1FDO A;  1KQL A;  1S9K D;  1RE4 A;  2J58 A;  2YO3 A;  4XFJ A;  3RL0 B;  1YTZ T;  4U3F G;  4BPF A;  5B66 H;  3L70 G;  1SQP D;  3L74 J;  1N7L A;  3LRY A;  1LT1 A;  3AE7 C;  2K5X A;  1LTI C;  1KOR A;  3SFD C;  2JWD A;  2OYI A;  2JR8 A;  2FAC A;  2O01 H;  2FY8 A;  2EHT A;  1FZB A;  1E5W A;  3B8E B;  3F89 A;  4GT1 A;  1PGQ A;  3CCU P;  3MGN A;  3L73 J;  4ASW A;  3AEG C;  1J1D B;  1A43 A;  2KP8 A;  3H1H E;  2KOS A;  4C7N B;  4AQR D;  5AW0 B;  1L0L J;  3ZDM A;  1DNY A;  3L70 J;  3L72 E;  3ITK A;  1LTT C;  5APU A;  2SPZ A;  2I1K A;  4UB8 H;  4MRT C;  7CEI A;  3Q1M A;  4U0C A;  3L75 G;  1FZG A;  3IN6 A;  4WY4 A;  2OYI C;  2DGY A;  4PV1 D;  2N9B A;  4JF7 A;  4BRY B;  1EDI A;  1JMB A;  5APQ A;  2JEE A;  1OVV A;  4XFZ A;  2KOR A;  2Y0C A;  1YJN P;  2MR8 A;  2E43 A;  5H2F E;  3S9O A;  1M6E X;  1KIL C;  1YQ4 C;  3CXC O;  3VMX A;  2PEN A;  3H1I D;  3RK3 E;  1JMM A;  1T2K C;  3GHG C;  4U3F J;  5AVQ B;  3VRL C;  1VL2 A;  3VMZ A;  1SQQ J;  3V4Q A;  1AQ5 A;  2E1M A;  1L0L D;  1BGY E;  4GR2 A;  1USD A;  1VF5 C;  1ZLL A;  3AE2 C;  3H1L D;  1J2J B;  1RF1 C;  2KB7 P;  4DG9 A;  2WZ7 A;  5AVZ B;  2MF4 A;  1GL2 C;  2B89 A;  2HOD A;  2W8Z A;  3G6E P;  1ZP0 C;  1KIL E;  3RBX A;  4RKU J;  2MKV A;  1G2C B;  1FZF A;  2FXM A;  1IJD B;  2I1J A;  2L5G B;  4RES B;  3RL0 C;  1EZV I;  2K93 A;  3LMO A;  3H1L E;  2MVV A;  1GL2 A;  2OTL P;  1ZR2 A;  3CCE P;  3L75 J;  1GW3 A;  1S5L H;  1BE3 G;  1HWT C;  1AJY A;  1SQB K;  1FC2 C;  3DS2 A;  2LML A;  1CEI A;  2QSI A;  3UIA A;  3WUV A;  1H8A A;  1KQS O;  1U57 A;  3B5N C;  2FYU K;  1IFD A;  3AEE C;  2M8P A;  2E75 C;  3Q2Y A;  3EJB A;  1YBK A;  1ZOY C;  2GZG A;  1LTJ A;  4D6T D;  4WYM A;  3BRT B;  4MN4 C;  4I7Z B;  3P32 A;  5KJ7 D;  4M3L A;  3JCU H;  2HOD B;  4BWN A;  1FS0 E;  2FXO A;  4WWI A;  3TGU E;  1PEU A;  2WWW A;  2Z4E A;  1EXI A;  1S3J A;  4PXH B;  3AE4 C;  2L4B A;  2A45 H;  2NPS A;  2ZFC A;  3GHG B;  1GPJ A;  3H1K D;  1KYO D;  3BCC D;  1M7L A;  2WPQ A;  3SWF A;  1D1D A;  2B87 B;  3V6I A;  3L70 E;  2NPS C;  2IZ1 A;  1M1J A;  3CCL P;  4UB8 E;  2YMY A;  5F2N A;  1Y8A A;  2XU6 A;  3L75 D;  1EDL A;  3FWL A;  1KFN A;  2IBZ G;  2KOQ A;  3HTK B;  3MTU E;  5KAI E;  1VQ7 P;  1QVF O;  3VMY A;  4CPG A;  4BPG A;  2WMM A;  4XRO A;  4PH1 A;  3M0A A;  1OR5 A;  3NY7 B;  1SQX K;  4DT0 A;  3EJE A;  3M9B A;  1JEK A;  4M0I A;  1L4A D;  2H89 C;  5AVX B;  1PEQ A;  1X22 A;  3KYQ A;  1BCC E;  2L9F A;  1PZQ A;  2Z5I A;  3L74 E;  2WT7 B;  3CPW O;  2NO8 A;  3C1L A;  2AVA A;  1PEO A;  2NRG A;  3BVH A;  1K9M Q;  4DOJ A;  2FAE A;  3L37 A;  1M1J B;  2R44 A;  1T3J A;  1SQQ E;  3G29 A;  3H4E A;  2FQ1 A;  3G0V A;  3GHG A;  5EJD A;  3GF7 A;  2FKW B;  1PP9 D;  1SQX D;  2KK7 A;  2H88 C;  1PEM A;  2E74 D;  1CI6 B;  3KHU A;  1RY3 A;  5KLV D;  2FYU E;  3BCC E;  1DX7 A;  5KLI B;  1XTC C;  1NU1 E;  3MUD C;  3A0H H;  3H1J E;  1N7S C;  1HF9 A;  1U7M A;  1ZV8 A;  2YIU B;  1L0N K;  1BXI A;  3G21 A;  3H0D A;  1USE A;  3D6Y A;  2BEQ D;  3QH9 A;  2KZI A;  3L4F A;  3CE7 A;  3GZM A;  1KB9 I;  2FBW C;  3CXH I;  1K30 A;  3G9R A;  1ZW0 A;  2KGE A;  2WPT A;  2QEX P;  2C0W A;  1NU1 J;  2JO0 A;  1KYO E;  2IBZ D;  1RQU A;  1FDM A;  2ZT9 D;  3EWK A;  2Z45 A;  1SQQ K;  5B5E E;  1KQF B;  1HY8 A;  4IL6 H;  2AXT H;  1H89 A;  3WUU A;  3D70 A;  1EDK A;  3IR9 A;  3AED C;  2UWJ E;  4KT0 J;  1T8Z A;  2CNR A;  2JU2 A;  2FYU D;  4H0L C;  4H13 C;  2FHS C;  1Y9B A;  3USS A;  5KKZ B;  1SQX E;  4H44 B;  1NTZ G;  5APY A;  3HRN A;  2BCC G;  3SWY A;  2L6E A;  1LTG C;  1E6J P;  2K92 A;  1GMJ A;  2Q7C A;  4BXL A;  5KP6 B;  1OIP A;  1VKU A;  3CME P;  2JO1 A;  2EG5 A;  2JP3 A;  1QLE D;  2ZYA A;  1LT9 C;  1IFN A;  1OX3 A;  1GK6 A;  3L36 A;  2J5U A;  2XKM A;  2IYP A;  4OGQ B;  1JO5 A;  4I2L C;  2FXP A;  2KXP B;  3NXS A;  3KQG A;  1JY3 P;  4U0B A;  4OWF A;  1M74 A;  3L72 G;  1BCC J;  2C9L Y;  2HR3 A;  5CCH A;  1ZXG A;  5AVS B;  2ZAE B;  2JU1 A;  1WRG A;  1HUC A;  1W2E A;  3V2P A;  2BQ1 E;  2R32 A;  1SQV D;  3CXH D;  1FJP A;  5BS2 A;  1NTK G;  2J59 M;  5CCG D;  3L71 J;  2R5D A;  3P8C D;  1NO4 A;  2ZYG A;  3LID A;  1BDC A;  2W6A A;  3MP7 B;  1A8O A;  3CMA P;  3L74 G;  1YTZ I;  2H43 A;  4RO0 A;  4UB6 E;  3H1H D;  3GJN A;  1SQB E;  3LW5 H;  2XDJ A;  4Y99 B;  1YQ3 C;  3IF4 A;  4H44 D;  2K9J A;  3AE6 C;  1OWA A;  2A06 G;  3CWB E;  2LIW A;  1KIL B;  2E76 D;  4F37 A;  3RBZ A;  2V7Q J;  2P9X A;  2GZE A;  4PJ0 H;  2K0Y A;  1YIT P;  4H44 C;  3FGA D;  3EQ2 A;  3L72 J;  2ZT9 B;  2WIT A;  2YMK A;  3HUS B;  1N73 A;  3H25 A;  1VF5 B;  2IPP A;  1UII A;  5E79 H;  1GD2 E;  1SQP K;  1HQB A;  5APW A;  3CWB G;  3DS4 A;  1VQM P;  3CC4 P;  1SQX J;  3WU2 H;  1M6N A;  3GKL C;  1SQV E;  4DJG A;  4JPZ B;  4C46 A;  4D6T J;  1VQK P;  1LTJ C;  4OGQ C;  4HYT B;  1URQ C;  2E5T A;  1FU1 A;  2P10 A;  1FR2 A;  3TF5 A;  2FFD A;  3NMD A;  5B5E H;  2QIW A;  5APT A;  2K0D X;  2IZ0 A;  4WY4 D;  4PWV B;  2PNG A;  2OGU A;  1CI6 A;  1AFO A;  2N1T B;  2KS1 B;  2GZF A;  1W5C E;  1VDF A;  2CQ8 A;  4B86 A;  2YKO A;  5AW1 B;  2K0X A;  1NU1 D;  1IZN B;  1L2P A;  3A5T A;  3B5N B;  3F5H A;  3SFE C;  2O01 J;  3RGU A;  2YKP A;  3TGU G;  1K04 A;  1KB9 E;  3H1I E;  4HB1 A;  3E7K A;  1NTM E;  2WT7 A;  2EIA A;  1NAY A;  3CI9 A;  5AW9 B;  3IFM A;  3PRJ A;  1JTH A;  4UHP B;  3H1H G;  1JJ2 O;  4I7Z C;  1UNK A;  2K3R A;  1TU3 F;  3HE4 A;  1GDT A;  1L0I A;  2GYK A;  5C39 A;  4Y99 C;  1JB0 J;  1EC5 A;  1HBW A;  3DS3 A;  1JY3 O;  4KJM A;  1DEE G;  1SQV K;  2BCC D;  5DCK A;  3CD6 P;  2FYU J;  4L75 A;  2Y9Y A;  3M0D C;  2PEI A;  1PP9 J;  1LWU C;  2KR5 A;  2NPS B;  1GTW A;  1L0N G;  2HYN A;  1RF1 A;  1QVG O;  1M90 Q;  3HUS C;  3QWO C;  2PEJ A;  1ZMB A;  5CMZ A;  1IK7 A;  3S4R A;  3U43 A;  3B5N A;  2JDI H;  4TT3 H;  2KYV A;  3CCM P;  5KTB A;  2KI7 B;  2PEM A;  3HE5 A;  1LTJ B;  1NQ4 A;  2KSJ A;  3WUT A;  4A7P A;  5KP7 B;  3CC2 P;  4GR6 A;  3RK2 C;  1Z56 A;  4IOI H;  2RN0 A;  1Q2N A;  1KTM A;  2XZ0 D;  1HTL C;  1NU1 G;  2W83 C;  1FBM A;  3CX5 I;  1K73 Q;  1RF0 A;  2CPB A;  4L74 A;  1DD4 A;  3L74 D;  3H47 A;  3CX5 H;  2XZ1 C;  2AEF A;  4COP A;  2PRR A;  2L22 A;  5BU8 B;  3LIE A;  1MUU A;  2AF8 A;  1MZ9 A;  1L0H A;  3VMA A;  1SQQ D;  3L70 D;  1SQP G;  2PP6 A;  4I6M C;  2VLQ A;  5AW3 B;  2Q5U A;  3O8Z A;  1Y47 A;  1IFI A;  3E2D A;  1RO0 A;  3H1I J;  1Q7Y Q;  3L71 G;  2LOL A;  2Y0D A;  2N1T D;  5AVU B;  2N5H A;  4GOF A;  1URQ A;  1DIP A;  3L73 G;  4XFY A;  3TGU D;  1G2C A;  3NTE A;  4U7J A;  1BE3 E;  1Z6M A;  3OW2 O;  1L0N D;  2AFE A;  2QJP B;  3HD7 C;  1NYH A;  2N6Z A;  5TJH A;  3TNU B;  3PLN A;  2LR2 A;  4ZKP A;  1EXJ A;  2KG9 A;  3Q3D A;  2BCC J;  5APX A;  2WSC J;  5TIS H;  5KLV K;  1AVY A;  4D6T E;  4H0L B;  4H13 B;  3M9H A;  2M8R A;  2MVU A;  4GIF A;  3NFQ A;  5KKZ C;  3MUD A;  4IFD K;  1G1I A;  2LKM A;  3H1J D;  1BSH A;  2N1T A;  2WSF J;  2AFD A;  3RK2 B;  1URQ D;  4OGQ D;  1IFP A;  4NEO A;  2KOO A;  1HGZ A;  3H1K E;  4U3F D;  3KDP B;  4EI2 A;  1A02 J;  3TYY A;  3KZI H;  3AE8 C;  2HPC A;  4PH0 A;  2B88 A;  1F80 D;  3CCS P;  2ZJS E;  2KW2 A;  1ZNV A;  4BPH A;  3M9Q A;  3G71 P;  3A7O A;  3HUS A;  4ZMD A;  1YIJ P;  3DTJ A;  2A45 I;  3CCJ P;  1D7M A;  2YXR B;  1OXZ A;  3SWK A;  1LGH B;  2WTY A;  1FAV A;  2KLV A;  1IMP A;  2M5R A;  1JY2 P;  1FZE A;  2QRX A;  4JQ0 D;  2ERH A;  1N86 A;  2W90 A;  3HD7 D;  1E0H A;  2B9B A;  2KOP A;  4H2X C;  1GXG A;  3AE1 C;  4NPD A;  1DV5 A;  1SQQ G;  2JGP A;  2RH0 A;  1WMK A;  3H1L J;  1PGO A;  2LXB A;  2P1J A;  3HD7 B;  2DNW A;  2GM4 A;  5B66 E;  2H7H A;  3WBH A;  1UJZ A;  1KLP A;  2LKI A;  2H8P D;  1YJW P;  2BHV A;  1SS1 A;  1P84 D;  2K2Q A;  2ZYD A;  5KP8 B;  2MD9 A;  3L73 D;  4LGD E;  2JWA A;  3GG2 A;  5AW4 B;  2BUO A;  1KD1 Q;  4QKO A;  2M8N A;  3Q5R A;  2Q3I A;  3H1L G;  3P8M C;  1NKN A;  4L73 A;  1PFI A;  2GZJ A;  3BAT A;  3KZI E;  1SQB D;  5HGN A;  1X0T A;  1RE4 C;  2ZT9 C;  1EOQ A;  4XE5 B;  2B87 A;  1H0T A;  3B4Q A;  4HH2 A;  3Q5P A;  5AW6 B;  4PD4 H;  3Q5S A;  2W27 A;  2QJY B;  1AV1 A;  2FFD C;  1Q82 Q;  4I1L A;  3WU2 E;  2QNW A;  1URQ B;  2XZR A;  1PP9 E;  3U1C A;  4CA3 A;  2YXQ B;  4N3Y B;  1OW6 A;  3P05 A;  3O6Q B;  2YKQ A;  2N1T C;  3S1K A;  1L0L K;  4PJ0 E;  1SFC C;  2CPS A;  5EW5 E;  1PGJ A;  1VQ9 P;  1RO2 A;  1RQV A;  1J1E C;  1GU4 A;  1FZC A;  2K9Y A;  2R3S A;  1N2D C;  4XFX A;  2XNX A;  4WVZ A;  2KG8 A;  2MY5 A;  1SQX G;  4D6T G;  1FOS F;  3H1K J;  3R4Y A;  1HGV A;  1KMI Z;  1BCC D;  4Z1M H;  1QEX A;  1KC8 Q;  4YTP C;  2G8Y A;  1M1K Q;  1KYO I;  3A0B E;  1FE6 A;  1ZRT E;  1NTK E;  1BSN A;  4U0D A;  2P7J A;  3V5B A;  1UIX A;  3G28 A;  1DH3 A;  2VRS A;  1OMI A;  4XA4 A;  1S5L E;  1S9K E;  1X9V A;  2W6J H;  4R4M A;  3CCQ P;  5DJT B;  4OVN F;  3VP8 A;  1NAF A;  2KIK A;  1LWU B;  3CC7 P;  1JNM A;  2N6Y A;  2QJK C;  3H6P A;  1NHL A;  1IMQ A;  4GOE A;  2A45 G;  1KV4 A;  1JUN A;  1NWQ A;  5K5G B;  5CHX A;  4GKG A;  3DS1 A;  2WPV B;  4YXD C;  1EZV G;  3RL0 g;  2OQQ A;  1GK4 A;  2AEJ A;  4DCK A; 
#chains in the Genus database with same CATH homology
 1PEQ A;  2EFJ A;  2LF4 A;  3E2D A;  3G71 P;  1YIJ P;  1RO0 A;  1VQO P;  3DTJ A;  3DS0 A;  3P05 A;  1Q7Y Q;  1VQ6 P;  3CCU P;  3CCJ P;  3DS3 A;  3CPW O;  3G4S P;  2JYG A;  5DCK A;  3CD6 P;  1PEO A;  4COC A;  2PY8 A;  2P9X A;  3DS2 A;  1K9M Q;  1A43 A;  3B5I A;  1VQ4 P;  1K8A Q;  2PEI A;  3G26 A;  2KOD A;  2L6E A;  1YIT P;  3RG6 C;  5HGM A;  1VQL P;  1VQ9 P;  1RO2 A;  1E6J P;  3G29 A;  1KQS O;  3G1I A;  3H4E A;  4XFY A;  3G0V A;  2JYL A;  3I55 P;  1Q81 Q;  3DS5 A;  4XFX A;  3CCV P;  1IUQ A;  2M8P A;  3CME P;  3NTE A;  2EG5 A;  1PEM A;  1QVG O;  1M90 Q;  2CWO A;  4QNB A;  3OW2 O;  2ONT A;  3DS4 A;  4U0C A;  1VQM P;  2PEJ A;  2DGY A;  5JPA A;  1Q86 Q;  3CC4 P;  1ZMB A;  1M6N A;  2Z44 A;  2XV6 A;  4WYM A;  1S72 P;  1YJ9 P;  4XFZ A;  5HGO A;  1N8R Q;  1VQK P;  1AUM A;  2PEQ A;  1W2B O;  2PEK A;  1YI2 P;  1YJN P;  1VQ5 P;  5F2K A;  5F2O A;  2XXM A;  3CCM P;  2Z46 A;  1KC8 Q;  1M6E X;  3WBH A;  4U0F A;  1PEU A;  3Q20 A;  2PEM A;  4U0B A;  5BS1 A;  1YJW P;  1M1K Q;  1M74 A;  1RNI A;  2BHV A;  3G21 A;  3CXC O;  5I4T G;  3H0D A;  2M8L A;  5HGL A;  2PEN A;  1BAJ A;  4U0D A;  4U0E A;  1EIA A;  3VRL C;  3CC2 P;  4GR6 A;  3G28 A;  3DPH A;  3MGE A;  2BUO A;  2XT1 A;  1KD1 Q;  2BQ1 E;  3CCR P;  2M8N A;  1VQ8 P;  2E1M A;  1QRJ A;  1D1D A;  3CCQ P;  1K30 A;  3I56 P;  4GR2 A;  2PEO A;  3G1G A;  3M1M A;  5HGN A;  3CCL P;  5F2N A;  5BS2 A;  1VQN P;  1EOQ A;  3HZQ A;  1K73 Q;  3CC7 P;  2QEX P;  2JO0 A;  1VQP P;  2EIA A;  1NJI Q;  1A8O A;  3H47 A;  3G6E P;  4U0A A;  1VQ7 P;  1QVF O;  3CMA P;  2Z45 A;  2QA4 P;  4COP A;  4XRO A;  4XRQ A;  1Q82 Q;  4PH1 A;  2OAR A;  3DS1 A;  1JJ2 O;  3LRY A;  4PH0 A;  3CCS P;  3HYB A;  4M0I A;  2OTJ P;  2OTL P;  3CCE P;  1YHQ P;  4IPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...