1QVVA

Crystal structure of the s. cerevisiae ydr533c protein
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
234
structure length
233
Chain Sequence
KKVLLALTSYNDVFYSDGAKTGVFVVEALHPFNTFRKEGFEVDFVSETGKFGWDEHSLAKDFLNGQDETDFKNKDSDFNKTLAKIKTPKEVNADDYQIFFASAGHGTLFDYPKAKDLQDIASEIYANGGVVAAVHGPAIFDGLTDKKTGRPLIEGKSITGFTDVGETILGVDSILKAKNLATVEDVAKKYGAKYLAPVGPWDDYSITDGRLVTGVNPASAHSTAVRSIDALKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YDR533c S. cerevisiae protein, a class II member of the Hsp31 family
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
molecule keywords YDR533c protein
total genus 87
structure length 233
sequence length 234
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.130: D-lactate dehydratase.
pdb deposition date 2003-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qvvA00
3P9SA 3B36A 4S0ZA 4LGYA 4Y1EA 2AD5A 2R1TA 2OR3A 4B31A 1N57A 4P35A 3EZGA 1GGHA 4OJYA 4K2HA 3TTVA 4P34A 3OT1B 3CZ9A 2VDJA 2D7JA 4WXYB 3R75A 4AULA 5LIRA 1PE0A 1L9XA 3B38A 4P36A 2A9VA 1J42A 2VKTA 1QWSA 2YWBA 3FIJA 3NOOA 4ENSA 3L3BA 4MNTA 2R1UA 2VXOA 1K9VF 2ZUWA 3MGKA 4GE0A 3BWEA 1KXJA 3TTYA 3ZJ5A 1CF9A 4B5KA 2YWCA 3D54D 1OX6A 3EJ6A 1KEEB 2R1TB 1WL8A 3SF8A 3WFZA 3NVAA 1FY2A 3N7TA 3UOWA 3ZR4B 3UJNA 3UK7A 1Q2UA 3TTUA 1OI4A 3P9PA 4HCJA 4ENVA 4L78A 4Y1GA 4ZDJA 1M6VB 5JZMA 3F71A 4N12A 3UGJA 5E9AA 1S1MA 4QYXA 3CZAA 1KWGA 3PQ5A 4B40A 3M3PA 4ENUA 1P5FA 3FSEA 3PQ3A 2GHRA 4N0MA 5SYAA 3B3AA 5SY4A 4AJ9A 1Q7RA 2ABWA 3CY6A 3TTSA 4UZSA 1CE8B 5SY9A 3VU3A 3ZJ4A 2AB0A 2ISSD 2W7TA 3PQ8A 5BV2P 4AUEA 3TQIA 1ONSA 3NOQA 2VRNA 1PDWA 4GE3A 2NV0A 4XLLA 1KWKA 3UMMA 3L7NA 4E5VA 4Y1RA 3L4EA 1IPHA 4AUNA 3TTTA 1GPWB 2R1VA 3PQ4A 1C30B 1T0BA 1GGKA 2ZUVA 3OT1A 4QYTA 1PDVA 5SY6A 1SY7A 3TTWA 4ZDIA 4L8YA 1JVNA 5JZOA 1PV2A 4JQSA 4OIFA 4RKWA 4ENTA 1QVVA 1P7YA 4L95C 1T36B 3NOVA 1KA9H 3F5DA 4OFWA 1VCOA 4OQ4A 2WJZB 3ER6A 1OX4A 4ZGGA 2XF2A 2ZUTA 3SF8B 1C3OB 4R7GA 4OGFA 2RK6A 1A9XB 1UCFA 1BXRB 1GGJA 4E08A 1P81A 3GRAA 1VCNA 2YWDA 1O1YA 3EWNA 4I4NA 4PXYA 4ENRA 3R76A 4L8WB 2RK3A 4ENPA 1GPMA 1P7ZA 4UNIA 3R74A 4UOQA 1GG9A 4GUDA 4WINA 3BHNA 1P80A 2GK3A 2YWJA 5K4AA 4MGHA 1FYEA 4B2YA 2LXNA 4LRUA 3P9RA 1OY1A 2FEXA 1VCMA 4UCFA 5IP5A 3EFEA 4BIMA 3MIIA 4UOZA 4ADSG 3CYFA 4P5PA 4BTEA 3PQ6A 4D1YA 4MTCA 4RKYA 1GGEA 4Y1RB 1GGFA 1CS0B 2H2WA 1T3TA 3EN0A 3L18A 4L7QA 4Y1FA 1G2IA 2R1VB 4I46A 4ENQA 1QVZA 3PQ2A 3PQ7A 1I7SB 2ZUSA 3CNEA 4OGGA 5DFAA 1QDLB 2IUFA 3NONA 1QF7A 3KKLA 4Y0NA 1R9GA 1VHQA 1SOAA 3TTXA 4P2GA 2V4UA 1U9CA 1JDBC 2ZUUA 4B7AA 1OX5A 1IZZA 4ENWA 4BFLA 1I1QB 1OX4B 2RK4A 2VPIA 3NORA 1IZYA 4AUMA 3P9QA 4ZDKA 4I2NA 3SOZA 1I7QB 2NV2B 3RHTA 4L8FA 1QVWA
chains in the Genus database with same CATH superfamily
2VWGA 2I76A 3DAYA 3EMBA 1ZI9A 5JCZA 4B73A 4LXGA 2PLRA 1BEZA 2JIQA 3RPEA 1GEGA 2FR0A 4WLVA 3RT7A 3UKJA 5AVVA 5JANA 2GN2A 2IYLD 1M6EX 2PWBA 1F2DA 3E3MA 3IPYA 4ZO7A 4Z9YA 5DNCA 1JIIA 1S2LA 1Y48E 4UBLA 3KPYA 1EBBA 1ZU4A 3F6YA 3U13A 3OT4A 1G9XA 1RI3A 4KR7A 3B51X 4DCSA 1HRKA 3OIDA 3A58B 2IHNA 4CMBA 2FLWA 3HVUA 2G9RA 3OTQA 3IELA 1B8NA 1N2IA 1QNLA 2R87A 4BE4A 3ZJTA 2NACA 3G8AA 5BW6B 1LNSA 2W42A 3UK7A 4OH1A 1KK3A 3JQAB 4MV3A 5CFQA 2FLKA 1SHTX 3E9NA 2WLTA 4K87A 5FI3A 4JKIA 4HN9A 1CTQA 4GI7A 4Z0HO 1KWGA 5KX5F 1G8GA 2IHBA 2X5OA 3H99A 5K0GA 4CF3A 5JMWA 2FMUA 4O1MA 2XXJA 1E2PA 2ZIWB 3LZ6A 5GADl 3THYA 2JEOA 2CJYA 1NY5A 2GXUA 1VDMA 2P2LA 5F7XA 2MYNA 2YC2C 2XHEA 5FWYB 2VRNA 6CHYA 3CRQA 1QP4A 1RPJA 2RAFA 4DSAA 3TUIC 1KU6A 3L7NA 4EG3A 1M5TA 2FUKA 3PXEA 3DFFA 4DDUA 5A9SA 1FJGB 5EWJB 5E6UA 1SQ6A 1NRWA 2WVJA 3LPLA 2D06A 2YJ5A 4Z1MA 4RAOA 3UPDA 3G9TA 3ZQ4A 4CYMA 3IODA 4M89A 4REQA 1T6BY 1KK2A 3Q8KA 3LXMA 2FWRA 1QC5A 1ZRMA 3NBFA 2REXB 3P2KA 1JU9A 2J45A 5I7AA 3RYFA 2JHPA 2QR5A 3QU4A 5GVRA 1FTNA 3LLCA 3AVYA 1HUQA 3AFNA 5LYJF 1US8B 2Q3LA 3FWPA 3R6TA 4CL3A 5HKAA 5KHLB 3RCBA 1NN5A 4BJ3A 3HUTA 5BR4A 1ZCZA 3PNKA 3R5KA 2WNSA 4ZMRA 1GPMA 1JR3A 1MTOA 1NPDA 4AJKA 1EUCB 5KOJB 1AKQA 4FMCB 4RJLA 4WA8A 1V25A 2PQ0A 3VYUB 5JAPA 4P3PA 3X44A 1QH9A 3IV7A 1PG2A 1XQ1A 7ADHA 3OLCX 2FQQA 2OQ2A 2K7FA 1IXSB 2Q07A 1AC5A 3ZHRA 1RSZA 1Y5RA 3L84A 2GAJA 2AMLA 5JJLA 1GGFA 2VP2A 4ED9A 1GNRA 1M72A 1R0RE 1W0KA 4ZYWA 1E9VA 1E2FA 4BKRA 4DYVA 3F9RA 2IXFA 3HA3A 2OYRA 1IOWA 4FDAA 1SA0A 1LBQA 2C31A 4R8VA 3W8RA 5I9LA 4YCJA 1KI6B 1N3BA 3NHFA 1QHYA 5HPYB 3Q85A 1GT91 3QLEA 1CR4A 3AM3A 3KKLA 1P6QA 4L3OA 4OG2A 1HF3A 1G20A 1VHQA 2XBUA 3HYNA 4N49A 1P2UA 2VDRB 2PU5A 4O2AA 1T9DA 1X7YA 1OX4B 3FPGA 4M9QA 4O0MA 5COQA 5CH3A 5I9TA 2WWRA 3VOSA 4DA0A 1ANKA 5M29A 4J7XA 1X13A 2AGVA 1V11A 3D02A 3MIZA 5KQRA 3TDMA 1WPQA 1H2HA 2XKAA 4Z49A 4CXMA 5AI5A 3R24A 1AA6A 1I6LA 1LPNA 5BW8A 4BQNA 2ECOA 2AEJA 5LVAA 4KB5A 3HYCA 2HK7A 4D9EA 3TXAA 4PIPA 3GJ8A 4NENB 1RLUA 5CBPB 5EJEA 5LIRA 3BMNB 2UZ0A 4LE1A 4S1NA 1DO0A 1E8DA 3IQFA 4P3OA 1DHRA 2IDKA 2OV2A 3PC8A 5LQRA 2PKRA 3P0EA 2XMSA 2ZI5A 4KIUA 2ZJ7A 5D1HA 3LGSA 2P6PA 5CYOA 3V9AA 4CF4A 1WZEA 1OR8A 3H8WA 2V0CA 3COYA 4B4UA 4EPRA 1E99A 3QKWA 1PJCA 1YMQA 1QJ4A 2CHUA 5B4VA 2QOEA 5MHTA 3T54A 3RSQA 4Y1GA 4S12A 1UKBA 5LYJA 3WMRA 1QP0A 3QKSB 1AD2A 1RBZA 2BBSA 4OOEA 4RE5A 1NW8A 5I7HA 2UYHA 2PT9A 4PFQA 1PP4A 2QWXA 1QIKA 2NUAB 4HPXB 4K88A 1NSFA 1ECLA 2Q3HA 3UN1A 3V8BA 1RPNA 2GHRA 3UHPA 5SY4A 1E6CA 2XB4A 3PPYA 1M0SA 1HZZA 1MVLA 3LD9A 4Y6PA 2ISSD 4D41A 3TQIA 2VAMA 1ZA2A 4RTSA 1UK7A 4JYZA 2Q2VA 4I1YA 1NNUA 2FPLA 3MRVA 3NANA 2ZZMA 4Y1RA 2JFOA 1IXKA 3H8JA 3EXG1 4N54A 5T3UA 3S68A 4EHAA 3R9XA 1XLTC 3AR6A 4TS4A 3UJ7A 3ET5A 5M34A 1G291 2R8OA 2A8YA 4UHFA 2IYEA 1OZGA 5FL7D 3VU0A 4A8PA 3AVQA 4MCIA 3ELDA 4K1LA 1D6NA 2QL9A 4S35A 1JJFA 3WE7A 4EOGA 3PPWA 4M38A 2QN2A 3OE7A 4MS4A 4ZRMA 1TJYA 2B94A 3NKLA 3QIVA 1B0AA 4ZTBA 5BV1A 5JAHA 1FU8A 3QEMB 4IOLA 1FFXB 1DCMA 1R0SA 4PX5A 4XUCA 4COOA 4AF8A 4Q4HB 5JROA 3U3ZA 1ST3A 4MWBA 3PHLA 2HX1A 1RWNA 1NR1A 1OXUA 2Q3FA 5FR2A 3VYSB 5KDOA 1U8CB 4G67A 1LSSA 1JWLA 1WVMA 3KQWA 4YIKA 2BFDA 1SFRA 2X1MA 3WDSA 5HJEA 4KH1A 4LQLA 5E1MA 2AI3A 1UJ4A 3CT6A 1P9OA 4S24A 4GOKA 4Z7JA 1W5FA 4QYSA 2ZR0A 4HC4A 3WA7A 4Z5XA 3EDRA 3PUKA 4ZXPA 4E2FA 2HA6A 3EFBA 5FTJA 4PX3A 1UFOA 2ODPA 5JALA 1H4QA 3EFEA 1C9JA 1BKSB 2XQFA 4BLWA 3X1XA 2JIRA 4PQFA 2NTNA 2BJWA 1VI2A 3RKUA 1YIDA 3ZHQA 2NZ2A 2YV1A 2YDYA 3O0DA 3PQ6A 4LXUA 5F9FA 3JX9A 2FUG1 1T9ZA 3ZKWA 3AVXA 1O9HA 3T1HB 1O95A 4G1CA 4DRXA 3PCRB 3O8QB 4L3WA 4QBHA 3D31A 5JCOC 1WO8A 1CS4C 1JHUA 1XZJA 3LX6A 3PQ7A 4NECA 2C8KA 3S5JA 3HKCA 5COAA 4O4JA 2H08A 4U3JB 1XMXA 2FEOA 4KXYA 3RHFA 2ZW9A 2JATA 4BO0A 4F6LA 4L6CA 1QP8A 3EZFA 2ILTA 3HVRA 1OX5A 3CUWA 2QZZA 3DMNA 2QENA 2YL2A 4JLNA 3ND8A 3BHMA 3DTNA 4MQEB 5DK4A 3UYLA 1KVRA 1TYZA 1UJ6A 4G0WA 1OI7A 3DEFA 3OMXA 4KK3A 3D6UA 4LYFA 2FSFA 4HGPA 2HCFA 3PNSA 4YAFA 5J5VA 3PGJA 3CW9A 3DSRA 4QTTB 1LZKA 1Q0QA 2WF6A 2G6BA 3QVOA 2FFRA 4JBIA 4PYKA 4ZJPA 4EQZA 1KMIY 3K8QA 3QWBA 3WL4A 5BN3B 1NP7A 2VZ9A 4GNKA 2I03A 1D2EA 3KBOA 1L5GB 1BYUA 1OC2A 3IAHA 5IWAB 1ZQ9A 1JPVA 4YJFA 1SHKA 1AQNA 1Z6YA 2B6NA 4OJQA 5HW0A 1KVTA 1P17A 4MA5A 1MEOA 1U2QA 4L8LA 4XIGS 1W0JD 1W4RA 3GBPA 4YA6A 1EFKA 3GLFE 3IAS1 1KJYA 2R85A 4JKOA 1W34A 1FLAA 1P61B 2FK7A 3T5AA 4I1PA 3BJRA 1XJWA 1R74A 2DP4E 1MRSA 1XZBA 1SCJA 2GCGA 2GPBA 2NU6B 2RGNA 3OU6A 4HFMA 4JSTA 3VC1A 3U7IA 2EF1A 5F1YA 6Q21A 2IK8A 3EGDB 1FFEA 4XTRA 1ZKDA 3DBRB 3ENVA 3O1HB 4WY8A 4PSDA 3WQBA 4HG2A 4AS3A 4DCGA 4EYQA 5BV2P 2H63A 4IMPA 5LU9A 5K0TA 1JG4A 2WYVA 4N5MA 4BYGA 3OQVA 4LZWA 5FBHA 4ZT5A 3VZBA 2JAWA 2ON6A 2E0IA 3NX4A 2R7LA 3OFSA 4KQXA 5FUWA 3VMMA 1X15A 4IIYA 3HWWA 2WRZA 1PWYE 1WTAA 2EBWA 4FFOA 2O8FA 4N1AA 2ZAGA 1I6MA 1GZVA 2C7GA 4H31A 1MENA 3NFRA 3UATA 2HWXA 4E1VA 2CVFA 1Y1LA 2VXCA 4F2GA 4ZJYA 5LDDC 2GJAA 4ZAWA 3GUVA 4GC5A 1NE7A 1JEEA 3V6LA 4JC4A 5C46F 1CJKC 2J0EA 2QMHA 3R0JA 3L7IA 2REQB 2PGLA 3ZV5A 5DDIP 3LYAA 1CX9B 4MWSA 4C05A 5A5VA 5T7BA 1BKYA 1D9ZA 1W25A 1EFVA 1Q77A 1HI9A 1SBIA 3AJ8A 1QIEA 1TQ2A 1G3IA 3KC2A 1H4SA 3GWZA 3U4DA 4PLHA 2VJMB 3A9SA 3QLUA 4WWHA 2VF4X 3L46A 2O4UX 3AFIA 4AMGA 4DAEA 1I4TD 3HSKA 3R40A 5KYKA 3C15C 2Z6AA 3C6MA 5EKDA 3OMWA 1N2XA 4O4JB 1IWBB 4LRUA 1Q0SA 2GR9A 2FP4A 2PWYA 5JADA 1Z3CA 2O0LA 4P1ZA 5JG7A 3SQDA 5GGXA 3U3MA 3KQLA 2QX8A 3IRVA 3PWZA 4JJEA 2VI5A 4CDNA 4G3XA 1T5OA 4ZOCA 3ZVRA 2WFLA 4BFUA 2WUFA 5BV7A 1ZGZA 1GAWA 1V7ZA 4QDTA 3RC2A 4D9MA 2E7ZA 3T7DA 3LKBA 1GTSA 4MW4A 3VPDA 2OD9A 3OJXA 1SCQA 1ONBA 1RAFA 1JX6A 2TRSB 2Z6VA 4RY0A 5T8KA 3A9WA 4D4MA 2G8NA 4LTMA 3CUEF 3NJ8A 3H5VA 4JIGA 4K8RB 3OSUA 5EZQA 3ZWPA 5AVUA 3RJ5A 4INOA 1ZICA 3IP3A 2GN6A 3KTOA 2J08A 3ZI4A 4RPJA 3EOBI 3JATA 4R01A 2CL7X 5I8WA 1EVZA 4JVSB 1QHXA 4R9NA 1A9XA 2A0XA 3EJWA 3IPLA 5LQJA 1TLFA 1XTSA 1DDOA 3GFRA 1Q1GA 3IUSA 2GVNA 1KEEA 3JD1A 1V8BA 4HNAB 1ZHOA 4G4IA 1GCOA 1QO7A 2JA2A 2RHRA 3S2EA 4KQHA 2C4WA 2ZRBA 4IILA 4HY3A 4V3CA 2A58A 1EJBA 1CCWA 4XD7A 3UJAA 3D9QX 2IHKA 2JBWA 1THGA 4TRJA 1TT5B 1Q83A 2AOUA 3PTZA 1ZW6A 3U39A 4O8CA 5K8CA 1VG1A 3ELBA 1F8XA 4I5DA 1S9HA 3WL7A 5L3RA 2P1RA 3G8BA 1XTPA 2GBPA 4I99A 3WSTA 2DVMA 3G0CA 2I66A 4TLEA 4DCVA 2J9GA 1ZHHA 3V5NA 3BL8A 5EIFA 4QGBA 3N2ZB 4QAJA 3I3SR 4LHSA 5EXEA 5C80A 1KY5A 2EHJA 2O8NA 5F78A 2JAHA 3W79A 4CUZA 4X3CA 5BO5A 1PWZA 1RJ9A 4NOKA 5F12A 4KYIB 3SIRA 1KYQA 1Z5ZA 1XF9A 2AF3C 1Q15A 1GSOA 3AHCA 3IP6A 3W0LB 5JWRA 1DCTA 1Z4LA 2PH3A 3EG9B 1QHNA 2EERA 5CVDA 3PEFA 3TAHA 3M1IA 4GOND 4ISCA 5E38A 3VJKA 3DMFA 5EHNA 2CNOA 2P0YA 1A9ZA 5E6RB 3AL2A 5CA0A 3CJTA 2OPBA 4PGFA 3O4GA 4OU4A 3WK6A 1XF1A 2RC5A 4N5LA 3CVWA 4IFIA 1Y63A 3B82A 3DDNA 3V6MA 2Z2IA 1D2RA 3TW0A 3KXKA 1JEAA 1YFKA 4ZDIA 4CUKA 3BMNA 4G0XA 1AVTA 4S2EA 1WSDA 3E0XA 3M6MD 2DPLA 3FYSA 1M33A 2P2ZA 3QMMA 4BX3A 5JY1A 3IEUA 4D79A 3G1TA 4GYKA 1E3WB 1O87A 4CTNA 1IY2A 4MYCA 1Y8QA 4MQUA 3F7NA 1VIVA 2KWIA 4UVHA 5CLHA 2GFHA 4MH0R 4YUVA 2XWSA 1FNNA 1T29A 4ZIRB 1EESA 4WGFA 3PI6A 5EZ5A 3K1AA 2BEKA 2R11A 3HCRA 3GGPA 3R76A 3WGQA 4R0MA 1M6WA 4OHMA 5SICE 3H97A 3OCWA 1CQJA 2ZAIA 3TX6A 1PV4A 4EK9A 3AY6A 3OZDA 5DLDA 1TZJA 3K4PA 2D7CA 3KETA 2PXAA 2XMCA 2Q1YA 5KINB 1TMOA 2B5VA 2Q1XA 3EVBA 3U9TA 3UKDA 5KI6A 4DQLA 1N25A 1WABA 4RELA 3T0IA 1I3CA 2AFIE 3L8EA 4TYWA 3I30X 5CG1A 5IVHA 3EAQA 2RHCA 4DANA 3TFQA 1J97A 4LE2A 2D1FA 2UYCA 1GADO 2I2AA 1SHUX 3UH0A 5DN9A 3UG6A 1Y3HA 1WUJS 4GGMX 1H8EA 1NULA 4LRXA 4MQBA 4QBKA 1SOAA 1B26A 1UP7A 1XTUA 2Q6TA 2HQBA 3PC8C 2X19A 4G65A 2PUGA 2PIDA 4TWBA 4UHHA 5TNXA 3QBEA 3GFFA 1OWLA 2J9ZB 3QV2A 2B8JA 2I6UA 4GMDA 5BRNA 5KCMA 1AQIA 2C42A 2C9OA 2MSCB 4MUMA 5CPFA 1MDBA 3MXOA 1W5TA 3TPZA 2PRJA 2RBEA 3P9SA 5LL6P 3FUXA 4IGIA 3CO5A 4BQRA 3I5YA 4U8GA 1TM7E 2B6HA 3EWIA 1QQBA 2KS6A 4ZZ2A 4EJSB 721PA 4NOLA 2C7RA 2RFLA 2W0MA 4FMCF 4GKVA 7AT1A 3C24A 3FHLA 1NU6A 2X6RA 2AZDA 3MTQA 4WJZA 3TIXB 5LUAA 1AUXA 5LPNA 3ZU3A 1JJAA 3QXHA 5AVWA 4P4SA 1AQJA 1Z0FA 4OQLA 5GONF 4ESVA 1E5LA 4UEWA 1MC5A 2LBPA 3G3EA 4I1IA 1C1HA 4Q4LA 3W1EA 1OX6A 5FI5A 2P4HX 4W5QA 5KOHA 2KLBA 1G3QA 5JAZA 4ZICA 1U2RA 2ZJOA 4PHFA 1Z56C 2WWXA 4DXDA 4B4VA 1P19A 1NI3A 1T34A 3JXEA 1Y7PA 2P75A 4LY9A 3KHKA 1AZLA 1FA9A 1KI7A 4CLXA 3GHHA 2PS1A 2FH5B 1WQ3A 2PT5A 1EG2A 3HCOA 2BH9A 2CXPA 3N5KA 2OM6A 2WUEA 5DHUA 1XEXA 5JSYA 1ATZA 1U8AA 5E2IA 3G13A 4D98A 1E79A 5B7NA 4LF6B 2HMUA 2VT6A 2XLCA 1JQBA 3NP7A 3WXMA 2G82A 1L7VC 1PHRA 4L27A 4JQCA 4YREA 2XUPA 4KI7A 3R3WA 3RWOA 1J8FA 1GILA 2RH9B 2ONYA 1BMFA 2V98A 3KL4A 3SE7A 4N03A 2LWIA 1I4LD 5IDQA 1J23A 1T0BA 2X1HA 2APJA 2OMKA 3H5WA 4BNNA 2FWIA 1Z2PX 1E79D 2FRXA 2MSKA 2PBZA 3L79A 3ELYA 4PICA 2INGX 2HM7A 1U0NA 3KJHA 4HX5A 2H1IA 5JDCC 3A1NA 4XB1A 2RE8A 2PR7A 2EHDA 2IYQA 4JP3A 4GS5A 4KX3A 4KCGA 3C8DA 4Z9AA 1B74A 1PZXA 3B3FA 2BGJA 2WIKA 3H1AA 4A0FA 2VYQA 5JQGA 4D74A 2OM2A 2ZIXB 4CM9D 3ICEA 1EZ1A 2EJBA 2Z1DA 5G1NA 3UUEA 1BU8A 1TKAA 2DCUA 4ENPA 4GLJA 4UMEA 3KVVA 2XWJI 1UFRA 5FP0A 4RJKA 5B4TA 3GGOA 1FRZA 1LLFA 4Q5IA 621PA 1AV7A 1J7KA 4MGEA 3L8DA 2JCSA 4OMFG 4DIMA 2Q49A 1OKKA 1FVOA 2P65A 2RGBA 1L5QA 3C14C 4HLNA 2PGNA 1Q6YA 1E6EA 1GAEO 2NLOA 4L6AA 1R0YA 2OY0A 5JJKA 1DFHA 5BN4A 4JXXA 3ZHTA 5ARDA 3DEHA 4MTCA 4DABA 4EL5A 2PPVA 3OZUA 4QC2A 3RJMA 2QTCA 2C4HA 3GLFB 1JHOA 2BZ0A 5IC5A 1RS0A 1E1LA 1GZ3A 4BX8A 1B42A 5KQGA 1T35A 5DISB 1J1ZA 2UVQA 2O52A 2O8EA 1IY9A 4BO7A 1E3TA 1KMQA 1CR6A 3ZY5A 3UC5A 2XZLA 1C8LA 1U7TA 1B8PA 1E5QA 3PPIA 1DRKA 3ROKA 3ABSB 3NXKA 4GT1A 3GNSA 5CURA 4NPCA 4MXDA 1TQDA 3UBMA 2C9DA 1CUSA 1CZNA 5IARA 4MVJA 2ET6A 1O89A 2V8OA 1TPZA 2GCNA 4X1KB 4NZPA 3UHOA 3UJBA 1QK3A 1AB5A 2HV9A 1OASA 1V8PA 2C1ZA 2ZK7A 4HDKB 4LHVA 2ZCUA 2HB6A 3K8YA 4KOAA 2SECE 4MVJG 4R2HA 5BMVA 1KI4A 1NF3A 1QVRA 1M1YB 4WLFA 4G0UA 4LXXA 2A3NA 3HCPA 2R8RA 1X0XA 2YWCA 3IOBA 1GQRA 4TKZA 2B92A 2GZAA 3LBIA 4C29A 2HJVA 3SPXA 1P0PA 2E2WA 4HDRA 1WUHS 4MW7A 1CSEE 3T8YA 2C7QA 1SVKA 1SBZA 1PFYA 3T9AA 5KKNB 1E9DA 3LHDA 3DZBA 1R4ZA 2OBMA 1RRPA 4MQ6A 3DZGA 2B3DA 1UMCA 5IW8A 1R9JA 3S5UA 3TM5A 1OFTA 4AZ0B 2ID8A 4JVMA 2X0FA 4OY3A 1JNYA 2POQX 2JJQA 3FWZA 3GFQA 5AVXA 1ZY2A 4PZDA 2QVCA 2PRKA 3PIRA 1FUUA 4O4LA 3SEQA 1EUYA 3WIBA 4B3RB 1TCCA 4H27A 3TN7A 2J3EA 1K8QA 4J0DA 4Q1EA 2MR6A 3DH0A 3TRHA 2VK4A 2ZIEA 3HSYA 3SGLA 3FUVA 3A4VA 2WQ7A 4U2BA 5C3UA 1ISHA 1EAMA 4C5CA 4D9IA 3ZJVA 4HFJA 1FU4A 4R6WA 3AJDA 1EQUA 1YF3A 4OGWA 1NOJA 2G1KA 3IAFA 4ONEA 5AKKA 3NT2A 1B15A 4JUFA 1AA9A 4H7IA 1Q57A 1Y8QB 4L0DA 2PWAA 4OQYA 3H6GA 1EVYA 1SB8A 3OHSX 2IV7A 3S1AB 5JLJA 2YX1A 1RQRA 2GZ1A 5DTIA 5HUHA 1V9SA 2B4RO 2B30A 1WDKA 1QXSA 3F0TA 4HXEB 2W2LD 2VNHA 3LCMA 3VKGA 5HRCA 1CUZA 1DIOB 1NW9B 1OXMA 2DY1A 3KELA 3M1AA 4M9XA 3WJ1A 4REQB 5LBUA 1ZQ1A 4HRXA 1OGIA 4QASA 1W30A 1YJ5A 4G0YA 2ZIFA 4NNOA 4EG0A 5CB6A 1LLQA 1BH6A 1Z74A 3V55A 4DG9A 3BHNA 2FW7A 2GK3A 5C1PA 3VNAA 3AVVA 1AQ6A 2C5LA 4BATA 2P9GA 1E3IA 1RRFA 2QU8A 4YRGA 3RS7A 4IYJA 5A71A 2DOKA 4Q1CA 2AG8A 1QBGA 1UMDA 4S1WA 4F5EA 1U94A 3PRJA 3L18A 3SXUA 5CITA 1UPFA 4RZUA 2CKDA 4J43A 2OBFA 1LRKA 1XRLA 1Y37A 3R5HA 1FNDA 4JH0A 2HLDD 4KIJA 5TLSA 2ODTX 4WKOA 4XVHA 5KAPA 4PO3X 5HS4A 2AN1A 3M9XA 1HEIA 3FROA 5J23A 1P74A 3QLJA 2LR0A 5EP3A 2ZUUA 3ZCUA 2JFBA 2NUPA 2YY5A 3R09A 3UV6A 4BLUA 4ZN6A 2C1XA 1LK5A 4GI3A 2NU8B 3DTVB 1IN7A 3ME5A 1LPSA 1HDXA 2XKJE 2R7AA 1YZQA 3E7XA 3BWVA 3HEBA 2ZJ4A 1KZ4A 3CEMA 3MC1A 4KRGA 3ISTA 3M4YA 1N57A 1SZDA 3G2OA 2B83A 3PFGA 3L07A 4PRKA 1WHSA 1C0PA 2RKWA 2ILVA 2QN9A 4JJAA 4JOQA 4KVFA 3BJMA 1FMTA 4ND8B 3GQVA 1TO6A 2R97A 3DXFA 3X43A 4G0VA 3O1LA 1C3JA 2C99A 3RFFA 3IA7A 4L5YA 3SHOA 4YAGA 4L1KA 1ZGJA 5KYYA 3HMKA 4PLCA 1B14A 3BHJA 1A98A 1KC3A 1MG5A 2R751 4NS4A 3ZS9A 1HV8A 1U7OA 2FW8A 4ZVKA 1VKOA 3SI7A 5HKKD 4IIJB 1GTMA 4J7CA 4ITVA 3HYSA 2QTHA 4J0IA 4PZLA 5G0TA 3SJAA 4HTFA 3CPHA 2HC9A 5FTKA 2UVPB 2QQ5A 2IQIA 4W6QA 4YJKA 1X94A 4EW6A 1OB5A 1E9SA 3MG9A 3SFTA 1YL7A 1S8OA 2TECE 2Q41A 2V7XA 3VPCA 5LMCA 4IHAA 5P21A 1FTSA 1RU3A 3K0KA 1NBEA 4IX9A 2DUNA 5EIXA 4WSOA 3PC3A 2II6A 4ANFA 5KNLA 4MW0A 4R9UC 4OXYA 4YYEA 3AKZA 1RQLA 1YE3A 2KM1A 3V1YA 2Q8QA 2IPAB 4TMYA 1FIUA 3CMCO 3AETA 4FHDA 4ALJA 5CA1A 6ABPA 2FZKA 1NURA 2I78A 2WMDA 3QELA 4G84A 2C4TA 5ICEA 5GM2A 4YRIA 4M6WA 5B6JA 5E1OA 1E1CA 2C4VA 3QYFA 4UMFA 3RRYA 1KMHB 1J1IA 2W6QA 3OD1A 1WCIB 3Q3CA 4K2AA 1L7OA 1QS0B 5FRDA 2GF2A 5FTMA 4N3CA 3WYAA 5H0IA 5JXHA 3MUNA 3BD8A 3EIHA 1WS6A 3PD1A 2QLTA 1PHPA 3HWRA 4HMPA 5EJFA 1BXRB 1QRTA 3KSDO 3K35A 3NWJA 5IRCD 5CB4A 3AEZA 5KTOA 3D6VA 5DM60 2NXEA 3L0PA 1BE0A 2OAGA 4QXPA 3VYVA 1ZA1A 4PFKA 1RACA 4QL3A 1UEJA 2VF8A 1YI1A 5I7UA 4Q3LA 5M04A 1GHTA 1E1YA 5SV2A 4AWXA 1G21E 1UJNA 2BW0A 4JUAA 4MTLA 5C1IA 2D5BA 4RMJA 3ZYZA 1IN4A 2GBFA 2WSYB 2C2YA 3C43A 1JBQA 3DWGA 3T7JA 2BGRA 3VNSA 1U2SA 3CCCA 4KXFB 1E3EA 1OHHD 1V8FA 1GAXA 1OIWA 2SBTA 3RFCA 1YIOA 3FCUB 4LNUA 4P58A 4HH1A 1MQSA 4X41A 1COZA 2CJWA 1VBMA 2WTXA 1IBSA 3DDCA 2JGIA 4LJ8A 3TSZA 1EEHA 1SD2A 1XYVA 2I4IA 2C8LA 3KX2A 4LSZA 4MI3A 4XW2A 3UENA 3ETNA 3T35A 1IEQA 5DULA 1Q1BA 2FYTA 4LY0A 4C6TB 4IR7A 1V26A 3RJTA 4B8ZA 3QU5A 2CDAA 4ESOA 3CGGA 1SBQA 3FTPA 1D8AA 3IO5A 5DBIA 3PHHA 4YP7A 2I7CA 5DWQA 4F60A 3N0WA 5CCBA 3JQPA 1KDOA 3L0CA 3TNFA 3ZWVA 3UGKA 3OA2A 2VSOA 4YAIA 5BPFA 4YALA 5K3CA 3NNSA 2PCJA 4ATNA 4GMKA 5C1BA 2BFMA 4IGKA 4MITA 3RHTA 2XXAB 2Q1WA 4IO0A 4M46A 1LF5A 3GLVA 3FYUC 3JRNA 3ZXUB 1CQXA 5A4IS 2IYWA 3HKCB 3PA6A 4LJRA 4PRZA 2JFZA 3WGMA 1VGRA 1Q6ZA 4YUZA 2P6RA 3ANTA 4QODA 4ZQCB 3O8LA 1QYWA 1JKXA 1OQAA 4HJXA 3REFA 3B38A 1XTJA 3FCEA 4DTIA 3QWFA 2BD0A 3IIEA 1MT0A 5BSGA 3GEGA 4DCPA 1GLGA 3FVRA 1A82A 3H16A 1N2HA 4I08A 2C5BA 1C7QA 5DHQA 3O94A 4FEAA 1SBHA 2BMDA 2WE7A 4AXXA 1WMFA 4WDQA 3WFJA 5LDHA 2ZI9A 4X61A 3FNEA 5BY2A 4WNAB 2AMFA 5G4KB 1MH1A 1I0ZA 3AI1A 1ZZGA 3LUCA 3AHIA 3VU1A 3C1AA 1GSHA 1SCDA 2FG6C 2XGOA 4QU9A 4MCJA 5IANA 3II6X 4EH1A 2WD7A 2PZBA 4LDQA 2XE6A 4KLRA 1JB1A 4RZXA 3AVWA 2ORIA 2OESA 1ODTC 3A8TA 2AV6A 2F9MA 3E9CA 1E7YA 3BCUA 4G24A 3EOAI 1YSCA 2I87A 1ADBA 2QYTA 2B82A 1LD3A 1WMBA 2KB0A 4II3A 3BTOA 1X1DA 2X2OA 1P72A 1VTKA 3PNMA 4RDIA 4UU8A 4IHJA 3ZKAA 4EHJA 4OP3A 4AJOA 2C9YA 2G5CA 3CXRA 2GEVA 3WL3A 4RANA 1N2CB 4F2PA 2FZ4A 4KXUA 2Y77A 1CG6A 1Z4IA 4C4TA 2NO5A 1LF0A 2FZVA 3E22A 2CLOB 3OT1A 3PUJA 1ZXBA 3RS4A 2BHLA 5CB4B 5IJ9B 6REQA 2A0UA 2IOFA 3H7AA 3DM5A 4HO1X 3B6ZA 3DVRX 1UJBA 1WKBA 1K3FA 1KNQA 2I62A 3MD0A 2FEPA 3NOVA 1KZ9A 2GPJA 1WQ4A 4G9BA 2O2DA 2W6IA 3RVNA 4QQFA 4HDMB 1X1BA 4ZTZB 1MX3A 3E1SA 3CLTC 1CDOA 3G0IA 4YN3A 1F8YA 4HYQA 4NVRA 3SC6A 3WI7A 5F35A 2LDBA 2XBLA 1CE8A 1K6MA 1R8YA 1VCNA 4KV9A 1P0MA 3KLNA 1MBZA 3A2LA 4DNPA 1HL7A 2CL6X 1NVAA 3CR8A 1HYHA 1D9XA 2ZBPA 4RORA 2Z09A 4E21A 5JCXA 2MDTA 3C41J 4MWDA 1TVCA 3NB0A 2LXNA 1N1EA 2CBZA 3OFJA 2FEXA 4J0JA 3UM9A 4L51A 1R0XA 5B3JC 4LNHA 5CVTA 1WV0A 4KAXA 1O94D 1SEPA 4YCAA 2D5LA 3AMVA 1XL0A 4INAA 1SCNE 3UV3A 1JG6A 3I6MA 3VTFA 5J4KA 2DR3A 2GYUA 4KHZA 1KI3A 2AVDA 2IUUA 1RIFA 1C7IA 1I1NA 1Z88A 3UJCA 1D2MA 3W3AA 2WJGA 4KLAA 4QOHA 4ER0A 3JALB 2GTHA 1US8A 2H4YA 2KQUA 4LJ9A 5HK8A 2GJSA 1ZD1A 1P33A 4OGLA 1VB3A 1C0LA 3A11A 3AR5A 2VQFB 3F97A 1GOTA 2Q9AA 4RKRA 3W6NA 1OLUB 1TT7A 3L7LA 1NSTA 4HX2A 4Q9KA 3STVA 1VOTA 3QKSA 1ZK4A 5LCXA 5DB4A 3OY2A 2EKQA 4YQZA 5AXCA 5ALMA 5EHGA 1TADA 2M9MA 1QRUA 3MS4A 1SUDA 1T1RA 2ZE8A 3E9MA 2NPFA 3I6BA 3ICVA 5D5PA 1KZGB 2A9KA 4JB8A 4JSYA 1V3VA 4CCYA 2XYVA 2X0NA 3EA4A 3FPSA 4WK6A 4B6QA 2YWRA 4FMBB 3KFVA 4TL7A 3MA0A 3TCKA 1BXKA 4CKBA 3HCBA 5EJAA 2YWBA 3L1JA 1XU7A 3NGMA 1AXRA 1P2BA 4LOAA 2FN7A 2CB9A 3TLEA 1LI5A 4I9FA 5L7TA 1Y89A 5CX4A 3A6HA 3DAGA 1FDOA 1YRYE 4QG3A 1MEEA 1R5BA 1QCCA 2DH6A 4V39A 2RGUA 3V1UA 3OQ1A 2CXOA 4JLOA 4P83A 4RIHA 2ZSEA 3BX1A 1JHMA 4KPUB 1XPJA 4U5XA 3WRYC 5B6IA 4HCJA 5U9CA 2E87A 4J6FA 4HLDA 5JO9A 1DKLA 1TC2A 3SEAA 1SXJC 3LECA 1VMEA 1FLDA 3B78A 4ND3A 1Z83A 3DMTA 4JBGA 3ZPXA 1EDBA 4FYPA 1GKLA 5KREA 1ZK1A 2R0QC 4INJA 1KF0A 2J0UB 2BFDB 1OBFO 1ZFNA 2RHBA 4X65B 4CVNA 1T3LA 4J9VA 3U80A 3K5PA 3IHKA 3KTFA 4PGMA 2IPXA 4OQMA 3OQJA 5CB8A 4JZYA 2QP4A 3SQOA 3WIVA 5L3SB 4TV9A 5LQSA 4DXHA 1Y0BA 3UJ9A 1TAHA 3BK2A 4LXIA 3MTAA 1KMHA 4MV5A 5KU1A 3AJEA 2XPCA 3HWX1 1LU9A 5KVQA 4BASA 5JH7F 5KMGA 3OE4A 1SY7A 4KO1S 1N36B 4I6GA 1EWQA 3LCJA 2KSQA 4C14A 1JKMA 1FFSA 2PGOA 3JRWA 1ZJZA 2QN1A 5K0LA 1QYRA 4D9FA 1E2UA 4A7PA 4E11A 2BKLA 2YH2A 3JARB 1E4EB 1Z4PX 4PINA 4PCAA 2OHXA 2JS7A 1GYRA 3LW7A 4PONA 3WBKA 3F6EX 1CY1A 4J9UE 4R4JA 4RD6A 3GUHA 4ALNA 3I34X 2YNMD 2H8GA 3QYAA 4P54A 1XX6A 2VH5R 4MPPA 5EL0A 3PWSA 3AI7A 1Y5NA 4JLUA 3WYGA 3OO0A 1BMQA 3WIUA 1TEVA 5C37A 2H57A 3HXLA 4B9AA 3QPDA 1T91A 2W22A 3L8GA 4GX5A 3LHKA 1UC4B 4MVCA 3B53X 4OB7A 4XKJA 4X7BA 5K4AA 4H15A 5ED0A 1FMFA 2OXIA 4QOJA 2QM8A 1W35A 3SMVA 4JV5B 3TZLA 2VTDA 2BWJA 2QM0A 1KFKB 2X8BA 2WF7A 1V1MB 4JEUA 1DCKA 2HRDA 1DB3A 1JLHA 3LC0A 3P2MA 1H3EA 3C3JA 4F8EA 3C45A 3EMDA 2GAAA 5HM6A 1EE1A 1TB4A 4QBTA 1PWEA 1U28A 5YASA 3EX7C 2GETA 3D6JA 1Q44A 1P3JA 4KMRA 1ZMBA 3R5FA 4UBOA 5KO2A 4KGDA 1G7CA 1LPAB 2X5JO 4IJWA 4Q9IA 2F4VB 1N6NA 3D8TA 3RFTA 2HKIA 1I3LA 1X3SA 3GLTA 2EV9A 2HCJB 2GYYA 3B1FA 3H4VA 5AW7A 4DR1B 5TQ0A 1F12A 3PJFA 2FOLA 3A31A 2H06A 3BG5A 2DH5A 2WUGA 3DAFA 2QD2A 3QYPA 4MV8A 1XOIA 5FEMA 3VFDA 4FZVA 2X5NA 4YMVA 2TSYB 3UCFA 5IFLA 2IHJA 2AUMA 2VSYA 3ZHBA 2JPDA 3MJRA 5IC6A 3OPXA 2IZ1A 3KZMA 3ZGZA 3GEEA 1JHRA 5BUSA 5JNUA 2BGIA 4Z4HA 3ZHSA 4PCLA 1AZSC 1L4BA 1KMNA 3I9V1 2VXOA 3L77A 2JC3A 5FOSA 3DDOA 3WGVA 3JQGB 3LWZA 4FSXA 4FI3F 2QGZA 2OECA 3O8NA 4BTVA 1XZFA 1UOOA 1YDFA 4ZZ1A 1PSDA 5C7IO 2XB9A 1U0BB 2UXCB 1L8XA 3ZXIA 1Y82A 1RJDA 1LVGA 5JCOA 2D0OB 2FVYA 2GZ2A 4O3FA 4TMXA 4NS1A 3A4NA 5F76A 2BFBA 3VZCA 3UPTA 3PR2B 1OOEA 2COKA 5EJIA 1UFVA 2QXTA 1TKRA 1EGQA 2ADFA 3TMKA 4RKEA 3OKAA 1V5WA 4HXFB 3PFKA 3HLKA 5EUCA 4DQVA 4ZYTA 4AZ3A 4PZAA 4ZP1A 1SVWA 5DCYA 1IMJA 3GOQA 3CUKA 4M98A 1DV1A 1CBUA 4YECA 4UXJA 4C9BA 4XPIB 4ZD6A 4JAVC 3NHAA 4PYRA 3SIWA 4NU8X 4WBSA 4BAZA 5F5NA 1VCHA 1WMEA 4LXHA 4U5QA 5DN6A 1NMXA 3A7DA 1J8VA 4X20B 3ZHCA 2CJXA 4MS3A 3JQBC 3Q0IA 2RARA 5HFAA 4MUIA 4OGKA 3D1LA 4HQRA 4CM8A 5BW4A 3KZNA 2ZS8A 5EWMA 1J7JA 3MTBA 1TKBA 1WHTA 1DIGA 1MP0A 3BPSA 3DCJA 1PG5A 1V7CA 4LHYA 4G0MA 4CF7A 4WLUA 1IK6A 1T9KA 1XTBA 3AZPA 1X38A 2WJZB 4U6QA 2NUTB 3O1IC 2H3HA 3VVBA 1J07A 1II8B 3W1VA 1SUBA 2H1HA 3L7MA 1C3OB 4GMHA 4NFSA 5DK6A 1MB9A 1LFAA 5DGXA 3IAAA 4NBSA 3HDHA 1R10A 1P18A 1UZLA 2WWVD 4AT1A 2NO0A 5BSHA 5L3QB 2BCGY 2XYPA 4HNVA 2IE8A 1NRJB 3WRWA 1Z16A 3P8ZA 4IP0A 4XIYA 2CBXA 3SSOA 3T1OA 3GDHA 3PYXA 5TEVA 3RT9A 1YWGO 5JD6A 1KEPA 2Q45A 3HLYA 5THXA 1GU1A 4XDGA 2ZSBA 3TL3A 1V1RA 3QVTA 5BR7A 2X8LA 4RZHA 3K09A 1EB9A 2HBRA 4XVRA 5JQGF 1W5AA 4IFTA 2AJLI 1IJBA 2HA7A 1NYRA 3DL4A 3TEFA 3C4JA 3LTEA 4UFPA 1AGRA 5CGZA 2IUTA 1JEYB 1WBDA 1J20A 1ESDA 1H2ZA 2GM3A 4RH3A 3D8BA 4WZBB 3NHYA 1TVKA 5B1HA 5U4XA 2Z6QA 3ILXA 1ES9A 1ZNXA 4KE7A 2C5EA 3PHIA 2QV0A 4PNEA 2ZYGA 3D4LA 3NVDA 2JFNA 1NVMB 1YS2X 1Z4JA 2WZCA 4L22A 1UBUS 3NDPA 4KH0A 3GAFA 4UBJA 3ENKA 2F9FA 1GNLA 1L5FA 3AI2A 3S2SA 3TKLA 3AXTA 3N8HA 3T7IA 3GJXC 2BY4A 2JGDA 4ZYLA 1L7PA 2VBGA 2Y1LA 3BIWA 4MUAA 2WF8A 4AVYA 4DUYB 1O0SA 1LQ2A 2M32A 4G9GA 5IJZA 5BVGB 2XDQB 1G4HA 1DXYA 1O5OA 4WLNA 3AEKA 1E7RA 4MMYB 1ZWLA 4U7HA 4KKXB 4QEZA 5ILQA 2XCRB 4QGFA 2W6CX 1ESEA 4JI1B 4V0SA 1T8UA 1AKNA 1O0BA 3DV9A 2R1TB 2Q5LA 2MSLA 1QB8A 1VRCA 3EQ2A 1YV9A 4X7RA 4O29A 4DLAA 2D74A 4EYKA 5KTNA 1BJTA 2BHSA 2JLWA 1F4LA 1GZHB 2FZ5A 2EKBA 3QUBA 4KDFA 1HO3A 2Y1OA 4IJVA 1RYMA 3EF3A 4M1EA 4LFAB 5I3CA 1PAUA 1VJRA 1S1CA 3OOJA 4Y30A 1DKNA 1GN8A 4O33A 1NR5A 4ZAFA 3TMYA 4WPGA 2ENWA 3THYB 1KMMA 1G5QA 2QL7A 2PSJA 2BM8A 1F06A 4A8JC 5J4VA 2C83A 3I12A 5T4BA 4EO9A 4AUNA 3ZK7A 1KDTA 2WP8J 2A0YA 3GP3A 3RSHA 3S7TA 5FWXB 3QPAA 3NM6B 1EFRA 2VTVA 2W11A 4TWZA 4GBJA 3T1TA 4I3FA 3PFFA 5AJVB 1ONPA 2VA9A 3R0ZA 4TLAA 4D4JA 3LPNA 1DIAA 1SVIA 4YRNA 4NPAA 1KR5A 1TF2A 1U0TA 1SULA 1LC0A 4JI5B 3N2YA 1S7CA 2FQ1A 1F8FA 3LJKA 2PGDA 3Q3JB 5C8XA 2HJGA 4GBGA 4WN9A 1XVLA 2P8JA 3QVSA 4L07A 4URFA 2Y0EA 2D2FA 4RVFA 3VPHA 2XZTA 4I6EA 3WB2A 1M2VA 1YU9A 2NVOA 2VDLB 3K15A 4RK5A 2DBQA 3W78A 4US2R 2WJJA 1XRPA 3O84A 3QI7A 3VNUA 3G7SA 2HT1A 1QK4A 5AVJA 3AG5A 1BGVA 1KGSA 2R7KA 1NUTA 1PV1A 3GAZA 2J0VA 2OAEA 1SRRA 1NBMD 4CMAA 3F4BA 1IZ0A 2PCLA 3B9PA 3V1MA 1A27A 4Y7DA 1MN6A 3GBVA 2G1JA 3O8BA 5I8PA 3NIWA 2ZBRA 2ZB8A 4KBFA 3RBXA 2P68A 2VRCA 3A2MA 4L4UA 4I46A 1UKEA 4AURA 3FCYA 3FMIA 4FXPA 5CUQA 5HM8A 3BTUA 4YQFA 1EXWA 4OJMX 2IUSA 4DCOA 5KMGB 1PJQA 5BW5A 3DP7A 2NZYA 1T5SA 2DFPA 4QUHA 2FHPA 4KR0A 2GDZA 3IBCA 3BE5A 4YJ2F 2IV2X 3JYLA 2YFQA 4QWWA 4P0TA 1F3OA 4QHYA 5ADWA 5KQMA 2RK4A 1QMGA 5KKAA 2Q7OE 4E32A 4YAKA 5ERYA 1DC5A 2GCPA 3H1GA 4IY1A 4AYTA 2PAFA 3IKLA 4BGVA 3NRJA 3SAJA 1TU3A 4WZ6A 2BISA 4E1AA 4RHCA 1K98A 1ZIDA 2XNKA 4DMHA 5CFZA 1E2HA 3E7WA 4DMLA 2CB0A 2Y4NA 1MAWA 3FZEA 4O2RA 1QBKC 4B6EA 3H7IA 3EUFA 3KO8A 4H1UA 5HGJA 5LZ5A 4ZMBA 1F1JA 4FFLA 3CCFA 2NQ2C 3M49A 4ZT4A 1IBKB 1NW3A 3OEYA 1KSHA 4RIGA 3HZOA 5K8UA 3Q3VA 4GQAA 4IGEA 4MVWA 1SC4A 4G1EB 2V97A 1E1QD 2VSNA 2MINA 3LLVA 1RTKA 1NXOA 1YZNA 2N47A 3OJEA 4D3YA 3DFMA 1YB4A 4Q9HA 3PKIA 1WAMA 3IOEA 5E3JA 4C30A 2DYKA 2ZITA 4MEAA 1QE3A 4IQFA 3FB1A 5IDWA 3CEAA 3IT2A 4G8DA 3NBAA 1ENPA 2WM9B 2VAWA 3UT6A 2P69A 1T6XA 4MW9A 5ALVA 4UUMA 5ELMA 3ZOKA 5EQDA 2F9LA 3OURA 4CQMD 1NVWQ 4PSAA 3DYIA 1Q92A 2JJ1A 3KJGA 1Y6JA 4OL0A 2OTCA 1FFWA 1P3DA 4YRRA 1XPRA 2WD7B 3L1VA 3LA6A 1FDTA 5KYWA 1Z6GA 4ERXA 4A2WA 3RSFA 3IERA 4QDXA 4X24A 1UDRA 1X7DA 2CBGA 4QRDA 1ADGA 1IEVA 2R1VA 1ML4A 1QRRA 3DQPA 4YBRA 4DMFA 4N5IX 1ZLYA 2EOAA 4ER5A 1UM9B 3LU1A 4QQRA 4TM7A 2XEXA 1TFRA 4NOJA 1E58A 3KUUA 4H1VA 4X8OA 1UWLA 4RV4A 2PZMA 5EKTA 4LJ6A 1E2NA 1PLLA 1ORHA 2B0CA 1XTKA 2A0WA 3R6WA 1Q7EA 4X85A 5DIZA 1LXCA 5DNDA 4QPJC 9LDTA 1USVA 1K8RA 1OWNA 1PLJA 1SWVA 2HSWA 3QEMA 4LKRA 4QU0A 3JR3A 2UVDA 3PC7A 3TOSA 4YAUA 1D4OA 1PGOA 3D3QA 4F1KA 5JAOA 1ULZA 1DKRA 3MUOA 4XYEA 1TK3A 1G66A 2OFFA 4MHOA 2YRWA 3D2LA 3G6KA 3SS9X 5A5DA 4DV7B 3EHEA 4BVEA 1B7GO 1NYQA 3OFVA 4LGMA 5FX2A 5LD2B 1FU7A 5CLIA 4RGBA 4R69A 5AHRA 1LZLA 3M6AA 4UNNA 4EENA 2JCBA 4PGGA 4ESHA 5LOVF 4DV6B 5HG0A 1XDBA 3QY9A 3F5QA 2QPTA 2YTZA 3CG0A 3AC0A 1OROA 3DM9B 2X1LA 3ZW9A 4EARA 2R5NA 4Q4CA 4RCZA 1GCGA 1FB5A 5B36A 1CY4A 3CSDA 3HBJA 3K73O 4C0AC 5IASA 4YJ2A 2FTKE 2RKBA 4JJ6A 1T2CA 2W70A 3VR6H 3GMDA 4OGGA 1QZTA 1PYDA 4X54A 4FUTA 3ZDQA 1OFUX 1SXGA 4I1SA 2AN4A 3TLAA 5KVAA 3VBEA 1QFZA 2CFCA 2PV7A 1NI5A 3JQCA 2CK3D 1XJQA 2QX7A 3MW8A 1KJNA 1M1NA 4XGNA 3EZ9A 1ABBA 4TL6A 5IM4A 5TMPA 2J32A 1NXSA 4GOJA 3VR5H 4DL9A 3AR2A 4B4DA 2C0PA 3IUBA 1NF2A 1IUKA 1DU4A 2WAMA 4C0HA 1NVVR 2GBCA 3UMCA 3E8SA 5DRTA 1P6UA 2IDZA 5HF9A 1NN3A 2OK8A 2FA9A 4LDRA 4C0SA 1UPXA 4QGAA 1IFXA 4HK4A 5HS6A 3RYHA 4BO4A 5LZ2A 4D97A 5HZKA 1CZOA 4A6DA 1H6CA 2WUVA 1UKYA 4ZO9A 5G2OA 3UMBA 4GVPA 1NLFA 1A9TA 1YJBA 2YXBA 3LLSA 4EX7A 4CEIB 2VP9A 1JKFA 1YKSA 2B69A 5LZ8A 1NRXA 3UHJA 4F6RA 7MHTA 1Y6RA 3U62A 4DKJA 5ALKA 1JF8A 3OETA 3TJRA 3IVXA 1RVV1 3AFMA 3M5CA 2C7BA 4LYGA 2W6JA 3NUQA 2IYPA 3E7DA 4WD3A 4IXNA 5H81A 4CLEA 3L6OO 2FZWA 5B2EA 1NMYA 3HBLA 1TLTA 3IURA 3V8QA 4DWOA 1L8QA 5K0CA 1LPPA 3PX7A 1U9IC 4IDBA 4OHKA 3QFRA 4TQAA 1BRMA 5E95A 5BSEA 4WFIA 2AJBA 3L0SA 2VNIA 4KFSA 1NY6A 4ASUD 3C5VA 2VDKB 4OXQA 5FYQA 2R7NA 5LP6B 3SNKA 1KTVA 1ISMA 1SXIA 1Z18A 4A92A 1TU4A 4FFBB 2FXIA 1YZFA 1MO6A 4PSUA 4WVLA 3W8FA 5H82A 5ISMA 1ZKMA 4G0OA 4H7FA 3K0AA 1OYVA 2OZLA 4KXNA 3ZNPA 2EL9A 3MT9A 4RGVA 5PGMA 4A73A 5B57C 4HVTA 3QTBA 1U98A 4UUNA 4ZKEA 1AOXA 1L9KA 1R4MB 2NU9A 3RBVA 1ACJA 2MIIA 3FW1A 1B00A 3BUSA 3L8CA 4R31A 5E6SB 5H68A 2HDWA 3AUFA 4CI9A 2HLHA 4CV0A 5A7HA 2AZXA 2PX0A 4JS0A 2QV7A 2VHXA 4I2VA 4WMLA 3MCWA 4P4GA 4B34A 5JXWA 2MSNA 3WICA 2IS4A 1ATIA 3VR6D 2GLXA 3OCVA 4D4HA 4ZVOA 5D3ZA 4F3YA 3ORYA 3AW8A 2XCIA 3V7WA 4PTLA 3KAKA 1KJJA 2ESRA 3PFIA 3OC6A 2O8FB 3B1KA 3S2FA 1UMCB 1ZN2A 2OCBA 5JFOA 1ESMA 3KEMA 2YY7A 5G3YA 4P92A 3ZJUA 1RWBA 2O3TA 3R44A 4PO9A 1YDGA 4KBGA 1JSXA 1UOPA 1GKKA 1YE8A 3LQFA 4RMGA 5KYXA 3WO0A 4LVNA 8ATCA 4AO7A 4ARSA 3FPBA 4PC3A 3BDAA 3HZHA 4RH1A 4JCCA 4TRNA 2EJCA 4IEIA 4B84A 3ZVLA 4LX0A 5KAMA 1G7RA 4TRRA 2IYVA 3K4HA 1DSSG 1FP2A 2J9FB 3OJFA 2C9MA 4URZR 2H2AA 1MB2A 4G4SO 1FXWA 4J90A 4QNRA 1J8MF 4ARUA 4BVJA 1XXLA 1NW4A 2GTPA 4HUQA 4F3CA 3S1AA 1X7GA 4GRAA 2F8SA 1JR3D 1AKTA 1K06A 3OJLA 4JEHA 4L76A 1KERA 3U4IA 3ABIA 1N5RA 1VGQA 3DE7X 2G76A 3SHQA 4WOBA 5AUNB 2FHSA 2JFPA 4U7PB 3J80A 3MK31 4KHPB 2D3WA 4KLCA 4GR9A 3G7NA 4O08A 5LXTB 1EE9A 4LZOA 4N8DA 4QIHA 4MR8A 3X1YA 2VSFA 3A9TA 3GDGA 5AI6A 2B1IA 4BNDB 4MMXB 3C39A 1FLNA 3T6KA 2ODQA 5BMOA 3UJNA 4UM5A 4GZLA 1LNQA 2ADMA 3OKCA 2ZTHA 1QH0A 1YCGA 1TJNA 2ZIAA 3FX2A 4RY8A 3CISA 4NKRA 2QRUA 2HRBA 4OEHA 5H02A 4DPLA 5KNCA 5L7WA 4FQ5A 1FQKA 3M34A 4KIFA 3RRBA 5TT0A 3X1KA 2WWWA 3EBOA 4EA7A 2A5DA 1EK0A 1PDOA 1W6UA 3IYLW 4CKZA 3T34A 3WWDA 1MQ8B 3ZK9A 5LLDA 4ZKDA 1TIPA 3SG0A 1G16A 2QYOA 1Q1EA 2XOXA 3DEIA 3DGEC 2AJDA 2H2DA 2UVPA 5CDTA 4YPOA 2DSTA 2PJUA 3PIDA 4IF4A 4E03A 4EY3A 1E5TA 3D7RA 5C5CA 1B6GA 4MINA 3W6UA 4DSUA 1C9EA 2JZOA 3QELB 2Y1DA 4YBZA 2J41A 2FFQA 4TMTA 3AO0B 2CLIB 1FY2A 3HBFA 3TR6A 3ZY4A 4CQJA 1CRPA 3KOYA 3I9LA 2Q7DA 4NYMR 1U7PA 3L1HA 1ORRA 3KD2A 3PX3A 3LG2A 4E4YA 2F43A 4XFDA 4XM1A 1H8ED 1TMGE 1T13A 3UAWA 4RS4A 3W2EA 4CI0B 1W47A 5FB3A 5JJCA 3PEEA 5FUQA 1M2OB 5CFLA 3NWPA 1IAQA 4D92A 1GY8A 1YGPA 3ZU5A 1E2KA 5I7FA 1TZ2A 3TG2A 2QZPA 3CVOA 2JFVA 1SVOA 2EJTA 2HRCA 1WHSB 2YDXA 3QPBA 4HDNA 2VP3A 2QBYA 2P3QA 2RGGA 3R5JA 4R7TA 5DT2A 3OEHD 1PFWA 4OJNA 2QRZA 3EFOA 3WK7A 3ZX4A 2VYVA 2H0QA 4P8RA 3EASA 2HZBA 4UHDA 2I9PA 2EP7A 2O0MA 2CCGA 2V7WA 2VPYA 1SD5A 2GT1A 1IWPB 2XADA 2BZ1A 2YASA 2D8AA 3DMYA 3LNCA 4P82A 5L4LA 5F5XA 3PT9A 3G2PA 2JIZA 2W48A 2Z2XA 4CF6A 2J9RA 3EGEA 4OMUA 3RIXA 1I5RA 4YUAA 5KS2A 2ETXA 4TV8F 1QGAA 3RVDA 5JTTA 3BD6A 1KA9H 1S89A 4LQCA 5CT9A 1DAGA 1TQHA 1M1XB 2R8XA 3DMDA 3ER6A 4HOYA 3WQQA 3IJEB 4B3CA 4BLQA 2ZRHA 3AIMA 4RIFA 4MROA 1RBQA 4DCJA 3I6IA 4M87A 5ICMA 3H2IA 4EI7A 4B7XA 1EBUA 1DQNA 1KP2A 1QH1B 1TUBA 1ZWKA 4EGFA 3IAUA 3KWLA 2RK3A 2Z08A 1Y9JA 1DG9A 1QHGA 4NBWA 2ZYSA 1E1KA 1P7CA 5G3ZA 2ONKA 4UW9A 3WK9A 3MT8A 1DELA 1F5SA 2FX2A 1ZD9A 5C53B 2B2NA 3Q6IA 1SUSA 2F1OA 3T52A 5BURA 1MW9X 2BMWA 3R3SA 1FTYA 2GPNA 3CTMA 4YLGA 4RSHA 5AW6A 5JZ9A 4AY5A 5K0SA 5BT8A 3DBHA 4JI0B 4QEKA 3IIIA 1QG2A 5B5SA 3ZDRA 2ZJ6A 3NW9A 4FGLA 4K46A 1WVIA 1KYWA 3R20A 3VHRA 3WDKA 4HVAA 4XX1A 5ILOA 1JFSA 2VYVD 5E3IA 1WU7A 3WL5A 5I51A 4KMOA 4Z8XA 4PIVA 1JQEA 3N70A 4JLSA 5IBRA 4DARA 3EXIB 4L50A 3UVEA 5L40A 3WLQA 1WZ2A 2W8ZA 1WIWA 4CIBA 3RTCA 3LYUA 4KSYA 5FOXA 4G4JA 1T2AA 1DAOA 2NYVA 2WT9A 4UTZA 1C41A 1QFYA 5BWLA 1RR6A 2AUNA 4KBYA 3ZWKA 2XZOA 5EXDA 4TTJA 1E0KA 1WDTA 2OP1A 5KNDA 2HMSA 5ENZA 2VHVA 3ILSA 1Q3HA 3FDJA 3T7EA 1GXSB 4Y6LA 4KXWA 4M54A 1XQWA 2AOWA 3KYCB 4Q19A 3CG4A 5GP1A 2GZSA 2Y1XA 3V1LA 4B31A 5LQCA 2R66A 3KT6A 4EYEA 1N2CE 1REQA 3NZEA 4PZCA 1B8VA 5F2OA 2ZRPA 3M82A 5F23A 2IYTA 3VC3A 4H1HA 3UUWA 1X7HA 4BRWA 3OA0A 2IUEA 4CMEC 1TM4E 5G4LA 1M2WA 5K6RA 4MQ4A 2B1QA 3TIIA 4OIMA 1OWPA 5DM2A 2VDOB 1SIWA 2GH1A 3NNNA 4LCBA 1ONNA 1IYZA 4DB4A 4XUGB 2ACWA 3RH0A 5LMUB 3K7EA 3SJCA 4MKGA 2AK2A 1OFGA 3W2FA 1JG2A 1XZLA 1SEVA 1NUAA 1UANA 1O58A 2DJIA 4REMA 5JC8A 1OA1A 2WU1A 1MPTA 1M8JA 1X1AA 1VG8A 1KBQA 4YK7A 1YS7A 4YCSA 3BWBA 1E7MA 3N2LA 3PQ5A 1PS8A 2QYHA 2FW9A 3WWZA 1N1GA 3I4CA 4FNGA 3FNBA 4AJ9A 1Q0UA 1Y4AE 2QJWA 3I6QA 3AUKA 3QUTA 4BFTA 1M34A 2I34A 1HXHA 2J46A 1YHYA 1WSBA 3LCUA 4IXMA 2BFCB 5K3SA 1Q0LA 4ZMSA 3BAFA 2CW5A 4A6EA 5HOEA 1T1EA 1BWQA 8GPBA 4N01A 1WE2A 3UIEA 3RVJA 1HH4A 3CNLA 2R4TA 3U48A 4HNTA 4I50B 1JHYA 4KQCA 1II9A 1JVNA 1MD9A 2NO1A 4OHWA 1ADFA 2JI4A 4OQDA 4YJHB 1F2VA 1NKTA 1R88A 3KSRA 3WZMA 1Q17A 5FWXA 5IF9A 3EGVA 4AKEA 3D3WB 4C87A 1ZX1A 2PG3A 3TCXB 4NF2A 4WZAE 3TLYA 1DT5A 1QOQB 4YP1A 4BB0A 3IUQA 1TTQB 4TXHA 1NM5A 3JRXA 5E3HA 3NV7A 1VBKA 3EXHB 4ZCQA 2ATXA 4ZVSA 2WG2A 4M9SA 1EP1B 4RKQA 5JDIC 2Q0HA 4TYQA 1U1CA 2HMAA 5J63A 1P77A 1CRLA 2AC7A 4OHCA 2GFIA 1O6GA 3VR1A 4AG5A 3ND9A 2VHJA 4HQFA 1YMUA 1ELOA 1DWQA 1P1BA 1PL7A 5KNBD 1J0AA 1E3WA 4Q21A 3STUA 1S3FA 3PFCA 1V16A 1IOZA 3JSAA 4NR0A 4Q9NA 4KOEC 3A6GA 3EZ2A 4DYHA 1ZONA 4RPIA 2HCRA 4DR5B 1MJNA 1R12A 5C4IA 4M37A 4P80A 4PE5B 2P2SA 4XAQA 3UMRA 1OPRA 4M8SA 1M8FA 4UM9B 2PUFA 5DP1A 4HNRA 3S2GA 4YDRA 1FSPA 1O57A 1A2OA 4YCDA 1R37A 3IV9A 2CC2A 3JASB 5JH7B 2VF7A 3SR4A 4FMDF 4BCCA 5EMNA 4F8JA 4RVGA 3W2TA 3WSWA 1Y4UA 1JLRA 1ODIA 3QQ5A 3QE0A 4E13A 4H77A 4RDHA 5K8VA 1SPBS 2X9VA 4GX0A 4HZUA 4KJZA 3SX0A 3GRYA 4QQNA 3V9PA 2KYRA 3TBKA 3DCNA 3PWTA 4EZIA 2NSDA 3AR8A 4DMUB 2XNDA 1W46A 4BO6A 4ZO4A 4OVKA 1P75A 4RF5A 2AKYA 2OHGA 4B0PA 1KDRA 4JBLA 2CNDA 4WFKA 1YR1A 1HWYA 3B6EA 3H1BA 2VA8A 4MUHA 4DHWA 1Z6PA 3OJ0A 4C06A 1KQFA 1W75A 1GTRA 4OATA 5KOIA 4IX1A 5CCXA 4E3WA 3IBFA 5FL7A 1W59A 2ZI7A 1SQFA 4UEKA 2Z8YM 2VBIA 3S0JA 1U3UA 5DW0A 2JJ8A 3U7GA 4B6PA 1L7NA 2X2FA 1LJ8A 4HB4A 3KB1A 2QTVB 3W8NA 4HDKA 4MI9A 4QGGA 4DNFA 1OLSB 4EY6A 4OI1A 3BMCB 5MGBA 2EGHA 1T8RA 3K9LA 2VH2A 3KYDA 5DMHA 3QXSA 5HF8A 3IVMA 3PUYA 4H7DA 3FDXA 4XGIA 4DBLC 1E4EA 3LBHA 3P9NA 3PS9A 4J29A 2X76A 4RQBA 3X1MA 2GARA 1GARA 3VH1A 3FMVA 2UKDA 3L0IB 4U2FA 3R0QA 1KOFA 4ECAA 3KTAA 2GM4A 2LV8A 4E2WA 4HR7A 3S29A 3GFOA 1J70A 3LDFA 2CK3A 1L0BA 1RYYA 2OILA 1RYDA 3IKVA 3LUDA 2QP9X 2VG8A 4MCAA 3B3QA 4BV2A 3JARA 4UAUA 3TECE 3DE6X 5DM1A 1FS6A 4HJRA 4ZAYA 4B48A 4G8CA 1ZN9A 3WL6A 2I3AA 2WTNA 2P2GA 3DP9A 1OV4A 5B1DA 5CBKA 4UD2A 1E3DA 3MXTA 4EATA 1GGKA 3LBFA 1X7XB 1F14A 1V7PC 4WUVA 4I8IA 1Z15A 4QLAA 1B6SA 3TLXA 5K4GA 3F2VA 3NJRA 3GMIA 1J56A 3D6HA 3MCTA 4JLVA 2ZU6A 3R7BA 4LV8B 4CN9A 5J2TB 4BMYA 1KZYC 5ENVA 4OSOA 2PQMA 5HZHA 5JOQA 4TQ9A 3E0QA 2IOFK 1F38A 3AWIA 3H19A 5IYZB 4N48A 3DV0A 4JHLA 3CF2A 3TLBA 3I5AA 5WRFA 3ROQA 4M49A 1JZTA 1RI5A 4TMKA 2WV7A 5A3VA 4ZU6X 2Y8EA 5J2UA 5AHWA 3H75A 4RMNA 1CDEA 1K7XB 2F55A 1QAMA 4UAJA 3H9BA 4A5SA 2WHQA 4GM0A 5LP6F 3KUCA 1MX5A 2ZDGA 1VSUA 2W71A 4UBIA 2VRBA 3JQ8B 4BQFA 3RK1A 4CTMA 1XC7A 2AA3A 3S8YA 3V4LA 1EM6A 1PNRA 1LDNA 2R44A 3ZVNA 3S28A 1PX2A 1J33A 1ZGCA 3E4CA 5FBQB 5IKOA 1J0EA 4TYYA 5B3LA 5EOVA 4C07A 1I1HA 4M36A 1KYIA 1X70A 5AVRA 1RADA 1Z7WA 2LRHA 1JPJA 1MJHA 1KI9A 1QGUA 1MX9A 3CWZA 3HCNA 4UE2A 4Z0TA 5NULA 3RUCA 3P26A 4PF1A 3UAOA 1XEWX 1U1GA 2YCLA 4LVOA 2Z3VA 3KHTA 4Y9DA 3TI7A 2E1PA 2FSGA 4DR2B 1VLZA 3KZKA 5ALTA 1ZGGA 4DIUA 2WJPA 1QP7A 3NHZA 2AOXA 3UXYA 2OUIA 3N5CA 4CCAA 1IOVA 4AUMA 4IUDS 5ALRA 4V2UA 1UWVA 2ZLBA 5L3ZA 1MJGA 2Z30A 4M88A 1V47A 2ZBUA 5A4MS 4J1TC 1G21A 5CD9A 4UDYX 2AD5A 1VE1A 3LL4A 1RLIA 1WXWA 3PGKA 4IDGA 5DM0A 3BRCA 4ACAA 5BV0A 3CWQA 3T5DA 3H83A 4KKVA 3GI1A 4L0CA 4K2HA 1EXVA 4KFUA 1MABA 4PYIA 4X1OA 3TQOA 4X6LA 1JHPA 1U63A 2CKMA 1UBLS 3BDVA 2DT5A 3DKVA 1CR1A 2ZTVA 3WP1B 3EQ6A 3LIPA 4ZQIA 1TVMA 1X77A 2H85A 5FQNA 5GQSA 4XWTA 5ITZB 4JI4B 3AP3A 1H85A 4I6JA 1W85A 2D2EA 4CR7A 1V2HE 1WU8A 1TLLA 4RACA 4XRRA 1N92A 3CR7A 1UEIA 2J07A 3U7FB 1GTVA 3K96A 5LKRA 1X9IA 2B1JA 1WA5A 4V0OA 1H0SA 3MRTA 1IDOA 3U1VA 5KYGA 1JQAA 2E4VA 1EFHA 2VWPA 3R7WB 1JRLA 4Z9FA 1UEXC 1A3CA 2HLDA 1W581 4ZO8A 4ZVRA 3LRTA 4KLNA 821PA 2AYXA 3PQ3A 3OIGA 3H2YA 4CMHA 4CW7A 4E31A 3GJYA 3VU3A 1Z28A 4ZT2A 3ZDXB 5LZ9A 2EFDB 3OU7A 1GAQA 5ADUS 1XD2B 4FJ1A 3WBJA 3S81A 4DFDA 1OZ0A 3DHEA 3FCSB 3H2GA 3RREA 3U61B 2FJUA 4D96A 1M2EA 4E5VA 1PLKA 1Z06A 4TTVA 1L7QA 3IKJA 3FTEA 1S9DA 3ZE8A 2AHRA 3GLIA 1HDYA 4QA9A 4AD8A 3TRKA 1YGYA 4M3NA 2X15A 3I6ZA 3GGSA 1R4MA 1WLYA 2PGIA 3DOCA 5ESRA 2CUNA 5K0EA 2VPXA 3D0RA 2JG3A 9MHTA 3AERA 1MO5A 1VI5A 3S2ZA 3L6RA 3AM5A 3A27A 2WM3A 4DJ5X 3VTKA 3G1UA 4ZHQF 1EK6A 4UC0A 2NPOA 2K5UA 1Z8HA 2FN3A 3C6KA 2DQSA 3DBVO 4NX2A 2E4AA 1QQAA 4BWGA 4TKUA 3FDZA 1DXHA 2NZ8A 4ZEOA 1V8OA 2QPLA 4Z9XA 4HH3C 5JYEA 2BEVA 4RLQA 5KOYA 2MU1A 1P4SA 2OHOA 4JI6B 2AQHA 3EGDA 2DY0A 4LYDA 1JV2B 2EQAA 4Z54A 2I1VB 2CNLA 2OHFA 3LKZA 3OSZA 4E51A 2C61A 2J30A 2VJNA 4LXYA 3W06A 2HMWA 4EI8A 1DXOA 1L7RA 1ZGAA 3BT7A 1VM6A 5K09A 5IG2A 2ZYRA 3QVKA 4MVJM 4W82A 4B74A 1YZVA 2HQOA 3W5VA 1ACMA 4RU1A 4QTYA 4YT4A 4G56A 5ARBA 2ANCA 4AC9A 5D8DA 3IP9A 2ONJA 3D7NA 4EB6B 3DFZA 4X8LA 2R6GA 2QN3A 4QRHA 1Q1AA 3H17A 2QJOA 2W2KA 4MRAA 3WOVA 4AF7A 3IOMA 3NHPA 4I4TA 2V4UA 3VTZA 2VJAA 2QLJA 2VJQA 2ZE7A 4XYBA 4DN6A 4OXNA 2QUHA 3TR0A 2WIDA 3B60A 4BWYA 3L01A 3QP9A 3V34A 2Q0QA 5CFMA 1DJMA 2FZLA 2IFTA 2XNCA 4YMUA 3HFRA 5EZYA 3EGXB 4ZT3A 2PYZA 5EMHA 3DZ8A 4OV6B 5TR9A 2OBLA 4G81A 1R0KA 4H7HA 1Z7EA 2HV8A 4TWRA 3ZLVA 4E2YA 4BXOA 2LCFA 4FCCA 4RL4A 4WV3A 3VH3A 3CS3A 3GFBA 1SC3A 2PGAA 2IHYA 2NUPB 5BR1A 2NU7B 3B5EA 3ORFA 1DBPA 1H94A 1RXEA 2YICA 4HMOA 2PHZA 4KN8A 4BNIA 1AG9A 4MNTA 4JBWA 3WRXC 4E2XA 2WA1A 3MLBA 1QKIA 2JIMA 4MUEA 5FV7A 3SZRA 1OV6A 4YLYA 1C29B 3MCAA 2WM2A 3BZWA 3V1TC 1GEEA 5BXYA 2COUA 2GMWA 1BQ4A 1TEHA 1EQAA 3AV3A 3R6GA 4CQNA 1SAYA 1GFIA 2GJ8A 3AX6A 1GRQA 3NTUA 1PSZA 3E5RA 3MJVA 1XVAA 1U9IA 5K51A 1S8AA 1SZPA 3WADA 4IWXA 5TQJA 3QBDA 5CAEA 2AL7A 2V7UA 4YP6A 2O0HA 1CK4A 1E4OA 1ZK2A 1NNSA 1E7SA 2AXQA 1H22A 2VHQA 4K6CA 4MP3A 4LI3X 1C50A 1L4EA 4EP1A 5KYYB 1Q50A 3ER9A 1YVDA 2WHXA 2XXBA 1XEAA 4YJ2B 1PZHA 2WIFA 5EXSA 3PPXA 2W37A 1ISIA 5EPOA 2W98A 2Z2ZA 4L15A 1EXNA 1VXRA 3V8EA 1JDVA 1S0UA 1W29A 3RJZA 2EXXA 3FXAA 1F2TA 1JLKA 4M7OA 1FFXA 1U6KA 3RC9A 4F46A 3HZRA 1WF6A 4CR8A 1ZH6A 4BAUA 4UPDA 1VRVA 3E22B 2H4ZA 1WUYA 1G2OA 4J2TA 3IUJA 4D6XA 2W4QA 2XR1A 1IHPA 4J2HA 4QNNA 4AMZA 3MBIA 3VSEA 4X97A 1JVSA 1FDIA 1RYNA 3K2IA 1UDXA 1VHWA 4FW8A 4MRMA 4Q4AB 5EXTA 2AF4C 1HLGA 4OAOA 1Q7TA 1TUEA 3OLYA 1UWCA 3F3YA 2FJ0A 5SZJA 2AJTA 5TF0A 2F6RA 2CNBA 2A0KA 1LDBA 1YFZA 1CPYA 4L0QA 5JDIA 3M6IA 4NSNA 3QNUA 5JS1A 1PWXA 1QS0A 3D6MA 1E5DA 1ZM2A 1E3SA 1L7EA 1UR5A 2VEDA 2K87A 1NUPA 4MRVA 4G5SA 4A0GA 3LGXA 1KJWA 1SK9A 2B98A 3C4VA 4KU4A 2Z57A 2Z3ZA 4DLSA 5T4FA 1YB7A 2J5KA 4U0JA 3L93A 3EGCA 4R0VA 1ABFA 4UZFA 2JZNA 4BVAA 3P0FA 3NM4A 2O5EA 2C1EA 4LOLA 3FWNA 4E4RA 1WKCA 4OMDA 4AI6A 5F52A 3QVJA 2PQ2A 4HTFB 2X3UA 4GKKB 2PL5A 2R8YA 4E33A 1KY2A 3DMGA 3WB9A 3ZE9A 1HDEA 4CUJA 4NK4A 4R71A 1E89A 4BAGA 1ND6A 4C03A 3A70A 3BF7A 1FOEB 3WHLA 4CM6A 1I1QB 3OHPA 1XAGA 2XUFA 2YHSA 3IAXA 1AKEA 4FEEA 4TRMA 4E6EA 1ESNA 1MR3F 3GVXA 3OZSA 3TBFA 2FOIA 3HEAA 4QREA 5K1ZA 3IUPA 4DKXA 4IKPA 5FA8A 5I9NA 3H4TA 3H18A 1U1FA 1VRWA 4PNPA 2DFLA 3BGWA 4FFDA 3LSTA 1MB0A 4EUFA 2RG7A 5CA1B 4FEGA 3ZDCA 5E9QA 4BZPA 2PWZA 1NN1A 3I0ZA 4QJ4A 5EFZA 5LDGA 3CGWA 1N0UA 2ZP1A 4EG6A 3O03A 1JFRA 3QHPA 2PT6A 1IHYA 1XNHA 2ZRAA 2ZUWA 3C48A 2CLLB 2QROA 3H9UA 3P2EA 2AQIA 4OHFA 5H83A 3F73A 4J7UA 4ZV9A 3AINA 3CZQA 3EQ9A 4JLDA 2AN5A 1Z6AA 4ZOAA 3AVTA 2ODWA 2PH7A 4KC0A 3FFXA 1JAHA 2ATIA 1NOKA 5B53A 4DA4A 1TJ4A 4PLTA 1GNQA 1OI4A 3QBJA 2VYCA 1XT6A 1YI8A 3FSGA 1VPLA 2B4KA 3A9UA 1R0CA 1TD1A 1U02A 5B55A 3PFNA 3WGTA 3K31A 2Z1MA 1XD2A 3KZXA 4HQLA 4YPVA 3O2SB 2BDTA 3FRJA 3RAJA 1PX0A 1BDHA 2ZWAA 4UUPA 9LDBA 1EA5A 1KHHA 1T15A 2OB2A 2R2GA 1WW3A 1NC3A 2BEUB 4K3VA 1PDWA 1RZUA 3UV7A 3ASVA 5BWOA 2C96A 1QLJA 2DUJA 2G1PA 3IS3A 2ZQ5A 3LZCA 2W8BB 5L4SA 1GR1A 2BM9A 5AFSA 5I3ZA 2RGYA 2YVQA 5A05A 1E92A 1ZO8A 4X1YA 3KUKA 4QPDA 2H31A 5TS3A 5HEKA 5DYWA 1DAIA 1LY1A 3PCXA 3TTWA 4EMTA 4GC9A 5BVGA 4X7MA 3SZMA 2C4UA 2VOJA 1FSFA 1GGNA 2VHCA 3H4MA 2J67A 4OFXA 3DMPA 4RW0A 4TTRA 4BB9A 3FDIA 1QVVA 5LLSA 2PT7A 2QRVA 4UAVA 4FS3A 4GR5A 3A7EA 4S3MA 5EWLA 1Z38A 4Q18A 1A5ZA 5DTQA 4D43A 2W4MA 3CQ9A 2LKDA 3P4YA 4CU5A 1VMIA 1N34B 1DAFA 4Y6GB 4DDMA 3KKQA 1GPLA 1PJTA 1QNFA 2KLHA 3PC2A 3TO5A 2A3RA 1M3SA 4D0RA 1FFBA 3Q5GA 3LA8A 3C3KA 2GXQA 3OQPA 3V1NA 1P7ZA 2A30A 2VQ6A 3HN6A 2E4ZA 1AGPA 1JEJA 2C95A 3EXHA 3I28A 2H16A 1MVOA 2QVBA 2L82A 3COPA 3U3JA 1SUAA 4EQ6B 4HVLA 1KIMA 1D1PA 4IXTA 2BEWB 5BVHA 1EHCA 4H60A 4JI2B 3OZRA 3FOEC 4S05A 1LI4A 3ON5A 2DJ5A 4YI5A 1XDZA 3WAJA 1RWXA 2RHDA 2G83A 3JQQA 4MIKA 2QE7D 5I01A 4XJTA 5A4AA 5FNVB 1JPNA 3BMOA 2D5CA 3MGAA 4IDDA 2W9XA 4WUTA 5A1TA 4JT2A 4UUBA 3R7SA 3TW4A 3NI2A 5FQOA 3ZLTA 1W1WA 1FP6A 3PIIA 1A8QA 4IV5A 5KNCD 4OD0A 2H52A 3RTGA 3ZE7A 1FDSA 4AF6A 4K05A 3ZGVA 1DJPA 1P5JA 2QNIA 4YLEA 2VNSA 4YAWA 2EFJA 3E3LA 4IZIA 3ZGNA 5IXSA 1SGWA 2Y68A 3V46A 3WNBA 4TT3A 2VQDA 3EVZA 3UHFA 1WX1A 4DA6A 3RVMA 2WG0A 1N2JA 3HGMA 2NNWB 2QUKA 3PLNA 5HNKA 2ST1A 4QDJA 4ND6A 3FPFA 2QAGC 1VJDA 3LOPA 2J1LA 3KU4A 1RNLA 4KG7A 4ZVTA 3STXA 1QCZA 4DE5A 4AXBA 4D4LA 3NRCA 3F4KA 3UWSA 1ECCA 1CULC 2FQYA 5HIJA 4B44A 4H0CA 4YRKA 2O8CB 3TRDA 2HY7A 5ER9A 4DLLA 1GV0A 3SU8A 4B8YA 2RHJA 1R8QA 4EGQA 4CIAA 3RNOA 3U26A 5JARA 2YMMA 3ZWMA 3HJUA 4P36A 1BDBA 2CJPA 2JLBA 4EKDA 1S02A 2YQ5A 1LGYA 4QO8A 2GXSA 1SZJG 1MQAA 1Z7BA 1MKYA 1T9HA 4TTTS 5CHYA 4DWJA 4UCWA 3DXYA 5IAAA 4TYPA 4UTPA 2D0IA 1SQGA 4CMIB 1G4AE 1CP3A 2G70A 3G2NA 4GUAA 4QTUB 1WMSA 4ZEWA 3WXBA 1CJBA 2WFMA 5IM4F 2JVKA 1UZAA 1PFUA 2W6PA 3HI4A 2HIAA 2IYSA 3B2QA 4UASA 4X9XA 4F92B 4CCSA 2D54A 1M7HA 2FPUA 3KV1A 4U02A 4AMBA 2VAVA 1QORA 3GFSA 1R5OA 2ROQA 4N0MA 5LP6C 5LXTF 4F9EA 4TKVA 3V7UA 1N3IA 3MB5A 3LY8A 1X80B 5BYJA 4FLFA 3WLMA 5HZMA 4AUEA 4QJIA 4M55A 4OP1A 1DAPA 1BCRB 3R3VA 1OZFA 5C7YA 3P71T 2F00A 2KHZA 2M6RA 3PYLA 2BVNA 1JAIA 1V95A 2ISCA 4RD4A 3L6BA 3FWHA 1ETUA 4EUEA 2QRPA 3PDWA 3UOGA 4A8TA 4A03A 4DMGA 3NEAA 1BO6A 2DWQA 1ND5A 1T0JB 2YV4A 5BOVA 2DETA 3C6YA 5E1DA 1OWOA 1KAOA 2GM5A 4M76B 4O02B 1Z08A 2QMYA 5KIAA 2YUIA 3L4JA 2MYUA 4PCVA 4MVJI 5IC4A 2OG2A 5H70A 2I6QA 1NQAO 2FEWB 2HF2A 3MFYA 3WHPA 1O3YA 3RIMA 2VPZA 4FHGA 2XUHA 1DFGA 2BELA 2TMYA 3F6PA 1H0KA 2JIZD 4PZEA 3WNCA 5LQDA 4H4EA 1BW9A 3OQ6A 3NDBB 1NQWA 1IN5A 1CUHA 5K3EA 1PT5A 3H9QA 3WKBA 3LY9A 4UOQA 2ZE5A 1TVEA 4AZ0A 8ADHA 5J1TB 2A1TR 2IP4A 5L4NA 3ESZA 2X1VA 4P4LA 5E6UB 4L4YA 3UW3A 5AJYA 4RTLA 3O73A 4I4IA 3RGGA 5GJBA 5THQA 5BSMA 4DADA 3RRFA 1Y3FE 1PGQA 1RCFA 2QK4A 2ZREA 3NTRA 3FMFA 3OCYA 4YP0A 3CX6A 4CM7A 3VI4B 5KJ6A 2EQ5A 3I9FA 1GRRA 3VNQA 1N7JA 1C0EA 3WHIA 1XZIA 4OA8A 4M22A 2GB4A 3ZTYA 4QYIB 1A88A 3HB1A 3SEFA 1SIUA 3INTA 1DWPA 1EDDA 4IJUA 2ICAA 4DMRA 3L1KA 4D44A 2ZXFA 3DBOB 2O3JA 3DOFA 4OL9A 5AKEA 5DNVA 3DNPA 4J1NA 4PYOA 1JHVA 2WTBA 4V0ME 3HTXA 2XGJA 3DQQA 2P0EA 2JW5A 4ENWA 1ADJA 1NF8A 1YR6A 4QWMA 1STOA 1VL6A 2O2ZA 4P5DA 2K4MA 3OU2A 4WFQA 3ZV4A 1KP3A 1U0RA 1ZIXA 1R8SA 3H9EO 5EQJB 2A9OA 5CDYA 1QO0A 3P4UA 4UNSA 4EHLA 2QRMA 3FJOA 1NJ6A 5CEJA 1L4UA 4IEEA 5JD5A 1CETA 2GO7A 1QRAA 1XP5A 3MN1A 4KLZA 1A8IA 1TAGA 3QXXA 5EIAA 2OVFA 4LJ7A 1B6TA 3PUVA 1NP3A 1NDHA 1LDMA 2ZZKA 1JTFA 5JNRA 3BRWA 4DV0B 3VMFA 1DX4A 1AKVA 2X9NA 4M7RA 2HTFA 2PUWA 1A7JA 2CL0X 3C6ZA 3JZDA 4S1VA 4EKYA 4BJ1A 1WW8A 4E6PA 2W6MA 2J85A 1FJHA 3CRW1 3E3AA 4YAOA 4XJXA 3RARA 4AZVA 3DOIA 1CIVA 1F6BA 3HHEA 3VDNB 5JI3E 1HETA 2JVIA 3NWBA 5IJ0A 1G17A 3A10A 3UC9A 3K16A 4D9KA 3GCGA 4X94A 2R86A 2YYZA 4ZVQA 1NQOA 3JYHA 1RHQA 1K97A 1XPOA 4GZMA 4KWTA 2AG1A 1ZSNA 3UK6A 3X2FA 1N33B 1GDHA 3NYRA 1SKBA 2BSAA 1DLJA 1WMDA 2WF9A 5D01A 1NVGA 2RAVA 4UVGA