1QVWA

Crystal structure of the s. cerevisiae ydr533c protein
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
236
structure length
235
Chain Sequence
APKKVLLALTSYNDVFYSDGMKTGVFVVEALHPFNTFRKEGFEVDFVSETGKFGWDEHSLAKDFLNGQDETDFKNKDSDFNKTLAKIKTPKEVNADDYQIFMASAGHGTLFDYPKAKDLQDIASEIYANGGVVAAVHGPAMFDGLTDKKTGRPLIEGKSITGFTDVGETIMGVDSILKAKNLATVEDVAKKYGAKYLAPVGPWDDYSITDGRLVTGVNPASAHSTAVRSIDALKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YDR533c S. cerevisiae protein, a class II member of the Hsp31 family
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
molecule keywords YDR533c protein
total genus 85
structure length 235
sequence length 236
chains with identical sequence B
ec nomenclature ec 4.2.1.130: D-lactate dehydratase.
pdb deposition date 2003-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qvwA00
4QYXA 4OGGA 4UCFA 3UJNA 3OT1A 3TTUA 1KEEB 3EZGA 1PDVA 2YWDA 3PQ8A 1VHQA 4R7GA 5SY9A 3EFEA 3NOVA 2ZUWA 3UK7A 1IZZA 1T3TA 2R1VA 1KA9H 4ENUA 3TTSA 4L95C 1PV2A 4MGHA 4ENQA 2R1TB 3CZ9A 1OY1A 5SY4A 4PXYA 1R9GA 3L18A 1CE8B 4ENTA 4LRUA 4HCJA 3PQ3A 4GUDA 3NVAA 4I46A 3N7TA 1WL8A 4P35A 3ZR4B 1N57A 2AD5A 3EWNA 3L7NA 3PQ5A 3TTYA 3ZJ5A 1PE0A 4OQ4A 4AUEA 2ZUUA 4B2YA 1VCOA 5SY6A 4S0ZA 1OX6A 3B38A 3P9RA 1KWGA 1OI4A 3FSEA 3PQ4A 1GPMA 3GRAA 2R1UA 3ER6A 2XF2A 4Y1GA 2LXNA 2W7TA 3F5DA 3UGJA 3TQIA 3WFZA 3MIIA 4E08A 3UMMA 2YWCA 3B36A 4B5KA 1L9XA 1U9CA 4BFLA 4ENPA 2ZUTA 2IUFA 3BHNA 5DFAA 4GE3A 4ENWA 2GK3A 4Y0NA 4OJYA 3R74A 5LIRA 4P34A 1C3OB 1VCNA 4OGFA 1CF9A 1P80A 3M3PA 2VRNA 2RK3A 1FYEA 3PQ7A 4AULA 1QVVA 1QDLB 4ENVA 1IZYA 4UOQA 3MGKA 4BTEA 4Y1RB 1P7YA 4MNTA 4BIMA 3EJ6A 2VKTA 3L3BA 5K4AA 2VXOA 3ZJ4A 3L4EA 1QVWA 3TTXA 4P5PA 1GG9A 4P2GA 1QWSA 2WJZB 3NONA 3VU3A 1I7QB 2A9VA 3F71A 4ENRA 1VCMA 3UOWA 3KKLA 4ZDJA 1G2IA 1K9VF 4K2HA 5JZOA 4N12A 2YWBA 4Y1FA 4AUMA 2D7JA 4P36A 4QYTA 3CNEA 1JDBC 2R1VB 1T36B 1GGFA 4XLLA 4L8WB 4OIFA 1C30B 2ZUSA 4ZDKA 5IP5A 2GHRA 3R76A 4E5VA 1OX5A 3P9PA 1QF7A 1SOAA 1GGJA 3R75A 2NV0A 1P5FA 1IPHA 1KXJA 2VPIA 3NOQA 4B7AA 2NV2B 2RK6A 4I2NA 3TTTA 1GGEA 1Q2UA 2FEXA 2OR3A 4GE0A 1P7ZA 5BV2P 4I4NA 5E9AA 1I7SB 3SOZA 3BWEA 1T0BA 4N0MA 3P9QA 2R1TA 5SYAA 1QVZA 1SY7A 3SF8A 2V4UA 4AJ9A 3PQ2A 1FY2A 4RKWA 3FIJA 4LGYA 3RHTA 4ADSG 1M6VB 4MTCA 2H2WA 4ENSA 4L8FA 3NOOA 1OX4A 1P81A 1UCFA 2VDJA 1PDWA 3CZAA 1S1MA 1KWKA 1OX4B 1GGHA 4OFWA 1Q7RA 2YWJA 3SF8B 4B31A 4L78A 4D1YA 1ONSA 4B40A 3EN0A 2RK4A 3B3AA 4JQSA 4ZGGA 1JVNA 4WXYB 2AB0A 5JZMA 3NORA 3CY6A 4UOZA 1GGKA 2ISSD 4UNIA 4Y1EA 4L7QA 4AUNA 3OT1B 4ZDIA 1BXRB 1I1QB 1J42A 3D54D 1CS0B 3PQ6A 4L8YA 4UZSA 3TTVA 1GPWB 4Y1RA 4RKYA 2ABWA 1A9XB 2ZUVA 3CYFA 3TTWA 4WINA 1O1YA 3P9SA
chains in the Genus database with same CATH superfamily
1F8UA 1PGOA 3AIOA 5AHWA 3GFVA 3QE3A 5AO9A 2J0SA 2E4XA 3AL0C 3OPYB 1FNCA 3R9XA 2NO0A 1NJFA 4O4HF 5HJ7A 1BGVA 2P67A 2I4MA 1T3TA 3OQIB 3SSMA 1G5RA 5KTOA 2XJ9A 2ZRKA 1QQ7A 2L17A 4V02A 1OVGA 2O0KA 4WZBB 4PU0A 1ZK1A 3L8CA 5CGZA 3BH7A 3OQBA 4L5AA 5I45A 4CLEA 1FX1A 1KNXA 2Q6KA 3TBHA 3F78A 3H2GA 4YT4A 2O2YA 3PT9A 1Z28A 4PICA 2XDAA 1N57A 1Z45A 3UJ8A 2V9ZA 2AFHB 4I6GA 4JI2B 1W4ZA 1E7MA 1JRLA 3U26A 5LXTF 2PAAA 1Z74A 5FQNA 1H66A 3CNLA 1W88A 2QG9A 1NVUQ 2AOVA 3DTNA 3ER6A 5B37A 1FBNA 1W0CA 1KZGB 1U99A 4X1IB 4BX2A 2VSOA 3HVUA 1CR0A 2QMEA 2NZWA 4FKMA 5JH7B 3VBCA 3INNA 3OFVA 1CR1A 1KDYA 2PUDA 5IH7A 1D0IA 2X2PA 1LQUA 2BFOA 3AERB 1UMBB 3GZJA 3E7FA 3SXUB 3G9XA 3WBKA 2NVOA 1XJWA 3R3WA 4QGHA 3ZY5A 1N34B 4JUFA 1NP3A 2B2CA 2GJ8A 3C5WP 1GCUA 3FSJX 4JP8A 1Q22A 4F2DA 4LF5B 4JUAA 1RNLA 2FWBA 3BH0A 3HCPA 5TV2A 1E6LA 1P2SA 1QDLB 1AZSC 2Z3VA 4KQ9A 1U2DA 2O2HA 4CI9A 1K7CA 5JMWA 4ZZ0A 3WG9A 1ACJA 5BQXA 1OFIA 4HDSA 2IOHA 4KVZA 2ZJ8A 4KH0A 4KODA 3G0IA 1JJAA 3FKQA 4M4SA 1AUPA 3WLMA 1DEOA 1I0IA 2G4VA 3EIOA 3O8NA 3WDKA 4WX2B 1UFKA 1UKBA 5JPDA 3FPCA 1KY5A 1US8B 2HRRA 5DF1A 2J3EA 1H94A 1GO2A 3LK6A 1A5AB 2YASA 4YVFA 3ADOA 3FNGA 5CD9A 1BHJA 2Q2VA 1GFSA 1KU0A 1HL7A 3UMVA 5BXQC 5M5BA 3V2GA 1K9SA 1P0FA 1MOPA 4GKBA 3IT1A 4ITVA 3RG2A 5FI1B 5I8PA 1D03A 2WSYB 2ZPUA 3H97A 5EZYF 4R2JA 4DV6B 3FTDA 5BMVB 1W0KD 4RKWA 2B4YA 1DVRA 1GVNB 5A3RA 1JEOA 2BFAA 5J5VA 4Q9JA 1AK2A 4OI4A 5ER6A 2ZIXB 3AZQA 3H2IA 2B37A 3IAAA 4D5GA 4DQXA 1E9EA 2FSIA 2PA0A 4TZ6A 1G5PA 3MF4A 2IS4A 1L7AA 4J0EA 2J09A 4XLZA 5ETJA 4AN4A 3KQLA 1A1SA 1QVAA 2JDIA 2QTNA 2COEA 4YJ3F 4LCBA 2RK4A 1GADO 3Q6NA 3WIBA 5IYZB 4KI7A 1MFPA 4G24A 4BZPA 1TDJA 1YUBA 2WTNA 5EMJA 5TX7A 4DJDC 1E5QA 4KXYA 1Q19A 2WB4A 3G9ZA 2XUPA 4PZZA 9MHTA 2C99A 3V3KA 1L8OA 4I4TF 3AY0A 3OM1A 4II2A 1A2QA 1U0GA 3U1VA 3E3OA 3TOZA 3F97A 2NVBA 3H17A 3LDFA 1HLGA 3QVKA 4FR5A 1QCYA 3NIGB 2FSGA 4OHBA 3FBGA 2E21A 2WPNA 3KQQA 4R8KA 3CVXA 1PQPA 2V0GA 1RJWA 1EZZA 4E4YA 5AW0A 4QGGA 1D4ZA 3DCJA 1PJBA 1RAEA 3L7NA 3RWMB 3W1WA 4NBSA 4O2RA 4KXLA 5KTMA 1J20A 1MC4A 1OA0A 3O5AA 1XU4A 1R0LA 4GOXA 1EB8A 2AFRA 2BMVA 4GI7A 3AONB 2OBFA 1EDEA 1KSFX 1K6MA 5KDLA 5IEBA 3TLGA 4OA5A 4J2TA 3T1VA 3CNQS 4OF4A 2PD3A 4ZODA 4NOMA 4BNUA 2DWPA 4G8JA 4KYVA 1LC0A 1O2DA 4Y9RA 1FJ2A 4GT1A 4EHFA 1MV8A 5J4KA 1T0IA 1R0YA 1IN5A 2FFRA 4UE2A 1RHMA 3D6TB 1Q1ZA 2YC2C 1GLVA 5AW3A 5KTSA 3AERA 1EE9A 4KG7A 4YRLA 3S44A 3ETLA 4PY2A 4NU0A 2VRBA 4M53A 5JH7A 3IAS6 2FWAA 2PMBA 3NBYC 1C1XA 1UXOA 2JH3A 2MMCA 1OASA 2A9FA 3F7OA 1IOWA 1TMKA 4YRFA 4IWNA 4EX6A 4V38A 4CLRA 1JU9A 3WHPA 4BTEA 3HHPA 3T5PA 4R16A 1L4HA 4AJIA 1Z5NA 3M6XA 3UMYA 3N6RA 2WUDA 2ZR7A 3DMRA 2PS1A 2A4MA 4HQ0A 1W44A 3L8EA 2O8FB 3VU1A 1YHZA 5B3JC 1G2IA 1YZQA 4GLFA 4WHMA 1I8TA 3M1IA 4FDUA 3EXG1 2HBYA 3QI7A 2FWMX 4CN9A 4PWYA 3DAHA 1GZSA 3GJXC 3QE9Y 4PG7A 3LP8A 4L8WB 1KMHB 3S40A 2NSYA 2AF3C 4C7VA 521PA 2HEIA 5L8VA 1KOJA 4DLAA 3H19A 2QT0A 3QA3E 4NH4A 3EZ7A 1VIDA 4E5NA 2FSVC 1PR9A 5ECGC 2A59A 2CFOA 1V5FA 1KMMA 5J2TF 3AR9A 4IIJB 3SJZA 1ADBA 3KYDA 4UASA 4J0JA 3KJGA 4BO5A 3TLEA 3QBDA 3O8CA 1P1KA 3FOZA 4R2KA 4YP9A 1YNSA 1GRQA 2X2OA 1GQSA 3TAHA 4RK4A 5EL0A 2BDTA 2G5PA 2REXB 3ZDEA 2KWIA 3JZDA 4KX5A 4I5DA 1OX4A 2VDJA 4L0MA 3B6KA 4V0ME 3SSNA 3TXXA 2IHNA 2OQVA 2OESA 4ISBA 3HNOA 1Z4QA 1JIXA 1N7HA 5KCMA 1XZJA 3MLBA 4UUOA 5FNVF 3AESB 1E1MA 3P20A 3TYXA 3JWIA 3OA2A 3C5EA 2VHXA 1VTKA 1QB8A 3L0CA 2ERXA 2FLKA 2QRLA 3B6EA 3TX6A 1PR5A 2JJ1A 4EEKA 3TAXA 1E2DA 3WLAA 2FCRA 5DN6D 4PIMA 2HF9A 3AB8A 3CKMA 3QVSA 1V45E 1EJ6A 4ZQFA 3TH5A 1XDSA 5CFPA 1LLUA 1UJNA 2UYOA 1RU3A 4R1TA 1FX0A 4X20A 5FADA 3UA4A 2WNSA 4JT2A 3DLAA 3NM6B 2VCYA 2ZBRA 5DNAA 2B8WA 3BGIA 1I7DA 4DJ5X 1G5IA 1WTCA 1E2NA 3I01A 2OCLA 3JVVA 4Q7QA 4CM3A 4M1MA 1IEQA 4TTRA 4HCJA 3EOBI 3KR1A 2HCTA 4KO8A 1MTOA 2PX2A 3RSZA 4OGWA 2R0QC 1NUUA 1Q21A 1TUBB 2R1ZA 3THRA 1HY3A 2HDWA 2MYPA 4OEHA 1PT9A 4DYVA 3VPBA 5KYTA 4TV8A 5DN6A 2FRXA 4Z49A 5H02A 3KJEA 4WDRA 2ODQA 2QJRA 2ZXUA 4AVYA 5HS4A 2OHFA 5IKEA 2O1XA 4MSUA 4Y3UA 1BEZA 4TKUA 3VNVA 3GPDG 3IDAA 1U0NA 3FCAA 1DRUA 1AOXA 3AVVA 2W2VA 2X0IA 4J0GA 3W7VA 2H7VA 3KE8A 5E0KB 1PEYA 3KDAA 1DFHA 3L0BA 4FFBA 3PXGA 4A6EA 1XLWA 5EWLB 2F3TA 4UE3S 2I2DA 4Y0AA 1AKEA 5JPIA 3TS1A 4NDNE 3WJ7A 4BWYA 1PL8A 1H22A 1G18A 3PQ7A 2G5CA 5ITVA 4GU5A 1KI6B 2F3RA 3A4VA 1G8MA 3O2JA 4C7MA 5LZ4A 4AICA 1CY4A 1E8NA 2H07A 4I50F 4CPDA 4RQBA 2JLCA 4DRXB 5ICMA 1X1TA 4EHHA 2AL7A 2BTQA 3UA3A 1JKXA 4UUAA 2G67A 1S89A 4HHEA 4IVPA 4RL6A 2GXUA 2V7QD 4CQMD 3UMBA 4B3BA 1Q6ZA 4GECA 4KFRA 4G01B 3D8BA 4IIJF 1DEHA 1X1SA 3BSFA 4P36A 2CNBA 1VL5A 3WNQA 3A2NA 4BQSA 5EXSA 2OV1A 1KFKB 3FOBA 3GBSA 4HAOA 5CIWA 5B4TA 4WKBA 4RABA 3OQNA 4EO9A 4Q3EA 4W5QA 4NZPA 3WO0A 3P45A 4V3BA 3CX7A 3GJYA 1D3AA 2C4KA 5CX4A 1WU8A 2RK6A 2J46A 1GQ2A 1HKUA 3MW8A 4G5OA 1M1XB 3BKXA 5IDVA 3TQOA 3U62A 1RHKA 4BX0A 2JGKA 2BFFB 2JLYA 2C3MA 4WNCA 2RB4A 3V3TA 4CDGA 1HO3A 2NZVG 1WUIS 2HPAA 3A58B 3D7LA 1J9GA 3PNYA 4II7A 3TR6A 4ZVRA 3NEJA 5J9FA 3UPDA 5AVTA 1RR6A 2FEOA 2QM3A 2R8ZA 5K0ZA 4C0QC 3D6MA 1B4DA 4PZ0A 1ESMA 3IDFA 5L3QA 1CQIB 2D0PB 2QTBA 1PW5A 3RYIB 3HVHA 4PLGA 2IXGA 5DNYB 3NO4A 3THXA 5F64A 3RVQA 2ZVJA 1VMDA 3KEQA 2UZ4A 3IP9A 2QYHA 1JQ5A 5JV5A 5EIXA 2C04A 2ONYA 4TUYB 4EEZA 5BW8A 2XA9A 1T1EA 3KEFA 1VE5A 1TCBA 2FOIA 3F2VA 4G4SO 2F64A 5CYPA 4DLZA 5ANRB 2J45A 1RYYA 1BXGB 3LV8A 1PG2A 1U7XA 2YV2A 1QG4A 3HPQA 4AJNA 3VH4A 4QJ3A 5B12A 5EHXA 3CKLA 1HQCA 3FVRA 3AFMA 4C04A 1RPNA 1WUTA 5IDQA 1UT5A 1TW2A 3A9TA 3MEQA 5AJYA 4WXPA 3I61A 2EKQA 1YK0A 1QQ6A 4JUBA 1EE1A 4Q3LA 1OXBB 3IDZA 3JR3A 3UG7A 4AFNA 4L57A 3MGCA 1T1RA 2O2IA 4A16A 2PVSA 2YJ5A 1NDQA 2OMEA 3CH4B 3FJ1A 5FRDA 3FOCA 1FFCA 3E15A 1KR2A 4BVLA 2WG0A 4O33A 1T9CA 5JANA 2WG2A 3CLRD 4P54A 2VFAA 2UUCB 1BS9A 3BF8A 2EFEB 1VE9A 3DMHA 2P2CA 3B9RA 4J0IA 2Y2UA 3AETA 4WGGA 4G5SA 3KS9A 3ZVRA 2C4WA 2LDXA 2P27A 1U9JA 3QXXA 4TLLB 4EB3A 2L0XA 3IVGA 4EENA 4LZZA 4QOGA 2J87A 2PYDA 1T0UA 4OLAA 3LW8A 2VP5A 3V80A 3RTDA 2V5AA 1JA1A 5J4YA 3DYBA 4HR7A 4PS1A 3OQMA 1YRLA 1X1EA 4DSAA 4OK5A 1C3VA 3AQ4A 1G7RA 2XTNA 3G6WA 3G88A 1S3FA 4XWYA 3UATA 4E22A 1PT7A 3M1LA 4I1RA 2QLLA 4TRMA 3BTOA 4KBGA 1B15A 2AOUA 3FFWA 5K1ZA 1H2AS 2QU8A 3WBJA 2ODEA 3OX4A 3WMXA 4K9PA 2AUTA 1ZJZA 1G5FA 3EVZA 1BOOA 3HA2A 4JNCA 4XH9B 1QAMA 4F1KA 3A4LA 3BRCA 3DM9B 4PNPA 4ZARA 4BBJA 3T5BA 3M83A 4ALKA 5I01A 1KRXA 1NUHA 4LDJA 1QDEA 3ZLUA 4LFCB 4K86A 5B7NA 2YFYA 1TQ4A 2QKYA 1WMFA 4MB6A 4XGRA 2XBUA 4PCVA 4Y8VA 1XKXA 2E4UA 3K9FC 5HK9A 3E9MA 4KDEA 3RSLA 2Y0CA 3WKEA 1IBCA 3NDIA 3REQA 4P93A 1VIVA 2PO5A 4EYGA 4L07A 5ALDA 1RQGA 3H9EO 3A6JA 3KTDA 1XT6A 1DNPA 5GWXA 4AT1A 1B2RA 1QIHA 3GJ0A 4B7XA 3DONA 3O93A 2ZWMA 2VTEA 3ADDA 5ICSA 2FMUA 2HTEA 1EFTA 1RP7A 4Q7EA 4MAAA 3RI3A 2OR3A 4B09A 2ECKA 2IE0A 1FDOA 2ST1A 4BZWA 1I7SB 3TIXB 4FI3F 5TLSA 1E7YA 3DV0A 4YY3B 1W73A 2HW8A 2X15A 1HQYE 2NXNA 4BGEA 3KEOA 2G80A 3D0OA 3GY0A 4LJAA 5G53C 1ULUA 3HACA 3T3GA 3QEAZ 3KPYA 4JL8A 3L0PA 2GKGA 2Q1WA 1AKQA 3D0KA 3Q7PA 5BN4A 2P77A 1U0BB 1W4CA 5TGDA 1SXJA 2WD7A 1VPEA 2NU7A 3WAGA 3CZAA 4H18A 3DFMA 3SKXA 2QSUA 5CT9A 3A0UA 3MS4A 1PDOA 1S3GA 2R7AA 1W8IA 2QMYA 3OLVA 4XYEA 1YRWA 2R25B 3WLNA 1WMBA 2GSWA 1A7KA 1SKMA 1GU0A 1Q50A 2C5HA 2QTLA 5A4JA 1IDOA 3DD1A 3W6ZA 2QOEA 1XRSB 4MH0R 4HUQB 1EM8B 3MBIA 4E3ZA 3D6UA 3A4IA 4P58A 3OZUA 1AZLA 3Q9LA 1A9XB 1JDVA 3GLSA 4AJHA 5CVTA 1X7DA 1VLLA 3C15C 3MFQA 4N3BA 3IQIX 1FP4A 3BG5A 3GGPA 3CS3A 1KS2A 5AR1A 5SY9A 1XNHA 1YC5A 2PUFA 3E9ZA 4N5MA 1D6MA 3D8RA 2BSXA 4W6QA 2AXPA 4FYVA 3NXKA 1IHOA 1SC6A 2OY0A 5DTIA 4CTOA 1BDBA 2OBYA 4DA7A 3FSRA 1PL7A 3EVNA 4H1VA 4B3SB 4KU4A 3KV3O 3T1TA 4NXMB 3CX8A 4WKCA 1PS8A 4W1PA 4O3MA 2FZEA 1V26A 4JLAA 4WZBE 4N03A 5DLDA 2HM7A 4M0LA 4D42A 2JH9A 3G1UA 3NBUA 2J67A 3NHYA 2ZT7A 1DDOA 1KP9A 2R8PA 1Y5NA 1Z68A 3KU1A 4BO9A 2RD2A 2RAFA 2OXIA 3LVRE 4F2WA 2JVJA 2FX2A 2YJ3A 3ED5A 3QUTA 4LF8B 4YNBA 1G4AE 5A3QA 4DMLA 2HB6A 1E66A 3X43A 4FSHA 4LJYA 3LD9A 2VCHA 1RMYA 2MCFA 4GSYA 1AUXA 4TTTS 3IALA 5IF9A 1OSNA 1VPLA 2RCYA 3AY6A 3U7IA 4DL9A 5BY2A 1GCIA 5LP6C 2F43B 1XVTA 3NPMA 5LLTA 2EAUA 4RS3A 4HGYA 1Z8HA 1GUZA 2X1LA 5D8DA 4Y2QA 4IG4A 4HAYA 1VLMA 1GDHA 1L4KA 3B85A 3V7WA 3I30X 3ORQA 5FNVB 3W79A 1ETUA 1UXJA 2H2DA 4UUPA 3VR4A 2JD1A 2XMRA 3G2LA 4IUDS 4KQHA 3PDHA 1XTJA 4C4ZA 1LPBB 1UPFA 3TM5A 3ZDXB 4HAUA 1U8EA 1TCCA 1WXWA 3QNMA 4W9NA 3JXEA 4FVTA 1H5UA 3PNKA 5CNMA 2HHHB 1U3GA 4UM8B 4YUVA 4BE9A 5DT9A 4KE7A 2AEMA 4HFJA 5A2GA 2JI9A 1FRQA 3BL5A 1ZD4A 3B13B 3O3CA 3WNZA 3EWAA 4NOLA 1PGJA 4RESA 4YJ2A 1E9VA 3QMPA 4INPA 3KAJA 1J8FA 4JVMA 5FTKA 4HKTA 2C88A 3BDAA 4E5VA 3CRZA 4H3KB 4FMDF 3ZE6A 4BV3A 2ID8A 1EJ2A 1CZNA 1IXYA 4GXRA 1TF5A 4QJ4A 1FDRA 4S04A 1H8ED 1R1DA 1P0MA 1ULBA 4UM5A 1GGEA 3LSTA 3VR3A 3GEHA 3PPYA 3WSVA 3LXRA 3HXMA 2OXRA 2NUPB 3LUFA 3KVOA 4GS5A 5KKNB 2CL7X 1N2IA 3IE0A 2MDTA 3O84A 4PO3X 2R1TA 1DCKA 1NNI1 1NR7A 3AVOA 3GL9A 4CV3A 4D57A 3UGQA 1GDDA 4O0LA 1FNSA 2JGLA 5P21A 1ZKDA 2IHJA 2Q07A 3I9KA 4QHYA 3MBOA 4MGIR 1TT5B 3L6CA 3W5CA 9LDBA 3SU8A 2O2DA 1ZNWA 4ER5A 1CFJA 1IHYA 1ZD8A 3EVFA 5FPSA 1GD1O 4MP3A 2JHFA 3S1LA 3WICA 4PBSA 3R5HA 4KIJA 3BILA 4EKYA 3DWEX 4OSEA 1YA8A 2C1XA 2WZQA 3MXOA 3ETNA 2R6JA 3DT6A 4LAFA 2PL9A 2C5GA 4PVCA 3H2KA 2CJWB 4J2OA 3RVLA 3CF4G 2FNAA 3ISVA 5HQJA 1L5HA 1FU8A 4GQIA 1I2MA 1LVUA 3K2IA 4ND5A 1DX9A 3VOTA 1PK8A 3CT6A 3QTTA 2Q2QA 4IEFB 4IJKA 1E1RD 1J97A 1YOBA 3F8TA 4R51A 5G41A 4BCDA 1EVIA 4JBYA 2GPWA 2AC2A 3VUFA 4BAUA 1VSUA 5DW0A 4DWWA 2VBCA 4LF9B 1K3FA 5CNKA 2PUEA 4RHTA 1RBYA 1UZNA 3OUTA 5BQ3A 3OO1A 4JC8A 2AOXA 2HWKA 2P5TB 5JZBA 7REQB 1ZJWA 1WEKA 2IPMA 4YASA 3MUNA 3HDVA 1T9AA 3PUJA 3R7BA 1GUDA 2QNBA 4I6EA 4JI3B 4DADA 1S96A 2I62A 4ND8A 1A7JA 2B8TA 1ZJ5A 4NFLA 3AT1A 4RNDB 5GV8A 4PXSA 1P9NA 5KYVA 1KQPA 4X8LA 2XNCA 1DGQA 3GLFA 3ZNQA 1RLTA 4X6XA 5C8VA 3SG0A 3QLVC 2XRZA 1HNXB 2XBMA 1TX4B 4LBYA 4R1QA 2HNKA 4EITA 4G4JA 4WN9B 3VR5A 4OM7A 3A2LA 3G02A 5CDYA 2ZYVX 5K4HA 4FHCA 5IAGA 3R74A 1C9YA 4MA4A 1T5TA 4D26A 2AQKA 2O3TA 3F2IA 1J1UA 4BNHA 4K8RB 4ZCPA 4XUCA 1IB0A 3UKOA 1ZIXA 2J8ZA 4RAQA 1ZXBA 2CLEB 2FW9A 3CLSC 5ULLA 4BKPA 4ZK6A 5JYBA 2Q3FA 1YU6A 1W0JA 1PJ3A 4EQZA 1T2DA 3RYHB 3RW9A 1UAAA 3ETHA 4M1ZA 4BPRA 5J47A 5JBQA 1GZ3A 1ML3A 1KIAA 2X8JB 3O2QB 5BYJA 3UXEA 1RWNA 4F4DA 2CSXA 1C9MA 2P0EA 1ZX1A 1GXSB 4TV9B 1VGVA 3M9WA 1UJMA 5AI6A 4MA0A 2BF7A 1M7BA 3N2IA 4NFYA 4PXAA 3WL7A 5FAKA 1CY7A 3D2CA 1O94D 5KHOC 5B64A 5DDIP 1Q15A 1GFZA 2XUQA 3CR8A 1C3JA 4PZCA 2LPMA 1F4LA 1II0A 5DTRA 1MMFB 4TWBA 3SR3A 3GLIE 2VKQA 3W34A 3GELA 1Y42X 3STYA 4DLTA 2EBWA 1CUXA 1Y8RB 2HLNA 3K9CA 3EIFA 3MUEA 4QODA 2IPXA 3EG9B 4MR7A 5KJ6A 3I2JA 1Q2UA 1OXUA 4GDFA 5L95A 3WY9A 1GA6A 1N2OA 5AM4A 4JP2A 2PTHA 1EFUA 1XP8A 4QL3A 3IP5A 5F33A 1OT5A 3I9MA 3B7WA 3N8IA 1RWPA 2FZGA 2B5WA 3CKKA 3RS3A 2DBRA 1B16A 2PNFA 1KFCB 5JCXA 1FMJA 4A0SA 4XB2A 2Q7DA 3TW6A 4Y0VA 1Z39A 4FTWA 5D2CA 3IXQA 1C50A 3QENA 1WUKS 3QTBA 4L8FA 4TT3D 1OH8A 1YJ8A 4NH0A 1IB6A 2C8VA 3RVSA 2JIDA 3BSWA 1JHZA 2FSVA 2JIMA 4W1QA 1T5SA 1Z7WA 1OGYA 2GGSA 2WIDA 3GGDA 2YZKA 4HFNA 2PUVA 4U9UA 1TUIA 5JZMA 1K5DA 2GM9A 3BB4A 1VLQA 3MCAA 1TT5A 4ZDIA 1DAEA 2BMDA 4KXQA 4QRDA 5JD3A 5ES4B 5KYUB 5LJLA 4FOPA 3PP8A 2A5LA 2RGNA 1DIOB 2PMEA 1SBCA 1ZVJA 3TI7A 4CIVA 3AUUA 1GCOA 2IHKA 2WIBA 3IBYA 3NHMA 3OCUA 2E48A 3JATA 4TUYF 5EJMA 5HFJA 3WADA 5K0EA 2PO7A 2RGWA 3MTGA 1HDEA 2RI6A 3BK2A 3AHDA 3KYIB 3NOVA 3V1UA 2E1RA 3VQTA 3KZKA 4ZI2A 4L27A 5CB4F 3EFOA 2H8KA 4L5IA 1AS0A 2R85A 2W71A 1NOJA 4XTCS 5FUVA 5I9TA 4CIWA 1T5OA 1TECE 2BGMA 3SEFA 2C98A 1LF5A 3F6EX 5P8WA 1W1IA 5DMXA 1RE1A 5JS1A 2JI6A 1WSAA 3NFRA 4UXHA 3WLRA 1JQEA 4D8UA 4DNPA 5EJ2A 5JIBA 2Q6IA 3QUQA 5FBQB 3ETJA 5CEJA 1PE0A 1RHUA 3WYAA 4CL3A 2AZTA 1RHJA 5EPUA 1YQGA 1E6MA 1MTZA 4DC0A 1FC0A 1QU2A 4MV9A 3FA2A 1PZXA 2CF5A 1XJ0A 4MVJG 1KYVA 2LVBA 2ACWA 1Y0BA 3IERA 2E6UX 5ALKA 3DUFA 2I1QA 1LNQA 1XFAA 2I2XB 2PR7A 3KO8A 4KIUA 4E08A 4RD3A 2B7LA 2XZLA 1RIIA 2GN2A 1JV2B 3OWXA 5CYOA 3SPXA 5HYVA 1CQWA 1G6HA 3A27A 3EF3A 4GPTA 4Y0NA 2C8LA 1PVVA 3MELA 1IZ0A 2H5EA 2XVXA 4NJEA 5AIBA 3B5EA 3QQ5A 1KDTA 4LXTA 4ZT6A 5J63A 2PUGA 3FG9A 1YRQA 2VOJA 1V5IA 1TLTA 4OP1A 1JHUA 1ZZEA 3OLXA 4LZPA 4MDHA 4YRMA 2XAUA 1YHNA 5FI3A 3VNBA 3K8OE 1VMKA 1WD5A 3O75A 3DHYA 1PVOA 1TZMA 2WNIA 5BT9A 3VU9A 1FSFA 1PT5A 1RZUA 2BL4A 1BWRA 2R7NA 4M1OA 2IHYA 3NONA 1XDDA 4EGJA 4Q4DA 2V8BA 3BWYA 2VTVA 1V1RB 3DLTA 2HMYB 3OTHA 4L15A 4N12A 1ZINA 121PA 3OQVA 4IEIA 5DASA 1SPBS 3MYRA 2FQQA 3PDWA 4YP1A 2Q50A 2NT3A 3URKA 1WSBA 3DNFA 2LTAA 4OIFA 2ZUSA 3MJVA 2VN8A 3S1AA 3FKJA 2EX0A 1TM2A 5K0TA 2VCEA 4ESEA 4GR4A 2HWYA 3NOQA 4I2NA 3U17A 3K0KA 3N2KB 5LXTA 4LECA 3PNMA 2RFLA 4IIJA 5BV2P 2WTAA 3BX1A 3N0XA 2XYRA 3GR6A 5CVVA 4KQ6A 3X2FA 3EXHB 1MZVA 2VHWA 3C3WA 3JQRA 1BHQ1 1Q3HA 2XPCA 3NALA 3QOFA 4PHCA 4QASA 4RZUA 4DM7A 4AY3A 5MGNA 2V4UA 1G3IA 1IQUA 2A5DA 3II6X 2QTGA 3ESCA 4YCJA 4JEMA 3WNCA 3TUZC 2IOQA 4D7AA 5CK5A 1P4GA 4P0PB 3F3KA 3R2JA 2XE6A 1CRZA 3AY3A 4F72A 1OFVA 5KTYA 2AC4A 2IFTA 2XOKA 1JFFB 1GKKA 3I9LA 4JC4A 4NMHA 4RD4A 4GYKA 3CLKA 1PCXA 2DBVO 4FILA 3B3AA 4PLVA 5IMSA 1DKRA 3NDBB 2ISSD 2AJBA 4I1IA 4PAOA 3GF4A 1JHMA 4E07A 5BYKA 2QRKA 1MW8X 4UTRA 2F8TA 4LY6A 2G9UA 4UZSA 2A57A 4YJ2B 1EGMB 4RKYA 1VHDA 2C7VA 4G89A 4QDTA 1NL3A 4YJKA 1F7UA 2JLWA 1UDAA 1Z6ZA 1QANA 1G4HA 3PPXA 3SBDA 5C5IA 3GN1A 2XXAB 3NASA 1ZW1A 3SBOA 4NSNA 1DRKA 1VL0A 4C0AC 3U9SA 2I55A 1I4LD 4NNOA 2UAGA 5EHQA 4W7SA 5B53A 3WRXA 1RRPA 2QDKA 1P3DA 1DMRA 3KOOA 5FNVA 1U2DC 2Y1GA 1DC4A 3DBRA 4XM1A 4EKEA 3A1TA 3AF2A 4JJ8A 3JVDA 3NVAA 4A82A 4P35A 2EXXA 1NKTA 4F3RA 1JEYA 4LRWA 2HA3A 5IDWA 1MA3A 3H3XA 5CLLA 3Q8LA 4F06A 2C9BA 4F1JA 5JS8A 2QTVA 3MGAA 4D9FA 2IBSA 2KLHA 1UBRS 2CBXA 3FDFA 3IJEB 4YACA 5T57A 1PS9A 3UYKA 3FNQA 5KOHB 1XD8A 3RS8A 1LBQA 3DDNA 2ZSHA 4J3FA 4CYMA 1ADGA 5IC6A 3CN7A 3T3PB 4ASUA 3QRWA 1NVDA 1NLFA 1HDGO 3FCUB 4B5KA 4E5YA 3T4PA 3MWGA 2VUIB 4JOQA 2J0QA 4EDHA 2JI4A 2BMEA 4TWIA 3PUXA 3PUYA 3KB2A 4KQJA 1CTQA 3EBLA 4QDOA 2KI5A 4TN5A 4ZC1A 1U5CA 1GP2A 4BLWA 1JJBA 1Z22A 4GKJB 1CY0A 3H5WA 4I0WB 1X86B 2DUNA 1HSZA 1JPVA 2GD2A 4KO2S 4N1AA 4EO7A 3TECE 1E6CA 3SMQA 1GWNA 3AF4A 3WGKA 3TPZA 3ESAA 4PLZA 3W90A 5KMGB 3HB0A 1UIMA 3M81A 3FTCA 2FXIA 5FXMA 3BORA 2GESA 4HVTA 1U9IA 3E9DA 3B1ZA 1NHGA 1E3LA 1NBIA 1UDRA 1Z12A 2BMWA 4PCLA 4ZEWA 5L4LA 1CVLA 3W9YA 1J8MF 5LFAA 1Q0TA 3N28A 4YV7A 1W7AA 1V11B 5B6JA 3SF0A 1XCBA 5THQA 4C7JA 1RLMA 3WAJA 2JI7A 2WJZB 1DG3A 4Q15A 1PR0A 2GEKA 4NDZA 3I6IA 4KDCA 1CE8A 3CHYA 2ZB3A 3GOHA 3GJ5A 1YB7A 1UFRA 1JWBB 1DQRA 3K0FB 3KB8A 4FWBA 1I36A 4MYCA 5TF0A 5DVZA 3PA6A 5I4BA 3BBPA 1VLZA 1BJKA 4RPHA 4FNOA 3KOUA 1WU7A 3BAFA 4HFMA 4UZFA 1C30B 1JE0A 1X94A 1FYXA 4O08A 4O1MA 4X93A 1FP4B 4WE3A 4BQQA 2XCQA 3ZXUB 5T6MA 2WZDA 2ISQA 1QTNA 2Z1MA 2A30A 4LOIA 3FNHA 1DPFA 1K27A 2NSDA 2CLSA 4YAWA 1GRRA 3TFWA 4E0BA 5I3CA 4FWTA 3EVGA 4P4TA 4CM9D 1VMEA 1EBFA 1CUBA 1PJSA 3AHFA 1JFRA 1OZFA 2GHQA 3INYA 5DCYA 5DIZA 4NZYA 3EZ2A 2GWHA 2C77A 2EERA 2QTZA 4MR9B 3W1VA 4QU0A 2P2SA 4YT2A 2H29A 1IUPA 1L4YA 1S7GA 1RYFA 1I6MA 1H6BA 2H4YA 3GQBA 4CM4B 5JVDF 1RYZA 1UEIA 1PJAA 2XQVA 3VKUA 3VSAA 1LB1B 4MUXA 1VJDA 2BKUA 3DKVA 4D0LB 3SR4A 2GF9A 2B5VA 4TYPA 1OBFO 2VAVA 3FHLA 3QOWA 3AF3A 3VTAA 1FLNA 1Q1BA 1Z0DA 4UCWA 2G1PA 3UAWA 4C7KA 4C87A 2CVHA 4QBKA 4EAAA 5EIOA 2QR3A 3N2KA 3ZQ4A 5CDGA 1T6NA 2FPPA 2EW2A 4PSVA 1JDZA 4EPWA 4HP8A 1JG7A 4BS9A 4QT0A 3X1WA 2C8KA 3BE5A 4L2IA 1KJ9A 1RPJA 4DBLC 3EAQA 1VCIA 2LCFA 3ZV5A 1T15A 2HCJB 2VDWA 1HFEL 5HOQA 2FRVA 2FZKA 3N39C 2Y1DA 3PL5A 3ACBA 3L43A 5L45A 5LDDC 3P5SA 1V25A 3LCUA 4I6JA 5AW4A 1OXKB 4EGQA 2BGRA 3NATA 4FIDA 3SIPA 1FIUA 3HKCB 4YJFA 5C8YB 5EA2A 3ONDA 1MEOA 4NV0A 1ZK3A 2NXJA 4X1IA 1YAHA 2JS7A 2H5IA 4RJLA 3RTCA 4C2UA 2D1YA 2R68A 2B35A 2D8AA 1TMOA 2RIRA 3N6XA 4YB8A 3UGKA 3TVYA 1YMVA 4UNSA 1Z5WA 1JR2A 2GD6A 2OVFA 2N47A 3PPIA 4Z9BA 4YUWA 1EIWA 3OZDA 3PJRA 4DIUA 1KKLA 4DV0B 4BMOB 3HDJA 3RYTC 3AINA 5G0VA 3NBAA 2VNAA 4OHUA 5MGBA 5EWMA 4QIHA 5T67A 3D8NA 4H15A 2IUFA 3ICQB 4K6OA 1BKSB 1MD9A 5EE3A 3H11A 1OYOA 5F7XA 4MCIA 1OBOA 4U7GA 1IONA 3RAPR 1VYUA 4JYPA 4GXNA 3B12A 3QPUA 3WHLA 2PL5A 3DGEC 1Z5PA 2Y1XA 4HGPA 4RIFA 4WJKB 1YRBA 5JJBA 5KDDA 3HL4A 3LH5A 2XODA 3EUAA 3EJ6A 1XP5A 2Y76A 4I8DA 4I9GA 4PZDA 2C4MA 3T9CA 2B4QA 5GP1A 2GRJA 1D6SA 3T7JA 1Q1AA 3PVZA 2PFGA 3LUHA 4FZ3A 1E5DA 1OAOA 2QROA 2O2JA 3ND8A 1KH2A 2F1RA 4K8OA 3DXYA 1EX1A 2OCKA 3GVHA 4X6UA 5GY7A 4EJMA 4TV8B 2C2MA 4HEHA 4L4YA 5FR2A 2HA4A 4DVJA 1R4AA 4KXVA 1N2JA 3OZRA 4DDWA 4TVKA 2ZI4A 1XHEA 4ZKDA 3AEKB 3BXOA 3OJEA 4QOIA 3TD9A 2VNIA 3CRRA 4H7DA 5JLJA 1V9CA 5JVDB 1PRYA 5EWMB 4TROA 3FYDA 3C3JA 4DR5B 1U94A 2C20A 2BELA 1I3CA 3WS7A 1P7ZA 1YQEA 2NU9A 4GC5A 3WMGA 1NMEA 5DP1A 3DMFA 5B1SA 1MQ8B 2DYKA 3DPUA 1GR0A 5AUPB 4M8KA 4U2DA 5HR5A 1XF9A 2FWPA 4BQRA 2ANCA 2ADOA 4ZI7A 4J76A 4FOSA 4JI0B 2DTDA 3R9WA 2FG5A 4CMGA 5KYUA 5D3QA 1NXPA 1N2GA 4GI5A 3ZGLA 1RCTE 3QBEA 3MRXA 1U2TA 3S8EA 3PDIB 1Z35A 3WK8A 3T52A 2G72A 4D8WA 2DWCA 2EZ9A 5J2TA 2RSLA 5HF9A 5B6PA 3FB4A 1TKBA 2Y0PA 1HNZB 3L4BA 4QBTA 1Q44A 1SOMA 4P2BA 1UP4A 3GXOA 4H6XA 5AXDA 2HF8A 3MT8A 4M86A 3S2GA 5K0JA 4ND3A 2HC9A 4ACAA 4F1WA 1YR8A 1ZIOA 3L82B 1E2PA 2NU9B 3WKAA 1DZ3A 3FYUB 1Q91A 1RWMA 3OT1A 3BH6A 1UFVA 5D1HA 5D3MA 2BUAA 1WKCA 1V8PA 4KHZA 2YVQA 4P3XA 3G85A 5E6UA 1TA9A 4FHFA 2G9ZA 5T3YA 3VZRA 3AV0B 3THSA 3VNSA 1MORA 2FG6C 3T1QA 5E9WA 2WVJA 4ENTA 4YCMA 1K97A 3NHJA 3PYXA 1ZCBA 4FYMA 4JYCA 5DLQC 5J5CA 5SZIA 1L5NA 3HJTA 2C4UA 3CEAA 1X7HA 4BGUA 4OXQA 4ZRNA 5F4BA 1G60A 4J94A 4YP0A 3KKOA 4D92A 4Q82A 2JIZD 1VCOA 2IVFA 4MVJH 3R7DA 3LJKA 3RRXA 4OD0A 1JSRA 2XVMA 2GJ4A 4MVJD 3U3KA 1WXXA 5FPPA 2GVNA 4KPGA 3TSOA 2HKIA 2BGUA 2WMYA 4LXGA 1M2FA 1QHNA 4OXRA 2E0IA 4M1WA 4UDNA 4BFLA 1B6SA 1DDIA 1USWA 2DU8A 4GGOA 1HDIA 3RUIA 3TBFA 1TT7A 4Q7LA 4HMQA 4XR9A 1JFLA 3EGOA 1Q84A 2AW5A 2I7TA 4GSLA 3ZHZA 2B25A 4M21A 1NR5A 3VXKA 2O5CA 1VKZA 3R77A 3OCYA 4IJ5A 5DM0A 5KIAA 4MVJE 5FL3A 1Y8QA 3HWWA 3KM0A 2Q0HA 3FLMA 3LKDA 4IQ4A 2VK1A 5G0SA 5LA6B 3OU2A 3O3NB 2JIZA 4ZAVA 3IQWA 4AULA 3IAEA 2ZBPA 1DB3A 2B94A 2C3UA 3G2OA 1WSDA 4R0MA 8ABPA 4Y2JA 1ZI9A 4JROA 1MR3F 3IPAA 1BXGA 1CZOA 2VZEA 3FWKA 3LHDA 3EJWA 4OJTA 5AKYA 3VTZA 1PHPA 4CQLB 1F4VA 4RTQA 1R7RA 1RJEA 5K3BA 4YV2A 1FLAA 3BIXA 3DJYA 3RUAA 1L7NA 3GLFE 1X8XA 2CGEA 4BQFA 2FMFA 4URYR 4H08A 2C2YA 4R9NA 3KFXA 2ENWA 4TTIA 5E8RA 1LLCA 2YN4A 5FUWA 4A8JB 1IBMB 3ITNA 3OZTA 5FP0A 2PFSA 4OLJA 1PKXA 2QN6A 4CU2A 4GOJA 3DC2A 3X1XA 4IWYA 1Y3BE 3URMA 1SELA 4DV1B 3I73A 3F67A 4LNUA 4M0CA 1EK6A 4BGVA 4KQFA 4MOWA 1Z7YA 5A1JA 3HB9A 1YDGA 4LBWA 1V0JA 1VHWA 3EXG2 4WJLA 1ULTA 2ZITA 4FR2A 4Y6QA 4D6YA 3GUYA 1CRPA 4RA9A 1JHOA 2LZ0A 1ECPA 2YBDA 3Q1LA 3HM9A 1M1NB 1QORA 3KPVA 4HVAA 4L85A 3U7HB 4KIWA 4EG0A 1J21A 3EQ7A 3CLUD 4EHKA 2ZQYA 1E1QA 3RSFA 3L4JA 1DWPA 1OILA 4F56A 4IH9A 2NPOA 1ZK2A 5AVKA 2JJ2A 3T35A 2VP0A 4CQMB 3H1TA 3N2ZB 1PZHA 4ND4A 3AJDA 1Y1PA 4I66A 3F3MA 2BD0A 1QFSA 2O4UX 4LTMA 3VR0A 3QYFA 2D1FA 1J06A 3DVAB 4AJJA 3QKRA 2WYHA 2D7CA 2QL5A 2AZ4A 1FFBA 1VJRA 2HWXA 3U7JA 1W9HA 3LECA 2O50A 4AZ3B 4EJSC 1RWVA 2NU8A 3UN1A 5JSUA 3O8BA 1EAMA 2YW9A 3EA0A 4BP8A 2VUUA 1PGQA 4EB6A 1QAQA 13PKA 1ZPDA 4Q9HA 1DCTA 1M2GA 3G0BA 5JISA 2MSKA 3NHFA 2X8JA 4Q00A 2GAOA 4JVOA 5AKHA 3BZWA 5JAOA 1L4FA 3FWZA 5KKAA 5AW9A 1RI5A 2G3YA 2VLBA 4NBKA 2HK8A 4I08A 1NXSA 3VA7A 2N1BA 3AB7A 1VHQA 4M8SA 4UU1A 3ZVLA 4F12A 4IIYA 4Q1EA 1YS9A 2MINA 4FKBA 4QJBA 4QVKA 4CLRB 1FDUA 4KSYA 1RJGA 4LX8A 3QJ5A 4OHWA 3ZV3A 1ND5A 2VNHA 2YRFA 3CLTD 3DDUA 3QXHA 4FP9A 3F6YA 2VDUE 4JASB 4N54A 3PXCX 2HHJA 1QS0B 2E2WA 1QB7A 1BWSA 2H51A 4PC2A 4RGYA 5T5QA 4R68A 4YI5A 3IVMA 2JFNA 1JNYA 1POWA 1CNEA 3JVEA 3L0YA 2X3FA 3LMKA 1VYVA 1UDWA 2ZYAA 3OMXA 4FB4A 2Y6UA 5LXTB 4ERNA 3N2EA 4Q4CA 1SCBA 3FBTA 3IO3A 5K8TA 5AKJA 4O2AA 5K0CA 3ESXA 1Q95A 3GUVA 1V16A 3AC0A 4YROA 1J09A 3RT9A 2Z1NA 1GYPA 3AU8A 3WYCA 1WVMA 3EDRA 1ZD5A 3IMGA 5CAEB 5CT6A 3N8NA 4P34A 1XRQA 2NIPA 4BAZA 3IDQA 2C3YA 5AI9A 2WA1A 4GYJA 4JLKA 1U3VA 3KQMA 5B1HA 4DQKA 4DCUA 2ONCA 1RI4A 1R6UA 2AYYA 3ENVA 2VYFA 4IKEA 4NULA 1ZVMA 4OH7A 2AYXA 2PH5A 4LYJA 4QBFA 4UMFA 1GPDG 4UNNA 5K45A 3HKBB 5JC1A 3JASA 1OW3B 4R3UC 4DUYB 1B8OA 3RG8A 3WLPA 3EGXA 5K6RA 1PWYE 4EQ6A 1JLHA 2HJSA 2GN6A 3S70A 5BQFA 1I24A 1QWSA 1O5IA 4XVRA 4O4IA 5FOSA 4OHVA 5CPBA 2QP9X 5L6MB 3NMUF 1XK6A 1XZPA 2I6XA 2JLUA 4RVGA 1E1DA 3JQAD 5EEGA 4E11A 1TW3A 2C7RA 1W36C 5GZ3A 3OU6A 3V4FA 1VYHA 3IEIA 1N5RA 4KQEA 4MLDA 5GGYA 2Z2JA 3D9QX 3L5OA 1EYZA 4HGQA 3GG9A 2ZPTX 1H0HA 1L8LA 1GGJA 1IHPA 2BFPA 2XJ4A 2ALJA 3F5QA 1QE0A 4PGHA 3O90A 5ES3A 1GNTA 2XMQA 3QU2A 3NYIA 5BWOA 5IAOA 4B81A 3CJRA 3G49A 3OM0A 4OQFA 5DTQA 3TLYA 3TUJC 4TYNA 4N40A 2ZJOA 4Z3OA 3AKEA 2OBLA 3RF7A 3L8YA 4JOBA 4PNZA 2DFVA 1C2TA 1FNBA 1M2OB 2E37A 3FYTA 3L9XA 1P19A 4ZZ3A 3PRKE 4AJ9A 1ZGJA 5EZ6B 1R5BA 3KB1A 5CVEA 2ZE6A 4HWKA 4Y2RA 1XZCA 2XD4A 1JILA 4JLWA 4QWWA 4FZ5A 2GO7A 5FOTA 3X1YA 3K0BA 1S1MA 2DQZA 3VSBA 1ODFA 4Z0NA 2WSLA 3JYNA 3OC6A 3SZRA 2MHCA 3QG5A 5FEMA 1RRMA 1LW6E 1N0VC 4RHXA 4Z4HA 1QYDA 5F1PA 3U81A 1J1IA 1UP7A 2WWWA 3A6LA 2CLHB 3T7IA 4AJOA 4AQYB 4PHFA 5E4FA 1RXIA 2ATCA 4NCHA 3HEAA 2EVWX 4IJVA 3WB1A 5HPYB 3DMPA 4FW9A 4DRZA 1B3BA 1C3LA 1XBTA 1C1XB 2PK3A 2YN2A 3R0ZA 4UD6A 4DPMA 5AK5A 3CLTC 3VZDA 4OYHA 2BI8A 4EZIA 5AVYA 5LZ2A 1U90A 1HE1C 2OZEA 3T3MB 4BMSA 4RKQA 3DZFA 2Q5HA 3W4KA 4YXWA 4ETWA 3ZD7A 4MRRA 3EDOA 1RACA 2G36A 2ONZA 1I9CA 1WPQA 2EEPA 2VC2B 3OT4A 3DE6X 5B1YA 2QTAA 4QUAA 1TD1A 3I5UA 1FLDA 4GP9A 1J24A 4JSTA 4DTIA 3AHHA 3FPJA 1L4MA 3G2JA 1MJFA 3PQ5A 2PGOA 3WTBA 4BJ5A 1XC7A 3QX9A 5C0OE 2ZJ4A 1ZDMA 1AG9A 1G9TA 1N32B 5KVCA 4P80A 1V7CA 1GCAA 5JZVA 2PRYA 2NVUA 1BD3A 4M36A 3ROGA 4W9MC 5H7XA 4YQFA 4FX5A 2QXTA 1EP1B 5KTKA 5H3CA 3ZDDA 4CV1A 1C4WA 1XHFA 2G1JA 3L0OA 3QLJA 1Z8DA 2DHRA 2XNHA 4ARSA 4ZPXA 1A04A 3RJ5A 4RY2A 1S8AA 2IEYA 3AWDA 3D8SA 3G7NA 1QV9A 5HRUA 1Z2OX 1YBMA 3BFKA 2B9VA 1UMBA 4M83A 2V58A 2R86A 3JYLA 3L93A 3OKPA 4UTZA 3T12A 1P2TA 1QO9A 1VMIA 2Q3HA 3PNOA 1X87A 5ENVA 2B2XA 3RS0A 2ADFA 4G5GA 5LIRA 3RAFC 1Z4OA 3RRZA 4MYDA 2EQBA 1NW9B 3DVSX 2DPHA 3M3PA 4MHOA 5FHQA 2RK3A 4KUEA 4OKSA 3JX9A 4F7WA 3EPKA 3QF7A 1UC8A 4KLRA 4UKDA 4Q1BA 3ZBQA 4MROA 4RGBA 3PLNA 2WZBA 5B1IA 1ISMA 2WHRA 4HAZA 4YONB 1MV5A 3D8HA 3H1AA 3L0IB 1NXXA 2OAP1 4FCVA 4HPXB 1OPRA 1YCDA 2BHTA 2D5IA 2HU5A 2QN1A 4K9NA 3U13A 5JAIA 2P6MA 2YHIB 3M4YA 1U9YA 4J16C 3VAZA 1TD9A 3A3OA 4AP5A 3A1EA 4DLVA 3RWBA 4DHWA 4PO9A 1DO8A 2YVAA 1MBZA 5EE5B 2CMGA 2GAFA 1W4RA 2OQIA 3AVQA 3CKYA 3FPLA 3MCWA 4JR2A 1XPUA 2Q5FA 3VMMA 2Q1XA 2R00A 3OP1A 5JATA 2GZAA 3T7EA 3EHDA 1HLDA 1M8PA 1NVBA 5IG2A 2Y05A 2ZATA 4GX2A 1YO6A 1MH1A 5DI9A 3F5FA 1DFGA 1XAHA 4WMLA 2VJNA 3DKPA 3UAOA 1PEDA 3M7IA 3L05A 1JL3A 1KL7A 2GJ9A 3ZZNA 4EGAA 4KMRA 3TNFA 3EX7C 3DULA 2C9YA 3UC9A 4GP7A 5I5GA 4D9EA 1EAYA 1M2JA 3HU3A 1I2CA 2WTEA 2C4HA 1OBHA 2ZI3A 1R0RE 1XELA 4Z99A 4GZ5A 3UUWA 2PSEA 1JAIA 4Q4AB 3L7IA 4IVQA 1H4VB 2Y77A 5LD2B 4IXMA 3W2GA 4FLEA 4XIYA 5IVIA 4JQSA 2M1ZA 5CCXA 3NG1A 1DI0A 1JA9A 3G8CA 3K4QA 3E84A 5FO0A 3MLAA 1Z0SA 1BXRB 1MJNA 3FOAA 4RKEA 4UBIA 2I6FA 4D4JA 5JWRA 1O6BA 2B0JA 1SD5A 2JAHA 2Y67A 3I6MA 3R40A 4EZEA 3J81A 2CNWD 2GZ2A 3HJGA 4MPDA 3IIEA 4YFVA 4HNAB 1E92A 2E5FA 3ZQ6A 5EPOA 5FULA 2YXLA 4NJMA 1Y8RA 3EZGA 5CVUA 3TI9A 1KAEA 2CCJA 2QMHA 5DCLA 5IDYA 4BVFA 1WSWA 2A9KA 2FTKE 2OK8A 3AK4A 2B98A 4WJZA 2WWVD 4B83A 4I8IA 3D3WA 4XDZA 3VAAA 4YRRA 2IS2A 1P62B 5LQUA 4NYIR 3JRWA 3R5KA 3CTPA 4ALIA 4R4JA 2EHDA 2JBAA 3E0QA 4C0WA 1WL8A 3DO5A 4CM1A 1H3EA 1EVKA 3V32A 1XCGB 2XMGA 3FDJA 2MSWA 3NEPX 4IYRA 1PFVA 4TXNA 2ERYA 2I6GA 5JSZA 4F3NA 1UR5A 4AJPA 1HTBA 2PIDA 4L22A 1SBIA 1RYNA 1Y6RA 2NO4A 2R1UA 3ET4A 2NPIA 4N41A 3H4MA 4F9TA 4YPFA 2R8RA 3RRBA 3ESBA 1EP2B 5TE9A 3Q2OA 5KNCA 1ISRA 1L7PA 4S3MA 2X6RA 3QUBA 1PFGA 2V9PA 2X22A 3IV6A 1ZM2A 1TTTA 1EFDN 3P2IA 4TV8F 3SS8A 4AP6A 5I4KA 3AHCA 1EHIA 5CX1B 4EY8A 3PHLA 2Z58A 4L4XA 4Z9YA 3ZDFA 3ZK7A 4DJEC 1MQSA 5BVHA 2IZZA 3A05A 4CHTA 1K86A 3FWHA 4Y9UA 5F12A 3MJTA 1NTRA 2IXEA 1YDHA 1W52X 5DW3A 1V96A 3E9QA 2AA3A 2QMOA 3KC2A 4YP5A 1GY8A 4JFRA 3JWJA 4L8LA 5FPYA 3TEFA 1SZPA 1GUBA 3K73O 5D01A 3ELDA 4BJ3A 3BYZA 5AHRA 2O6HA 4OMDA 5BSHA 8GPBA 3UJHA 1CFZA 1BSVA 3ESQA 1V3UA 2LCIA 3I6QA 1EBBA 1UMKA 2L69A 1DPGA 3IH5A 3K5IA 3MUOA 1C4OA 3NTOA 4GDMA 3UV3A 3D2AA 3P9XA 3AKZA 1N0HA 3FNFA 1PGNA 3R6GA 3NT5A 2WM2A 3M4NA 1LC3A 1OPXA 5F73A 4DLBA 5ALVA 3ZC3A 4N48A 2A1IA 5HRAA 5LQCA 1RAIA 2AOTB 4GX5A 1PJCA 4W7IA 3ZV6A 5IP5A 2HMTA 4H4EA 2IV2X 3JRXA 5AKLA 2I71A 5TR9A 4XJSA 5HZKA 4B6SA 5A4IS 4CL2A 4OPMA 1X0XA 3QHQA 2EP7A 1NFQA 2PMDA 1R0KA 2YMLA 4L0DA 4UZEA 1QF6A 4DMGA 3C7TA 3KJIA 3CCFA 4NEHB 3KU4A 1CZHA 4EH1A 1WMEA 2YIDA 2JBWA 4F96A 1ESDA 1BVUA 2IYSA 3Q2IA 1FPQA 1NZDA 2B8EA 3CU5A 1G3UA 4BVHA 4CQNA 1U5BA 5I9BA 2BGWA 4PYMA 5A1TA 2ZEJA 3OSUA 3TL2A 3AW9A 3HRHA 1SULA 5JCOC 5HZGA 3ZWDA 2Q3MA 4P98A 2J07A 2MT9A 2UZIR 2W2NA 2ZRPA 4QXRA 4HMPA 3RSOA 4DZZA 3FRJA 2CCKA 1SKBA 4WACA 3NVKI 1AN0A 2P9ZA 3FF1A 3ZK8A 2H6EA 4KTTE 2AFIE 2XT9A 2F8SA 1QFZA 5JALA 3M5WA 3PJDA 3V7FA 2YWHA 3Q3VA 5HZMA 3TSZA 4BXOA 4BP1A 3A25A 3TIFA 2F1HA 5FUMA 1ID8A 2A9JA 5HJEA 2YXNA 5BSMA 1YQ9A 4BYMA 3IQEA 4UM9D 3RHZA 3T7KA 4S1NA 5BW5A 1A71A 1K8XB 2CVPA 1CS0B 4L8YA 4OGLA 4Z54A 1NJSA 5CH5A 2QRHA 2JNWA 1CQJA 1HEYA 1U02A 2VHYA 3ZI4A 5K0LA 4N5LA 3ZIAA 4S05A 3V55A 4FEYA 4B4DA 2GJSA 1KEEB 5EIBC 2XYQA 3CNHA 1JJ7A 1Z9BA 3FZYA 1Q7GA 2ZYGA 4KQMA 2VAPA 4R7GA 3H1PA 2FZCA 1RJ9B 3IRUA 4H4DA 2AJDA 2XB8A 3CUWA 4HY3A 1GAJA 4ZO8A 2HQSA 3SHTA 4BNNA 2H1RA 3IUJA 4A91A 3TLAA 1V1JA 1KEZA 5EIWA 1B8UA 1GNRA 3W5HA 1E61A 4XRGA 5HKKD 1YZGA 1SK8A 3DZ8A 4GHWA 5AVXA 1RJDA 1WA5A 1YQDA 4M60A 4QOHA 3HKBA 5J4HA 1MX1A 2IYQA 1RXYA 2VSXA 3OD1A 2O3SA 1IJKA 1BMTA 4I1OA 4BNJA 3GOQA 3VKVA 3KVNA 3CISA 4Y2YA 3FI0A 4KWEA 4E5DA 2O8EA 2D8MA 4PLCA 1KE2A 4ITUA 4M7OA 4Z1MA 3RVRA 3ZG6A 4G0WA 4LZJA 5AW5A 2PXHA 2J6HA 1J39A 4WKNA 5A9SB 4E2FA 3WGZA 1OXSC 5L3VA 2ZRNA 4GE3A 4R1SA 1R4NA 4TVSA 4NCKA 2X7XA 2AN3A 5A5VA 2Q4TA 4AU1A 2I78A 4ZWNA 2ROQA 4KRFA 4Z4QA 10MHA 4EI8A 1JJIA 1IY0A 3W04A 3F7TA 2NOAA 3COWA 1NW4A 1QQBA 2A9QA 2GTIA 2E4YA 2ENUA 3N2GA 4N8SA 1T26A 4RSGA 1ORVA 1V5EA 4I9NA 5BVHB 3I04A 2Q2NA 3L5KA 3OTWA 2X7JA 3UB4A 3M8KA 3NTVA 3JVUA 5CCDA 4AY5A 4JDUA 1Y3CE 3L0ZA 5KNCD 1K0UA 1VCMA 1F8GA 1P29A 2B4RO 4D9MA 3KJHA 1KTVA 2AKAB 2W5UA 4PFQA 2JFVA 5AICA 1OC4A 1QKKA 1VIMA 1I3OA 4NS1A 4XYGA 4H1WA 2OWEA 5IW8A 1NW5A 4IHJA 3O73A 3SZLA 4UM9B 5KC8A 2Q27A 2XB9A 3ZY4A 3QVTA 2PZ8A 3T4UA 1NPYA 2B1QA 3PJFA 1Z88A 1KETA 2PGDA 1AUVA 1KI8A 1R5JA 1Y7PA 2Q46A 2XE7A 1BX1A 4B7AA 4XIFA 5KWEA 1T25A 2JFHA 2VXCA 3I9JA 4V1CA 5JW6A 3WISA 4G0UA 1UKAA 3OZWA 1R12A 4P4UA 1NVEA 2H9IA 2KB0A 3B82A 2FQWA 1V9SA 5F76A 5KVQA 3NFYA 5L3RA 4DW8A 1ADFA 2WNHA 3HMQA 5DIFA 5EKXA 3QVWA 3GO4A 2H9AA 2JCSA 4PQRA 4X64B 5LBUA 1MP0A 2Q3EA 2QR2A 3H18A 5HGXA 2FSHA 3TCNA 4BO8A 2Z4SA 4N6NA 1GPLA 1SG9A 4P84A 4B74A 4B76A 4HX2A 4QHSA 3KT6A 2CXSA 3LY9A 3BTUA 4NWIA 1P2BA 1Y7HA 2HJHA 4IKOA 4KN9S 3JYOA 3CG4A 4YWJA 3G7SA 4HJXA 4ZEVA 4IZIA 1LFDB 5KQMA 5KNBA 4O4IB 1DQYA 2XT0A 4KO3S 1F2UA 2PGJA 2AMLA 3OOWA 3DBLB 2LGJA 1D7AA 4U6NA 5B4VA 5IK2D 4E14A 3FFAA 4U5QA 4IXWA 4N39A 1KFBB 1YC2A 4MKGA 4UQOA 4F2PA 2WM9B 1PIWA 3PPWA 4KL8S 2HJGA 4QGFA 4R6WA 3UMGA 4EF4A 4UJ5A 4DIEA 1V6CA 4LQ4A 1BCSB 4RK0A 3TR0A 4FGLA 3JZIA 3RR2A 1Z6YA 1L7VC 2B8NA 4GM1A 4FMPA 4J1TC 3V48A 2B99A 4BEVA 2ECOA 4LJ4A 3ZN2A 2C2KA 3IIMA 5ILGA 1JR4A 2HQBA 1JI3A 2IYFA 4OOFA 3SEQA 1PVDA 1TNDA 1X2EA 2H1HA 5EJGA 5JSKA 3U7RA 3PT5A 2IEAA 4QPCA 2QB5A 2IH2A 3L92A 4NCXA 3WMWA 4CM6A 1PJLA 1OY1A 2E9SA 4P0TA 2I34A 1P3Y1 4ZVSA 1JQDA 3SOPA 3LUBA 3N58A 4YQYA 5C18A 2IEZA 1TAQA 1IHDA 2E49A 2A92A 4LDNA 4LWOA 4O4LA 4OUDA 5EKDA 3JARA 1NQUA 5HKAA 2H2GA 2VDVE 1OOEA 2IGTA 3PFKA 4MVJI 4ROTA 5KUTA 3L0SA 1XLUA 4JBGA 2CL0X 3T7TA 4DUZB 3IAM1 1EP3B 2JC3A 4X5OA 3I5XA 3B6JA 4M46A 3ELBA 3SXUA 2PH3A 2Z57A 4NNJA 3P97A 1XHLA 4WSOA 1CZKA 1OU0A 2OLJA 2QX8A 5JD5A 1VKJA 3EISA 3O91A 3M3DA 3VR5D 2O4CA 3BFPA 2QG6A 4MV6A 1QH8A 2HRBA 3GT4A 5A4MS 4MW1A 1QX3A 2FU5C 2ZYTX 3C8HA 3ZHYA 1AO0A 2GLTA 4I19A 3PC8A 5D5HA 4YECA 4CLDA 1HZZC 1VJ0A 2YY6A 3LRTA 3LIIA 3LLSA 4WXRA 2VTBA 5FOUA 1ZH6A 2EFYA 4J8PA 3KQUA 4FGUA 3DEFA 4CF4A 4HZIA 5JTTA 5K3EA 2QRPA 4MB2A 2D54A 2YJTD 1TU4A 1AF4A 5DEIA 1WHSA 5AJVB 1RXUA 1P2UA 1YASA 4FYIA 5GONA 3AJRA 4P6VF 2A9OA 4G9BA 1L7XA 2BIFA 3TKYA 1F0PA 2IQ5A 2ZJ3A 1MDFA 4ASUD 4MDEA 3KKPA 2JB9A 5HFAA 2Q6VA 5K0GA 4DJFC 2CUTA 2YFQA 4HDKB 1JDBC 1XUOA 4HTAA 5ALTA 1IZ9A 4ESVA 3LBYA 4URVR 2IYLD 1MAAA 1QH8B 2ANBA 1Q57A 3AEXA 1L8XA 1EWTA 3PEFA 4XQEA 2XNSA 5KSYA 3PHHA 5ALPA 3QUSA 1NC1A 1CEEA 4QU5A 1HLFA 2XDWA 4HNRA 3VUEA 3DFUA 1RXEA 3B2QA 3F4LA 4K81B 4MQ6A 2GJAA 1U3TA 3GWZA 1RYHA 3K6KA 4LVCA 4OQDA 5E9AA 3IKTA 3RFFA 3UT5A 1VGRA 2RGRA 4ESOA 1W6RA 2WF5A 3RRMA 4YIHA 3U56A 2OUKA 2F3QA 4OTZA 2GN8A 4OCZA 1LSSA 2XV1A 1WLSA 1V95A 2NZ8A 1PEAA 3KOMA 1YKGA 3DAYA 3BXFA 3WMFA 3SR0A 2PGIA 2I6SA 5CVJA 5KSWB 3KWMA 4EVQA 1U3FA 1JQBA 2CEAA 2OV3A 3JQEA 3ASVA 5F3DA 5LA6F 3LUPA 5CB8A 3N9IA 4OL0A 2EV9A 2Y4NA 1K92A 1JT2A 5K6TA 2IJGX 2N1MA 5EFOA 5JARA 1XKLA 3A6GA 3SQLA 3EOAI 2ZSEA 3KZNA 4IFIA 4M99A 3WWDA 3ERCA 4JB3A 3HO8A 1P74A 1ORIA 3LLCA 1M7GA 4FZJA 4JBIA 1I2ZA 2DH5A 3QGMA 1T91A 4Z86A 1BVHA 5BW6B 4IOLA 2BCEA 1DWUA 1XKQA 1ECBA 5BRNA 4BNGA 4BUCA 4A15A 3D4NA 1WLYA 4HWPA 4E12A 2LE0A 5I9IA 4B48A 3O4RA 4OJKA 2DR2A 4LGCA 5JQGA 1NBEA 2YHIA 2ZUWA 4KRYA 3D1LA 2GCPA 4OMFG 3C16C 2G6TA 4TSKA 3UJDA 1VKHA 1WXFA 2FPMA 5FWDA 4OM8A 3NC1C 2AJ8A 1Q1NA 1WF6A 2O5RA 3N5CA 4JUCA 3RRNA 4C7OB 1VJTA 4MJXA 4TGLA 2X4LA 1JLMA 1NHWA 1ZCJA 3SX4A 2B92A 4R71A 4DNQA 2JCBA 2IYPA 3L41A 2XADA 3WLFA 1YL5A 5HDBB 1N9ZA 3ZNPA 6REQA 3TMAA 4LX0A 4M7PA 3BVPA 4DCGA 2NAPA 5ALRA 2Z2ZA 2FUKA 3TZKA 3EMBA 3L04A 2CHFA 1D2EA 1DL5A 1NV9A 1W2GA 4FE3A 5J2UB 4B84A 1JTFA 4CU5A 3DZBA 3B9BA 4K3VA 3PYMA 4YRBA 4YAJA 2J3MA 5C32A 5AKGA 1GARA 3FNIA 1T10A 2H48A 2XF8A 3HQ4O 3O31A 3N7AA 1QHHA 3GGSA 3A9WA 3JWEA 5DFAA 2JHAA 3ABOB 4KBFA 2VP3A 4RA6B 4TZKA 1O5TA 1V35A 1ZJ4A 5BRAA 5KS2A 5KNLA 2OKCA 3HDYA 1LK0A 1PTJA 1VL6A 2QIOA 4ZVKA 2FN8A 5JRDS 3QNUA 4KFCA 4N65A 3AJ8A 3VI3B 3IHTA 3QHAA 1D1SA 4U5XA 4H7KA 3EEIA 1BWPA 4MNTA 3F6RA 4BKOA 5JMTA 4ZGWA 3TE7A 3HEBA 2OAQ1 5U4XA 1SCJA 1GA1A 2DTEA 1ZJYA 2IYXA 4HNAA 4ZOLF 4A2QA 4ZIRA 1SC4A 1THZA 3KXLA 4ENRA 2XSZA 4ID9A 2GEVA 1DAOA 1B8PA 4TN1A 2XCTB 3N0VA 3MTBA 1JWAB 3A3PA 2O7QA 3QVMA 1JQ3A 2IY8A 4RVHA 4XLLA 2UXDB 3B48A 3P9PA 3G79A 2EP8A 2QRNA 4EKNB 1N3LA 5KQGA 2DHQA 1H0RA 4QHTA 3I0ZA 3FTPA 1FRZA 2VDPB 2VPIA 4GX1A 1RKQA 1S5PA 2C5AA 1XDBA 4PQFA 1P9WA 3P2YA 1IBKB 4FFRA 1EXVA 1CRLA 1SVNA 2JIPA 3K1JA 3W6NA 1X7YB 1HBJA 1KDOA 5KWSA 2FMTA 4WLEA 5LM3A 5DM70 3EC2A 2D1SA 2CK3D 1SVKA 4QEZA 4LISA 1GTL1 3FPAA 5BVGA 1I3MA 2GPBA 3ROXA 2P1ZA 2ZSKA 4RH3A 4BMYA 1VDMA 2HFJA 3AUSA 3E1KA 1J23A 1U81A 4NESA 3UJPA 3SVLA 1LH0A 4HLQB 5ITZB 5M2QA 1W36D 1N5KA 3PGXA 3EVAA 3HCNA 1ZVQA 2OUIA 3BQMB 5JSYA 1AB6A 1V8DA 2PV0A 2A4KA 4OMUA 4WLVA 4AS2A 1I1QB 2A3RA 1S01A 2K5UA 3PENA 1NVXQ 1EHYA 4O8CA 3T7DA 2V7TA 1WNTA 4HRXA 1JQAA 3UWMA 3KPUA 3GB9A 4C9BA 4XIGS 4BB6A 4IL5A 4DJJA 1BGWA 1QOZA 1TA4A 3OICA 1TM1E 1HYEA 4M9SA 4KP7A 2AG5A 3R9IA 2QRUA 1CRQA 4RA9B 5DXFA 3PQ8A 5ALFA 1SFRA 2C29D 3QY9A 5FR1A 3GU3A 1PO7A 3KE9A 4LY3A 3DMTC 1MVLA 4RTLA 1P1BA 1IWPB 1IUKA 4GMDA 5HCNA 1WCV1 3GLHE 4E13A 3H0EA 5TIIA 2WMOB 5CDSA 2W98A 3B1JA 4RFVA 1IWBB 1JLRA 4Z3DA 2ZJ5A 3KPWA 3VKFA 3ORHA 4RTOA 5I7OA 4HNVA 1Y6ZA 2OSBA 1IRIA 1URPA 5HIMA 5KQPA 2XH8A 4EHLA 4M1SA 2YRXA 3G17A 2KX7A 1Y82A 2I4OA 1WW2A 3WRYA 4Q34A 1DXYA 2DSTA 3CZQA 1KVRA 2RCNA 1AGRA 1RRVA 2A5JA 3PKIA 1Z5VA 1FDTA 3TQIA 5I4IA 4OKIA 2P35A 1Q0LA 1U7HA 1N7IA 2H16A 5GMOA 2QW1A 4QOJA 1KORA 5IJAA 3RGGA 1U7UA 2ATXA 1L4GA 4Q4LA 2AMVA 1FOEB 4PGMA 2CWWA 5BT8A 1ORWA 2BUCA 2I1WA 4HOYA 4X9XA 3AF1A 4PLTA 3W3ZB 4LCJA 1K4YA 2CXQA 2H3HA 1COZA 2YUTA 2YWXA 3CEJA 4IW3B 2CHUA 1CD5A 1JB1A 4KWTA 4M6WA 1ISSA 3IURA 4PGAA 3RLFA 1N2CE 3OX3A 1F6BA 4EI2A 1UFOA 4PW0A 2AI3A 5AJZA 2GN0A 3F6PA 1GPUA 1LBHA 1JIJA 4RJTA 3W6PA 2D59A 5FA5A 2X2EA 1Q3KA 4ARZB 3K6SB 1F5SA 5A03A 3GJ3A 2HF2A 3CB2A 2OZVA 5DHQA 3BGDA 3OP4A 4EG4A 2WW8A 2X76A 3M9LA 1GQYA 4PLWA 5IAJA 2G07A 2INGX 3QUAA 5A3VA 4IMJB 3DV2A 2XXAA 2IYZA 4MV1A 1GZ6A 2FPSA 1CNFA 5BSTA 5CIQA 3W77A 4PTLA 4K6HA 1Q3TA 2DPYA 3WGIA 1HDCA 1TI7A 2E82A 2W2KB 2JLRA 3FFTA 4RULA 2A1UB 1MX5A 3DTYA 2XWJI 3VDNB 3I64A 1K4MA 2E5LB 2AQHA 1KXZA 2OHXA 1F6WA 2SCUA 4MIKA 4P82A 3K70D 1MB3A 4QZVA 2GPTA 3DSRA 5AW7A 1BS2A 5C35A 2GOYA 3ZI7A 5REQA 4F5WA 2Z2KA 2D0DA 3L1UA 4CQMA 1E2GA 1EEHA 4DMMA 1NFFA 4J91A 3I45A 2WLSA 4G86A 4LMAA 2R8YA 2ZE8A 4RWZA 3SF8B 1CULC 4QG3A 1SXHA 3OLYA 3P5BA 4NENA 3OPYI 4L78A 2BJHA 3EK2A 1SBHA 4WZAB 2CDNA 2GUGA 2ZIEA 1SEVA 3C6MA 5EUBA 5H16A 5CDFA 1SQ6A 5T4EA 5KU7A 3NHRA 3D6AA 1KFJB 3DB2A 3R41A 2O8CB 4DUGD 2P6RA 1XMOB 2D1TA 4X91A 1BTOA 2PZLA 3G0GA 4M55A 5JZ9A 5F3WB 4EG5A 1NMZA 1VKRA 2AFIB 4G1VA 3N87A 4GVXA 3HXPA 5IC5A 4HG2A 4ZT4A 3RUPA 3IUNA 4OBBA 3L06A 4KVFA 3GPCA 4C08A 3EGXB 3SBEA 1D8AA 1R0BA 4G5YA 2ZAGA 3QHPA 1QHIA 2UKDA 3JQ9C 3KXIA 1C7FA 5DBGA 3UK7A 3WK6A 4FKZA 1XTRA 1KRWA 4CFYA 2HRDA 1SC1A 3IEVA 1QIJA 4W8GA 4A0FA 3ODPA 1Q7EA 2YY5A 4DY4A 3RYCA 4ZQBA 3AR3A 3OEYA 3FXAA 4OOEA 1RS0A 2ZE7A 3HGMA 4REOA 3NUZA 2PQ2A 3HKEB 1FL9A 3A6FA 1AK1A 5DPMA 2FEAA 2A94A 1NQXA 2IUTA 4KK4A 1GL6A 3UAYA 1JKJA 4EJ6A 4KI0A 2IUUA 3VOBA 5B5SA 4Q1FA 3P32A 5E0OA 3C3XA 5HVNA 3ZDBA 1SXJC 3F49S 2OGSA 3HO6A 1FVOA 4R84A 5FNZA 3PKJA 2XCSB 2O5EA 2WYOA 1AV7A 3D3JA 4QU9A 4TTVA 4I1PA 2ZRAA 3JTMA 4MRAA 5K3SA 2PGNA 4E6PA 4OBEA 1A9OA 1IAQA 3SQOA 1JSCA 3TNDA 2ICAA 3FMFA 4TMTA 5CX1A 5KNDD 1IMJA 1V16B 1UBLS 4I1SA 5DWQA 5HM6A 2L19A 2OCYC 3AB3A 3LC1O 3RBVA 4A4DA 1Y3AA 3KV1A 4F8JA 3Q8KA 3CLHA 3P9KA 4MJLA 4OX9Y 4LE0A 1XEXB 4IIGA 4D82A 1YULA 3BXGA 3O0TA 5TMBA 2GK7A 1YE5A 3I58A 1KZYC 3IR6A 4MQ5A 2R6AA 4YXFA 2JZCA 3EUFA 1GPAA 2WP8J 1JHDA 2O3UA 3BWVA 2PZFA 3F6SA 2IEIA 4NZOA 4QOFA 4FCCA 2FFBA 1R6VA 2V96A 3V9AA 1XMVA 3PZRA 1T3LA 3LGXA 4JI8B 4YCSA 2R6ZA 4ZCLA 1OXVA 2GBFA 5ALUA 2VUSA 4AS1A 2G0AA 3SM3A 4EHJA 4RDHA 2FZVA 1S0UA 4MULA 1TLLA 4D3SA 1E89A 3I23A 1CSEE 1NV8A 4D9IA 1YRAA 3JQDA 1CJKC 2X3YA 3JD3A 5EXPA 4YDHB 4D80A 3AP2A 3EC7A 1Z37A 2XSZD 1J0XO 3N76A 4LW8A 4NJMB 5I9NA 2F3PA 1WR8A 1HA3A 1SD1A 1O9BA 1HURA 2I2CA 7ADHA 1ZR2A 3OCCA 5DWVA 1U80A 4X8OA 4LMRA 4QOEA 3W2HA 1HG1A 4BVEA 4BTLA 5LYJB 3BMOA 3CF4A 4FJ0A 2IDKA 3KHSA 2QK4A 1D9XA 2GNOA 4HUJA 1O9GA 1KQOA 3FSGA 1NDUA 4ZANA 3AYZB 3EGVA 4K9LA 3GZNB 5TEVA 1MX3A 2GFHA 2HIAA 2XUOA 3A14A 3FX2A 3FOWA 2XQKA 2C58A 1C0KA 1A8SA 2EJWA 1HYBA 3RVKA 4ZI7B 2DKNA 4B2PA 2FJ0A 3WL3A 2P65A 2CV1A 5TSDA 2MJLA 1UBJS 3UWKA 4NXNB 4C6TA 2YJ6A 3FROA 4YRPA 2Z6VA 1KEKA 4PGGA 4BFSA 4MKHA 3ZWCA 2P2GA 3E70C 2Z95A 5JSFA 1XF1A 4UBOA 3DYVA 1HZJA 2OCIA 2C7GA 1NE7A 2GQ0A 2I65A 1XMPA 3I8OA 2IUSA 3NIFB 2CCGA 3O94A 4G37A 1LRLA 5CFLA 3O38A 4B7CA 3W5IA 4WRRA 2POQX 5JJLA 3RU7A 3ZTYA 2XE8A 4P3OA 1IM5A 4D81A 3EEBA 1JVBA 1DJMA 3PSHA 3J7AC 1AUQA 4IGIA 2JCVA 3MUFA 4WOKA 4R8MA 1O94C 1EK0A 4DT1A 1I01A 3ZY2A 1UBGA 1MJ5A 1SA0B 5I47A 1XNQB 1EM6A 3HVKA 4TMWA 2YV3A 3JD4A 5F2EA 4L75A 4G25A 2RI1A 4DQUA 3CRVA 3SQXA 1LQTA 1U8YA 3GMIA 5E6RA 4DB2A 3PV0A 4XR4A 1SVLA 1KI4A 2ZYSA 1GZDA 1ZFNA 1E9BA 1SVMA 1XMIA 1T0PA 2CJPA 2VNSA 2WVHA 4AURA 4F9FA 5AM3A 4U7FA 2I80A 2JJMA 2DUWA 4YJ3A 4QYIB 2Z43A 3AFGA 3DHWC 1VOTA 4JEIA 4JKOA 2BFNA 4MXDA 1QIIA 4B2IA 3ZGZA 1XPOA 5EY5B 1DFIA 1E6WA 4WFJA 1R3UA 4IQ8A 3ZIAD 5K3OA 4MPTA 2DUUA 4YIKA 1DEAA 2PAFA 5DEOA 3TVDA 1EZ4A 3MWLA 4JAVC 1SHZA 2OORC 1XQ6A 1SU6A 1IOZA 4OHCA 4A26A 4NCBA 1SOVA 2QAGC 1RYEA 2QTFA 4UEJA 1WZ2A 4E1VA 3JASB 3C85A 1EKXA 1Q7CA 4B4WA 1OGIA 2BVNA 4LNHA 2QDXA 1NN3A 1QV7A 3FUTA 4PIPA 3KQTA 4Q5IA 1AQJA 2ZB2A 3KX2A 3OQJA 3P96A 3PEYA 4LHZA 1RWOA 3KJFA 2WTUA 2XZPA 3JWPA 1O4VA 3TB4A 1V8ZA 1O08A 1LJLA 5AI5A 5JBIA 4U0KA 1KO4A 2RHTA 5IBQA 2OGWA 2ORIA 5HCUA 1Z83A 4MP8A 5JWHA 5HTKA 2QLFA 3EXEB 4IZOA 3EPJA 4YUYA 2DFPA 1A27A 1EEXB 3BCRA 1E4VA 4MRVA 3TPFA 4OAPA 3V2IA 2D0IA 4AKTA 1JBEA 2J08A 3T1NA 1QCZA 3N86A 1NVGA 1T1SA 2ADMA 4LGMA 1WBDA 4K9DA 2ZIGA 4YCAA 1FYVA 4YCBA 4ZXPA 3BWEA 4P8RA 3FHCB 3FETA 5SYAA 3MS7A 4TS9A 1Z5OA 5ALIA 4ARAA 2Z3ZA 4Y67A 1A9ZA 4MIYA 2JJ2D 1HC7A 1Q6YA 4OQLA 4QGSA 2FR0A 3D6VA 3LCRA 3WLQA 5K0BA 1CCWA 3L46A 2ZUCA 4BL5A 2CF6A 2IQIA 3B1VA 3WK4A 5BWLA 4RETA 4ZZ1A 3KYBA 5C4GB 3K7EA 1QWOA 3WYNA 2X1MA 1YOVA 3N74A 3OFSA 2MINB 4FHDA 1EGAA 4Y6PA 4K1XA 2Q1YA 1S2IA 3LBIA 3ZGVA 3AP3A 3KJZA 4UOZA 1NBMD 3BZBA 1KKMA 2PR2A 5FFFA 4KPFC 4QUIA 2E1PA 1AQUA 3EQ2A 2HMUA 3JZFA 3D1JA 3CR7A 1G21A 1WVIA 3OTIA 5G1NA 3X2SA 4CM4A 4ZOQI 3ESZA 3QWBA 3PA8A 4PQYA 3GMDA 2VQDA 3E5MA 4IF6A 2WDZA 5ICGA 1NJ8A 1CP3A 1XVAA 1Z33A 5D51S 4RF4A 2EF1A 4CEJA 2J32A 1QHSA 1XTBA 3THWA 2WM3A 2NM0A 1VJ1A 4AZSA 4AG3A 1T5IA 2FR8A 3QBTA 1HOTA 3SJCA 3QNWA 5K5EA 1TO1E 4TL8A 1W5FA 4ZO7A 4NMMA 3T54A 2Z5GA 3EPLA 2FHPA 3RLIA 2EGHA 2F9MA 2X4GA 2K7FA 2VJAA 1RLUA 4RU1A 4DJAA 3LX6A 4OQ4A 4N5NA 3K71B 2P0AA 5EESA 4ND8B 1M1YB 2V3VA 2JFPA 2X13A 3MCTA 5BR8B 4IKPA 3P26A 1P9RA 4ZRMA 3BTVA 3PNSA 5KPJA 4EI7A 4EZBA 2OYCA 1IQRA 2XTJA 4F4CA 5EQJB 2BFEB 2E5WA 1NWCA 2IF2A 2Q5OA 2QRVA 1W75A 2ZBUA 5KHAA 2M6KA 1MAVA 4M0FA 1QH1B 3COZA 3D5TA 1CZLA 5DOVA 1UWKA 1GPH1 2UDPA 2IYVA 2GLXA 2AMJA 2ZB7A 3EASA 3P2JA 4H3SA 2BM1A 4J7CA 4PZEA 2PY6A 5K3CA 1PJ8A 2PBLA 3DEIA 4GRDA 1SUEA 3TOVA 3J80A 5DZSA 4OQYA 1K8RA 3OJFA 3F9IA 3WNVA 2I0FA 1BQ3A 3A70A 4LWQA 2QVGA 3ZTWA 5HWSA 4K3UA 4CM5A 3D3EA 4ZREA 3SK0A 5FLYA 1L4LA 3GP8A 1N5JA 1Q7TA 2R66A 5GVSA 3RC8A 3K94A 3LVQE 4R9RA 3KQSA 1RE0A 1JXMA 3BSYA 3E61A 5DJ5A 4CMEC 3F0TA 1W6UA 3O4GA 1J8YF 3JALA 4YT8A 5AJXA 4MICA 1IJFA 2AKYA 5BSRA 2GYUA 2JIOA 1CUSA 2TMDA 5ENDA 5B3JA 3WYGA 2C4TA 2GEDA 2EJVA 3DL4A 4JLJA 1SXJD 2OC9A 4PQGA 4DF3A 4B45A 4AMZA 2I8LA 1I10A 1MO5A 2NW6A 4JKYA 4B17A 2D13A 3COJA 3WXMA 3R8XA 3LDGA 1Y5LA 5HGJA 2XGJA 4XX0A 2QF7A 4GZMA 2BKEA 2DUJA 2UYYA 5TQ2B 2FLWA 2ZQZA 5EXXA 4CF5A 1DJOA 4PYJA 1RRCA 4HDNA 4N7BA 1H1LA 2HIGA 2M2IA 3FPFA 1QYWA 2CNOA 1SXJE 3EDYA 5G3YA 1GYQA 3KJQA 1XTIA 2WA2A 3IBTA 4ARVA 1O96B 2DBZA 4CM8A 4E21A 5I5EA 1DTWB 1P1FA 3L6DA 1ZNYA 3JPYA 4YJHB 5SZJA 2Q7OE 4YRDA 3PQ2A 3QW4B 4AZ0B 1DAHA 4O5AA 3SX2A 1FFDA 2NXCA 4MHTA 2C9DA 3WDSA 2FPKA 4XDYA 1SO8A 1KAMA 2R11A 3G0DA 3LT0A 3PFWO 1H1LB 2Q4OA 2SKCA 5L4SA 2OBXA 3DFKA 4BO1A 2QV0A 1KRHA 1DC8A 2NTYC 3AKDA 1Q0HA 5T8KC 2QUBA 1WX1A 3TQHA 4MGZR 1BS1A 3CLSD 3LDUA 3OI7A 6LDHA 4I9UA 4V0OA 4Z4IA 4RNCA 2GPJA 5EUQB 4CN8A 3WLKX 3CLUC 3THYB 4A92A 1FU4A 5JCJD 3MAGA 4B6OA 4E5SA 1E3QA 3CONA 1G41A 4MIEA 3ZHOA 2WAOA 2QMZA 4X85A 3E0XA 2DM6A 3B3QA 1QLJA 3DPIA 2X19A 4K5QA 1O1YA 3KCQA 2C2GA 4O4IF 5JXWA 3HRIA 1XRJA 4KN8A 5B3AA 1IHXA 2A86A 4KXMA 1LZKA 5IN4A 5AVSA 1QFJA 4FLFA 3ICCA 1NF9A 1QG0A 4B85A 3L49A 2OQ2A 3BJMA 2H1VA