1QVXA

Solution structure of the fat domain of focal adhesion kinase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
134
structure length
134
Chain Sequence
RSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title NMR Solution Structure of the Focal Adhesion Targeting Domain of Focal Adhesion Kinase in Complex with a Paxillin LD Peptide: EVIDENCE FOR A TWO-SITE BINDING MODEL.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 55
structure length 134
sequence length 134
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1qvxA00
4XEVA 1KNYA 3C18A 3MFNA 1KTMA 1O3UA 4R32A 3GM2A 3O10A 1OW8A 4XEFA 1V4AA 3L8IA 3BRJA 2HSBA 1QVXA 3S9OA 4EBJA 3GM3A 1UFBA 3JYYA 3JZ0A 1OW7A 3C8GD 1K05A 2L6FA 3TULA 3C8GA 4NQFA 2JX0A 3U0CA 3RQEA 3B71A 1ZZPA 3U3FA 3AJMA 1JOGA 2L6HA 2Q00A 1K04A 2L6GA 3L8JA 2PBEA 3C8GB 3K7DA 2KK1A 3GM1A 3RQFA 1WWPA 1PV3A 4EBKA 2LK4A 2JPUA 1WOLA 1WTYA 4XEKA 5F28E 3RQGA 2YWAA 1OW6A 1K40A
chains in the Genus database with same CATH superfamily
2YLGA 3AG4C 2OEXA 3GODA 2R7VA 1TWGA 1I5NA 2HMQA 4WJ0A 3RYLA 4BG0A 2W4MA 3LLIA 1U6HA 3DI5A 5KYUB 4BPMA 1M2VA 2A69F 3ITFA 2J0XA 4XWJA 4YL1A 2YL3A 3LEOA 3EHMA 5A69A 3QW0A 1H9GA 4U9EA 3LJBA 3FXHA 1G5ZA 1FFTC 2IYLD 3S90A 2BL2A 3L0IA 1M56C 2VH3A 4N06A 3U3FA 3JRTA 1JOGA 1OR3A 4XPYA 2DI3A 2Q9AA 4X0RA 1ZHYA 2PX0A 4EWCA 1Q0KA 1NU9C 1SF8A 3T6JA 1DOWA 3B0VC 1XWJA 4IWBA 2VASA 2I8BA 1GS9A 2LP4A 2XL4A 4JTDB 1R5ID 4U5GA 4LACB 3I5PA 2XLHA 3UR3C 4CS8A 3AQBA 4MVMA 3T6BA 1V74B 3LAYA 2LFDA 2UUHA 4ONSA 3KMIA 4RDAA 1CPRA 3RKOF 3WAQA 1NU7D 3IQ5A 3SXMA 1TFOB 3KPHA 1NFOA 3HKKA 5DQTA 3HLZA 3CZ6A 3R2PA 4A4AA 3UMIA 2Y3DA 4ZLCA 1FNTc 1Z6AA 4JURI 4YK5A 2I15A 4J7YA 4PJMA 5COFA 3U8PA 3ZC4A 3JZ0A 3AOUA 3NDBB 1O5HA 1BR4A 3N24A 3Q7GA 1ORJA 2H7BA 1RKEA 2NUTA 1VYIA 1AEPA 4BJ1A 5D91A 4AK9A 1TWHA 3K33A 5HV9A 3UGOA 4DBRA 4UDVA 5CI9A 2PBEA 3CAXA 3K7DA 3UMHA 3EGXA 4MQ9F 3N0TA 4CS8C 1NBBA 5L0CA 3TQOA 1ZYRF 2J9WA 3GEHA 1E83A 2R7TA 3EZHA 4JC7A 3VRCA 1VLTA 1WOLA 4MTFA 5A6BD 4FESA 4MVSA 5L0FA 1K40A 2LIGA 3V5YA 3ASNC 5DQZA 4D4NA 1MMAA 3H65A 4MW8A 5L3VA 1ZVZA 3LS0A 3ATPA 3GM2A 3L34A 4N6CA 2OCCC 4C3EA 4JIOA 4CS7A 2HFIA 3ZDLA 1ZW2A 5DS4A 3SXZA 2M4EA 2R7QA 3TOMA 5DLJA 4J30B 3C62A 2HV7A 4CX9A 1HY5A 3KYIA 3NMKA 4D4XA 2G3VA 2XXAB 1VB5A 3W2VA 2WL8A 2PFDA 1FMVA 3ZQYA 2FAPB 3O39A 2G62A 1JMWA 2J8WA 5L0HA 2EPNA 1BR2A 5E2QA 3RVYA 3BEHA 1YA7O 1OCOC 2ZXOA 3GM1A 5JLIA 2OJED 1OXBA 3TJ5A 3VAYA 1T6IA 3MYFA 3JT1A 4B6IA 4I1OB 3W8IA 3H2UA 5B3SC 1ZHXA 4E7SA 1TR2A 1U0BB 1T01A 2YLIA 1TKNA 1V4AA 4U5HA 1S05A 5F5HA 4LLEA 4GQHA 2BC5A 1SYQA 2OJQA 1TWAA 2R05A 3A11A 4QI2A 1HW1A 4YT2A 3K6BA 1C17M 2W45A 3DWWA 4HEAJ 2NSFA 5KYWA 4C3BA 1NG1A 1VK5A 1ZZPA 3B71A 4OD5A 2IOQA 3G4ZA 1ST6A 2EPKX 5DS5A 3K66A 4KC9A 3FVYA 4M63A 4OIRF 3S27A 1ORYA 2L7AA 3ASOC 5CI8A 3FHDA 4MS2A 3AGUA 2LSEA 1T6UA 5F5FA 3RQGA 2V3CC 2WB7A 4JVSA 4U9DA 3FAPB 4FAPB 1AUEA 3ABMC 3LNRA 3MYIA 3TK0A 2MWQA 1LVKA 2J9BA 1LPEA 2XM0A 4LDKA 4LERA 3S0XA 3DE8A 4MVRA 2CYDA 2J9VA 2ASRA 3O55A 2DGJA 2AU5A 2VCCA 3O6XA 3UNGC 1OKKD 2O9XA 3M4CA 3IPMO 2YLDA 3FMSA 1D0XA 5E3AA 2CDQA 4OIPF 3RH3A 5A6KA 2YEVA 2QY9A 1S7ZA 3HNJA 2XS1A 5T1DB 3KL4A 1A41A 5E33A 3AJMA 2WZLA 3HNIA 3DE9A 3M15A 4G7HF 2NUPB 3X1OA 3HJCA 3EFOB 4H4KC 5FCLA 2G3KA 4XQ1A 1RJ9A 2ETSA 2XSEA 4DVZA 2KQ9A 4ANJA 1HE1A 4C7OB 1ORSC 3U8VA 1OKKA 2OQMA 3M1CB 1HE9A 1Z23A 4EBBA 4JE9A 2YWAA 1OW6A 2Q7RA 1YLMA 2XLOA 2EIJC 4CJOA 1CGOA 1QSPA 2Q9CA 2QNLA 2C04A 2H8AA 3UGPA 1FAPB 2C03A 4IJJA 3IQ6A 4EHPA 4RBNA 3R7CA 3M79A 2ZXPA 3SYNA 1ZHZA 3JYYA 2M64A 1A0BA 2J7PD 2FFHA 2XLEA 4E17A 4NQFA 1C03A 4HFFB 5B1AC 1DOVA 4U5CE 3B0UX 1H7IA 2WVQA 1O87A 3DM5A 4IGGA 1YA9A 1VOMA 3J06A 2L6GA 3IQCA 1KU2A 4H54A 1UG7A 4MVOA 1NLXA 3S28A 3DJNB 3DJUB 2KGOA 2PP4A 2HUJA 5JSLA 2YHSA 2JPUA 3EH2A 2EIKC 3EHNA 4K7BA 3JYHA 4PFPA 5D92A 3KKBA 3NYJA 2J7PA 1L3PA 2J0WA 2Q9BA 2R03A 1H6GA 2YL7A 3GWLA 3IEEA 4P9FA 5T3WA 3TOLA 4ER9A 1OW8A 2OEVA 2XRHA 1G8XA 3N2ZB 3VF0A 2CNWD 4CDYA 4JCHA 2AVKA 3DMDA 3EJNA 2EPOA 2P61A 3C8GD 4JTAB 3NYLA 1B68A 1OR2A 2A6HF 3EPVA 3U2MA 2VCAA 3NG1A 4PACA 2L81A 3WG7C 1YYXA 2QLAA 3JCUQ 4CIPA 5KYXA 3EGDA 2FGYA 4AX2A 3ZTZA 2CNWA 3C7JA 5L0GA 5KYYA 1AVOB 2YVKA 2P1AA 3PCVA 3U9JA 4XEKA 1FFHA 1WTYA 2DYSC 2EINC 3CEXA 1GGQA 1SZIA 3NMIA 1HMDA 3C8GA 1C02A 4KI2A 2LFFA 3DAGA 1BBHA 1T5OA 1L7CA 2XL6A 2GA0A 256BA 2UUIA 4MTOA 2AWYA 4MNDA 4XEFA 4OINF 4PJJA 3L8IA 4DOZA 3BRJA 4KNWA 1RKEB 2H7VC 2LQGA 2NUTB 2OOCA 1U89A 1E84A 1YAUO 3FOOA 2TMVP 2CCYA 1GQAA 4JEAA 4P9TA 2Y3HA 4JW1A 3EGXB 4E18A 3S84A 2WVOA 4O6NA 2X51A 3SXKA 2IXMA 2XXAA 4IARA 4RD9A 4L6RA 3W2WA 3HNKA 4NC3A 1D1AA 2R7RA 2LCHA 1XZPA 2WZGA 2XL8A 3JRMO 3JSEO 4G78A 1WWPA 1ZU5A 3B9QA 1V54C 3FDQA 5DS6A 4YWQA 1FTSA 1NSGB 1MMGA 2YZSA 4WGYA 3SP1A 3SXYA 3SZRA 2J46A 2VCBA 4CSAC 2KNHA 3C18A 4YT5A 1J8MF 3FAJA 2A6EF 1LIHA 2HJMA 2HKVA 3O10A 2GDCA 2XS8A 5FZTA 4E0IA 1LS4A 3CQZA 3JSZA 2MYSA 4NCQA 5COGA 2VC9A 4DBQA 1QQ3A 1ZHWA 2AWCA 2Y69C 4XLPF 3CSKA 1RKCA 4U5DE 3DZAA 1G4US 1QKRA 3EH1A 3RF3A 2HMZA 2OKUA 3ABKC 5BQGA 4J32B 4MTGA 1MNEA 3ZG1A 3PDMP 2AP3A 4Q7CA 3L8JA 2JD3A 2P0NA 3I4UA 4YN0B 1OQCA 5COMA 5T3TA 3NKDA 4YL3A 1YYJA 3RQFA 1CGNA 4O6YA 4W8KA 2YL0A 4I44A 4GYTA 1PD1A 2P7VA 1YDIA 3F46A 1MMDA 4MW3A 3G4XA 2OU6A 1KTMA 1T9KA 2A1DD 4CJGA 5JUAA 3C63A 2HJ3A 5AGFA 3L1MA 1I4YA 4PR9A 4E7ZA 5K0IA 3US6A 5KYWB 1BZ4A 2OG2A 4DXWA 5L0DA 1QZXA 4AL0A 1D0ZA 3S9OA 4FWVA 4IB4A 2HZ8A 3GM3A 4Z9IA 4OIOF 2GWWA 3DKAA 4I3MA 1K05A 1WGWA 4O6MA 1YZAA 2Q3TA 2R7WA 2DYRC 1D0YA 4EUKB 4PJLA 1A7EA 4YJWA 3ZSUA 4AE4A 3GANA 1YVIA 2J9UA 4K0DA 1Y4CA 4XPXA 1M6TA 2Q4FA 5JRAA 3DAFA 4XTKA 2D5RB 3U2LA 4BJ6C 5GPGB 1CPQA 5EHHA 4FX5A 2ZXRA 2A68F 4WGZA 1W2WA 4PJNA 3X2QC 3M4BA 4U5BE 3ECSA 1H9TA 2P6VA 4DRHB 4CDAA 4Q5SF 4MVQA 1KNYA 3AQCA 2CW0F 1OCZC 1WN0A 3FOPA 3AG2C 3EG9A 1HMOA 3NMJA 4O79A 4Z9JA 3SNHA 4BJTA 1N1CA 4ULWA 2KJGA 4P6IC 1Q0MA 4GEHA 4JCZA 2HSBA 4JTCB 2KYHA 2E87A 3Q6NA 2EPMX 1R4TA 5AC5A 5JVEA 4MVZA 3T4RA 1QLEC 1RJ9B 2EILC 5KYUA 5JT4A 1OXKA 1MNDA 1E86A 1JPNA 1M2OA 3EZIA 4U5EE 1EQ1A 1K04A 3B0PA 3B29A 1RCPA 2L9JA 3PMRA 2XLWA 5JP7A 4NY3A 3TJ6A 1LE2A 4IAOA 4CS9C 3UMKA 1A7VA 4KNVA 3QVYA 3KH2A 1J8YF 3OWTA 4JJGA 4BJ5C 5EK0A 3V5XA 3EQLF 4JRZA 1M2VB 1Z63A 5A6AA 1TQGA 4LLCA 1Y6DA 1LE4A 1Q0DA 2KC3A 2QUPA 2ZXWC 3GORA 3Q6MA 4CDVA 2F22A 4A2NB 2RD9A 3IQTA 4G7OF 1TWCA 2D4UA 4O7GA 4HE8D 2HV6A 2HS5A 1EKYA 4G0HA 2EPLX 5B1BC 3LUTB 1G4WR 2L6FA 2GFHA 4YL0A 4E0HA 2R7OA 2HSQA 3S29A 3K1IC 4LDRA 4OD4A 2R9RB 1JAFA 1T6QA 2Y3BA 2Z15A 1Z5ZA 2BE5F 1D1BA 1JR8A 3E70C 1Q0FA 3NKEA 3U9MA 3WODF 1Z3IX 2LK4A 3E9VA 3AGTA 3Q7LA 4C3DA 4EBKA 1CGME 3OEOA 4N4WA 2R02A 3WHNA 1OCRC 2V26A 1QPUA 2IBFA 2YKZA 3ZVRA 3U5SA 2NG1A 1EA8A 3T6GB 2W4BA 1LKXA 5DVWA 1JRAA 3ZIBA 3U3BA 4CSAA 2NSGA 4IRUA 1OCCC 4EBJA 1M57C 2RSEB 5BQIA 3PHF2 2QTVA 2R7SA 5KYXB 3EGDB 3C8ZA 4PFOA 4BEJA 5JS5A 4F4BA 3AG3C 3U0CA 5KYYB 2XLMA 4XPWA 4DVYP 2KW3C 3LS1A 2R25A 4LDQA 1VYKA 4NTFA 1VTMP 1SMYF 2ICWG 3A9CA 3C8GB 1NZEA 4YT4A 4Q4ZF 5L0IA 4JJFA 2YL1A 3V5ZA 1EI7A 1PD0A 3LESA 3T9OA 1LM3B 2H7OA 5B3IA 2J45A 1VLSA 3QMKA 1D1CA 2Y3GA 1Q0GA 3POVA 2R7XA 3OA1A 2XM4A 2YRFA 1O3UA 4R32A 5A6JA 4JZAA 1RXQA 3TD7A 1Z7Qc 1MMNA 3DXJF 1F1MA 1QVXA 4K1OA 1ZU4A 4W8PA 3LLKA 3ZTMA 5CIVA 3W8HA 4NTBA 4IAQA 1OW7A 1E85A 5L3QA 5A6BA 2JX0A 3QZCA 4N6HA 3SEOA 1NFNA 1LS1A 4DRJB 2R7UA 3GWNA 4AL1A 5HSWA 5EGYA 2XLVA 4MVUA 3K1HA 3ZWIA 4HFKB 2X0CA 1A7DA 4DRIB 2A0BA 1JPJA 2LD6A 4PK4A 3DM9B 3I5QA 4U5FE 4QDLA 4ZLDA 1E2XA 4I1MA 2IXOA 1SR2A 4BJ6A 5BQHA 1IW7F 2WVNA 3NYMA 3GEIA 2PX3A 1WASA 1I4ZA 2IM8A 2IXPA 2W9YA 2EIMC 3H2VA 3IHUA 2PF4E 1LI5A 5TJ5E 4DJ9A 3VM6A 4EIYA 1VMAA 1YJGA 4J7TA 4JEBA 1UFBA 4CIHA 1ZHTA 5E3CA 2KSFA 3TULA 1RMVA 1IZMA 1YARO 2A0UA 3MLGA 2XLDA 3RQEA 1FMWA 3MX3A 1HW2A 2IXNA 3GEEA 3AG1C 2NPUA 1LI7A 2KK1A 3JTLO 3QW1A 2ZPAA 1BDJB 5IY5C 3LEVA 3RW0A 4CBEA 1GM5A 2Y39A 2GAQA 1YZCA 4NTAA 3KYJA 1BR1A 2NUPA 3VYWA 3EFOA 3HTKC 4QI0A 1ZW3A 2QE9A 3F47A 4XEVA 3RFYA 3MFNA 4YT8A 2CGEA 4JKVA 4C7OA 4ULVA 4CS9A 3G50A 3NRHA 3RVZA 4OIQF 2MHRA 4BJ5A 4AE4B 3MBGA 3RIPA 5BUOA 1XZQA 1PCXA 2ZD9A 5L0JA 3QVZA 3LNMB 3V7OA 4Z9HA 3ZQVA 1TFKB 2DB4A 2L6HA 2B0HA 2Q00A 3DD7A 4XLNF 3ABLC 4G7ZF 1V55C 2WZFA 1APCA 2VB6A 1MQVA 1WATA 3HNLA 3QTHA 4BEMJ 5KYNA 1PV3A 2PNOA 2YQYA 3EG9B 3W4YA 3K1IA 4KBLA 5F28E 2B0JA 4EKWA 1FR0A 4WABA 5AC4A
chains in the Genus database with same CATH topology
4XEVA 1KNYA 3C18A 3MFNA 1KTMA 1O3UA 4R32A 3GM2A 3O10A 1OW8A 4XEFA 1V4AA 3L8IA 3BRJA 2HSBA 1QVXA 3S9OA 4EBJA 3GM3A 1UFBA 3JYYA 3JZ0A 1OW7A 3C8GD 1K05A 2L6FA 3TULA 3C8GA 4NQFA 2JX0A 3U0CA 3RQEA 3B71A 1ZZPA 3U3FA 3AJMA 1JOGA 2L6HA 2Q00A 1K04A 2L6GA 3L8JA 2PBEA 3C8GB 3K7DA 2KK1A 3GM1A 3RQFA 1WWPA 1PV3A 4EBKA 2LK4A 2JPUA 1WOLA 1WTYA 4XEKA 5F28E 3RQGA 2YWAA 1OW6A 1K40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XEV A;  1KNY A;  3C18 A;  3MFN A;  1KTM A;  1O3U A;  4R32 A;  3GM2 A;  3O10 A;  1OW8 A;  4XEF A;  1V4A A;  3L8I A;  3BRJ A;  2HSB A;  1QVX A;  3S9O A;  4EBJ A;  3GM3 A;  1UFB A;  3JYY A;  3JZ0 A;  1OW7 A;  3C8G D;  1K05 A;  2L6F A;  3TUL A;  3C8G A;  4NQF A;  2JX0 A;  3U0C A;  3RQE A;  3B71 A;  1ZZP A;  3U3F A;  3AJM A;  1JOG A;  2L6H A;  2Q00 A;  1K04 A;  2L6G A;  3L8J A;  2PBE A;  3C8G B;  3K7D A;  2KK1 A;  3GM1 A;  3RQF A;  1WWP A;  1PV3 A;  4EBK A;  2LK4 A;  2JPU A;  1WOL A;  1WTY A;  4XEK A;  5F28 E;  3RQG A;  2YWA A;  1OW6 A;  1K40 A; 
#chains in the Genus database with same CATH topology
 2YLG A;  3AG4 C;  2OEX A;  3GOD A;  2R7V A;  1TWG A;  1I5N A;  2HMQ A;  4WJ0 A;  3RYL A;  4BG0 A;  2W4M A;  3LLI A;  1U6H A;  3DI5 A;  5KYU B;  4BPM A;  1M2V A;  2A69 F;  3ITF A;  2J0X A;  4XWJ A;  4YL1 A;  2YL3 A;  3LEO A;  3EHM A;  5A69 A;  3QW0 A;  1H9G A;  4U9E A;  3LJB A;  3FXH A;  1G5Z A;  1FFT C;  2IYL D;  3S90 A;  2BL2 A;  3L0I A;  1M56 C;  2VH3 A;  4N06 A;  3U3F A;  3JRT A;  1JOG A;  1OR3 A;  4XPY A;  2DI3 A;  2Q9A A;  4X0R A;  1ZHY A;  2PX0 A;  4EWC A;  1Q0K A;  1NU9 C;  1SF8 A;  3T6J A;  1DOW A;  3B0V C;  1XWJ A;  4IWB A;  2VAS A;  2I8B A;  1GS9 A;  2LP4 A;  2XL4 A;  4JTD B;  1R5I D;  4U5G A;  4LAC B;  3I5P A;  2XLH A;  3UR3 C;  4CS8 A;  3AQB A;  4MVM A;  3T6B A;  1V74 B;  3LAY A;  2LFD A;  2UUH A;  4ONS A;  3KMI A;  4RDA A;  1CPR A;  3RKO F;  3WAQ A;  1NU7 D;  3IQ5 A;  3SXM A;  1TFO B;  3KPH A;  1NFO A;  3HKK A;  5DQT A;  3HLZ A;  3CZ6 A;  3R2P A;  4A4A A;  3UMI A;  2Y3D A;  4ZLC A;  1FNT c;  1Z6A A;  4JUR I;  4YK5 A;  2I15 A;  4J7Y A;  4PJM A;  5COF A;  3U8P A;  3ZC4 A;  3JZ0 A;  3AOU A;  3NDB B;  1O5H A;  1BR4 A;  3N24 A;  3Q7G A;  1ORJ A;  2H7B A;  1RKE A;  2NUT A;  1VYI A;  1AEP A;  4BJ1 A;  5D91 A;  4AK9 A;  1TWH A;  3K33 A;  5HV9 A;  3UGO A;  4DBR A;  4UDV A;  5CI9 A;  2PBE A;  3CAX A;  3K7D A;  3UMH A;  3EGX A;  4MQ9 F;  3N0T A;  4CS8 C;  1NBB A;  5L0C A;  3TQO A;  1ZYR F;  2J9W A;  3GEH A;  1E83 A;  2R7T A;  3EZH A;  4JC7 A;  3VRC A;  1VLT A;  1WOL A;  4MTF A;  5A6B D;  4FES A;  4MVS A;  5L0F A;  1K40 A;  2LIG A;  3V5Y A;  3ASN C;  5DQZ A;  4D4N A;  1MMA A;  3H65 A;  4MW8 A;  5L3V A;  1ZVZ A;  3LS0 A;  3ATP A;  3GM2 A;  3L34 A;  4N6C A;  2OCC C;  4C3E A;  4JIO A;  4CS7 A;  2HFI A;  3ZDL A;  1ZW2 A;  5DS4 A;  3SXZ A;  2M4E A;  2R7Q A;  3TOM A;  5DLJ A;  4J30 B;  3C62 A;  2HV7 A;  4CX9 A;  1HY5 A;  3KYI A;  3NMK A;  4D4X A;  2G3V A;  2XXA B;  1VB5 A;  3W2V A;  2WL8 A;  2PFD A;  1FMV A;  3ZQY A;  2FAP B;  3O39 A;  2G62 A;  1JMW A;  2J8W A;  5L0H A;  2EPN A;  1BR2 A;  5E2Q A;  3RVY A;  3BEH A;  1YA7 O;  1OCO C;  2ZXO A;  3GM1 A;  5JLI A;  2OJE D;  1OXB A;  3TJ5 A;  3VAY A;  1T6I A;  3MYF A;  3JT1 A;  4B6I A;  4I1O B;  3W8I A;  3H2U A;  5B3S C;  1ZHX A;  4E7S A;  1TR2 A;  1U0B B;  1T01 A;  2YLI A;  1TKN A;  1V4A A;  4U5H A;  1S05 A;  5F5H A;  4LLE A;  4GQH A;  2BC5 A;  1SYQ A;  2OJQ A;  1TWA A;  2R05 A;  3A11 A;  4QI2 A;  1HW1 A;  4YT2 A;  3K6B A;  1C17 M;  2W45 A;  3DWW A;  4HEA J;  2NSF A;  5KYW A;  4C3B A;  1NG1 A;  1VK5 A;  1ZZP A;  3B71 A;  4OD5 A;  2IOQ A;  3G4Z A;  1ST6 A;  2EPK X;  5DS5 A;  3K66 A;  4KC9 A;  3FVY A;  4M63 A;  4OIR F;  3S27 A;  1ORY A;  2L7A A;  3ASO C;  5CI8 A;  3FHD A;  4MS2 A;  3AGU A;  2LSE A;  1T6U A;  5F5F A;  3RQG A;  2V3C C;  2WB7 A;  4JVS A;  4U9D A;  3FAP B;  4FAP B;  1AUE A;  3ABM C;  3LNR A;  3MYI A;  3TK0 A;  2MWQ A;  1LVK A;  2J9B A;  1LPE A;  2XM0 A;  4LDK A;  4LER A;  3S0X A;  3DE8 A;  4MVR A;  2CYD A;  2J9V A;  2ASR A;  3O55 A;  2DGJ A;  2AU5 A;  2VCC A;  3O6X A;  3UNG C;  1OKK D;  2O9X A;  3M4C A;  3IPM O;  2YLD A;  3FMS A;  1D0X A;  5E3A A;  2CDQ A;  4OIP F;  3RH3 A;  5A6K A;  2YEV A;  2QY9 A;  1S7Z A;  3HNJ A;  2XS1 A;  5T1D B;  3KL4 A;  1A41 A;  5E33 A;  3AJM A;  2WZL A;  3HNI A;  3DE9 A;  3M15 A;  4G7H F;  2NUP B;  3X1O A;  3HJC A;  3EFO B;  4H4K C;  5FCL A;  2G3K A;  4XQ1 A;  1RJ9 A;  2ETS A;  2XSE A;  4DVZ A;  2KQ9 A;  4ANJ A;  1HE1 A;  4C7O B;  1ORS C;  3U8V A;  1OKK A;  2OQM A;  3M1C B;  1HE9 A;  1Z23 A;  4EBB A;  4JE9 A;  2YWA A;  1OW6 A;  2Q7R A;  1YLM A;  2XLO A;  2EIJ C;  4CJO A;  1CGO A;  1QSP A;  2Q9C A;  2QNL A;  2C04 A;  2H8A A;  3UGP A;  1FAP B;  2C03 A;  4IJJ A;  3IQ6 A;  4EHP A;  4RBN A;  3R7C A;  3M79 A;  2ZXP A;  3SYN A;  1ZHZ A;  3JYY A;  2M64 A;  1A0B A;  2J7P D;  2FFH A;  2XLE A;  4E17 A;  4NQF A;  1C03 A;  4HFF B;  5B1A C;  1DOV A;  4U5C E;  3B0U X;  1H7I A;  2WVQ A;  1O87 A;  3DM5 A;  4IGG A;  1YA9 A;  1VOM A;  3J06 A;  2L6G A;  3IQC A;  1KU2 A;  4H54 A;  1UG7 A;  4MVO A;  1NLX A;  3S28 A;  3DJN B;  3DJU B;  2KGO A;  2PP4 A;  2HUJ A;  5JSL A;  2YHS A;  2JPU A;  3EH2 A;  2EIK C;  3EHN A;  4K7B A;  3JYH A;  4PFP A;  5D92 A;  3KKB A;  3NYJ A;  2J7P A;  1L3P A;  2J0W A;  2Q9B A;  2R03 A;  1H6G A;  2YL7 A;  3GWL A;  3IEE A;  4P9F A;  5T3W A;  3TOL A;  4ER9 A;  1OW8 A;  2OEV A;  2XRH A;  1G8X A;  3N2Z B;  3VF0 A;  2CNW D;  4CDY A;  4JCH A;  2AVK A;  3DMD A;  3EJN A;  2EPO A;  2P61 A;  3C8G D;  4JTA B;  3NYL A;  1B68 A;  1OR2 A;  2A6H F;  3EPV A;  3U2M A;  2VCA A;  3NG1 A;  4PAC A;  2L81 A;  3WG7 C;  1YYX A;  2QLA A;  3JCU Q;  4CIP A;  5KYX A;  3EGD A;  2FGY A;  4AX2 A;  3ZTZ A;  2CNW A;  3C7J A;  5L0G A;  5KYY A;  1AVO B;  2YVK A;  2P1A A;  3PCV A;  3U9J A;  4XEK A;  1FFH A;  1WTY A;  2DYS C;  2EIN C;  3CEX A;  1GGQ A;  1SZI A;  3NMI A;  1HMD A;  3C8G A;  1C02 A;  4KI2 A;  2LFF A;  3DAG A;  1BBH A;  1T5O A;  1L7C A;  2XL6 A;  2GA0 A;  256B A;  2UUI A;  4MTO A;  2AWY A;  4MND A;  4XEF A;  4OIN F;  4PJJ A;  3L8I A;  4DOZ A;  3BRJ A;  4KNW A;  1RKE B;  2H7V C;  2LQG A;  2NUT B;  2OOC A;  1U89 A;  1E84 A;  1YAU O;  3FOO A;  2TMV P;  2CCY A;  1GQA A;  4JEA A;  4P9T A;  2Y3H A;  4JW1 A;  3EGX B;  4E18 A;  3S84 A;  2WVO A;  4O6N A;  2X51 A;  3SXK A;  2IXM A;  2XXA A;  4IAR A;  4RD9 A;  4L6R A;  3W2W A;  3HNK A;  4NC3 A;  1D1A A;  2R7R A;  2LCH A;  1XZP A;  2WZG A;  2XL8 A;  3JRM O;  3JSE O;  4G78 A;  1WWP A;  1ZU5 A;  3B9Q A;  1V54 C;  3FDQ A;  5DS6 A;  4YWQ A;  1FTS A;  1NSG B;  1MMG A;  2YZS A;  4WGY A;  3SP1 A;  3SXY A;  3SZR A;  2J46 A;  2VCB A;  4CSA C;  2KNH A;  3C18 A;  4YT5 A;  1J8M F;  3FAJ A;  2A6E F;  1LIH A;  2HJM A;  2HKV A;  3O10 A;  2GDC A;  2XS8 A;  5FZT A;  4E0I A;  1LS4 A;  3CQZ A;  3JSZ A;  2MYS A;  4NCQ A;  5COG A;  2VC9 A;  4DBQ A;  1QQ3 A;  1ZHW A;  2AWC A;  2Y69 C;  4XLP F;  3CSK A;  1RKC A;  4U5D E;  3DZA A;  1G4U S;  1QKR A;  3EH1 A;  3RF3 A;  2HMZ A;  2OKU A;  3ABK C;  5BQG A;  4J32 B;  4MTG A;  1MNE A;  3ZG1 A;  3PDM P;  2AP3 A;  4Q7C A;  3L8J A;  2JD3 A;  2P0N A;  3I4U A;  4YN0 B;  1OQC A;  5COM A;  5T3T A;  3NKD A;  4YL3 A;  1YYJ A;  3RQF A;  1CGN A;  4O6Y A;  4W8K A;  2YL0 A;  4I44 A;  4GYT A;  1PD1 A;  2P7V A;  1YDI A;  3F46 A;  1MMD A;  4MW3 A;  3G4X A;  2OU6 A;  1KTM A;  1T9K A;  2A1D D;  4CJG A;  5JUA A;  3C63 A;  2HJ3 A;  5AGF A;  3L1M A;  1I4Y A;  4PR9 A;  4E7Z A;  5K0I A;  3US6 A;  5KYW B;  1BZ4 A;  2OG2 A;  4DXW A;  5L0D A;  1QZX A;  4AL0 A;  1D0Z A;  3S9O A;  4FWV A;  4IB4 A;  2HZ8 A;  3GM3 A;  4Z9I A;  4OIO F;  2GWW A;  3DKA A;  4I3M A;  1K05 A;  1WGW A;  4O6M A;  1YZA A;  2Q3T A;  2R7W A;  2DYR C;  1D0Y A;  4EUK B;  4PJL A;  1A7E A;  4YJW A;  3ZSU A;  4AE4 A;  3GAN A;  1YVI A;  2J9U A;  4K0D A;  1Y4C A;  4XPX A;  1M6T A;  2Q4F A;  5JRA A;  3DAF A;  4XTK A;  2D5R B;  3U2L A;  4BJ6 C;  5GPG B;  1CPQ A;  5EHH A;  4FX5 A;  2ZXR A;  2A68 F;  4WGZ A;  1W2W A;  4PJN A;  3X2Q C;  3M4B A;  4U5B E;  3ECS A;  1H9T A;  2P6V A;  4DRH B;  4CDA A;  4Q5S F;  4MVQ A;  1KNY A;  3AQC A;  2CW0 F;  1OCZ C;  1WN0 A;  3FOP A;  3AG2 C;  3EG9 A;  1HMO A;  3NMJ A;  4O79 A;  4Z9J A;  3SNH A;  4BJT A;  1N1C A;  4ULW A;  2KJG A;  4P6I C;  1Q0M A;  4GEH A;  4JCZ A;  2HSB A;  4JTC B;  2KYH A;  2E87 A;  3Q6N A;  2EPM X;  1R4T A;  5AC5 A;  5JVE A;  4MVZ A;  3T4R A;  1QLE C;  1RJ9 B;  2EIL C;  5KYU A;  5JT4 A;  1OXK A;  1MND A;  1E86 A;  1JPN A;  1M2O A;  3EZI A;  4U5E E;  1EQ1 A;  1K04 A;  3B0P A;  3B29 A;  1RCP A;  2L9J A;  3PMR A;  2XLW A;  5JP7 A;  4NY3 A;  3TJ6 A;  1LE2 A;  4IAO A;  4CS9 C;  3UMK A;  1A7V A;  4KNV A;  3QVY A;  3KH2 A;  1J8Y F;  3OWT A;  4JJG A;  4BJ5 C;  5EK0 A;  3V5X A;  3EQL F;  4JRZ A;  1M2V B;  1Z63 A;  5A6A A;  1TQG A;  4LLC A;  1Y6D A;  1LE4 A;  1Q0D A;  2KC3 A;  2QUP A;  2ZXW C;  3GOR A;  3Q6M A;  4CDV A;  2F22 A;  4A2N B;  2RD9 A;  3IQT A;  4G7O F;  1TWC A;  2D4U A;  4O7G A;  4HE8 D;  2HV6 A;  2HS5 A;  1EKY A;  4G0H A;  2EPL X;  5B1B C;  3LUT B;  1G4W R;  2L6F A;  2GFH A;  4YL0 A;  4E0H A;  2R7O A;  2HSQ A;  3S29 A;  3K1I C;  4LDR A;  4OD4 A;  2R9R B;  1JAF A;  1T6Q A;  2Y3B A;  2Z15 A;  1Z5Z A;  2BE5 F;  1D1B A;  1JR8 A;  3E70 C;  1Q0F A;  3NKE A;  3U9M A;  3WOD F;  1Z3I X;  2LK4 A;  3E9V A;  3AGT A;  3Q7L A;  4C3D A;  4EBK A;  1CGM E;  3OEO A;  4N4W A;  2R02 A;  3WHN A;  1OCR C;  2V26 A;  1QPU A;  2IBF A;  2YKZ A;  3ZVR A;  3U5S A;  2NG1 A;  1EA8 A;  3T6G B;  2W4B A;  1LKX A;  5DVW A;  1JRA A;  3ZIB A;  3U3B A;  4CSA A;  2NSG A;  4IRU A;  1OCC C;  4EBJ A;  1M57 C;  2RSE B;  5BQI A;  3PHF 2;  2QTV A;  2R7S A;  5KYX B;  3EGD B;  3C8Z A;  4PFO A;  4BEJ A;  5JS5 A;  4F4B A;  3AG3 C;  3U0C A;  5KYY B;  2XLM A;  4XPW A;  4DVY P;  2KW3 C;  3LS1 A;  2R25 A;  4LDQ A;  1VYK A;  4NTF A;  1VTM P;  1SMY F;  2ICW G;  3A9C A;  3C8G B;  1NZE A;  4YT4 A;  4Q4Z F;  5L0I A;  4JJF A;  2YL1 A;  3V5Z A;  1EI7 A;  1PD0 A;  3LES A;  3T9O A;  1LM3 B;  2H7O A;  5B3I A;  2J45 A;  1VLS A;  3QMK A;  1D1C A;  2Y3G A;  1Q0G A;  3POV A;  2R7X A;  3OA1 A;  2XM4 A;  2YRF A;  1O3U A;  4R32 A;  5A6J A;  4JZA A;  1RXQ A;  3TD7 A;  1Z7Q c;  1MMN A;  3DXJ F;  1F1M A;  1QVX A;  4K1O A;  1ZU4 A;  4W8P A;  3LLK A;  3ZTM A;  5CIV A;  3W8H A;  4NTB A;  4IAQ A;  1OW7 A;  1E85 A;  5L3Q A;  5A6B A;  2JX0 A;  3QZC A;  4N6H A;  3SEO A;  1NFN A;  1LS1 A;  4DRJ B;  2R7U A;  3GWN A;  4AL1 A;  5HSW A;  5EGY A;  2XLV A;  4MVU A;  3K1H A;  3ZWI A;  4HFK B;  2X0C A;  1A7D A;  4DRI B;  2A0B A;  1JPJ A;  2LD6 A;  4PK4 A;  3DM9 B;  3I5Q A;  4U5F E;  4QDL A;  4ZLD A;  1E2X A;  4I1M A;  2IXO A;  1SR2 A;  4BJ6 A;  5BQH A;  1IW7 F;  2WVN A;  3NYM A;  3GEI A;  2PX3 A;  1WAS A;  1I4Z A;  2IM8 A;  2IXP A;  2W9Y A;  2EIM C;  3H2V A;  3IHU A;  2PF4 E;  1LI5 A;  5TJ5 E;  4DJ9 A;  3VM6 A;  4EIY A;  1VMA A;  1YJG A;  4J7T A;  4JEB A;  1UFB A;  4CIH A;  1ZHT A;  5E3C A;  2KSF A;  3TUL A;  1RMV A;  1IZM A;  1YAR O;  2A0U A;  3MLG A;  2XLD A;  3RQE A;  1FMW A;  3MX3 A;  1HW2 A;  2IXN A;  3GEE A;  3AG1 C;  2NPU A;  1LI7 A;  2KK1 A;  3JTL O;  3QW1 A;  2ZPA A;  1BDJ B;  5IY5 C;  3LEV A;  3RW0 A;  4CBE A;  1GM5 A;  2Y39 A;  2GAQ A;  1YZC A;  4NTA A;  3KYJ A;  1BR1 A;  2NUP A;  3VYW A;  3EFO A;  3HTK C;  4QI0 A;  1ZW3 A;  2QE9 A;  3F47 A;  4XEV A;  3RFY A;  3MFN A;  4YT8 A;  2CGE A;  4JKV A;  4C7O A;  4ULV A;  4CS9 A;  3G50 A;  3NRH A;  3RVZ A;  4OIQ F;  2MHR A;  4BJ5 A;  4AE4 B;  3MBG A;  3RIP A;  5BUO A;  1XZQ A;  1PCX A;  2ZD9 A;  5L0J A;  3QVZ A;  3LNM B;  3V7O A;  4Z9H A;  3ZQV A;  1TFK B;  2DB4 A;  2L6H A;  2B0H A;  2Q00 A;  3DD7 A;  4XLN F;  3ABL C;  4G7Z F;  1V55 C;  2WZF A;  1APC A;  2VB6 A;  1MQV A;  1WAT A;  3HNL A;  3QTH A;  4BEM J;  5KYN A;  1PV3 A;  2PNO A;  2YQY A;  3EG9 B;  3W4Y A;  3K1I A;  4KBL A;  5F28 E;  2B0J A;  4EKW A;  1FR0 A;  4WAB A;  5AC4 A; 
#chains in the Genus database with same CATH homology
 4XEV A;  1KNY A;  3C18 A;  3MFN A;  1KTM A;  1O3U A;  4R32 A;  3GM2 A;  3O10 A;  1OW8 A;  4XEF A;  1V4A A;  3L8I A;  3BRJ A;  2HSB A;  1QVX A;  3S9O A;  4EBJ A;  3GM3 A;  1UFB A;  3JYY A;  3JZ0 A;  1OW7 A;  3C8G D;  1K05 A;  2L6F A;  3TUL A;  3C8G A;  4NQF A;  2JX0 A;  3U0C A;  3RQE A;  3B71 A;  1ZZP A;  3U3F A;  3AJM A;  1JOG A;  2L6H A;  2Q00 A;  1K04 A;  2L6G A;  3L8J A;  2PBE A;  3C8G B;  3K7D A;  2KK1 A;  3GM1 A;  3RQF A;  1WWP A;  1PV3 A;  4EBK A;  2LK4 A;  2JPU A;  1WOL A;  1WTY A;  4XEK A;  5F28 E;  3RQG A;  2YWA A;  1OW6 A;  1K40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...