1QVXA

Solution structure of the fat domain of focal adhesion kinase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
134
structure length
134
Chain Sequence
RSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR Solution Structure of the Focal Adhesion Targeting Domain of Focal Adhesion Kinase in Complex with a Paxillin LD Peptide: EVIDENCE FOR A TWO-SITE BINDING MODEL.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 55
structure length 134
sequence length 134
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1qvxA00
2L6GA 3C18A 3BRJA 1UFBA 3C8GA 1KTMA 2JX0A 3U3FA 1K04A 3JZ0A 1WTYA 4NQFA 4XEVA 4R32A 1K05A 1JOGA 3B71A 2Q00A 3GM1A 3AJMA 4XEFA 3K7DA 3O10A 3L8IA 1OW6A 3RQEA 1QVXA 5F28E 2JPUA 2L6FA 1O3UA 1ZZPA 4XEKA 3U0CA 1K40A 2PBEA 2KK1A 3L8JA 4EBJA 2HSBA 2YWAA 3MFNA 3RQFA 3TULA 1KNYA 3JYYA 1WOLA 1WWPA 4EBKA 1OW8A 2LK4A 3C8GD 3RQGA 2L6HA 3GM3A 1OW7A 1PV3A 3GM2A 3C8GB 1V4AA 3S9OA
chains in the Genus database with same CATH superfamily
1WASA 4KBLA 4DRJB 2LQGA 3W4YA 3DKAA 3IHUA 3IPMO 3L1MA 2J7PA 2HV6A 2Y3HA 4K0DA 2XXAA 3J06A 4YN0B 1NU9C 4NQFA 1T6QA 2H7VC 3HTKC 4YT5A 3RVYA 3SEOA 3ZQVA 1JOGA 1S7ZA 2Y3BA 1A7EA 1EI7A 1NFNA 3K7DA 4I1OB 5A69A 1FNTc 1NBBA 1Z23A 2KNHA 3FOOA 3RQEA 2XLDA 1VB5A 2KC3A 2XL8A 4N4WA 1ZYRF 2M64A 4JJFA 4D4XA 1ORJA 3Q7LA 3NYJA 2X0CA 5L0GA 1L3PA 1ZHXA 2HMZA 2L9JA 1I4YA 2KW3C 3EGXA 3JT1A 2OJED 3HNIA 4Q4ZF 2R02A 1XZQA 2NPUA 1T01A 4JVSA 1RXQA 4MW8A 5E2QA 3C8GD 3U8VA 3RW0A 5KYUA 1NSGB 1G4US 1RKEB 3T4RA 4JRZA 5TJ5E 3LS0A 4H4KC 3VRCA 4U9EA 3S9OA 1FFTC 3U3BA 4K7BA 4MTGA 4WJ0A 4MVMA 1E83A 2EIKC 2WL8A 2AU5A 2CYDA 2JX0A 2KJGA 3RH3A 1JPNA 4IB4A 1PD1A 4N6HA 4CS9A 2Y69C 4AL0A 5F5FA 2WVOA 4MQ9F 1HW1A 3B29A 4PJMA 4XEFA 1T6UA 2OQMA 1F1MA 3KKBA 1HE1A 1QQ3A 1APCA 1OW6A 4G0HA 5E3CA 1BR1A 2CW0F 3N0TA 1Q0DA 4OIQF 1FTSA 1SF8A 4LERA 4NTBA 3IQCA 1CGNA 3IEEA 1ORSC 3GORA 2LD6A 1L7CA 3MFNA 4BPMA 2EILC 5T1DB 5A6BA 3K33A 1WOLA 3C62A 2VCBA 1D0XA 2V3CC 1VLTA 2WVNA 1OW7A 1TR2A 2L81A 4X0RA 4AK9A 1QKRA 2GAQA 2YLGA 3OWTA 5DQTA 2XLVA 2IXNA 4JCHA 1UFBA 4PFOA 3MX3A 1G4WR 1CGOA 4FWVA 3R7CA 4CS8C 1K04A 2YL1A 3DWWA 4XEVA 2J0WA 2Y3GA 1MNEA 5FZTA 3L34A 4OIPF 2J9BA 3KL4A 4E0HA 5CI8A 4KNVA 5JUAA 5T3TA 3T6JA 3PMRA 3DI5A 1YYJA 3E70C 4CX9A 2IXPA 2O9XA 4CDYA 1PCXA 1HMOA 2W4BA 5KYUB 4G7ZF 1IZMA 5DS4A 4EBJA 1R4TA 1MQVA 1OKKD 2HMQA 4MVSA 4XPXA 1SR2A 3Q6NA 2BC5A 2VB6A 2E87A 2KGOA 2Q9AA 2XS1A 1QZXA 1BR4A 2CNWA 3GM3A 3L0IA 4U5GA 4LDRA 1HW2A 4PR9A 2FAPB 2IOQA 4A4AA 2XM4A 2OEXA 5B3SC 4JW1A 3I5QA 1GQAA 1M2VA 3NRHA 2XSEA 3AGTA 3C8GA 2H7BA 3N2ZB 2IM8A 1LE4A 3GEEA 3RYLA 1RMVA 1G8XA 1E2XA 3B71A 3K1IC 5E3AA 1ZU5A 3SNHA 4JJGA 2AVKA 2Y3DA 3GWLA 1YAUO 2PF4E 2R7QA 4L6RA 1R5ID 1K40A 5EGYA 3DAFA 5JVEA 3AG2C 4CSAC 3CZ6A 2Q9CA 2NUPA 4MVRA 2YHSA 4BJTA 3NYMA 3DM5A 4G7OF 2L6HA 1SMYF 1V74B 1LKXA 4HFFB 3AG3C 2J0XA 3GM2A 3TJ6A 1M2OA 3EHMA 2M4EA 4O79A 4BJ5A 3DE9A 4GEHA 3VM6A 4YT8A 4IGGA 3RVZA 3SP1A 3WAQA 2XLOA 4IJJA 4P9TA 3ABKC 1FR0A 2XLMA 3AG1C 1RJ9A 3PCVA 4DRHB 1IW7F 4U5EE 4U5CE 1QPUA 2DI3A 1YZCA 3NKDA 1A0BA 3A11A 4YL1A 3EQLF 1EA8A 2L7AA 3F47A 4EUKB 3PHF2 3K66A 1JR8A 4G78A 4OIRF 5F28E 2AP3A 3V5XA 4MVZA 3JYHA 4XEKA 3U0CA 2B0JA 3AQCA 1H6GA 2EPKX 2G3VA 5BQGA 2YWAA 4P6IC 4PJLA 1QLEC 4MTFA 2GWWA 3C63A 3DJNB 4C3DA 4E7ZA 3FVYA 5KYXA 1M6TA 1ZHYA 4JIOA 3QTHA 4EKWA 1MMAA 4JTDB 5DLJA 5IY5C 2OCCC 3DAGA 4NTFA 1FAPB 1TKNA 1V55C 5EK0A 4WGYA 1YDIA 1ZVZA 1YYXA 3H65A 1BDJB 2DYSC 2B0HA 3NDBB 5BUOA 2OG2A 4O6YA 1AVOB 2R9RB 3M15A 5GPGB 2V26A 4CDVA 2HZ8A 1VYIA 1CGME 2YZSA 4CSAA 2QY9A 5K0IA 4IAOA 1TWCA 4ER9A 2P7VA 2P6VA 3L8JA 3TK0A 3RQFA 2Q7RA 1D1CA 4Q7CA 1LS4A 4C3EA 3K1HA 4DBQA 1ZHWA 2ASRA 3EFOB 1LE2A 1MNDA 256BA 2KYHA 2YKZA 3N24A 3FXHA 2Q4FA 3A9CA 4WABA 4Z9HA 1MMGA 1C02A 2DB4A 4YL3A 3EZHA 3NYLA 3EGDB 2YLIA 3SXZA 2LIGA 1ZU4A 1OCZC 5AGFA 3UMIA 1JMWA 4DXWA 5D92A 4E17A 1VLSA 4UDVA 5B3IA 3UNGC 3LEOA 4C7OA 3ZDLA 4ZLCA 2OEVA 4CJOA 5BQIA 2I8BA 1OR2A 4ZLDA 3QW0A 4YJWA 4CDAA 4U5HA 1O87A 3B0PA 3G4XA 1HY5A 1TWHA 4U9DA 4FESA 3X1OA 3U2LA 3ZIBA 1GM5A 1Q0GA 1H9GA 2AWCA 4LLCA 5DVWA 3FOPA 1BR2A 2LK4A 2W4MA 1CPQA 4ULVA 3RQGA 3WG7C 3AOUA 3W8HA 3ZSUA 3B0VC 3LEVA 2I15A 5JT4A 1VYKA 1WATA 1M57C 4D4NA 3DZAA 3BRJA 3ASNC 3QVYA 1D1AA 4AE4A 1BBHA 4B6IA 1NG1A 1OXKA 2QE9A 3AQBA 3C7JA 2WB7A 3S90A 4DVZA 3GANA 3CSKA 5B1BC 3K6BA 4J7TA 4FX5A 2OU6A 2VCCA 3S27A 3TOLA 3UMHA 3Q6MA 3IQ5A 1RKEA 2P0NA 3LNRA 4J32B 3V5YA 5L3QA 2IBFA 1YA9A 2CNWD 1Z7Qc 3K1IA 1WGWA 3MBGA 4LLEA 4DOZA 2J45A 3EGXB 3NKEA 2J9WA 3KPHA 3NG1A 4YK5A 3TD7A 2ETSA 1Y4CA 4F4BA 2TMVP 4OIOF 1O5HA 5AC5A 4MW3A 5COMA 4Q5SF 2MYSA 3W2WA 4W8KA 2A69F 2NSGA 5DQZA 5L0CA 2HKVA 2H7OA 3DMDA 1OCCC 1OQCA 2A6EF 2NUTB 3T6GB 3POVA 3FHDA 5A6KA 3C18A 3G50A 2CGEA 3RKOF 3TJ5A 1E85A 2R7SA 2BL2A 1H9TA 2R7OA 4JZAA 2XXAB 1U6HA 2A6HF 1HE9A 3FMSA 3VYWA 2Q00A 2XS8A 1A7VA 3X2QC 1DOWA 2MWQA 1GGQA 2QTVA 4AE4B 3DE8A 5JRAA 1E84A 4IARA 2R7TA 5L0DA 4NY3A 2JPUA 2RD9A 4BJ1A 4GYTA 4JCZA 1Q0KA 1I4ZA 1XZPA 4JURI 2VC9A 5B1AC 4CS7A 3I5PA 2KK1A 1W2WA 3M79A 2HSBA 4MTOA 5KYNA 2EIJC 4U5BE 4BG0A 3JYYA 4KI2A 1U0BB 1BZ4A 1OW8A 3FAJA 4A2NB 4MNDA 3ZVRA 4BEJA 4CIHA 5L0JA 4ONSA 3O39A 3ABLC 1H7IA 2QUPA 4QDLA 2CDQA 3Q7GA 3SXKA 2R7WA 4MS2A 3T6BA 3M4CA 4NCQA 2NG1A 2YL3A 2EIMC 4AL1A 2FGYA 2P61A 3GEHA 2NUPB 3JRTA 4NC3A 4OD4A 4R32A 1N1CA 3E9VA 3EGDA 4MVUA 3US6A 2WZLA 3DD7A 3JSEO 3SYNA 4J7YA 5FCLA 1EQ1A 4YL0A 3EH1A 3LLIA 5KYYA 1YJGA 2D5RB 2R25A 3ATPA 3I4UA 1ZHZA 1MMDA 1ZZPA 4XQ1A 1VMAA 2PBEA 4LDQA 2W9YA 1NFOA 2LSEA 1CPRA 2Y39A 3ITFA 4PJNA 1G5ZA 2KSFA 2WZFA 4IRUA 2P1AA 3HNJA 4EWCA 5L0HA 5KYWB 1TQGA 4Z9IA 4O6NA 3U2MA 1M2VB 1LS1A 2IXMA 2XL4A 2H8AA 5COFA 4PACA 3ZTMA 4GQHA 1MMNA 1NLXA 3ZWIA 2YVKA 4YT4A 1JPJA 2J46A 3QMKA 1T5OA 5AC4A 2OJQA 2ZXOA 2LCHA 4N6CA 3TQOA 1I5NA 1V54C 2WZGA 4H54A 3EHNA 3O10A 1Z3IX 3U9MA 2R05A 1OKKA 4P9FA 5JP7A 3EG9B 4RD9A 5EHHA 2BE5F 3FAPB 1TFKB 3S29A 1D1BA 1WN0A 2ICWG 2ZD9A 5A6JA 4G7HF 2F22A 2A68F 3LS1A 4JC7A 3LAYA 1TWGA 3MYIA 3ZQYA 2EPLX 1ORYA 3U8PA 1C17M 1KNYA 3WHNA 1EKYA 2EINC 1AEPA 3MLGA 2J7PD 3KYIA 2ZXPA 2OOCA 5L0IA 2HUJA 4RDAA 2LP4A 3ZTZA 1OCRC 3OA1A 4KC9A 3S28A 1A7DA 2MHRA 1YZAA 1ZW3A 4LDKA 5BQHA 4JTCB 3DJUB 1UG7A 4DJ9A 1RJ9B 3UMKA 2G62A 2HFIA 2NSFA 4XTKA 1QSPA 3UR3C 4XWJA 1VOMA 3ZC4A 2HJ3A 4ANJA 4E18A 3O6XA 2R03A 3KYJA 2A0BA 1OXBA 4RBNA 4PK4A 1J8YF 3CAXA 1LIHA 3F46A 2NUTA 5DS5A 1Z6AA 2YRFA 4J30B 4PFPA 2J9UA 2WVQA 1RKCA 2YQYA 2HS5A 3GEIA 4XPWA 2AWYA 4Z9JA 3EH2A 3TOMA 4AX2A 4EBBA 2J8WA 1DOVA 1D0ZA 1YA7O 3QW1A 4XLNF 3VAYA 3JCUQ 2R7XA 4EHPA 3G4ZA 4HEAJ 2XRHA 2YEVA 1FFHA 3U5SA 4EIYA 4DBRA 5JSLA 3SXMA 4JE9A 5KYWA 1LM3B 3WODF 5T3WA 1Z63A 3R2PA 2R7UA 1B68A 1KTMA 1ZHTA 2Z15A 3T9OA 3ZG1A 2LFDA 2Q3TA 3JZ0A 4K1OA 2KQ9A 1JAFA 1YARO 2HSQA 3AJMA 1LI5A 4MVOA 5CI9A 1FMWA 1YVIA 3V5ZA 2UUIA 2A0UA 2W45A 1LI7A 5DS6A 5KYYB 1SYQA 3S84A 4CIPA 1OCOC 2EPNA 3IQ6A 3IQTA 1Q0MA 3O55A 1NU7D 4MVQA 5CIVA 1VK5A 3C8ZA 4KNWA 1Z5ZA 4BJ6A 5JS5A 4C3BA 3LNMB 2PFDA 3UGPA 1PV3A 3EJNA 2DYRC 1PD0A 3KMIA 2C04A 4CS9C 1V4AA 2L6GA 4JEAA 5A6BD 3B0UX 1NZEA 2IYLD 4QI0A 5L3VA 5E33A 3MYFA 2RSEB 3LUTB 2OKUA 4I1MA 1WTYA 4U5FE 4W8PA 3RFYA 1K05A 3S0XA 2R7VA 4OINF 2DGJA 4I3MA 3ASOC 5COGA 1A41A 3GODA 1QVXA 4IAQA 3EZIA 3HNLA 1J8MF 3CEXA 2L6FA 2XM0A 2ZXWC 2VH3A 4XPYA 1OR3A 2ZXRA 3EFOA 3QZCA 4WGZA 3W8IA 2YLDA 1VTMP 2CCYA 2EPOA 2XL6A 1T6IA 2D4UA 2QLAA 4CJGA 1M56C 3NMIA 4I44A 3SZRA 3LLKA 3JTLO 4QI2A 1Y6DA 1FMVA 2A1DD 3M4BA 4CS8A 3W2VA 1KU2A 3EPVA 2YL7A 3EG9A 3C8GB 1C03A 3H2UA 3CQZA 3HLZA 4LACB 3ECSA 3U9JA 2Q9BA 2R7RA 4ULWA 5F5HA 1RCPA 2HJMA 3HKKA 4HE8D 3SXYA 4E7SA 2EPMX 1ZW2A 1YLMA 2XLHA 4YWQA 3PDMP 3GM1A 5L0FA 2X51A 3V7OA 2XLWA 2FFHA 1XWJA 3L8IA 1TWAA 3LJBA 3M1CB 1AUEA 1HMDA 1Q0FA 1SZIA 2C03A 3HJCA 3RIPA 3UGOA 2G3KA 3HNKA 5KYXB 3QVZA 4OD5A 3OEOA 4BJ6C 5HSWA 2ZPAA 3DM9B 5HV9A 3BEHA 3RF3A 1WWPA 1LPEA 2VCAA 4DVYP 4YT2A 3AGUA 3GWNA 2GDCA 3JRMO 4JKVA 2YL0A 3NMKA 2GA0A 4O7GA 4O6MA 4CBEA 4PJJA 1T9KA 4JTAB 2GFHA 3DXJF 2PX3A 3LESA 3U3FA 3NMJA 5D91A 4N06A 3KH2A 1JRAA 4FAPB 2PP4A 3AG4C 3JSZA 4XLPF 1D0YA 2QNLA 2VASA 1S05A 4JEBA 1TFOB 2HV7A 2IXOA 4U5DE 3FDQA 1LVKA 3H2VA 1O3UA 4BEMJ 4C7OB 2JD3A 3ABMC 1ST6A 2J9VA 2XLEA 4BJ5C 5JLIA 4NTAA 3TULA 4E0IA 2LFFA 3B9QA 4IWBA 1GS9A 2PNOA 1E86A 4EBKA 5A6AA 4HFKB 2PX0A 1U89A 4M63A 2UUHA 4DRIB 3VF0A
chains in the Genus database with same CATH topology
2L6GA 3C18A 3BRJA 1UFBA 3C8GA 1KTMA 2JX0A 3U3FA 1K04A 3JZ0A 1WTYA 4NQFA 4XEVA 4R32A 1K05A 1JOGA 3B71A 2Q00A 3GM1A 3AJMA 4XEFA 3K7DA 3O10A 3L8IA 1OW6A 3RQEA 1QVXA 5F28E 2JPUA 2L6FA 1O3UA 1ZZPA 4XEKA 3U0CA 1K40A 2PBEA 2KK1A 3L8JA 4EBJA 2HSBA 2YWAA 3MFNA 3RQFA 3TULA 1KNYA 3JYYA 1WOLA 1WWPA 4EBKA 1OW8A 2LK4A 3C8GD 3RQGA 2L6HA 3GM3A 1OW7A 1PV3A 3GM2A 3C8GB 1V4AA 3S9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6G A;  3C18 A;  3BRJ A;  1UFB A;  3C8G A;  1KTM A;  2JX0 A;  3U3F A;  1K04 A;  3JZ0 A;  1WTY A;  4NQF A;  4XEV A;  4R32 A;  1K05 A;  1JOG A;  3B71 A;  2Q00 A;  3GM1 A;  3AJM A;  4XEF A;  3K7D A;  3O10 A;  3L8I A;  1OW6 A;  3RQE A;  1QVX A;  5F28 E;  2JPU A;  2L6F A;  1O3U A;  1ZZP A;  4XEK A;  3U0C A;  1K40 A;  2PBE A;  2KK1 A;  3L8J A;  4EBJ A;  2HSB A;  2YWA A;  3MFN A;  3RQF A;  3TUL A;  1KNY A;  3JYY A;  1WOL A;  1WWP A;  4EBK A;  1OW8 A;  2LK4 A;  3C8G D;  3RQG A;  2L6H A;  3GM3 A;  1OW7 A;  1PV3 A;  3GM2 A;  3C8G B;  1V4A A;  3S9O A; 
#chains in the Genus database with same CATH topology
 1WAS A;  4KBL A;  4DRJ B;  2LQG A;  3W4Y A;  3DKA A;  3IHU A;  3IPM O;  3L1M A;  2J7P A;  2HV6 A;  2Y3H A;  4K0D A;  2XXA A;  3J06 A;  4YN0 B;  1NU9 C;  4NQF A;  1T6Q A;  2H7V C;  3HTK C;  4YT5 A;  3RVY A;  3SEO A;  3ZQV A;  1JOG A;  1S7Z A;  2Y3B A;  1A7E A;  1EI7 A;  1NFN A;  3K7D A;  4I1O B;  5A69 A;  1FNT c;  1NBB A;  1Z23 A;  2KNH A;  3FOO A;  3RQE A;  2XLD A;  1VB5 A;  2KC3 A;  2XL8 A;  4N4W A;  1ZYR F;  2M64 A;  4JJF A;  4D4X A;  1ORJ A;  3Q7L A;  3NYJ A;  2X0C A;  5L0G A;  1L3P A;  1ZHX A;  2HMZ A;  2L9J A;  1I4Y A;  2KW3 C;  3EGX A;  3JT1 A;  2OJE D;  3HNI A;  4Q4Z F;  2R02 A;  1XZQ A;  2NPU A;  1T01 A;  4JVS A;  1RXQ A;  4MW8 A;  5E2Q A;  3C8G D;  3U8V A;  3RW0 A;  5KYU A;  1NSG B;  1G4U S;  1RKE B;  3T4R A;  4JRZ A;  5TJ5 E;  3LS0 A;  4H4K C;  3VRC A;  4U9E A;  3S9O A;  1FFT C;  3U3B A;  4K7B A;  4MTG A;  4WJ0 A;  4MVM A;  1E83 A;  2EIK C;  2WL8 A;  2AU5 A;  2CYD A;  2JX0 A;  2KJG A;  3RH3 A;  1JPN A;  4IB4 A;  1PD1 A;  4N6H A;  4CS9 A;  2Y69 C;  4AL0 A;  5F5F A;  2WVO A;  4MQ9 F;  1HW1 A;  3B29 A;  4PJM A;  4XEF A;  1T6U A;  2OQM A;  1F1M A;  3KKB A;  1HE1 A;  1QQ3 A;  1APC A;  1OW6 A;  4G0H A;  5E3C A;  1BR1 A;  2CW0 F;  3N0T A;  1Q0D A;  4OIQ F;  1FTS A;  1SF8 A;  4LER A;  4NTB A;  3IQC A;  1CGN A;  3IEE A;  1ORS C;  3GOR A;  2LD6 A;  1L7C A;  3MFN A;  4BPM A;  2EIL C;  5T1D B;  5A6B A;  3K33 A;  1WOL A;  3C62 A;  2VCB A;  1D0X A;  2V3C C;  1VLT A;  2WVN A;  1OW7 A;  1TR2 A;  2L81 A;  4X0R A;  4AK9 A;  1QKR A;  2GAQ A;  2YLG A;  3OWT A;  5DQT A;  2XLV A;  2IXN A;  4JCH A;  1UFB A;  4PFO A;  3MX3 A;  1G4W R;  1CGO A;  4FWV A;  3R7C A;  4CS8 C;  1K04 A;  2YL1 A;  3DWW A;  4XEV A;  2J0W A;  2Y3G A;  1MNE A;  5FZT A;  3L34 A;  4OIP F;  2J9B A;  3KL4 A;  4E0H A;  5CI8 A;  4KNV A;  5JUA A;  5T3T A;  3T6J A;  3PMR A;  3DI5 A;  1YYJ A;  3E70 C;  4CX9 A;  2IXP A;  2O9X A;  4CDY A;  1PCX A;  1HMO A;  2W4B A;  5KYU B;  4G7Z F;  1IZM A;  5DS4 A;  4EBJ A;  1R4T A;  1MQV A;  1OKK D;  2HMQ A;  4MVS A;  4XPX A;  1SR2 A;  3Q6N A;  2BC5 A;  2VB6 A;  2E87 A;  2KGO A;  2Q9A A;  2XS1 A;  1QZX A;  1BR4 A;  2CNW A;  3GM3 A;  3L0I A;  4U5G A;  4LDR A;  1HW2 A;  4PR9 A;  2FAP B;  2IOQ A;  4A4A A;  2XM4 A;  2OEX A;  5B3S C;  4JW1 A;  3I5Q A;  1GQA A;  1M2V A;  3NRH A;  2XSE A;  3AGT A;  3C8G A;  2H7B A;  3N2Z B;  2IM8 A;  1LE4 A;  3GEE A;  3RYL A;  1RMV A;  1G8X A;  1E2X A;  3B71 A;  3K1I C;  5E3A A;  1ZU5 A;  3SNH A;  4JJG A;  2AVK A;  2Y3D A;  3GWL A;  1YAU O;  2PF4 E;  2R7Q A;  4L6R A;  1R5I D;  1K40 A;  5EGY A;  3DAF A;  5JVE A;  3AG2 C;  4CSA C;  3CZ6 A;  2Q9C A;  2NUP A;  4MVR A;  2YHS A;  4BJT A;  3NYM A;  3DM5 A;  4G7O F;  2L6H A;  1SMY F;  1V74 B;  1LKX A;  4HFF B;  3AG3 C;  2J0X A;  3GM2 A;  3TJ6 A;  1M2O A;  3EHM A;  2M4E A;  4O79 A;  4BJ5 A;  3DE9 A;  4GEH A;  3VM6 A;  4YT8 A;  4IGG A;  3RVZ A;  3SP1 A;  3WAQ A;  2XLO A;  4IJJ A;  4P9T A;  3ABK C;  1FR0 A;  2XLM A;  3AG1 C;  1RJ9 A;  3PCV A;  4DRH B;  1IW7 F;  4U5E E;  4U5C E;  1QPU A;  2DI3 A;  1YZC A;  3NKD A;  1A0B A;  3A11 A;  4YL1 A;  3EQL F;  1EA8 A;  2L7A A;  3F47 A;  4EUK B;  3PHF 2;  3K66 A;  1JR8 A;  4G78 A;  4OIR F;  5F28 E;  2AP3 A;  3V5X A;  4MVZ A;  3JYH A;  4XEK A;  3U0C A;  2B0J A;  3AQC A;  1H6G A;  2EPK X;  2G3V A;  5BQG A;  2YWA A;  4P6I C;  4PJL A;  1QLE C;  4MTF A;  2GWW A;  3C63 A;  3DJN B;  4C3D A;  4E7Z A;  3FVY A;  5KYX A;  1M6T A;  1ZHY A;  4JIO A;  3QTH A;  4EKW A;  1MMA A;  4JTD B;  5DLJ A;  5IY5 C;  2OCC C;  3DAG A;  4NTF A;  1FAP B;  1TKN A;  1V55 C;  5EK0 A;  4WGY A;  1YDI A;  1ZVZ A;  1YYX A;  3H65 A;  1BDJ B;  2DYS C;  2B0H A;  3NDB B;  5BUO A;  2OG2 A;  4O6Y A;  1AVO B;  2R9R B;  3M15 A;  5GPG B;  2V26 A;  4CDV A;  2HZ8 A;  1VYI A;  1CGM E;  2YZS A;  4CSA A;  2QY9 A;  5K0I A;  4IAO A;  1TWC A;  4ER9 A;  2P7V A;  2P6V A;  3L8J A;  3TK0 A;  3RQF A;  2Q7R A;  1D1C A;  4Q7C A;  1LS4 A;  4C3E A;  3K1H A;  4DBQ A;  1ZHW A;  2ASR A;  3EFO B;  1LE2 A;  1MND A;  256B A;  2KYH A;  2YKZ A;  3N24 A;  3FXH A;  2Q4F A;  3A9C A;  4WAB A;  4Z9H A;  1MMG A;  1C02 A;  2DB4 A;  4YL3 A;  3EZH A;  3NYL A;  3EGD B;  2YLI A;  3SXZ A;  2LIG A;  1ZU4 A;  1OCZ C;  5AGF A;  3UMI A;  1JMW A;  4DXW A;  5D92 A;  4E17 A;  1VLS A;  4UDV A;  5B3I A;  3UNG C;  3LEO A;  4C7O A;  3ZDL A;  4ZLC A;  2OEV A;  4CJO A;  5BQI A;  2I8B A;  1OR2 A;  4ZLD A;  3QW0 A;  4YJW A;  4CDA A;  4U5H A;  1O87 A;  3B0P A;  3G4X A;  1HY5 A;  1TWH A;  4U9D A;  4FES A;  3X1O A;  3U2L A;  3ZIB A;  1GM5 A;  1Q0G A;  1H9G A;  2AWC A;  4LLC A;  5DVW A;  3FOP A;  1BR2 A;  2LK4 A;  2W4M A;  1CPQ A;  4ULV A;  3RQG A;  3WG7 C;  3AOU A;  3W8H A;  3ZSU A;  3B0V C;  3LEV A;  2I15 A;  5JT4 A;  1VYK A;  1WAT A;  1M57 C;  4D4N A;  3DZA A;  3BRJ A;  3ASN C;  3QVY A;  1D1A A;  4AE4 A;  1BBH A;  4B6I A;  1NG1 A;  1OXK A;  2QE9 A;  3AQB A;  3C7J A;  2WB7 A;  3S90 A;  4DVZ A;  3GAN A;  3CSK A;  5B1B C;  3K6B A;  4J7T A;  4FX5 A;  2OU6 A;  2VCC A;  3S27 A;  3TOL A;  3UMH A;  3Q6M A;  3IQ5 A;  1RKE A;  2P0N A;  3LNR A;  4J32 B;  3V5Y A;  5L3Q A;  2IBF A;  1YA9 A;  2CNW D;  1Z7Q c;  3K1I A;  1WGW A;  3MBG A;  4LLE A;  4DOZ A;  2J45 A;  3EGX B;  3NKE A;  2J9W A;  3KPH A;  3NG1 A;  4YK5 A;  3TD7 A;  2ETS A;  1Y4C A;  4F4B A;  2TMV P;  4OIO F;  1O5H A;  5AC5 A;  4MW3 A;  5COM A;  4Q5S F;  2MYS A;  3W2W A;  4W8K A;  2A69 F;  2NSG A;  5DQZ A;  5L0C A;  2HKV A;  2H7O A;  3DMD A;  1OCC C;  1OQC A;  2A6E F;  2NUT B;  3T6G B;  3POV A;  3FHD A;  5A6K A;  3C18 A;  3G50 A;  2CGE A;  3RKO F;  3TJ5 A;  1E85 A;  2R7S A;  2BL2 A;  1H9T A;  2R7O A;  4JZA A;  2XXA B;  1U6H A;  2A6H F;  1HE9 A;  3FMS A;  3VYW A;  2Q00 A;  2XS8 A;  1A7V A;  3X2Q C;  1DOW A;  2MWQ A;  1GGQ A;  2QTV A;  4AE4 B;  3DE8 A;  5JRA A;  1E84 A;  4IAR A;  2R7T A;  5L0D A;  4NY3 A;  2JPU A;  2RD9 A;  4BJ1 A;  4GYT A;  4JCZ A;  1Q0K A;  1I4Z A;  1XZP A;  4JUR I;  2VC9 A;  5B1A C;  4CS7 A;  3I5P A;  2KK1 A;  1W2W A;  3M79 A;  2HSB A;  4MTO A;  5KYN A;  2EIJ C;  4U5B E;  4BG0 A;  3JYY A;  4KI2 A;  1U0B B;  1BZ4 A;  1OW8 A;  3FAJ A;  4A2N B;  4MND A;  3ZVR A;  4BEJ A;  4CIH A;  5L0J A;  4ONS A;  3O39 A;  3ABL C;  1H7I A;  2QUP A;  4QDL A;  2CDQ A;  3Q7G A;  3SXK A;  2R7W A;  4MS2 A;  3T6B A;  3M4C A;  4NCQ A;  2NG1 A;  2YL3 A;  2EIM C;  4AL1 A;  2FGY A;  2P61 A;  3GEH A;  2NUP B;  3JRT A;  4NC3 A;  4OD4 A;  4R32 A;  1N1C A;  3E9V A;  3EGD A;  4MVU A;  3US6 A;  2WZL A;  3DD7 A;  3JSE O;  3SYN A;  4J7Y A;  5FCL A;  1EQ1 A;  4YL0 A;  3EH1 A;  3LLI A;  5KYY A;  1YJG A;  2D5R B;  2R25 A;  3ATP A;  3I4U A;  1ZHZ A;  1MMD A;  1ZZP A;  4XQ1 A;  1VMA A;  2PBE A;  4LDQ A;  2W9Y A;  1NFO A;  2LSE A;  1CPR A;  2Y39 A;  3ITF A;  4PJN A;  1G5Z A;  2KSF A;  2WZF A;  4IRU A;  2P1A A;  3HNJ A;  4EWC A;  5L0H A;  5KYW B;  1TQG A;  4Z9I A;  4O6N A;  3U2M A;  1M2V B;  1LS1 A;  2IXM A;  2XL4 A;  2H8A A;  5COF A;  4PAC A;  3ZTM A;  4GQH A;  1MMN A;  1NLX A;  3ZWI A;  2YVK A;  4YT4 A;  1JPJ A;  2J46 A;  3QMK A;  1T5O A;  5AC4 A;  2OJQ A;  2ZXO A;  2LCH A;  4N6C A;  3TQO A;  1I5N A;  1V54 C;  2WZG A;  4H54 A;  3EHN A;  3O10 A;  1Z3I X;  3U9M A;  2R05 A;  1OKK A;  4P9F A;  5JP7 A;  3EG9 B;  4RD9 A;  5EHH A;  2BE5 F;  3FAP B;  1TFK B;  3S29 A;  1D1B A;  1WN0 A;  2ICW G;  2ZD9 A;  5A6J A;  4G7H F;  2F22 A;  2A68 F;  3LS1 A;  4JC7 A;  3LAY A;  1TWG A;  3MYI A;  3ZQY A;  2EPL X;  1ORY A;  3U8P A;  1C17 M;  1KNY A;  3WHN A;  1EKY A;  2EIN C;  1AEP A;  3MLG A;  2J7P D;  3KYI A;  2ZXP A;  2OOC A;  5L0I A;  2HUJ A;  4RDA A;  2LP4 A;  3ZTZ A;  1OCR C;  3OA1 A;  4KC9 A;  3S28 A;  1A7D A;  2MHR A;  1YZA A;  1ZW3 A;  4LDK A;  5BQH A;  4JTC B;  3DJU B;  1UG7 A;  4DJ9 A;  1RJ9 B;  3UMK A;  2G62 A;  2HFI A;  2NSF A;  4XTK A;  1QSP A;  3UR3 C;  4XWJ A;  1VOM A;  3ZC4 A;  2HJ3 A;  4ANJ A;  4E18 A;  3O6X A;  2R03 A;  3KYJ A;  2A0B A;  1OXB A;  4RBN A;  4PK4 A;  1J8Y F;  3CAX A;  1LIH A;  3F46 A;  2NUT A;  5DS5 A;  1Z6A A;  2YRF A;  4J30 B;  4PFP A;  2J9U A;  2WVQ A;  1RKC A;  2YQY A;  2HS5 A;  3GEI A;  4XPW A;  2AWY A;  4Z9J A;  3EH2 A;  3TOM A;  4AX2 A;  4EBB A;  2J8W A;  1DOV A;  1D0Z A;  1YA7 O;  3QW1 A;  4XLN F;  3VAY A;  3JCU Q;  2R7X A;  4EHP A;  3G4Z A;  4HEA J;  2XRH A;  2YEV A;  1FFH A;  3U5S A;  4EIY A;  4DBR A;  5JSL A;  3SXM A;  4JE9 A;  5KYW A;  1LM3 B;  3WOD F;  5T3W A;  1Z63 A;  3R2P A;  2R7U A;  1B68 A;  1KTM A;  1ZHT A;  2Z15 A;  3T9O A;  3ZG1 A;  2LFD A;  2Q3T A;  3JZ0 A;  4K1O A;  2KQ9 A;  1JAF A;  1YAR O;  2HSQ A;  3AJM A;  1LI5 A;  4MVO A;  5CI9 A;  1FMW A;  1YVI A;  3V5Z A;  2UUI A;  2A0U A;  2W45 A;  1LI7 A;  5DS6 A;  5KYY B;  1SYQ A;  3S84 A;  4CIP A;  1OCO C;  2EPN A;  3IQ6 A;  3IQT A;  1Q0M A;  3O55 A;  1NU7 D;  4MVQ A;  5CIV A;  1VK5 A;  3C8Z A;  4KNW A;  1Z5Z A;  4BJ6 A;  5JS5 A;  4C3B A;  3LNM B;  2PFD A;  3UGP A;  1PV3 A;  3EJN A;  2DYR C;  1PD0 A;  3KMI A;  2C04 A;  4CS9 C;  1V4A A;  2L6G A;  4JEA A;  5A6B D;  3B0U X;  1NZE A;  2IYL D;  4QI0 A;  5L3V A;  5E33 A;  3MYF A;  2RSE B;  3LUT B;  2OKU A;  4I1M A;  1WTY A;  4U5F E;  4W8P A;  3RFY A;  1K05 A;  3S0X A;  2R7V A;  4OIN F;  2DGJ A;  4I3M A;  3ASO C;  5COG A;  1A41 A;  3GOD A;  1QVX A;  4IAQ A;  3EZI A;  3HNL A;  1J8M F;  3CEX A;  2L6F A;  2XM0 A;  2ZXW C;  2VH3 A;  4XPY A;  1OR3 A;  2ZXR A;  3EFO A;  3QZC A;  4WGZ A;  3W8I A;  2YLD A;  1VTM P;  2CCY A;  2EPO A;  2XL6 A;  1T6I A;  2D4U A;  2QLA A;  4CJG A;  1M56 C;  3NMI A;  4I44 A;  3SZR A;  3LLK A;  3JTL O;  4QI2 A;  1Y6D A;  1FMV A;  2A1D D;  3M4B A;  4CS8 A;  3W2V A;  1KU2 A;  3EPV A;  2YL7 A;  3EG9 A;  3C8G B;  1C03 A;  3H2U A;  3CQZ A;  3HLZ A;  4LAC B;  3ECS A;  3U9J A;  2Q9B A;  2R7R A;  4ULW A;  5F5H A;  1RCP A;  2HJM A;  3HKK A;  4HE8 D;  3SXY A;  4E7S A;  2EPM X;  1ZW2 A;  1YLM A;  2XLH A;  4YWQ A;  3PDM P;  3GM1 A;  5L0F A;  2X51 A;  3V7O A;  2XLW A;  2FFH A;  1XWJ A;  3L8I A;  1TWA A;  3LJB A;  3M1C B;  1AUE A;  1HMD A;  1Q0F A;  1SZI A;  2C03 A;  3HJC A;  3RIP A;  3UGO A;  2G3K A;  3HNK A;  5KYX B;  3QVZ A;  4OD5 A;  3OEO A;  4BJ6 C;  5HSW A;  2ZPA A;  3DM9 B;  5HV9 A;  3BEH A;  3RF3 A;  1WWP A;  1LPE A;  2VCA A;  4DVY P;  4YT2 A;  3AGU A;  3GWN A;  2GDC A;  3JRM O;  4JKV A;  2YL0 A;  3NMK A;  2GA0 A;  4O7G A;  4O6M A;  4CBE A;  4PJJ A;  1T9K A;  4JTA B;  2GFH A;  3DXJ F;  2PX3 A;  3LES A;  3U3F A;  3NMJ A;  5D91 A;  4N06 A;  3KH2 A;  1JRA A;  4FAP B;  2PP4 A;  3AG4 C;  3JSZ A;  4XLP F;  1D0Y A;  2QNL A;  2VAS A;  1S05 A;  4JEB A;  1TFO B;  2HV7 A;  2IXO A;  4U5D E;  3FDQ A;  1LVK A;  3H2V A;  1O3U A;  4BEM J;  4C7O B;  2JD3 A;  3ABM C;  1ST6 A;  2J9V A;  2XLE A;  4BJ5 C;  5JLI A;  4NTA A;  3TUL A;  4E0I A;  2LFF A;  3B9Q A;  4IWB A;  1GS9 A;  2PNO A;  1E86 A;  4EBK A;  5A6A A;  4HFK B;  2PX0 A;  1U89 A;  4M63 A;  2UUH A;  4DRI B;  3VF0 A; 
#chains in the Genus database with same CATH homology
 2L6G A;  3C18 A;  3BRJ A;  1UFB A;  3C8G A;  1KTM A;  2JX0 A;  3U3F A;  1K04 A;  3JZ0 A;  1WTY A;  4NQF A;  4XEV A;  4R32 A;  1K05 A;  1JOG A;  3B71 A;  2Q00 A;  3GM1 A;  3AJM A;  4XEF A;  3K7D A;  3O10 A;  3L8I A;  1OW6 A;  3RQE A;  1QVX A;  5F28 E;  2JPU A;  2L6F A;  1O3U A;  1ZZP A;  4XEK A;  3U0C A;  1K40 A;  2PBE A;  2KK1 A;  3L8J A;  4EBJ A;  2HSB A;  2YWA A;  3MFN A;  3RQF A;  3TUL A;  1KNY A;  3JYY A;  1WOL A;  1WWP A;  4EBK A;  1OW8 A;  2LK4 A;  3C8G D;  3RQG A;  2L6H A;  3GM3 A;  1OW7 A;  1PV3 A;  3GM2 A;  3C8G B;  1V4A A;  3S9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...