1QVXA

Solution structure of the fat domain of focal adhesion kinase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
134
structure length
134
Chain Sequence
b'RSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title NMR Solution Structure of the Focal Adhesion Targeting Domain of Focal Adhesion Kinase in Complex with a Paxillin LD Peptide: EVIDENCE FOR A TWO-SITE BINDING MODEL.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 55
structure length 134
sequence length 134
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1qvxA00
1OW6A 4EBKA 2JX0A 3C8GB 1K04A 3GM2A 3MFNA 3U0CA 4XEFA 3C8GA 1WTYA 1QVXA 3JYYA 1K40A 1V4AA 3L8IA 2L6GA 3AJMA 2L6HA 1WOLA 1KNYA 1OW7A 2KK1A 2Q00A 3BRJA 3B71A 1ZZPA 1PV3A 1JOGA 3GM3A 3RQEA 4NQFA 3C18A 1O3UA 1WWPA 3K7DA 1K05A 4XEVA 3TULA 5F28E 2YWAA 4R32A 2JPUA 3O10A 1UFBA 3L8JA 1KTMA 3GM1A 1OW8A 2LK4A 3U3FA 2L6FA 2PBEA 3S9OA 3RQGA 3JZ0A 4EBJA 2HSBA 3RQFA 3C8GD 4XEKA
chains in the Genus database with same CATH superfamily
1ZYRF 1HE9A 3IQTA 4EBKA 3SNHA 3NYJA 4WJ0A 2W45A 2R05A 2ZPAA 1TWCA 4JCZA 3TK0A 1MNDA 2Z15A 2YVKA 1BR2A 2KGOA 4MNDA 1Q0DA 4HFKB 4ULWA 1HMOA 1T6QA 3EGXB 2Q9AA 3PCVA 3TJ5A 2KK1A 1KU2A 1RKEB 1Y4CA 3TOMA 1NU7D 3NRHA 4NQFA 3C18A 4MVUA 1W2WA 5DQZA 3NMIA 1EA8A 3RW0A 1R4TA 1H6GA 3LLKA 1UFBA 3MYFA 1VYIA 3T4RA 1C03A 3ZQYA 4MTOA 4ER9A 3L34A 3JT1A 2XXAA 4D4NA 3V7OA 3MX3A 2AVKA 3S9OA 1ORSC 2PF4E 1TWGA 2J7PA 4YT5A 3U5SA 2CYDA 4YN0B 4E0HA 4BEMJ 3DE8A 2WZLA 3C8GB 2HV6A 2BE5F 3GM2A 2Y3GA 4JTAB 5DQTA 1LS4A 1I4YA 2Y3BA 1XZQA 3ZTMA 3EZIA 4JVSA 2Q7RA 3ECSA 3FOOA 3GEHA 3QW1A 4I1MA 1R5ID 2KW3C 4W8KA 2AWCA 4E0IA 4MVQA 3AGUA 1U0BB 2E87A 4IAOA 2WVNA 5E33A 3WAQA 5CIVA 2CCYA 2LCHA 1O3UA 2PX0A 1LE2A 2WL8A 4O6NA 1T9KA 2Y3HA 2IOQA 3ABMC 3T6GB 3DAGA 4OIPF 3IEEA 2G3KA 4NTBA 1BR1A 3T6BA 3PDMP 3H2VA 3SZRA 2Q9BA 1YA9A 3MBGA 4MVSA 1VMAA 2CDQA 5L0JA 4FAPB 4YT4A 1M56C 4IAQA 3HTKC 4XEKA 3VAYA 4DOZA 3TJ6A 4JJGA 3W8IA 4CDVA 5KYUB 3I5PA 4AE4B 3NDBB 4EUKB 2YL3A 1ZU5A 3JTLO 1ST6A 3H65A 4PJNA 5K0IA 4CJGA 2WVOA 1D1BA 2X51A 2EIMC 3VF0A 2I15A 1O5HA 3EGXA 3KPHA 2R7RA 1LI7A 3DXJF 3FAPB 3UMIA 5B3SC 2HSQA 3FHDA 3Q6NA 1NBBA 1RKEA 4JEAA 4H4KC 4U5BE 2H8AA 3K7DA 2PP4A 5AC4A 4DBQA 2A6EF 4R32A 4IB4A 4KI2A 1T5OA 5GPGB 4J30B 1D1CA 2J9WA 2ETSA 4RBNA 2M4EA 3GM1A 3O39A 1OW8A 1LPEA 3L0IA 2KNHA 2O9XA 1APCA 1RJ9B 2EPOA 2HSBA 2J0XA 1OCRC 1QLEC 3WODF 2DI3A 5HV9A 3FXHA 3A11A 1VK5A 3NMKA 4JZAA 4MTFA 3E70C 1OR3A 1E86A 2OQMA 5TJ5E 2OJED 4DBRA 2RSEB 3EH2A 2G62A 1Q0MA 2R7SA 3SXYA 1V55C 4BG0A 2R7UA 4P9TA 3B29A 2A6HF 4EBBA 2D5RB 2NSFA 5EGYA 5FZTA 3UMKA 2KJGA 1SYQA 4OD4A 5FCLA 1HY5A 2A0UA 3AG3C 3AGTA 1JPJA 2HMQA 4G7ZF 3ZTZA 1VTMP 1V74B 2HZ8A 4U5HA 2NPUA 3RIPA 3SXMA 4C3EA 1BZ4A 4BJ6A 1E83A 2Y69C 2GA0A 4L6RA 1A7DA 2A69F 2H7VC 4DRIB 5L0FA 2G3VA 1TKNA 4U5EE 5KYUA 5COFA 1QVXA 2YHSA 3O6XA 1OCCC 1SF8A 4WABA 2MHRA 5L0HA 1G8XA 3BEHA 1ZHWA 3B71A 3N0TA 1ZZPA 3X1OA 1JOGA 3DAFA 1AEPA 2VH3A 3FMSA 4RDAA 3K66A 4PK4A 5BQGA 4DJ9A 5BUOA 3CAXA 4IJJA 3B0VC 1QPUA 1SMYF 1CGNA 3L8JA 1TFKB 1U6HA 4J32B 4N06A 5L3QA 1ZHZA 2W4BA 3G4ZA 2VCBA 1C02A 4CSAA 2IXNA 4XTKA 5JSLA 4J7TA 4EBJA 1RJ9A 3HNLA 2YL0A 4CJOA 1OR2A 3AG4C 1MMDA 4XLPF 3X2QC 3HLZA 3EH1A 3QMKA 4LERA 4BJ6C 2KC3A 3POVA 4QI0A 2LFDA 3EPVA 3ITFA 3VRCA 1ZW2A 4CS9A 5KYXB 3FAJA 3KMIA 3KL4A 2ZD9A 3MLGA 4UDVA 5AC5A 3EGDA 4JTDB 2A0BA 4QDLA 2MWQA 4GEHA 5A6BA 2QLAA 3IHUA 4Z9HA 5KYYB 4BJ5C 5KYNA 4PACA 3TD7A 1E84A 3RVYA 2NSGA 1G4US 2YWAA 1A0BA 1Q0GA 3N24A 3OEOA 1CGME 1FR0A 4EHPA 3V5XA 2WVQA 4O6MA 3ZC4A 1WN0A 1LE4A 1WASA 2UUIA 1GGQA 3KYIA 4JRZA 4MS2A 5F5FA 4JEBA 2KYHA 3EJNA 4LDQA 2IXMA 3W2WA 1YLMA 3CZ6A 4IWBA 4DRJB 1YYXA 3ZQVA 3C8GD 2IXPA 3EFOA 4MVZA 5JRAA 2Y3DA 2XL6A 1JAFA 2LSEA 3NKEA 1K04A 1OXKA 3UNGC 2ZXWC 1MNEA 4P9FA 2RD9A 3K33A 2P61A 5A6KA 4IGGA 1YARO 2L6GA 5DLJA 3S27A 2L6HA 2YZSA 3QZCA 1KNYA 1OW7A 2VCAA 4YT2A 2PX3A 5KYWB 1RCPA 1PV3A 1FNTc 2XLEA 3CQZA 3NYMA 1SZIA 1T6UA 2OEXA 4LDRA 3S29A 2BC5A 4MVOA 2NUPB 4W8PA 1K05A 4Q5SF 1NFOA 3U8PA 3ZDLA 2QY9A 4Q7CA 2XLHA 3U2LA 1YAUO 2OJQA 4G78A 4KC9A 1GS9A 2J0WA 1J8MF 3ASOC 4U5FE 1IW7F 3PHF2 3UMHA 2EILC 3F47A 1Z6AA 4YJWA 1ORYA 1IZMA 1DOWA 4CIPA 1S05A 2HFIA 4WGZA 5CI8A 4U5CE 4BPMA 1UG7A 2C04A 3N2ZB 3M1CB 1OCZC 3SP1A 2Q4FA 1ZHXA 4XEFA 4A4AA 4E7ZA 2IYLD 3NMJA 2V3CC 5KYXA 3GWLA 5A6JA 4G7OF 3L8IA 2J45A 4CS8A 4U5DE 1D0XA 4C7OB 5CI9A 3LESA 4XPWA 4FWVA 2XM4A 1YYJA 2A1DD 1NSGB 1G4WR 2V26A 5KYYA 1EKYA 4AK9A 4CIHA 2XLWA 2XLOA 1Z5ZA 2QTVA 3LEVA 4XEVA 3SXKA 3HKKA 3O10A 2VASA 2D4UA 1YZAA 1BBHA 1ZVZA 4E7SA 2LK4A 5BQIA 5EHHA 1XWJA 5IY5C 3NYLA 1TR2A 2J9UA 3RQGA 5D91A 256BA 1WATA 3U9MA 2EINC 3QW0A 3VM6A 2NUTB 4IRUA 4BJTA 1GM5A 2IXOA 3EZHA 1JRAA 3DE9A 4HE8D 4K0DA 2R7XA 3C8GA 1BR4A 4LACB 5F5HA 4NCQA 1V4AA 1Z7Qc 5A6BD 4X0RA 4CS7A 3M4CA 3C7JA 4CS8C 5JLIA 2FGYA 3DJNB 3GEIA 2F22A 1MMNA 2B0JA 2OU6A 3RH3A 1A41A 5B1AC 3GM3A 1CPRA 4OD5A 5DS5A 2YL7A 3DKAA 1FAPB 2XLVA 1YA7O 2P1AA 4G7HF 1VYKA 2NUPA 3H2UA 2YL1A 5DS4A 3IPMO 2LD6A 4U9EA 3RYLA 3W4YA 4YL1A 1KTMA 2L6FA 3T6JA 2PBEA 1U89A 2YEVA 2R02A 3LJBA 3R7CA 2OEVA 2BL2A 5D92A 3GWNA 3IQCA 1Q0FA 2YQYA 5JP7A 1WGWA 2MYSA 4EIYA 5L0CA 1QKRA 2WZGA 3VYWA 3UR3C 1L7CA 3DD7A 3DWWA 3U0CA 2UUHA 4AE4A 1VLTA 3LS1A 2VC9A 2ASRA 3G4XA 2KSFA 4U5GA 4U9DA 2M64A 1D0YA 2GDCA 2NG1A 3EHMA 3LNMB 2L81A 3ZWIA 4Q4ZF 4C7OA 5BQHA 4CX9A 2R7VA 2WB7A 3QVZA 3RF3A 2HS5A 4NC3A 2JD3A 3FOPA 1WWPA 5E2QA 3RKOF 3G50A 5F28E 5L0GA 1S7ZA 4MW8A 4ZLCA 1FFHA 1ZU4A 4I3MA 1FMVA 3TOLA 4DRHB 2LP4A 3K6BA 1ZHTA 3F46A 1HW2A 1OXBA 2J46A 1YZCA 5B1BC 3GANA 3M15A 1LI5A 3RQFA 2I8BA 3R2PA 2DB4A 4KNVA 3ASNC 2NUTA 3OWTA 3J06A 4XWJA 2LIGA 2X0CA 4EKWA 4NTAA 1TQGA 2YKZA 3IQ6A 3ZIBA 4ZLDA 4PR9A 2LFFA 1EQ1A 1I4ZA 1OQCA 2R7QA 1D0ZA 3EQLF 1HW1A 4CDAA 3HJCA 4YL0A 5A6AA 2XLMA 4Z9JA 4YWQA 2OCCC 3ABKC 2HKVA 4N4WA 5T3WA 3FDQA 4NY3A 1VB5A 1SR2A 2Q9CA 4DVZA 2FFHA 3QVYA 3HNIA 3GORA 3C63A 3I4UA 1Z63A 3S84A 1HMDA 4M63A 3PMRA 2XS8A 3KYJA 3ATPA 4CSAC 3Q6MA 1CPQA 1ZW3A 3NKDA 4JJFA 4PFPA 4Z9IA 4PJMA 5E3AA 3RVZA 2ZXOA 4RD9A 3AG1C 4DVYP 5JUAA 2IM8A 3UGPA 3LNRA 2QNLA 4MVRA 4AX2A 1BDJB 1WTYA 2J9BA 4XQ1A 1YJGA 2DYSC 2GFHA 2HMZA 2B0HA 2HJMA 2Y39A 1M57C 1AVOB 3AG2C 3LUTB 4CS9C 5L0IA 3JSEO 1VLSA 3C8ZA 1O87A 5E3CA 1GQAA 3BRJA 4NTFA 1QSPA 2ZXRA 3RFYA 5L0DA 4IARA 4K7BA 2YLIA 2AWYA 3S0XA 4O79A 3EG9B 2XM0A 4FX5A 4I44A 4PJLA 1M6TA 3DM9B 4ONSA 1Z3IX 4G0HA 2YRFA 3Q7GA 1VOMA 1NFNA 2J9VA 3HNJA 4JC7A 3U3BA 3U8VA 3JSZA 1YDIA 5JVEA 5L3VA 3AQCA 1ORJA 1NU9C 5T1DB 1B68A 3LEOA 3NG1A 3OA1A 3SXZA 2Q3TA 2P6VA 1Z23A 1AUEA 1E85A 2AP3A 1TWAA 1OKKD 1C17M 3K1IA 3B0PA 1F1MA 5HSWA 2PNOA 4HEAJ 3JYYA 4JE9A 1K40A 3V5ZA 1DOVA 1D1AA 5DS6A 2R7WA 4WGYA 3A9CA 3U9JA 5JS5A 4FESA 1H7IA 2Q00A 3DI5A 4KBLA 4YK5A 2QUPA 2XL8A 3CEXA 1QQ3A 3MYIA 2HJ3A 2J8WA 2FAPB 1YVIA 2KQ9A 4PJJA 4YL3A 3C62A 3GEEA 3LLIA 2GAQA 2HV7A 3LS0A 2W4MA 1MQVA 1V54C 4JW1A 3DJUB 2P7VA 3JCUQ 3LAYA 3KH2A 4PFOA 3JRMO 2R25A 1LIHA 1TFOB 3I5QA 5COGA 4AL0A 3K1IC 3E9VA 3ZSUA 1N1CA 4O7GA 3V5YA 2TMVP 2PFDA 2LQGA 1T01A 4EWCA 3K1HA 1I5NA 4XPYA 3L1MA 4F4BA 2A68F 1WOLA 2CNWD 1JMWA 5JT4A 2R03A 1M2VB 1LS1A 4JURI 4OIQF 2L9JA 2DYRC 1L3PA 3RQEA 5KYWA 4LLEA 3EG9A 1FMWA 2WZFA 3TULA 3CSKA 4N6CA 3TQOA 2AU5A 4DXWA 2JPUA 3GODA 4JIOA 3JYHA 5AGFA 3UGOA 2R9RB 4OIRF 4CDYA 4GYTA 4E17A 1MMGA 1QZXA 1A7EA 3SEOA 2DGJA 4A2NB 1G5ZA 2XRHA 4J7YA 4OINF 3SYNA 4B6IA 4MVMA 4QI2A 1MMAA 4JTCB 2OG2A 3QTHA 1Y6DA 3US6A 1JPNA 4BEJA 4E18A 2JX0A 2VCCA 2XL4A 1RXQA 2XLDA 1OKKA 2YLDA 3EGDB 4AL1A 1T6IA 2QE9A 4P6IC 5COMA 5T3TA 1XZPA 3S28A 1OCOC 3IQ5A 4XLNF 4YT8A 2VB6A 1PD1A 2ZXPA 3KKBA 3FVYA 2H7BA 3WHNA 2R7OA 4JCHA 4JKVA 1RKCA 3U2MA 4OIOF 4CBEA 2C03A 5DVWA 2XSEA 1RMVA 3ABLC 3AQBA 3JRTA 4XPXA 4BJ1A 2EPKX 2J7PD 1Q0KA 1NZEA 2IBFA 3DMDA 4MQ9F 4HFFB 2XXAB 1H9GA 1HE1A 1JR8A 3EFOB 1NG1A 3M4BA 3S90A 2EIKC 2R7TA 3U3FA 2GWWA 1OW6A 3B0UX 3DZAA 3DM5A 2EPMX 3MFNA 1EI7A 1LKXA 4KNWA 2OKUA 4ANJA 3T9OA 1LM3B 3AJMA 4C3BA 2CW0F 2P0NA 2XS1A 2YLGA 4GQHA 3W2VA 2CGEA 2L7AA 3W8HA 1M2VA 1A7VA 1NLXA 4LLCA 4BJ5A 3M79A 4N6HA 2EPNA 1E2XA 2CNWA 2H7OA 2HUJA 1CGOA 4H54A 1H9TA 1LVKA 3EHNA 4K1OA 4ULVA 4C3DA 3O55A 3WG7C 3ZVRA 1FFTC 4LDKA 1ZHYA 4I1OB 4MW3A 4D4XA 5B3IA 2W9YA 5A69A 1M2OA 3B9QA 1PD0A 2EPLX 1J8YF 2ICWG 1FTSA 3Q7LA 2EIJC 2OOCA 5EK0A 4O6YA 3AOUA 3JZ0A 4MTGA 1PCXA 3ZG1A 1TWHA 3HNKA
chains in the Genus database with same CATH topology
1OW6A 4EBKA 2JX0A 3C8GB 1K04A 3GM2A 3MFNA 3U0CA 4XEFA 3C8GA 1WTYA 1QVXA 3JYYA 1K40A 1V4AA 3L8IA 2L6GA 3AJMA 2L6HA 1WOLA 1KNYA 1OW7A 2KK1A 2Q00A 3BRJA 3B71A 1ZZPA 1PV3A 1JOGA 3GM3A 3RQEA 4NQFA 3C18A 1O3UA 1WWPA 3K7DA 1K05A 4XEVA 3TULA 5F28E 2YWAA 4R32A 2JPUA 3O10A 1UFBA 3L8JA 1KTMA 3GM1A 1OW8A 2LK4A 3U3FA 2L6FA 2PBEA 3S9OA 3RQGA 3JZ0A 4EBJA 2HSBA 3RQFA 3C8GD 4XEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW6 A;  4EBK A;  2JX0 A;  3C8G B;  1K04 A;  3GM2 A;  3MFN A;  3U0C A;  4XEF A;  3C8G A;  1WTY A;  1QVX A;  3JYY A;  1K40 A;  1V4A A;  3L8I A;  2L6G A;  3AJM A;  2L6H A;  1WOL A;  1KNY A;  1OW7 A;  2KK1 A;  2Q00 A;  3BRJ A;  3B71 A;  1ZZP A;  1PV3 A;  1JOG A;  3GM3 A;  3RQE A;  4NQF A;  3C18 A;  1O3U A;  1WWP A;  3K7D A;  1K05 A;  4XEV A;  3TUL A;  5F28 E;  2YWA A;  4R32 A;  2JPU A;  3O10 A;  1UFB A;  3L8J A;  1KTM A;  3GM1 A;  1OW8 A;  2LK4 A;  3U3F A;  2L6F A;  2PBE A;  3S9O A;  3RQG A;  3JZ0 A;  4EBJ A;  2HSB A;  3RQF A;  3C8G D;  4XEK A; 
#chains in the Genus database with same CATH topology
 1ZYR F;  1HE9 A;  3IQT A;  4EBK A;  3SNH A;  3NYJ A;  4WJ0 A;  2W45 A;  2R05 A;  2ZPA A;  1TWC A;  4JCZ A;  3TK0 A;  1MND A;  2Z15 A;  2YVK A;  1BR2 A;  2KGO A;  4MND A;  1Q0D A;  4HFK B;  4ULW A;  1HMO A;  1T6Q A;  3EGX B;  2Q9A A;  3PCV A;  3TJ5 A;  2KK1 A;  1KU2 A;  1RKE B;  1Y4C A;  3TOM A;  1NU7 D;  3NRH A;  4NQF A;  3C18 A;  4MVU A;  1W2W A;  5DQZ A;  3NMI A;  1EA8 A;  3RW0 A;  1R4T A;  1H6G A;  3LLK A;  1UFB A;  3MYF A;  1VYI A;  3T4R A;  1C03 A;  3ZQY A;  4MTO A;  4ER9 A;  3L34 A;  3JT1 A;  2XXA A;  4D4N A;  3V7O A;  3MX3 A;  2AVK A;  3S9O A;  1ORS C;  2PF4 E;  1TWG A;  2J7P A;  4YT5 A;  3U5S A;  2CYD A;  4YN0 B;  4E0H A;  4BEM J;  3DE8 A;  2WZL A;  3C8G B;  2HV6 A;  2BE5 F;  3GM2 A;  2Y3G A;  4JTA B;  5DQT A;  1LS4 A;  1I4Y A;  2Y3B A;  1XZQ A;  3ZTM A;  3EZI A;  4JVS A;  2Q7R A;  3ECS A;  3FOO A;  3GEH A;  3QW1 A;  4I1M A;  1R5I D;  2KW3 C;  4W8K A;  2AWC A;  4E0I A;  4MVQ A;  3AGU A;  1U0B B;  2E87 A;  4IAO A;  2WVN A;  5E33 A;  3WAQ A;  5CIV A;  2CCY A;  2LCH A;  1O3U A;  2PX0 A;  1LE2 A;  2WL8 A;  4O6N A;  1T9K A;  2Y3H A;  2IOQ A;  3ABM C;  3T6G B;  3DAG A;  4OIP F;  3IEE A;  2G3K A;  4NTB A;  1BR1 A;  3T6B A;  3PDM P;  3H2V A;  3SZR A;  2Q9B A;  1YA9 A;  3MBG A;  4MVS A;  1VMA A;  2CDQ A;  5L0J A;  4FAP B;  4YT4 A;  1M56 C;  4IAQ A;  3HTK C;  4XEK A;  3VAY A;  4DOZ A;  3TJ6 A;  4JJG A;  3W8I A;  4CDV A;  5KYU B;  3I5P A;  4AE4 B;  3NDB B;  4EUK B;  2YL3 A;  1ZU5 A;  3JTL O;  1ST6 A;  3H65 A;  4PJN A;  5K0I A;  4CJG A;  2WVO A;  1D1B A;  2X51 A;  2EIM C;  3VF0 A;  2I15 A;  1O5H A;  3EGX A;  3KPH A;  2R7R A;  1LI7 A;  3DXJ F;  3FAP B;  3UMI A;  5B3S C;  2HSQ A;  3FHD A;  3Q6N A;  1NBB A;  1RKE A;  4JEA A;  4H4K C;  4U5B E;  2H8A A;  3K7D A;  2PP4 A;  5AC4 A;  4DBQ A;  2A6E F;  4R32 A;  4IB4 A;  4KI2 A;  1T5O A;  5GPG B;  4J30 B;  1D1C A;  2J9W A;  2ETS A;  4RBN A;  2M4E A;  3GM1 A;  3O39 A;  1OW8 A;  1LPE A;  3L0I A;  2KNH A;  2O9X A;  1APC A;  1RJ9 B;  2EPO A;  2HSB A;  2J0X A;  1OCR C;  1QLE C;  3WOD F;  2DI3 A;  5HV9 A;  3FXH A;  3A11 A;  1VK5 A;  3NMK A;  4JZA A;  4MTF A;  3E70 C;  1OR3 A;  1E86 A;  2OQM A;  5TJ5 E;  2OJE D;  4DBR A;  2RSE B;  3EH2 A;  2G62 A;  1Q0M A;  2R7S A;  3SXY A;  1V55 C;  4BG0 A;  2R7U A;  4P9T A;  3B29 A;  2A6H F;  4EBB A;  2D5R B;  2NSF A;  5EGY A;  5FZT A;  3UMK A;  2KJG A;  1SYQ A;  4OD4 A;  5FCL A;  1HY5 A;  2A0U A;  3AG3 C;  3AGT A;  1JPJ A;  2HMQ A;  4G7Z F;  3ZTZ A;  1VTM P;  1V74 B;  2HZ8 A;  4U5H A;  2NPU A;  3RIP A;  3SXM A;  4C3E A;  1BZ4 A;  4BJ6 A;  1E83 A;  2Y69 C;  2GA0 A;  4L6R A;  1A7D A;  2A69 F;  2H7V C;  4DRI B;  5L0F A;  2G3V A;  1TKN A;  4U5E E;  5KYU A;  5COF A;  1QVX A;  2YHS A;  3O6X A;  1OCC C;  1SF8 A;  4WAB A;  2MHR A;  5L0H A;  1G8X A;  3BEH A;  1ZHW A;  3B71 A;  3N0T A;  1ZZP A;  3X1O A;  1JOG A;  3DAF A;  1AEP A;  2VH3 A;  3FMS A;  4RDA A;  3K66 A;  4PK4 A;  5BQG A;  4DJ9 A;  5BUO A;  3CAX A;  4IJJ A;  3B0V C;  1QPU A;  1SMY F;  1CGN A;  3L8J A;  1TFK B;  1U6H A;  4J32 B;  4N06 A;  5L3Q A;  1ZHZ A;  2W4B A;  3G4Z A;  2VCB A;  1C02 A;  4CSA A;  2IXN A;  4XTK A;  5JSL A;  4J7T A;  4EBJ A;  1RJ9 A;  3HNL A;  2YL0 A;  4CJO A;  1OR2 A;  3AG4 C;  1MMD A;  4XLP F;  3X2Q C;  3HLZ A;  3EH1 A;  3QMK A;  4LER A;  4BJ6 C;  2KC3 A;  3POV A;  4QI0 A;  2LFD A;  3EPV A;  3ITF A;  3VRC A;  1ZW2 A;  4CS9 A;  5KYX B;  3FAJ A;  3KMI A;  3KL4 A;  2ZD9 A;  3MLG A;  4UDV A;  5AC5 A;  3EGD A;  4JTD B;  2A0B A;  4QDL A;  2MWQ A;  4GEH A;  5A6B A;  2QLA A;  3IHU A;  4Z9H A;  5KYY B;  4BJ5 C;  5KYN A;  4PAC A;  3TD7 A;  1E84 A;  3RVY A;  2NSG A;  1G4U S;  2YWA A;  1A0B A;  1Q0G A;  3N24 A;  3OEO A;  1CGM E;  1FR0 A;  4EHP A;  3V5X A;  2WVQ A;  4O6M A;  3ZC4 A;  1WN0 A;  1LE4 A;  1WAS A;  2UUI A;  1GGQ A;  3KYI A;  4JRZ A;  4MS2 A;  5F5F A;  4JEB A;  2KYH A;  3EJN A;  4LDQ A;  2IXM A;  3W2W A;  1YLM A;  3CZ6 A;  4IWB A;  4DRJ B;  1YYX A;  3ZQV A;  3C8G D;  2IXP A;  3EFO A;  4MVZ A;  5JRA A;  2Y3D A;  2XL6 A;  1JAF A;  2LSE A;  3NKE A;  1K04 A;  1OXK A;  3UNG C;  2ZXW C;  1MNE A;  4P9F A;  2RD9 A;  3K33 A;  2P61 A;  5A6K A;  4IGG A;  1YAR O;  2L6G A;  5DLJ A;  3S27 A;  2L6H A;  2YZS A;  3QZC A;  1KNY A;  1OW7 A;  2VCA A;  4YT2 A;  2PX3 A;  5KYW B;  1RCP A;  1PV3 A;  1FNT c;  2XLE A;  3CQZ A;  3NYM A;  1SZI A;  1T6U A;  2OEX A;  4LDR A;  3S29 A;  2BC5 A;  4MVO A;  2NUP B;  4W8P A;  1K05 A;  4Q5S F;  1NFO A;  3U8P A;  3ZDL A;  2QY9 A;  4Q7C A;  2XLH A;  3U2L A;  1YAU O;  2OJQ A;  4G78 A;  4KC9 A;  1GS9 A;  2J0W A;  1J8M F;  3ASO C;  4U5F E;  1IW7 F;  3PHF 2;  3UMH A;  2EIL C;  3F47 A;  1Z6A A;  4YJW A;  1ORY A;  1IZM A;  1DOW A;  4CIP A;  1S05 A;  2HFI A;  4WGZ A;  5CI8 A;  4U5C E;  4BPM A;  1UG7 A;  2C04 A;  3N2Z B;  3M1C B;  1OCZ C;  3SP1 A;  2Q4F A;  1ZHX A;  4XEF A;  4A4A A;  4E7Z A;  2IYL D;  3NMJ A;  2V3C C;  5KYX A;  3GWL A;  5A6J A;  4G7O F;  3L8I A;  2J45 A;  4CS8 A;  4U5D E;  1D0X A;  4C7O B;  5CI9 A;  3LES A;  4XPW A;  4FWV A;  2XM4 A;  1YYJ A;  2A1D D;  1NSG B;  1G4W R;  2V26 A;  5KYY A;  1EKY A;  4AK9 A;  4CIH A;  2XLW A;  2XLO A;  1Z5Z A;  2QTV A;  3LEV A;  4XEV A;  3SXK A;  3HKK A;  3O10 A;  2VAS A;  2D4U A;  1YZA A;  1BBH A;  1ZVZ A;  4E7S A;  2LK4 A;  5BQI A;  5EHH A;  1XWJ A;  5IY5 C;  3NYL A;  1TR2 A;  2J9U A;  3RQG A;  5D91 A;  256B A;  1WAT A;  3U9M A;  2EIN C;  3QW0 A;  3VM6 A;  2NUT B;  4IRU A;  4BJT A;  1GM5 A;  2IXO A;  3EZH A;  1JRA A;  3DE9 A;  4HE8 D;  4K0D A;  2R7X A;  3C8G A;  1BR4 A;  4LAC B;  5F5H A;  4NCQ A;  1V4A A;  1Z7Q c;  5A6B D;  4X0R A;  4CS7 A;  3M4C A;  3C7J A;  4CS8 C;  5JLI A;  2FGY A;  3DJN B;  3GEI A;  2F22 A;  1MMN A;  2B0J A;  2OU6 A;  3RH3 A;  1A41 A;  5B1A C;  3GM3 A;  1CPR A;  4OD5 A;  5DS5 A;  2YL7 A;  3DKA A;  1FAP B;  2XLV A;  1YA7 O;  2P1A A;  4G7H F;  1VYK A;  2NUP A;  3H2U A;  2YL1 A;  5DS4 A;  3IPM O;  2LD6 A;  4U9E A;  3RYL A;  3W4Y A;  4YL1 A;  1KTM A;  2L6F A;  3T6J A;  2PBE A;  1U89 A;  2YEV A;  2R02 A;  3LJB A;  3R7C A;  2OEV A;  2BL2 A;  5D92 A;  3GWN A;  3IQC A;  1Q0F A;  2YQY A;  5JP7 A;  1WGW A;  2MYS A;  4EIY A;  5L0C A;  1QKR A;  2WZG A;  3VYW A;  3UR3 C;  1L7C A;  3DD7 A;  3DWW A;  3U0C A;  2UUH A;  4AE4 A;  1VLT A;  3LS1 A;  2VC9 A;  2ASR A;  3G4X A;  2KSF A;  4U5G A;  4U9D A;  2M64 A;  1D0Y A;  2GDC A;  2NG1 A;  3EHM A;  3LNM B;  2L81 A;  3ZWI A;  4Q4Z F;  4C7O A;  5BQH A;  4CX9 A;  2R7V A;  2WB7 A;  3QVZ A;  3RF3 A;  2HS5 A;  4NC3 A;  2JD3 A;  3FOP A;  1WWP A;  5E2Q A;  3RKO F;  3G50 A;  5F28 E;  5L0G A;  1S7Z A;  4MW8 A;  4ZLC A;  1FFH A;  1ZU4 A;  4I3M A;  1FMV A;  3TOL A;  4DRH B;  2LP4 A;  3K6B A;  1ZHT A;  3F46 A;  1HW2 A;  1OXB A;  2J46 A;  1YZC A;  5B1B C;  3GAN A;  3M15 A;  1LI5 A;  3RQF A;  2I8B A;  3R2P A;  2DB4 A;  4KNV A;  3ASN C;  2NUT A;  3OWT A;  3J06 A;  4XWJ A;  2LIG A;  2X0C A;  4EKW A;  4NTA A;  1TQG A;  2YKZ A;  3IQ6 A;  3ZIB A;  4ZLD A;  4PR9 A;  2LFF A;  1EQ1 A;  1I4Z A;  1OQC A;  2R7Q A;  1D0Z A;  3EQL F;  1HW1 A;  4CDA A;  3HJC A;  4YL0 A;  5A6A A;  2XLM A;  4Z9J A;  4YWQ A;  2OCC C;  3ABK C;  2HKV A;  4N4W A;  5T3W A;  3FDQ A;  4NY3 A;  1VB5 A;  1SR2 A;  2Q9C A;  4DVZ A;  2FFH A;  3QVY A;  3HNI A;  3GOR A;  3C63 A;  3I4U A;  1Z63 A;  3S84 A;  1HMD A;  4M63 A;  3PMR A;  2XS8 A;  3KYJ A;  3ATP A;  4CSA C;  3Q6M A;  1CPQ A;  1ZW3 A;  3NKD A;  4JJF A;  4PFP A;  4Z9I A;  4PJM A;  5E3A A;  3RVZ A;  2ZXO A;  4RD9 A;  3AG1 C;  4DVY P;  5JUA A;  2IM8 A;  3UGP A;  3LNR A;  2QNL A;  4MVR A;  4AX2 A;  1BDJ B;  1WTY A;  2J9B A;  4XQ1 A;  1YJG A;  2DYS C;  2GFH A;  2HMZ A;  2B0H A;  2HJM A;  2Y39 A;  1M57 C;  1AVO B;  3AG2 C;  3LUT B;  4CS9 C;  5L0I A;  3JSE O;  1VLS A;  3C8Z A;  1O87 A;  5E3C A;  1GQA A;  3BRJ A;  4NTF A;  1QSP A;  2ZXR A;  3RFY A;  5L0D A;  4IAR A;  4K7B A;  2YLI A;  2AWY A;  3S0X A;  4O79 A;  3EG9 B;  2XM0 A;  4FX5 A;  4I44 A;  4PJL A;  1M6T A;  3DM9 B;  4ONS A;  1Z3I X;  4G0H A;  2YRF A;  3Q7G A;  1VOM A;  1NFN A;  2J9V A;  3HNJ A;  4JC7 A;  3U3B A;  3U8V A;  3JSZ A;  1YDI A;  5JVE A;  5L3V A;  3AQC A;  1ORJ A;  1NU9 C;  5T1D B;  1B68 A;  3LEO A;  3NG1 A;  3OA1 A;  3SXZ A;  2Q3T A;  2P6V A;  1Z23 A;  1AUE A;  1E85 A;  2AP3 A;  1TWA A;  1OKK D;  1C17 M;  3K1I A;  3B0P A;  1F1M A;  5HSW A;  2PNO A;  4HEA J;  3JYY A;  4JE9 A;  1K40 A;  3V5Z A;  1DOV A;  1D1A A;  5DS6 A;  2R7W A;  4WGY A;  3A9C A;  3U9J A;  5JS5 A;  4FES A;  1H7I A;  2Q00 A;  3DI5 A;  4KBL A;  4YK5 A;  2QUP A;  2XL8 A;  3CEX A;  1QQ3 A;  3MYI A;  2HJ3 A;  2J8W A;  2FAP B;  1YVI A;  2KQ9 A;  4PJJ A;  4YL3 A;  3C62 A;  3GEE A;  3LLI A;  2GAQ A;  2HV7 A;  3LS0 A;  2W4M A;  1MQV A;  1V54 C;  4JW1 A;  3DJU B;  2P7V A;  3JCU Q;  3LAY A;  3KH2 A;  4PFO A;  3JRM O;  2R25 A;  1LIH A;  1TFO B;  3I5Q A;  5COG A;  4AL0 A;  3K1I C;  3E9V A;  3ZSU A;  1N1C A;  4O7G A;  3V5Y A;  2TMV P;  2PFD A;  2LQG A;  1T01 A;  4EWC A;  3K1H A;  1I5N A;  4XPY A;  3L1M A;  4F4B A;  2A68 F;  1WOL A;  2CNW D;  1JMW A;  5JT4 A;  2R03 A;  1M2V B;  1LS1 A;  4JUR I;  4OIQ F;  2L9J A;  2DYR C;  1L3P A;  3RQE A;  5KYW A;  4LLE A;  3EG9 A;  1FMW A;  2WZF A;  3TUL A;  3CSK A;  4N6C A;  3TQO A;  2AU5 A;  4DXW A;  2JPU A;  3GOD A;  4JIO A;  3JYH A;  5AGF A;  3UGO A;  2R9R B;  4OIR F;  4CDY A;  4GYT A;  4E17 A;  1MMG A;  1QZX A;  1A7E A;  3SEO A;  2DGJ A;  4A2N B;  1G5Z A;  2XRH A;  4J7Y A;  4OIN F;  3SYN A;  4B6I A;  4MVM A;  4QI2 A;  1MMA A;  4JTC B;  2OG2 A;  3QTH A;  1Y6D A;  3US6 A;  1JPN A;  4BEJ A;  4E18 A;  2JX0 A;  2VCC A;  2XL4 A;  1RXQ A;  2XLD A;  1OKK A;  2YLD A;  3EGD B;  4AL1 A;  1T6I A;  2QE9 A;  4P6I C;  5COM A;  5T3T A;  1XZP A;  3S28 A;  1OCO C;  3IQ5 A;  4XLN F;  4YT8 A;  2VB6 A;  1PD1 A;  2ZXP A;  3KKB A;  3FVY A;  2H7B A;  3WHN A;  2R7O A;  4JCH A;  4JKV A;  1RKC A;  3U2M A;  4OIO F;  4CBE A;  2C03 A;  5DVW A;  2XSE A;  1RMV A;  3ABL C;  3AQB A;  3JRT A;  4XPX A;  4BJ1 A;  2EPK X;  2J7P D;  1Q0K A;  1NZE A;  2IBF A;  3DMD A;  4MQ9 F;  4HFF B;  2XXA B;  1H9G A;  1HE1 A;  1JR8 A;  3EFO B;  1NG1 A;  3M4B A;  3S90 A;  2EIK C;  2R7T A;  3U3F A;  2GWW A;  1OW6 A;  3B0U X;  3DZA A;  3DM5 A;  2EPM X;  3MFN A;  1EI7 A;  1LKX A;  4KNW A;  2OKU A;  4ANJ A;  3T9O A;  1LM3 B;  3AJM A;  4C3B A;  2CW0 F;  2P0N A;  2XS1 A;  2YLG A;  4GQH A;  3W2V A;  2CGE A;  2L7A A;  3W8H A;  1M2V A;  1A7V A;  1NLX A;  4LLC A;  4BJ5 A;  3M79 A;  4N6H A;  2EPN A;  1E2X A;  2CNW A;  2H7O A;  2HUJ A;  1CGO A;  4H54 A;  1H9T A;  1LVK A;  3EHN A;  4K1O A;  4ULV A;  4C3D A;  3O55 A;  3WG7 C;  3ZVR A;  1FFT C;  4LDK A;  1ZHY A;  4I1O B;  4MW3 A;  4D4X A;  5B3I A;  2W9Y A;  5A69 A;  1M2O A;  3B9Q A;  1PD0 A;  2EPL X;  1J8Y F;  2ICW G;  1FTS A;  3Q7L A;  2EIJ C;  2OOC A;  5EK0 A;  4O6Y A;  3AOU A;  3JZ0 A;  4MTG A;  1PCX A;  3ZG1 A;  1TWH A;  3HNK A; 
#chains in the Genus database with same CATH homology
 1OW6 A;  4EBK A;  2JX0 A;  3C8G B;  1K04 A;  3GM2 A;  3MFN A;  3U0C A;  4XEF A;  3C8G A;  1WTY A;  1QVX A;  3JYY A;  1K40 A;  1V4A A;  3L8I A;  2L6G A;  3AJM A;  2L6H A;  1WOL A;  1KNY A;  1OW7 A;  2KK1 A;  2Q00 A;  3BRJ A;  3B71 A;  1ZZP A;  1PV3 A;  1JOG A;  3GM3 A;  3RQE A;  4NQF A;  3C18 A;  1O3U A;  1WWP A;  3K7D A;  1K05 A;  4XEV A;  3TUL A;  5F28 E;  2YWA A;  4R32 A;  2JPU A;  3O10 A;  1UFB A;  3L8J A;  1KTM A;  3GM1 A;  1OW8 A;  2LK4 A;  3U3F A;  2L6F A;  2PBE A;  3S9O A;  3RQG A;  3JZ0 A;  4EBJ A;  2HSB A;  3RQF A;  3C8G D;  4XEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...