1QVZA

Crystal structure of the s. cerevisiae ydr533c protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
236
structure length
235
Chain Sequence
APKKVLLALTSYNDVFYSDGMKTGVFVVEALHPFNTFRKEGFEVDFVSETGKFGWDEHSLAKDFLNGQDETDFKNKDSDFNKTLAKIKTPKEVNADDYQIFMASAGHGTLFDYPKAKDLQDIASEIYANGGVVAAVHGPAMFDGLTDKKTGRPLIEGKSITGFTDVGETIMGVDSILKAKNLATVEDVAKKYGAKYLAPVGPWDDYSITDGRLVTGVNPASAHSTAVRSIDALKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YDR533c S. cerevisiae protein, a class II member of the Hsp31 family
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
molecule keywords YDR533c protein
total genus 81
structure length 235
sequence length 236
chains with identical sequence B
ec nomenclature ec 4.2.1.130: D-lactate dehydratase.
pdb deposition date 2003-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qvzA00
1PDWA 1K9VF 3OT1A 3TTTA 3NOOA 3D54D 1QVVA 3UJNA 4UZSA 3WFZA 4B40A 3PQ8A 1C3OB 1FY2A 1G2IA 1GG9A 4BFLA 5IP5A 2ZUTA 4ENPA 1P5FA 1U9CA 2R1UA 3TTSA 4ENUA 4ZDIA 2RK6A 1JVNA 2VDJA 3ER6A 3TTVA 4L78A 3TTWA 2OR3A 3F71A 3CNEA 3L4EA 1FYEA 3TTXA 4B2YA 3EFEA 4E08A 2ZUUA 3TTYA 4BIMA 2A9VA 2GHRA 1C30B 2VPIA 1L9XA 2YWDA 3TQIA 1QF7A 3FIJA 4S0ZA 4LGYA 4MNTA 4Y1EA 3ZJ4A 4UOZA 5BV2P 2NV2B 3P9PA 2H2WA 3EZGA 4P34A 3R75A 1N57A 3UK7A 2ZUSA 4AUEA 3PQ3A 5K4AA 1CE8B 2ZUVA 4BTEA 2R1VB 3L18A 4ENSA 3R76A 3N7TA 5SY6A 1A9XB 4Y1RB 3SF8A 4D1YA 1CS0B 2ISSD 3PQ6A 4OJYA 1R9GA 4OQ4A 1VHQA 1VCMA 4Y1GA 4P36A 4AULA 4XLLA 2LXNA 2WJZB 4ENQA 4R7GA 5E9AA 4UNIA 2VRNA 3PQ5A 4Y1FA 4ZGGA 1J42A 4Y0NA 1KA9H 4GE0A 2RK3A 2R1TB 3CY6A 2IUFA 4JQSA 3ZJ5A 1JDBC 1Q2UA 4N12A 4OGFA 1PV2A 1QWSA 3NOQA 4RKWA 3EWNA 4K2HA 1T3TA 1SOAA 3SF8B 1GPMA 4Y1RA 3FSEA 1T36B 1CF9A 1VCOA 3BHNA 1OX4B 1IZZA 3L7NA 4OIFA 1Q7RA 1M6VB 1QVWA 3UOWA 4B31A 4L8WB 4B5KA 4P35A 1GGJA 1I7SB 1UCFA 3P9QA 1KXJA 3MGKA 5JZMA 2AB0A 1QDLB 4HCJA 3RHTA 2XF2A 3CZAA 3PQ2A 4UOQA 1QVZA 2VKTA 1O1YA 3F5DA 2RK4A 1OX6A 2ZUWA 1ONSA 3ZR4B 3EN0A 1P80A 3NVAA 4L95C 4MTCA 4E5VA 3NOVA 4GE3A 2V4UA 4AUNA 2NV0A 1GPWB 3OT1B 4L8YA 2AD5A 4L8FA 3EJ6A 4PXYA 1OY1A 1P81A 5JZOA 3KKLA 4AJ9A 1P7ZA 1VCNA 2FEXA 1OX4A 3BWEA 3CYFA 4P2GA 3UMMA 3GRAA 4AUMA 1GGEA 2YWCA 1IPHA 4WINA 3MIIA 4ZDJA 4ADSG 1IZYA 5LIRA 4OGGA 3B36A 1SY7A 3P9SA 1I1QB 4I4NA 3CZ9A 2R1TA 4B7AA 3B3AA 1P7YA 3UGJA 4P5PA 4WXYB 1OI4A 2YWJA 3NONA 1WL8A 3L3BA 2GK3A 4L7QA 1OX5A 4I2NA 4QYTA 4MGHA 3SOZA 3M3PA 4ENTA 2D7JA 4GUDA 3VU3A 2W7TA 3NORA 3P9RA 5SY9A 4ENWA 1T0BA 5DFAA 4ZDKA 1PE0A 2VXOA 2YWBA 1GGKA 4ENVA 2ABWA 4ENRA 1KWGA 1GGFA 1GGHA 3B38A 3PQ4A 3PQ7A 5SY4A 5SYAA 3R74A 1KWKA 4QYXA 4N0MA 1S1MA 4OFWA 4RKYA 4UCFA 1KEEB 2R1VA 4LRUA 1I7QB 3TTUA 4I46A 1PDVA 1BXRB
chains in the Genus database with same CATH superfamily
2C1ZA 3FOCA 3OHMA 4FFLA 1TOAA 4EFLA 4WEOA 1YK0A 3A1WA 5SZHB 4O5OA 2VI5A 1B93A 5B2FA 1EXVA 5IS2A 3FX2A 3H2BA 5CB0A 1KTVA 3PYXA 2ZUTA 2Z5GA 4XWGA 1L7EA 5EKTA 3NC4A 4P3OA 4MV7A 1SVKA 3EZ6A 3NHJA 4KK4A 1RTTA 1Z7EA 3UYKA 5FNVB 2NVUA 2RKBA 2Y2UA 4QATA 5KTMA 2IHJA 3RC7A 1YT5A 3NHSA 3FVRA 1ZCJA 3CUTA 1SA0A 1N0WA 4PM4A 1E69A 3O92A 3U3KA 4LZOA 4UMEA 5CAEB 3RFUA 1QYWA 3ZEAA 2BBOA 4PV7A 2EEZA 1PWHA 5AO9A 3WGMA 1ZL0A 4BAZA 1K8ZB 1UP7A 4FOPA 1AA6A 2CDRA 1VJTA 4GZ3A 4UQOA 4O0LA 2YNMC 3H9BA 3U7RA 1NN3A 2Q8NA 3IKTA 2Z4TA 4HFMA 4KIUA 1DIOB 3SQWA 3CX8A 1H5NA 1KPHA 1CR6A 5F33A 1T9ZA 2QL6A 3C5WP 1NF3A 5LNK1 2R8PA 5GGXA 2R68A 2CLEB 2ZG6A 2DWOA 3KXIA 1BFDA 1C8VB 2ERXA 3M6AA 3MUEA 1BGWA 1GILA 1R0KA 1U4SA 3QVGB 1MAHA 4IGEA 2OXCA 3COSA 3LHKA 4FKMA 4HB0A 4A16A 3TJZA 1KVSA 1W1UA 1OX4B 2FN9A 5KSYA 4HYYA 1SC6A 2VDWA 3KYDB 3SHFA 4B6FA 4D7AA 4QLBA 1MQSA 2BC9A 2XTMA 4ITVA 2JLRA 3X43A 4GICA 4UAUA 3KDPA 4OHXA 1B8PA 4OJNA 3LCCA 5J2TB 1XDSA 3ZE7A 4DXAA 4HDKA 4B1FA 5KDLA 4L95C 2WPDA 2YYSA 2ZB3A 5E7JA 3V4VB 2AVNA 4LDZA 3NBQA 3IV6A 3A37A 1FPQA 3PDWA 2G9RA 1DG1G 4K9KA 3SIPA 3TW4A 4A4DA 1ODIA 3HI6A 1B74A 3IQFA 3KTFA 2PWZA 5DN9A 1HX7A 1DC7A 2ZCUA 4ZOBA 1ZJ6A 1MT0A 2JJMA 1KO8A 2OZVA 2FQQA 3N8IA 4W8GA 5HJ2A 4F71A 3H1BA 5DTRA 2FPGB 3NBMA 2ZPTX 2UV8A 2H8KA 4MMZB 1R00A 1QYXA 1I3KA 4P82A 3EG9B 1SUDA 3DCNA 4IIXA 1V4NA 1TVCA 4L8GA 4NJMA 3NFRA 4QUGA 5AHOA 1JFFB 2AC7A 3PCRB 5JSZA 1UWLA 3ZQ6A 4EEXA 3VPAA 3SF0A 1IHDA 3D8HA 3EY9A 3ICVA 1ODCA 1ZGBA 5K8VA 4ZQCB 2A5JA 2ECKA 2PJZA 3OF2A 4QPDA 2WFLA 4PFQA 4MVJP 4QUDA 4EUFA 2HXYA 2RCYA 1IY0A 1IMJA 1Y3DE 1QV6A 2D1TA 2CY0A 3EDQA 1N5JA 3IO5A 4YRZA 5C8VA 2OFFA 1C7FA 4ZVOA 5ADHA 4CM6A 3WGUA 2O8VA 3GYBA 2CT8A 1RPAA 3I30X 5BSRA 1UPXA 4B17A 3AXSA 3AGQA 4R41A 4RTJA 1YQ9A 4GWLA 1JFTA 4RE5A 1R4NA 3URMA 4Y7CA 3FH0A 3SN6A 1OXUA 3Q2KA 3H5IA 4NIMA 4Q7JB 3RQIA 2C7BA 5J4VA 5EP4A 3THXA 1Q0LA 2WIBA 4RJKA 3BZBA 1UINA 5BY2A 1J2JA 2HT6A 1P5FA 1U9CA 3HKEB 2VDJA 4NBLA 3S1AB 1KAEA 3LFTA 4DWJA 4JJ7A 1MO5A 1JA9A 1NURA 4BGDA 1H4TA 3AVWA 2J9ZB 1QIFA 1D9XA 3B7PA 3G5LA 4O2BA 4TL9A 221PA 1X1EA 3TKLA 4OGKA 2W6IA 4YEDA 1AKQA 3BKWA 1QZTA 3A3OA 1SBZA 5AJTA 4EHDA 4HQ6A 3LHDA 5EHNA 4YT4A 4P8RA 3C4VA 1GKIA 1U3FA 1XFDA 3FPAA 4CQMA 3QZUA 4HNUA 3W5VA 4KWCA 4PWYA 1WMFA 2FX5A 2WMNB 2YV1A 2I2DA 3LT0A 1N1DA 2OVBA 4IO1A 2QTMA 3R40A 1T9HA 3ILSA 4XPIB 1ZNZA 3F6YA 1JAZA 1CZUA 1E5DA 4JL6A 1SHUX 1W2HA 2CWDA 1P2GA 2WU4A 5E2BA 1I6KA 1GLNA 1FFCA 1I2ZA 4RSHA 5CA0F 2V6FA 4AECA 3QE4A 1UL1X 3MYRA 5FI0B 1A9ZA 3T4XA 1TEZA 4IICA 1P3Y1 2BFDB 4QLOA 4L6IA 1OZGA 1V8BA 2R1TB 2X19A 2ZJZA 4OJTA 3DD5A 1ZQ1A 3JAKA 1MC4A 1QWSA 1UOQA 3O8CA 4LJ9A 3IVGA 1ORWA 1Y9AA 1ZD8A 3BL6A 3LUJA 3NOQA 3NYIA 4CV1A 1VHWA 5A4JA 3RTAA 2ZAMA 3C8UA 3G7UA 4TS3A 1MC1A 3VC7A 5BSWA 1DC6A 4X71A 4E3WA 1NI3A 5JNSA 2CSXA 4MKGA 3WNZA 1C3EA 1U8YA 2QRHA 1MN6A 1Y82A 4GBJA 3DW3X 1RAFA 4Q03A 2QZSA 1ZXXA 2O0HA 4JBWA 4YASA 3M5WA 3ILXA 4GLJA 4Z9XA 1CLUA 2I9PA 1EESA 3DC7A 2XPCA 3LV8A 3ZN2A 5ITZA 1NXXA 3HLTA 2G1JA 3HY6A 4YAEA 3IKVA 1VE6A 4U7GA 1TIPA 3GGPA 1XEAA 1W2GA 3UT5A 3RFTA 4L8YA 1DBWA 4V1CI 2YCBA 3AB8A 4PZYA 4P81A 2YXEA 4X20B 1G5RA 2WILA 5KPDA 2JFPA 4LJ4A 1QE3A 3CPEA 4KUGA 3SM9A 4OI1A 2WHPA 2Q9BA 2X8JB 3JPYA 2GM4A 4F2GA 4B0PA 1LU9A 4G24A 3ZDQA 3KRTA 4URYR 1ZHHA 5AKKA 1G3UA 2GAJA 3LPCA 4IIBA 4XOIA 3AG5A 3O84A 2IEDA 2OXTA 1OGYA 2FLKA 2CLDX 2JK0A 2PZMA 3OKCA 4IXNA 4XA8A 4TKVA 3O4RA 2EJTA 2QVLA 2CLKB 3ZX5A 3NHPA 1ZEMA 1Y9DA 5FLEX 1WL8A 2G0AA 2WW8A 1DAFA 3MINA 4LF9B 3GVXA 1JRLA 1MH1A 2VYVD 2Y3IA 1PKXA 3LLVA 4WGGA 4ZVNA 4GI7A 3NORA 4GI5A 3VZDA 4GYWA 4TLBA 4JI4B 1PFKA 3O83A 1EP3B 1U8AA 2C9CA 1G59A 4OQNA 2B1IA 4QPZA 2OCPA 4GOOD 4PYMA 4S35A 5DM2A 1ARZA 3RVQA 3KPWA 4BFSA 2JLYA 2ZYSA 4WIAA 5B6JA 4FNGA 4MGIR 4CGYA 1RRMA 4LRUA 5FV4A 3MUNA 3EEFA 1OGIA 4JJAA 2V3VA 2HTEA 3PNOA 4LECA 4AVYA 2BMEA 2NPOA 5DN6D 5ICMA 1H5QA 3IPCA 4AO7A 3WDMA 4U02A 1U7TA 4GW3A 2GFQA 3VR4A 2F55A 3SHWA 2OO3A 2NZJA 2OAGA 2K87A 3GDHA 3LRTA 2RHMA 3UXHA 5T6BA 2ZJ0A 4JK3A 3HFRA 5E7IA 3WAGA 5LKAA 3LT2A 3DMTC 2WWVD 1GYPA 3CSUA 2QXYA 2WAMA 2OR3A 2QQFA 3KYJB 2WICA 3A1EA 4C0QC 1KZ9A 2Y1WA 1G6KA 3TTYA 1J00A 2X8BA 1SIUA 4HNRA 2XDQA 1EFPA 2WLTA 5FFNA 2AFHB 2JAXA 3P9XA 3TNFA 3ZJ4A 3Q9UA 4JUCA 1ECJA 2Z57A 3WV5A 3MT8A 2SKDA 2GEFA 3R5HA 4ZYYA 3ZCRA 4FMCF 2P2NA 4HZIA 4Q9AA 1TAUA 1TGYA 2MYPA 1ECGA 4C07A 1S0UA 1TM1E 4DA4A 1RHKA 3F6EX 1CP3A 2KI5A 3H6GA 3NKFA 1K6IA 5B2ZA 3RTGA 1IQPA 1Z4KA 2ISSD 2BHRA 2PSSA 4WZBB 2V97A 4ETWA 4RL4A 4TN5A 3UMFA 4GBMA 3W79A 1L5LA 3CU5A 3RFCA 2H2IA 2C4KA 4FBLA 4XZ3A 4BEWA 4YFVA 1H8HA 1BJRE 2COEA 5DBEX 4QDXA 4AMGA 4E13A 3F67A 3ZWQA 4N12A 1C9NA 4KR6A 3Q8KA 3CE9A 4YRQA 1P3DA 1T3TA 2P62A 4LE2A 3S5JA 1UJ6A 5J2UA 4WLOA 4J49A 5EUMA 3STXA 3JATA 4M6WB 3TB4A 3UUFA 2EZTA 5LBTA 4NVRA 4E2YA 2GF2A 1DCKA 2ONCA 3IP3A 2RGBA 4FXOA 4NBKA 1BDBA 4NHEA 3UMCA 4AZ0A 5JDIC 3CVOA 2FP4B 4P35A 4QGBA 3AH8A 1V25A 5K3CA 1F8XA 3AEUA 3R7NA 4WFIA 3KQTA 4KE8A 1SXJC 4NCNA 4PCAA 2A8YA 4DMUB 1XK6A 4HEQA 3ZR4B 2FUG6 1PQPA 4JX9A 4JEIA 2RI1A 4QULA 1U8CB 1UPBA 2BLLA 3DBHB 2OV2A 2Q1TA 2X15A 4U2EA 5CVVA 5EIBC 4BLOA 1HFKA 3KLMX 3JQPA 2UVDA 4OM8A 5AD1A 4ER6A 1JN0A 2DHDA 2GSWA 1H3EA 1EE9A 1ZN7A 2ZI3A 1SCKA 3DBOB 4J0DA 2A57A 3KAJA 3IIEA 1LXCA 1DKPA 3VHXA 2V7UA 3BSWA 4XDYA 1HE1C 4Q39A 5ALTA 3AVYA 3JWJA 3QPVA 2OM2A 1J9ZA 3FW1A 4B3TB 1QIJA 4J1SA 1F51E 1TW3A 3H2JA 3O21A 2Y1FA 5LKRA 3NWEA 2UYGA 3ND5A 1PJBA 2JHGA 2QRJA 2DWPA 4KH1A 4X66B 3WGYA 4OBWA 1V3UA 5B3JA 4LNHA 4TTPA 1RR6A 3JQCA 5JCZA 4JMPA 2C7PA 5JWRA 4ARSA 1IUOA 1TZMA 1KRXA 3NRBA 1V11A 1E1RD 2IRWA 2QPAA 1QO9A 4MR7B 5HKLA 3UUWA 5KWSA 1BVYF 1FX0A 4KAJA 2IXAA 4ENWA 2IP2A 1H05A 1QPBA 3QA3E 3T0FA 3GLIE 3GGJA 5C52B 2AF4C 1FP7A 5ISMA 3E1GA 1OT3A 2AG6A 4Z0PA 4ZHQB 5M5BA 1R4MB 1SUFA 3EDCA 2VLIA 3WDKA 4UE3S 2JJYA 3OH8A 4A92A 1W0KD 1Z9BA 3QEMA 3DUWA 2XXAB 2BGIA 5EMNA 1AK1A 3TTTA 1NA5A 4OL0A 1KKUA 1I7DA 4CF5A 1UEXC 1XKXA 1ONOA 4KN9S 1X2EA 4GYYA 1UFVA 2GH1A 1XG5A 2AG1A 4CTNA 1WHTB 3ELWA 3WZMA 2C59A 3IJPA 1KK2A 1HF3A 2YIVX 3E84A 1L8LA 8MHTA 1BCSB 3DO8A 3LBNA 4XWTA 2PMCA 4Q4JB 3ZW7A 4BKOA 2O2SA 1K7CA 2C95A 4XLZA 4Y2SA 2WU1A 3FCXA 1RWBA 3K8QA 1QR2A 2PFSA 3EZ9A 4GQBA 1A8QA 4PO1A 2ONJA 4MINA 5DBGA 4ASUA 2JLUA 2G6BA 2EC5A 3JYPA 4G81A 4S2UA 3GJQA 5J47A 4DN6A 2BFFB 4IX1A 3J80A 4QECA 4ER5A 2OV8A 1U0RA 5CBKA 3M2TA 3B1JA 3PBKA 2J09A 4HWOA 4KX5A 4AJHA 4GXTA 4XGNA 2PS9A 5J3JA 1J0XO 5G4KA 1MO4A 2H1WA 4V0KA 2NO9A 1Q1EA 3DE0X 4J1TA 4MV0A 4WBNB 2JHFA 4UNIA 4C06A 1U28C 5K8CA 1CIJA 1FFEA 2C2WA 2IEGA 3FFAA 3IALA 5EWMB 3H4MA 4WOCA 3K2BA 3FGOA 4WUTA 1QHHA 2B20A 4N7RA 5I7RA 1T6XA 1QYDA 2FWPA 3BXHA 1W30A 4NZPA 1LS1A 1FNMA 1MX1A 1YJQA 1NXPA 1T9GR 2OBXA 5IYZA 3PXDA 4DRXA 4Z4EA 3VA7A 4YAUA 2WHYA 4O5AA 2HDOA 3G7NA 1AKRA 2CLCX 1KS2A 4MWTA 1GZSA 1GGJA 4GGMX 4ZOLA 1T13A 4YYEA 3EVEA 2VWGA 3IUNA 5GIOE 3QLEA 3K70C 1XZPA 3TDKA 2IS1A 1Z25A 5IMSA 1R9JA 1KI9A 1T36A 1T91A 2WDPA 3OJWA 3VXKA 1LX6A 4BWFB 4FCVA 3V97A 2WTXA 1TCVA 2G5GX 3QWHA 4EX6A 1ZFNA 3ZWAA 2UZ0A 4GRIA 4ZYTA 1CUUA 2N75A 4M83A 2C57A 2HI0A 2BFCA 4R6XA 3RT7A 1IPFA 2XMPA 4H9GA 4MCHA 4XEHA 1E9FA 5A3SA 3L0ZA 2ZRLA 3F0TA 3CUSA 3L7DA 5EC8A 2X7JA 3TRIA 5K3BA 1BVHA 3H17A 2PA0A 4B2LA 5KQLA 2ZI4A 1Z37A 4G01B 3T3GA 3IDAA 4K5QA 4NTZA 3UTCA 1M7BA 5CH3A 3DUFA 3BH7A 3PQDA 1TD9A 3WLFA 3O38A 2P11A 3RSLA 4ND3A 1EGHA 1FPMA 3GRKA 3R23A 1Y1TA 3RS3A 4E21A 2XZLA 2P2SA 3K0SA 4PAGA 2I62A 3WFJA 4CMKA 2DEUA 3KD2A 3CF4A 3RS5A 4BNWA 3FMVA 4Z4GA 2YWBA 3EMDA 3SJ7A 1K68A 4EL0A 3IP6A 1CF2O 4G1UC 4O3FA 4TRNA 4R0NA 2JDIA 1UH5A 3QW2A 3M70A 4DIMA 5T41A 4BCCA 1GTG1 4WJLA 1EGQA 4WLEA 3AVVA 4I99A 1CY4A 1G8AA 4MICA 3NJ4A 3ZKWB 4DQ0A 1PT8A 3LLSA 4N5MA 2WHQA 1XU9A 2J30A 2X6QA 4DADA 3L1KA 4PQGA 4EVQA 4CQNA 4UBMA 2ZLBA 3PXGA 2R6HA 1KFEB 2JW5A 3HKCA 3HP7A 3QFFA 4KDEA 3RJMA 3GLGB 1LDNA 1TIBA 4JWTA 1CF4A 2Q4BA 3C85A 2IYRA 4GVLA 4N18A 2GBLC 2FAXA 4BZPA 4OP2A 3TW6A 2Q3EA 1D5CA 2DLDA 3AVQA 4MB6A 2Z6UA 3AGPA 4D4KA 4F3TA 1J9EA 3OQIB 3U9LA 1XMOB 3UH1A 5K0ZA 1AQIA 5AW7A 3BRQA 3A4TA 3N1UA 1Q5PA 4NONA 6NULA 3GLIA 1N6HA 3OQVA 3GH3A 3Q7IA 4MUAA 1B76A 1L7PA 1X86B 2C04A 5CT4A 5A04A 2B8JA 2AWOA 1POXA 3DZGA 3G9TA 1QC5A 2HADA 1W4BA 1E6CA 5H3LA 3FN4A 1SXIA 4ZVQA 1PJ8A 3GT0A 3VOAA 5JAOA 2BKAA 2YW2A 3QF4A 4ER0A 3BSFA 4PN3A 1QX4A 7REQB 1MGOA 2OUIA 4O2AA 3D5QA 4OVKA 4RK5A 2G1PA 3J7TA 3VR3D 3FZNA 4QBHA 1O3YA 3HJUA 1MOZA 2Y27A 2YFHA 1GL6A 1D2HA 3Q1LA 2IP1A 4JBNA 3PHCA 3E4CA 1IEQA 1KAMA 1CUHA 2WAXA 2XYQA 2J7PA 3QUBA 5JHHB 4ZO4A 1EB8A 4OY3A 4Z1MA 3R8XA 2AQ8A 3NHKA 1QVZA 5E6SA 4AN0A 4BUZA 4MPPA 2ZAGA 3EVFA 3IH5A 5IDQA 1FU4A 2LDBA 2NAFA 4HWSA 1QO7A 4WLVA 3A6JA 4D8UA 3CA8A 4MAAA 3WBBA 3IMKA 3L6OO 4TUYB 1ZOSA 4WZAE 4CKEA 4UDOA 2MINA 3AP1A 4ZV9A 1G6Q1 2LUOA 3UC5A 2QAGC 3QU7A 2EEPA 5CD9A 2NNLD 3I39X 3H8VA 5I51A 4G0XA 4GC9A 1ZJWA 4ISCA 4UUQA 3R6GA 3BRWA 1T9KA 4A8JA 1QH1B 2ZRQA 2XMZA 2ZIAA 4PSKA 4TYMA 5JALA 3NTVA 4RPCA 1WMSA 1RKBA 2E3JA 3QPAA 4NU5A 4D41A 4G5QA 3MTEA 2WVJA 3P0FA 3LQKA 3ON5A 1E1QD 2AA3A 2FDRA 1YAHA 4KJZA 1T2UA 3AI7A 3M7IA 4FDVA 5EE1A 3VNSA 1R12A 1OIVA 2F1OA 4QRIA 1E6UA 3WGZA 1IN4A 3LCUA 5I8WA 3LQ1A 3JPWA 2D0DA 4G4SO 3H9JA 2A7QA 3GG2A 3HRKA 4KGVA 4OB6A 3K7EA 5DCLA 3WAKA 1PWZA 1Z12A 3PQCA 5J4LA 1XYYA 3VKUA 2VA8A 1Z7BA 3OE7D 4PRKA 4QFDA 1CUAA 3FMOB 1RD4A 5TEWA 1DHRA 2HU7A 4KFRA 2CFOA 1BE0A 3HJBA 1OLXB 3DJFA 1LA2A 3ETCA 3CRMA 3HLYA 4L51A 4QUBA 5J23A 1J8FA 2PMEA 5KOJA 4LE1A 2NUPB 3CEPB 5CLHA 1WOMA 3GDFA 5PGMA 3OZGA 1M2KA 2EFGA 4EHAA 1Q0TA 3II6X 1S4MA 3FROA 2FW9A 4MA4A 3KOYA 3QV2A 3AHGA 5IYZF 2VQSA 3WYGA 4RTKA 1XMQB 3E81A 1CWUA 1E1KA 1BAPA 1D4ZA 3CVVA 2XUIA 3H9CA 1XCPA 3H4IA 4J0IA 5D3ZA 3RIHA 3IMCA 1JTEA 5DRTA 2DU8A 5EYPA 5A0VA 3M5PA 2NU8B 1WZ2A 3DCJA 5HIAA 2ZUUA 3Q8XB 2G5CA 4EB3A 5LN1A 5MFZA 3KKQA 1UMDB 1OLXA 3P45A 2OZKA 4IJUA 1VSQA 2B21A 4C4SA 3NBZC 4XR9A 3WLKX 1T5DX 1MUUA 5KOJB 3OFJA 3VPSA 3WJ1A 4CETA 3AEQB 1MZVA 2ZE5A 2H5EA 4IIDA 1ULZA 2QDXA 3DDHA 3ED5A 4F5ZA 4Z1OA 4C03A 2QQGA 1XRNA 1R8YA 2B1QA 4NFLA 1EA7A 3HDGA 4IGIA 5FHQA 5UKDA 3BIJA 4HH1A 4PGHA 5HIKA 2IBSA 3I12A 5KNLA 4LI0A 3DE5X 3T9FA 4W5OA 2G72A 2OK8A 3TR5A 3PWKA 4AXXA 3S2ZA 2WJZB 3U40A 5CEEA 4JSTA 3EOAI 1ZI8A 2PX3A 2EDCA 4JOBA 3WK4A 2HRDA 2ZRNA 3DFFA 2FPLA 4AY3A 1E9VA 4PYOA 3ZDAA 1UKAA 4FEAA 1QH1A 1W5FA 2ODBA 2Q2OA 2IU4A 2WFZA 2OT3B 3F3SA 4G4JA 4MKIA 3ITDA 3G49A 5DLPA 4KOEC 1M74A 4TQ9A 2C54A 4L02A 5BNIA 2F8TA 1EBUA 3FBTA 3HKCB 4PEVA 4W5WA 5CGQB 3AU8A 1AO3A 4LYDA 4I81A 4PLPA 2AJ8A 2VA9A 4AXBA 2Q3BA 5IPFA 1O96A 3GW8A 3L7NA 3AEUB 3OM0A 3G68A 3PTAA 1RSZA 1P3JA 3GGGA 3BE8A 3GHYA 1ITZA 4MQMA 3O93A 3CNNA 2CV0A 1ZIXA 3HEAA 1ZCFA 5HKOA 5LMCA 2ZSUA 1ZOPA 4KQHA 2B92A 1VIAA 3I01M 3W1EA 2UUAB 5C8XA 4B3MB 1BXGB 5DM60 2DQ4A 4Z9YA 1C3VA 1WVMA 2NT3A 3S2YA 2IH2A 4CTKA 3KKLA 5BYJA 2XEXA 3GCXA 3V7YA 1W7AA 3GUHA 4O0MA 1N34B 5KINB 2FH5B 3SQNA 1PLJA 1XJCA 5KHLB 2GF9A 3HNPA 4LJ6A 2V96A 1ZGZA 3L0DA 1AQ6A 4NS4A 5KCZA 4CMJA 2QMZA 2EKZA 3BN3A 2VH1A 3MBOA 3PGVA 5ED4A 3CINA 3MIIA 1M34A 3ND8A 3H99A 4BATA 4F92B 5I7SA 1K2WA 3TAHA 5JJBA 1F8YA 1HPLA 1EDZA 2WKRA 1XR3A 4UJ5A 4D3ZA 1T0UA 3O1LA 5ECGC 3WKAA 4B79A 1IAVA 3ABIA 3AEKA 2F43B 4DM7A 2DCUA 4EPRA 2B37A 2NTEA 3BA6A 4WD3A 2DSTA 1YUMA 3D4OA 1RABA 5AHXA 1NWCA 3T7SA 2ZB2A 5IXJA 1NRIA 3D7LA 4LY3A 1K75A 4MQUA 5TMDA 4A2QA 2Y0DA 3AV3A 1FB5A 1BWPA 2ZWPA 2HY7A 2PLAA 4QRHA 4B09A 4BWYA 5JNLA 1KWKA 4MS3A 1AU9A 1U2GC 5LQMA 1P45A 2Q5IA 3VR2A 1L4EA 5HKBA 4URHA 1X14A 3HA3A 3UUGA 4EG8A 3TF5A 3WNBA 4ZVRA 2I6SA 3I0MA 1BW9B 1W0KA 4MRVA 4KU4A 4LJLA 2B8EA 2O8NA 1BD4A 1CDOA 1Y1SA 2Z04A 3GP3A 3F6CA 3KFLA 4JQCA 1XVUA 4JXKA 4YMVA 4ZEVA 2N1MA 2J9GA 1N3IA 5E1MA 3T0GA 2CLMB 1GD1O 4H0FA 1EJ6A 4IIVA 4IHJF 3VPCA 1S5PA 4FGKA 2XNCA 4OHUA 2W37A 1A4IA 3AILA 3WO0A 2FR1A 1E1RA 3LH5A 3FIJA 3B3QA 3H8WA 2I7DA 2A1TR 2AR9A 2G09A 1MOPA 2XAUA 2JI9A 2QORA 4WJZA 5HGXA 4I1SA 1UKCA 2ZUVA 3BBLA 2OC4A 3KEFA 5GM1A 1GR1A 1GYRA 3DULA 1KDVA 3R7WB 3SYRA 2B5OA 1XALA 1KQOA 2XSZA 1IOZA 2W6NA 2W00A 5K3FA 3TKAA 3SFVA 3ZVLA 2F8SA 4WN9B 1UBSB 2HSWA 3QKIA 1JSLA 4BNDB 4OK3A 4R84A 2Z2IA 3HBMA 1QLWA 4RW0A 3KPYA 4YLYA 3K0CA 3TZHA 1QE0A 1E2HA 4C88A 1KOJA 2HQBA 521PA 5CGZA 1NKTA 1YMVA 1ZMTA 1X42A 3F7MA 4LHXA 2G04A 1YOVB 4PTZA 4DMKA 4QVGA 3U44B 1TUEA 2H16A 1JECA 2QTVB 4RFVA 2V59A 4KGZA 4RV5A 4MR9A 1EMDA 1E60A 1NW9B 2ZSHA 3C3MA 3FPSA 4N7JA 4JP3A 3OCUA 1DFIA 1NUAA 4OQLA 3VISA 4LAFA 5JLJA 1YONA 2Y66A 3SY8A 3I8SA 3T1HB 2ZAOA 2KBFA 2VYCA 3OD5A 4N9WA 4BFVA 1U0SY 2HHLA 5TQ0A 1Z5NA 4ARZB 4BVBA 4YRCA 2P7IA 5DXFA 1YJBA 5CG1A 1S7CA 1VE9A 3NT4A 3IDQA 4PAOA 4I9NA 4BKPA 3ROTA 1ZMBA 4CT5A 2XNDA 1BXZA 5ALIA 4L8FA 1XLTC 1H8HD 2DFVA 2BCEA 3W5UA 4ZMSA 4BMSA 2B1JA 5BQOA 1U3TA 2ZRFA 1JFRA 1ECLA 3GRVA 3P96A 4IHJA 4EMTA 1Y4ZA 4G0QA 4Q3LA 3PFCA 4FX5A 4ZVKA 4DRXB 3SC6A 2A5GA 1S2NA 3W6OA 4GL2A 2ZRPA 3G3EA 2A92A 4WT7A 4RD0A 1G9XA 5JAIA 2Q9CA 4CL8A 1H0KA 2NXEA 1OWMA 1JFLA 1OV4A 2PT9A 3LL4A 4R8LA 2H4HA 4F2PA 3GJZA 1WW2A 3AUKA 3GXOA 1VRWA 2PXCA 5IDWA 1GTSA 3KSRA 4LJ8A 1L6RA 1U0JA 3VGPA 1PYGA 1U04A 2FJ0A 5HVNA 1ZW1A 2YBEA 2ZP1A 3EUAA 4HB4A 1PTJC 1P91A 1GRCA 2VJBA 2G5TA 2G17A 4OLAA 2HXSA 1NBAA 3CURA 1VA5A 2YHIA 2O6HA 4GRAA 2BBTA 4LXHA 3L7LA 1TRKA 4KQXA 1YNSA 3EFBA 1TVKB 2IIVA 1KI1A 2UVPA 4KN8A 2Q8QA 1BCSA 4PO8A 3P71T 3TSWA 3B53X 2H1SA 2YRFA 4HEJA 3MZ0A 1EWTA 2D3TA 2W2XA 2LE0A 3WKEA 1RBMA 1P73A 2F59A 1MEOA 1T6YA 2V7WA 2ZJ3A 3PIDA 1FUKA 1MJGM 1BS1A 4JLAA 4Y2RA 3SQOA 3U39A 2I4MA 2W2PA 2QN2A 4NABA 4UMDA 2DWUA 2YJGA 2V0GA 1KY5A 4DOMA 4CL0A 1SVMA 2PQ6A 2Z98A 1Q20A 4J2OA 4NEHB 2HCBA 2R6CA 3JALA 2LW7A 5JU6A 5BUCA 4LXXA 3F3KA 4DNQA 2V3WA 3M4NA 4M9RA 3HMKA 3M89A 4WZAA 4XLTA 1R27A 2AI1A 4JODA 2QTLA 1WRBA 2DPXA 2GTHA 1DLIA 4EG7A 1NLFA 3WB9A 4MAFA 4R54A 3TRKA 2XIQA 5JY6A 4ZHQA 1YB1A 5EWLA 1W5AA 3Q0EA 4CLDA 2C5EA 2CDBA 3D3EA 3K1AB 4MV5A 1A0OA 1PIWA 3K20A 4JJ4A 1RJEA 1LDEA 4P36A 1RLJA 4U2DA 2PGXA 4WKPA 5EMKA 4DKJA 1NX9A 1FK8A 2F3UA 4JU8A 4K9RA 5IULC 1JHMA 4O08A 1OOEA 1S3SA 1XPJA 3HCCA 4NY1A 4R3UC 3BXOA 5DBHX 4MR7A 2IFTA 2ILTA 3TZBA 4DXHA 3G9ZA 5ALGA 1FFBA 1VSBA 2HMSA 2RHHA 5TS2A 2XMDA 3QW4B 1KOLA 1A2OA 1GKYA 5SICE 4KQWA 3VMMA 2P5YA 1RWKA 4JLJA 4A0RA 1XNJA 3DBIA 4UDXX 4UPDA 4JUAA 4MIOA 2G3YA 4KN6A 4NG5A 1KP9A 2UYCA 4LVNA 4F38A 3S2GA 2FFBA 3TBFA 4DAOA 2BMJA 2XB6A 3MT9A 3FI0A 4H1HA 5CFNA 2CB0A 1RJWA 3IJEB 1N5KA 3PQ2A 4UHCA 1C81A 2QX7A 1BQ4A 2LIVA 1FDTA 2HLDD 2PGAA 4FKZA 4CG1A 4DUGD 3VM6A 2JLVA 1KS9A 2R7AA 2CJPA 5BOSA 2XYPA 1GPWB 1W1WA 1SQ5A 4YAGA 5DV9A 3ZD8A 1F17A 5GVRA 3A9RA 1T2CA 1W88A 3R3XA 3LWZA 2ZSDA 3FB4A 2KLBA 3SE0A 1PZEA 2J4CA 4HZGA 4D0RA 2JEZA 2XMSA 3E5HA 3WY9A 4YP9A 2FZCA 3AESA 4DLXA 1YZFA 3A2LA 4U6SA 1U2TA 2QJRA 4FDMA 4PSAA 2B4QA 1PV4A 4YIHA 4I4NA 1QFJA 4EY4A 2WF8A 4HDMB 3G8CA 2QJTA 4CQLB 3NMUF 4NJEA 1PK7A 3FNRA 5T3UA 2VK8A 1SR8A 3AIIA 4F9EA 5C7IO 2V65A 5K0GA 4OHZA 4YMLA 2IH5A 2JAOA 5I4IA 4NBNA 1Z29A 4R1TA 1DTEA 1I14A 1P2VA 4EBBA 3RWOA 4BAGA 3EXG2 1DJLA 3K70B 4W1QA 2GN2A 3OZWA 4LJ7A 3BOSA 2DETA 3I2FA 3VSBA 4MVJD 1DWUA 5FA8A 3TOCA 2PO7A 3VSCA 4LK2A 4ETNA 5L3QB 3EEOA 2Q6TA 1RMQA 3ABOB 5C81A 4DNPA 3E8XA 4XARA 1MO3A 2EXXA 4KP7A 5JHGB 3QEBZ 1C1DB 2QR2A 2ZSBA 1AVTA 2PA3A 3AY3A 3DCYA 4BFXA 2HCTA 3OWXA 1DFGA 2EOAA 2ZXEA 2W2QA 3JY6A 4D2IA 1NJ2A 4W99A 2F62A 2OHOA 4R2LA 4I08A 3X1JA 4DA0A 1U65A 2HSDA 3N0TA 3Q72A 3NHMA 4XQEA 5F1KA 1L4NA 4B9AA 3BK7A 4CDGA 4ENPA 3LBHA 1QBKC 4RVCA 2AIRA 1L4UA 2EWWA 3U0BA 3TTVA 3PLRA 5FOTA 3JQBA 2B9EA 3WK8A 4FK8A 4M9CA 1T0HB 5CDSA 2H65A 2FU5C 4UDNA 5DYIA 3VU8A 3WGHA 5I4BA 3GN2A 5HCUA 6GPBA 3HVIA 5B1SA 1LPPA 4LXTA 3VR4H 3ZHUA 5M29A 2ZJ6A 5KBYA 5AVVA 4L85A 4I14A 2AOVA 4YJ2A 3C8DA 3QOFA 4OA5A 1QTNA 4V2UA 2VJDA 5CM9C 4QPCA 3RK4A 3ICQB 1FJ2A 4DILA 1DKRA 3F74A 3F9CA 4IDFA 3D6JA 2HREA 3PQ6A 4KC0A 4L74A 1PKEA 2B2NA 1L1RA 1E0JA 2PN1A 3QFTA 4RFLA 5DI3A 3TN7A 4P7BA 1XRPA 1M2JA 4ZO8A 3AM3A 3GK3A 2NNWB 3UJ6A 1FXSA 1JKJA 2YZKA 4OQXA 4TVBA 1D2RA 2WWHA 1NVMB 3NLLA 5CXQA 1T5SA 5LWQA 1ZC4A 2GT1A 1L7BA 4NCBA 4EPWA 5FTLA 3PV0A 4MV9A 4MLDA 1WNTA 2JLBA 1KFKB 5BVGA 3NHRA 1U2PA 2UUOA 4EELA 3S1AA 3TCNA 5AKIA 3T4PA 4AMVA 5IVPA 3GV0A 4Y67A 2VHJA 1XD9A 1XELA 2BBSA 3I9OA 3CTMA 3IVMA 1XEFA 3DB1A 1J1ZA 2Z8YA 4I1VA 3TO5A 2DJ5A 3AKEA 5L7YA 2ZZMA 1JIUA 4H1UA 3STYA 4HXGA 2IK8A 2MT9A 2MSDB 3UNXA 3EYWA 3ZD9A 2PIDA 4YJ3F 2FLWA 3R5JA 5KREA 3F5QA 1O1YA 2IGBA 2CF5A 4V0RA 4AM8A 2ZXUA 5TSDA 1RC8A 3E18A 5E6UB 1NONA 2V4UA 3OJXA 3VBEA 4UEWA 2XUPA 4ZI7B 3ZEIA 4D9CA 3M9LA 1XZ8A 3QX9A 3A1TA 4PWZA 3T5DA 3FHTA 2JB9A 3TUZC 3NWJA 3S40A 3VPBA 5JJIA 1Z8HA 1EJ2A 4XWYA 4BCBA 2IH4A 4QXRA 2OCIA 2WM3A 1JG4A 2PG3A 3KETA 4DSZA 1NULA 4UMVA 1V8DA 1ESEA 2AI2A 4FHFA 4AIIA 9ATCA 4DFDA 2HWKA 4ADSG 4N0DA 4K2AA 3NNDA 1YCGA 1GGMA 2INGX 4COKA 1UT6A 2R1TA 3DGFC 3SBDA 4A6XA 4DNFA 3T3NA 1YB5A 3DR5A 3HJHA 1U2GA 3SYMA 4Z54A 1OZFA 4JVNA 4MVJE 1PL6A 1DZ3A 1ESMA 1OIXA 1FVXA 4AYXA 4BNZA 3KJEA 4MROA 3U7GA 2V7PA 4ZTBA 1L4GA 4GUDA 4X3CA 1YR2A 4DBLC 2ZUFA 3BMQA 2EL9A 1AUQA 3V4RA 1N8NA 4D74A 3PE4A 4M7PA 3AKYA 1Z8FA 4RSGA 5D3QA 5EUBA 2BEWA 2EKQA 1GPKA 2C1XA 3AX6A 3RR2A 2HA3A 1QHNA 2Q3JA 3GJSA 1HDRA 1Z74A 2Q07A 2IS2A 3C7CB 1EINA 4IQFA 4J8PA 1V8FA 2GPTA 3OZSA 5HK8A 1YB4A 4EB6B 4J0EA 5U4XA 4ZK2A 3LJKA 1HXHA 4GXRA 2CKMA 1E3EA 1XMSA 3U5ZB 1L4HA 4D8WA 1Q0PA 2BMDA 4LMAA 1XZCA 3KJNA 3LGSA 4AI6A 2HF7A 3AL0C 3C3XA 3O4HA 1G3IA 3GEHA 4RIIA 1XZGA 4GP6A 1JKMA 2J3EA 4TWBA 1Z4OA 3HYSA 2JJ1A 2VCYA 2RHTA 1IUPA 2IHYA 3EQ2A 4DABA 2GCNA 4ALKA 1ANKA 1CZLA 1WXQA 2CVOA 1GUDA 1MDFA 4M7OA 4Q16A 4EMBA 3GJ5A 2BMVA 2IV2X 1J5PA 2Q9AA 1T2DA 4GO1A 4OQFA 6YASA 3LF1A 2QK4A 1QZ3A 4N39A 3AJRA 1J90A 4YRFA 2AFHE 2YWDA 3IQIX 4OBBA 5B6IA 1QF7A 4QG7A 5HILA 4F4JA 4UEJA 1N4DA 3B6ZA 1UWKA 5CG2A 1ORTA 3UJ8A 4HS4A 4B8YA 3K3PA 4UUAA 1DS6A 1E77A 4IR7A 2VQFB 3FDXA 4D42A 2XMCA 3U49A 3VZBA 2H1IA 3N70A 5FI5A 2EGHA 4AIRA 5BN4B 4HPJB 5DWQA 3VBCA 2DPHA 1SFRA 4N4AA 1G38A 1SBTA 1WULS 2WVGA 3PG5A 4PXAA 4NFYA 2EX4A 4PZLA 2PLRA 3GB9A 4RDXA 1TTHA 3I32A 1VMAA 1UZMA 3D6AA 3RVPA 2I66A 4E1VA 2J6CA 1L5QA 2P90A 3DQPA 3AQ4A 4TV9F 5IZ4A 4L8LA 3LX6A 2GZ1A 1HEIA 1E5LA 2IUFA 4Q4HB 5D8DA 3SR3A 2FPIA 4TQUS 5AW0A 2O8FB 3NU1A 3S28A 3HJAA 3GYGA 2HBYA 4TUYF 3KT0A 2WQ7A 2GN8A 1KJQA 1Q3TA 2AYYA 3AFOA 4MVXA 4IRMA 3FYHA 3BMXA 1JZQA 3RTBA 3OJEA 4R3NA 5E4JA 2OSVA 3SXUB 1LNSA 4PCVA 3S8YA 3SQDA 4GBED 2GM3A 5TJHA 1QG6A 3F6RA 2YWRA 3KALA 3A9CA 4EY5A 4KLCA 1QH0A 4BRUA 3PS9A 4E07A 1N3BA 5KNBH 2SKCA 4FE3A 3PEWA 2XRZA 2A35A 2BHSA 1KEKA 4HDMA 2HCRA 1Y3HA 3E03A 4TLEA 5LYYA 1Q6ZA 2K6GA 4TUYA 1DXOA 1DC5A 1L5SA 4PNHA 5EUCA 3RSGA 3PFGA 1OLUA 3LM8A 1I2DA 2JGDB 3LBIA 3CJRA 4GBGA 5BW8A 5KOHA 1TCCA 3ZNNA 3SC2A 4L9WA 4YXWD 4OPMA 4ZEWA 3ZQUA 4C0BA 2AZMA 2WWFA 2FWIA 3K9WA 2CBXA 1GRNA 1K6JA 1T8TA 3R6WA 4P2GA 4Q4LA 5DW3A 2IYEA 3P9KA 2Y6UA 4V0SA 1QGOA 1MAVA 2CFTA 2W9XA 4G9GA 4WI1A 4C0HA 5JC8A 4DV6B 4OHFA 4AZ3B 3BMNB 5GTDA 1CR2A 4C0KA 1EM8B 4LJYA 4P0TA 1HE3A 3UICA 1PJAA 2IHVA 1LY1A 3CZ9A 3IFSA 2DFKB 3QF4B 4C43A 5LYJF 4YRPA 2VYND 3GAZA 5G02A 5A03A 2SICE 4GGOA 1IHOA 3IP8A 1XE3A 2CLOB 5BMOA 3FPJA 1N8SA 3OICA 4FMPA 4MDHA 2IZ0A 4N3AA 1NE7A 1QYCA 4KFUA 1QRUA 3EHDA 4EJSB 2OBFA 1II8B 3NM4A 5A2QA 2I2BA 1PR5A 3OZRA 1OTHA 4WJKB 1EQUA 3PA6A 4W63A 1AGNA 1CVIA 3BDVA 2GHQA 2OTCA 1I7NA 2JLXA 4WOKA 2ALJA 3AZPA 3C24A 821PA 3GLVA 4LOLA 4BQNA 1AK2A 2YX1A 2H31A 2YHAA 1E2EA 2YY5A 3LQQA 4YS6A 2BMWA 2G7MC 2WT9A 3HDTA 1P4SA 3ONWA 4ZPJA 4H1VA 4RIEA 1GDHA 3A9SA 4N0MA 3IAS1 1A9PA 2FZLA 3CKYA 5DCUA 4GLBA 3RSFA 1HI9A 3TTUA 3VKWA 5FNVA 2FJUA 3EZNA 2GZMA 2CFRA 3KYIB 3LCVB 3FZEA 3BWBA 2B69A 3HV0A 3ZVKA 1IYZA 3TLZA 4BUCA 5BYAA 1H4VB 2VT7A 4A1OA 3VUFA 3SHVA 2XGMA 2VHVA 5D1HA 2AX3A 5D87A 3THWB 2GAOA 3D4LA 1YZNA 4Y2YA 1JA0A 1GKKA 2BBWA 4K9PA 2C29D 4MX8A 4E5SA 3DOFA 5FTWA 1I3LA 5IWCA 4IDNA 2FXVA 1LK7A 4NZMA 3HN2A 4X84A 1NQAO 3B6MA 4HADA 1K8RA 3GZTB 3PEVA 1GAWA 4CLOA 1H6BA 1VMEA 3UK7A 3ZKWA 1X7YA 2D13A 4DRZA 3OZTA 3WWOA 2IOQA 4KITB 1QK4A 1ICIA 3IIJA 4OUKX 3GRRA 4UAGA 5BN5B 5A05A 3GG9A 3JQ6A 3ZHVA 1Z4NA 3A6LA 2NVBA 4I50F 3D0OA 3U3OA 3GCDA 4JFAA 1UANA 3VJLA 1C7RA 1M6EX 3K2IA 3OT5A 3DAOA 1SPXA 5JXIA 1HFEL 1GFIA 1H1LA 2DBZA 4M0UA 3PDHA 1Z8NA 2IZ5A 2VRNA 1XZDA 4QU5A 4RXUA 4X9XA 5HA5A 1S3IA 4KXMA 4R2IA 2F4VB 1C8KA 2AW5A 3OE7A 1JI3A 4LMRA 3UV6A 1BROA 5AOBA 2CMKA 2IHKA 3FOZA 3LFUA 3BGIA 1H2EA 1XAHA 4JOCA 1L8QA 2XTNA 2Q41A 4CCSA 1NFRA 3DZDA 2JFNA 3B70A 4F56A 1NYLA 2WJGA 4W5HA 2VNJA 1SG0A 1TADA 1KL7A 3JVUA 1PGJA 2P0YA 4I6GA 1U6IA 1YR1A 3ZLVA 2HJWA 4BE4A 2TMKA 5ICEA 2YKGA 5DP2A 4OK6A 4RTLA 3SBOA 2VNAA 2Q28A 3BF7A 1FFSA 4C6TB 1VE3A 4CMAA 2O0MA 1M8JA 3N2KA 3W4KA 3HUEA 4S1PA 4M89A 4M1EA 1PW7A 4QPPA 3QQ5A 3UFXA 2RHWA 3RC1A 4Z8XA 3EVNA 5T3YA 2AD5A 1Z7GA 3M4JA 1OCEA 2BFNA 4PONA 3LY8A 4UVDA 3UA3A 3AVUA 4PPYA 2D4HA 1NRWA 2W6JD 1U4OA 3GA0A 3RT1A 5KNBD 1KRHA 1RJ9B 3UN1A 1S6YA 4X1IA 1ACJA 3BDIA 3GT4A 4BV3A 1R0YA 3N8NA 4B8ZA 2YJ3A 1D4OA 3B12A 4R2XA 2JJ2A 2X0NA 2E4AA 3MLEA 4C0LA 1WXEA 2J5RA 2O9JA 3ED1A 5CP8A 2J9RA 3IE2A 4PLZA 4R98A 4P5PA 1JFVA 1LC0A 5FOUA 4ESOA 4WN3A 4N48A 1HDIA 4O4HA 3FTFA 3CSSA 4I2NA 1XEXA 1Z5OA 3LI2A 3RO7A 3RS7A 3KM0A 3WL8A 4RTMA 4K46A 1AH2A 2AKYA 1WAMA 3B6EA 5HQTA 4KIFA 1UZNA 2I0FA 1ZKMA 3OPMA 2FHPA 3C7KA 2ZIZA 3N2GA 4PCUA 1W581 3FF1A 3RFVA 5LZ7A 1VPDA 1L5WA 2GCOB 3MW8A 1K3UB 5CVEA 4I5FA 4R2HA 3ZKAA 1AKNA 2ZGVA 1OQAA 3PF9A 1IIRA 1TUBA 1UWCA 2JAPA 3IRVA 3AHCA 2UZAA 1U90A 4HATA 3RAJA 3GLTA 4EKYA 1TXGA 3PXAA 2J3MA 2AEEA 1K7SN 3BE4A 2WHPB 3F5SA 4U0KA 3BWXA 3M33A 3O4VA 4D6PA 2EHDA 3MWLA 1NYRA 3TG8A 5A0TA 1FY2A 3PA8A 5A5EA 3IUSA 4DXDA 1NXQA 4QUAA 1W4ZA 1DE0A 2E0IA 3NHWA 4DMLA 3TR6A 4DZTA 3FPHA 1NW7A 2GCEA 1MC5A 2XBLA 1X74A 1KFJB 4N82A 3ZS8A 3BJZA 3ZUPA 1IXYA 3EF0A 3KT6A 4UUNA 1T24A 1YJAA 1R4MA 1Q0QA 2YYAA 1IVYA 4JUFA 2TSYB 4IQGA 2ZVJA 4MQ4A 4QBKA 4X0EA 4WNAA 2PL5A 5K8TA 2AFIB 2PX8A 1EFAA 4P5EA 4XD7D 3SXPA 1QRAA 5FLXA 2IC5A 3MWDB 1QHXA 2JKZA 2QRPA 4C7VA 5A9RA 3DMDA 3BXGA 3WC4A 3KZNA 1UT5A 4YCNA 5IUNC 3NGMA 4KSCA 4D9JA 1FXWF 3WLAA 4GSYA 5KAMA 3LPNA 1DLJA 2WJIA 7MDHA 2QBYA 3ELDA 2CMFA 2C2HA 2GZ3A 3R7FA 2VXYA 1AZSC 1QFYA 1GKLA 4LCJA 2YW9A 3H5NA 1B42A 4X97A 4UEKA 4MI9A 1KNQA 2V7EA 1EP2B 4RMHA 4C5BA 1PJ4A 4LJ5A 5CNJA 1OXMA 2OZLA 3HCEA 3CZ4A 1ZVVA 1A5TA 3NCHA 3FSGD 3BRSA 5BNFA 5HKKD 1EK1A 3GRFA 3RJTA 3RHSA 2PM8A 3WRVA 4XIJA 3O82A 4Y1RA 5HE9A 1MB9A 3FCOA 4F97A 1OTYA 3FFBA 1ZUHA 4F72A 2GNAA 2HIGA 3B1XA 1GNRA 3VSAA 5IDXA 4CQMB 2Z9BA 1VMIA 2ACWA 5MGBA 3TGLA 1O97D 2FNAA 1W9HA 4F21A 1V5FA 4C2UA 4O4HF 3FLAA 4N5IX 1N5LA 2YV2A 4FZJA 1DAGA 1GQ2A 3LKVA 1KKMA 3LT4A 3DZBA 1FOEB 3PZBA 4C4YA 3VX3A 4U8GA 5ALPA 2RIPA 4KE6A 4PLYA 1C8LA 2YZMA 2ZRIA 3QOWA 2F17A 1F6DA 4MHOA 3THXB 4BBZA 4FSDA 4J7AA 2QGFA 3VKFA 4XVCA 2PKQO 3BB3A 3R8FA 3ZK7A 4DJTA 3L7AA 2FEXA 2GNPA 4Q4JA 1G2OA 1G63A 3QIAA 3RK1A 3H6KA 2DSNA 2GEKA 3PL1A 4RCZA 1EG7A 3V3TA 3O4IA 4ABYA 4DVGA 9LDBA 3JQAD 1TQ4A 5BV8A 2IY8A 1PJRA 1Z47A 1IEWA 5JSQA 3DYVA 1PWEA 3QWIA 1YE3A 2YFKA 3K6KA 1NUQA 2X0KA 4F46A 1JAIA 3M6FA 2VP5A 4F4UA 3MJCA 4CE6A 2IYZA 3PNBA 4G09A 3ASVA 3GP8A 2Q5FA 2WB2A 3F8TA 4DV1B 1GUAA 1NW8A 2BFEA 2XUKA 3L1UA 1HTBA 2QRVB 1QRSA 2BRUA 2RCNA 4HEA6 4DJAA 4DCOA 1VYVA 1P29A 3IPYA 1FQWA 2Z1DA 1L7MA 4CF3A 3I45A 3O73A 2ZB7A 5COAA 3TW0A 3CNOA 2X3FA 1M1NA 5EHGA 1WKVA 3CLUD 3N8GA 3PDUA 1I4LD 5EVJA 1CY8A 4XX1A 1KY4A 2HLDA 2QTAA 2TMYA 1M8GA 3AC0A 2GWHA 4DUGA 2HFKA 1PDWA 4D43A 4DIOA 3U4CA 2WQZA 2ZAIA 3EEYA 1JUDA 1SC1A 1QGUA 2CBGA 4F9GA 1P1IA 2ZZKA 1KI6B 1Y8AA 1B00A 4O6VA 3DKIA 2BHLA 2OM6A 5LD2B 1LBEA 1ENYA 3E9CA 5IVIA 2ZVDA 4YREA 1MRZA 3TSAA 3VC2A 5KNCA 5DTQA 5CJJA 4ZZ3A 1SXPA 3U3MA 1NSYA 1FC0A 4FUQA 4B6EA 4U7WA 2OGUA 2HYDA 2AT1A 4NCHA 3AVXA 4CNQA 1QIGA 4BKRA 2HAEA 2YNMD 2EP8A 1ZBQA 4MYHA 2GETA 3NDIA 3OM8A 4R9UC 3MRVA 1AQLA 2PX0A 2YY6A 4KQEA 4ND8A 1WPGA 3WX0A 3N7TA 5BN4A 3M1IA 5JATA 3PJGA 4WGFA 4CL2A 4WLUA 4N0EA 2O50A 3M6LA 2OXIA 4KMRA 4URFA 2GERA 2HNBA 2Y1DA 1MB3A 1PVVA 2XE7A 1X2BA 4D9KA 2BL4A 3RREA 3UV3A 3LA6A 3VNRA 4BDSA 1W88B 4UCQA 4I8XA 1PFYA 5IBRA 3UIEA 2W2VA 3N6VA 3TNLA 4I1IA 4FQ5A 2HK8A 2XUGA 1E3QA 4IJ6A 4B9EA 5H9WA 2XRYA 4AJ2A 2BGJA 4RM2A 4KLAA 1ZCAA 4ZQEA 4QOSA 3WBJA 4LF7B 5EMJA 3CWZA 1J0CA 3IR5A 3HCOA 5AVJA 2O2HA 4EY8A 1IH8A 1R5JA 3P9QA 3CLVA 4HD8A 2W4IA 1ZHFA 2H18A 4KYUA 4R1QA 4UBLA 4MJXA 4N47A 2GBCA 1LJ8A 3T52A 4C01A 3QF7A 2C98A 3B52X 1DAPA 4NV1A 1N2CE 1TM4E 4AK9A 3OETA 3P0JA 3GDGA 4XGRA 1NXSA 4G89A 5J4HA 2GZ2A 5ALWA 3FZGA 4Q93A 3ORRA 3LMKA 5CX4A 3DJYA 3C4QA 3LGXA 1E2IA 1AO0A 2HJRA 1T9BA 3CVXA 2J31A 2QE6A 1QGUB 3R5XA 4ZHQF 5CJPA 3UMMA 4M86A 1VB3A 5EY5B 4NNJA 2XA9A 2ZTHA 1NUTA 2OCGA 3RS4A 2A30A 1ZRSA 2GHTA 4M53A 2G1AA 5FBWB 2QX4A 3DMHA 4AJPA 3PC2A 1ZUWA 2GEVA 4R8KA 3BFKA 5HS6A 5JY1A 2YQZA 3DEJA 3TBHA 3TVTA 4JC8A 1RJDA 2LBPA 3JTMA 3NRCA 2O54A 4RXTA 3BYZA 3L1IA 1KP3A 1HUQA 1JWBB 3RUCA 2OD9A 3KB6A 3SOZA 4LW8A 5LXTA 1GARA 4L73A 3M3PA 2PX2A 5I7UA 1AHIA 1IN7A 2A86A 2DBYA 2Y1OA 4XGIA 1J7KA 3BWCA 3KOUA 3OZIA 2HRQA 3CX6A 4MYRA 1K9SA 3TRHA 4EGFA 3DEAA 3ZE2B 1VGRA 1W48A 4ZI7A 4N6GA 2Q5EA 1SD1A 3ECSA 4K9QA 4J1QA 4LCEA 5KVQA 4ER3A 1LI5A 3V3KA 4NOJA 3PQ4A 2FSVA 1YVPA 2XNDD 2ID8A 4FZVA 3Q6MA 4QC2A 4YGXB 5EPUA 3X1XA 5KYTA 1ZHOA 4FFBB 1P5RA 4GZLA 4H08A 2OYRA 3KKOA 3OJCA 4GKAA 1KYXA 3RUIA 4WESA 4X44A 1GL9B 3SCZA 2OHVA 1PI3A 3QX7A 5CW1A 4BGIA 1ABEA 2O2GA 1VCIA 4YUVA 5KNCH 4IPTA 4NYIR 3Q9NA 2DQZA 1WX1A 1IJBA 2QU7A 5DPMA 1XAJA 3CRW1 3R3ZA 1NM5A 1THZA 4KUEA 2WKQA 1O6ZA 2GBFA 2BFFA 2QV7A 4ZEOA 4YPOA 2WYWA 3WNCA 3G2MA 2WYVA 1JHVA 1KK3A 2PS0A 3PR1A 4RQAA 5CTJA 3PSHA 2LIPA 4B2YA 1L9KA 1XLWA 1Z16A 4BX8A 2JLQA 3RS2A 2IODA 4ZOQI 5JAPA 4OUDA 4OXXA 1ZAKA 3EXHC 4WFKA 5DMXA 2JFOA 3R6DA 1MABB 3HJRA 3MBIA 2QN3A 2C4UA 4Q47A 3M3DA 4F60A 1EB9A 1RDFA 1L7XA 1KP2A 4ZZ2A 2OHGA 1F0YA 1ISJA 1PJTA 3PXCX 3UQYS 1VJ1A 1SKMA 3MAJA 4Y1RB 3PU6A 3WB1A 1PO7A 2NQ2C 4BQFA 4WCVA 3O95A 4NH4A 3LVQE 1TLTA 3P5BA 3RDPA 1XMJA 4PHGA 4CLRA 4M1TA 3GLUA 3WJ2A 3OKAA 2WTMA 3K1JA 2WUWE 4R8RA 2AL7A 1GXSA 3E2IA 4Y2HA 1G60A 2NXCA 3F5FA 2UXCB 1M6NA 1P1BA 1HYQA 3USES 1GPMA 1FP4B 4FFVA 2XCRB 2HRRA 2DPMA 4IX9A 4UUOA 1EGVB 2X9VA 3EMVA 4Q05A 3GPIA 2AUNA 4MWCA 2AEFA 2W2NA 4U5QA 4PU0A 4WCFB 3GMIA 4R1UA 4XSGA 3TZLA 5JT1A 5FPQA 2J0QA 1CZOA 2JC3A 2YJ5A 4GUAA 4J0FA 3SPXA 2D6FA 5ITWA 3RYFA 3QKSB 1CYDA 1XWFA 2XF2A 1HT3A 2E49A 4B48A 2VQ3A 4HVAA 4DLBA 1Z7YA 2C9BA 2MYTA 5EIHA 2XRMA 3UJ7A 4Y6PA 2BI4A 4X85A 3HDHA 5IDYA 3FI9A 5KJEA 3MTIA 4W1RA 1XRSB 3LHFA 2V6MA 2P40A 3W7BA 5SZJA 3QKSA 1YDHA 4GP7A 2HOQA 2IF2A 2B4YA 3DBRB 5KJ1A 1JJBA 1YV9A 5EYPB 4BZWA 4FYJA 3HNOA 1XHEA 4BGEA 3VYTB 3SEAA 4ERXA 1HRKA 1DCFA 2VDQB 1Z6XA 4G86A 2BUAA 4HAZA 4FIDA 1TO1E 3H7IA 4HWKA 4LDNA 1SUPA 4DL9A 1DIRA 2IDMA 3QE9Y 2CNKA 2C94A 5BWCA 1V1RA 3A1NA 3OFSA 3OY7A 4KXWA 1KJJA 3EBLA 1TT7A 5CA1B 4EW2A 4RA6B 1KI7A 3GHHA 1H2AS 3PNKA 5I5GA 5KB3A 2ZM5A 1ZMRA 2WJPA 3BFPA 3H5RA 5CAEA 5EUQB 4V3CA 2QU8A 1IXRC 4JXZA 5I9LA 1H9CA 1YJ8A 4UTPA 3AW8A 1QV7A 1WQ4A 4M46A 2YXBA 4ABTA 1JSXA 1GO2A 2CFIA 1W1IA 5AKZA 1J2EA 3T3DA 1JHAA 2AOTA 4QQKA 4X1IB 2AX4A 4UFOA 4NZZA 5FAXA 5U1PA 4CKBA 3C45A 3HABA 1KJ9A 3QWBA 3RLIA 2RB4A 4K88A 5B53A 1E7MA 3LOUA 4LWZA 3WFZA 3I4LA 1LZKA 4RZHA 4IH1A 4HEA1 4U7JA 3LF2A 2GFIA 3TLYA 1KAQA 3JRXA 3BHJA 1DBVO 3WGJA 4CV3A 4K1XA 2X0FA 2IHNA 4KXQA 1BEZA 4ZVMA 4BQPA 1U1CA 4P4TA 4X1KB 4GM4A 4DMMA 2ZWIA 1NXTA 4PVCA 5C4MA 4IDGA 5LYJA 2PFKA 1W85A 2IIQA 2CBZA 4XOUA 2AK2A 1RADA 3OIDA 5I7EA 5LWHA 4ZYUA 1XQWA 4I4TB 3SZRA 4H7FA 3EARA 5ICGA 4RFSA 1P2SA 4OH7A 1SCIA 2IZ1A 3W9SA 3GLFA 1BKSB 1TT5A 4GX0A 3A11A 1F8UA 2WI8A 5JCXA 1WE2A 1AKMA 3KUXA 3NT2A 3RFXA 2QRQA 1LCIA 1SURA 2YJZA 3NEJA 2P5TB 3DXYA 1UPAA 5H80A 1M1YE 1MOSA 1L1QA 4BVGA 3WP1B 1U0HC 2FSGA 4KAXA 2V4MA 1C50A 1CZKA 3CJTA 3KC2A 5K8LA 1WUIS 4JUIA 4KH0A 5FR2A 3F78A 2B1RA 3LQFA 1K4YA 5G0TA 4CFYA 4CV0A 1U7WA 4CVNA 1OYOA 2QY9A 3LQ4A 1DQPA 3CF4G 1KYIA 2H06A 2Y1LA 4JC5A 3ZDFA 3FFXA 1PQ4A 1ONBA 5LQCA 1NAHA 2W2LA 1QGZA 1VL1A 3AJEA 4RVHA 4B5KA 1Q12A 4MW1A 1ODFA 3UMVA 1WSAA 3OECA 3SE7A 4BUJA 4YI5A 1IBCA 1VLZA 2IZ7A 3O0DA 4XVUA 4CKYA 2WIJA 2Q21A 5J5AA 3D64A 1VG9B 3DMPA 1RYEA 3OUTA 3P4YA 3FRIA 3P0HA 1RBYA 1E8DA 1XMVA 2IZZA 3KKKA 1LZLA 1R88A 2IGTA 5ESRA 3GLHE 4R9VA 5IZCC 2IYLD 4CKBB 1HE4A 2I3ZA 2O1WA 4UVIA 2GN0A 2QUIA 5ALJA 3MWJA 4Z4FA 3L7KA 1LFDB 3DDSA 4QZVA 1RRCA 2CHVA 3V4LA 1LPAB 3A27A 4XYBA 4ZCMA 3PNVA 2DZDA 1V6AA 3L7BA 3N8DA 4MJ7A 4ZDJA 4MQBA 1Y3FE 1OI3A 3IEPA 3OESA 3H3FA 4GVPA 3OP1A 4LPKA 4LXUA 4YRRA 5CB4B 1HTTA 3DLHA 1U9IA 3A25A 1NXOA 5JCOC 3A04A 1KZ7B 3UV7A 5FQOA 2BGWA 3GXBA 3IBCA 3X1DA 4RZSA 2O1EA 4TXNA 1Q1NA 2C78A 2NLOA 5FT9A 4CMEA 3ZBTA 1IBRA 3R0IA 3KOOA 4J0JA 4JLKA 2PBFA 2POCA 5HDQA 1RXEA 4EFNA 3OA2A 2COKA 1P6QA 1MA3A 5DGHA 5CDUA 3PRYA 4HB3A 4JSYA 4H59A 1DQYA 1DIGA 3CMMA 1XSEA 1YK1A 1T2VA 3BHIA 1MU0A 5IZCA 3A6GA 1Z4LA 3INRA 3ZHQA 2RARA 2B94A 1BWRA 2IYWA 2YHUA 1U8ZA 3H04A 1MQAA 3KD3A 1ULAA 4FD3A 4IGKA 3OLZA 4ND2A 5FXMA 2LWIA 5COQA 2JGRA 4E7OA 4MXDA 4JA2A 1IBMB 2ACVA 5F7ZA 5BQPA 2GYVA 2YZ2A 1OU0A 3CO5A 4BNGA 1K06A 4MR9B 1AKWA 1E3JA 5K20A 3AHHA 3VVLA 2H48A 4GIBA 2W98A 3PKIA 2CCKA 4IV5A 1MZPA 2FUNB 3A3PA 5G41A 2O2JA 4JL8A 4WWHA 1Z13A 4MLPA 5JMPA 5ICCA 3T12A 2EKLA 1O95A 3H87A 1AV6A 3VR3A 4H0NA 4KWEA 5CCXA 3MJTA 3U4DA 3H65A 2GYUA 4PPGA 1C3JA 5C31A 2H6EA 2PZGA 4LGYA 3OQ6A 4WK6A 1YL7A 3FYCA 4PXSA 4YJFB 2HC9A 2CW5A 2VBFA 3U0VA 3BZUA 4Z7QB 4XX0B 5EGNA 3TAXA 4MW0A 5CFPA 2HBQA 3A1UA 1N7HA 1QNLA 1FP4A 2CJYA 4DLTA 2UZ3A 2GTIA 4GECA 3OT4A 4JA0A 4AO8A 1Y8RB 1J2RA 5E3JA 1GNSA 4PG7A 4LNAA 1XEXB 4IOMA 4MVJF 4RXMA 3L40A 5JWHA 4BPRA 5E9AA 1M2VB 2BKXA 3KWJA 3QVSA 3TXYA 3W5CA 2VTEA 3ZHTA 3TZ6A 5BW4A 2ZJBA 1TW2A 3NASA 2O5EA 3KKMA 2VUHB 4Z0TA 4OLHA 3OUUA 2VHWA 1GPLA 1WIWA 3HN6A 2YXLA 1Q1GA 4E0BA 3D6TB 3NJ8A 4BO6A 2JAWA 3HL4A 2B82A 3TQQA 2C2OA 3BJIC 3U1VA 1DKQA 4JENA 1GPDG 2ZWOA 5BXQC 1GPH1 2Z43A 1PU2A 4M88A 1OI2A 3IP5A 4YV1A 4BLRA 5AJVB 1C14A 5I6DA 1U6KA 4PSUA 1NIJA 5MFPA 1A9QA 2HMTA 1ZI6A 1T4MA 4LGMA 4WX2B 4BMDA 2NU6B 1G4AE 3PNYA 4MCAA 1LW6E 5EJ8A 3OMXA 1N2BA 2AR7A 1I1HA 4YP7A 1T0JB 1NQOA 1Y9ZA 3OOYA 1DUVG 1DWQA 3F6BX 1QB8A 1LV7A 1RRVA 3RUAA 3NVMB 3D4IA 1OC4A 1LBTA 3CH4B 2EF1A 2LTAA 3HBNA 4PYKA 5EG5A 4A27A 4A0HA 4L4YA 1PV1A 3R41A 1ULHA 3D6UA 1NASA 4H15A 3V6MA 4E5MA 2C7GA 3BCRA 4P4SA 4Z4QA 4NCKA 3EF1A 1ZM2A 1N36B 4LGVA 1VDMA 4BKQA 3ET4A 1B8UA 1R0WA 1WDKA 3KWMA 4CUKA 4TS9A 1FCJA 2I6FA 4YMWA 4IHJB 2VH5R 1FDSA 1CFZA 4I55A 3INTA 4N40A 3L79A 1JWAB 3GCWA 1ISRA 1MC8A 3NX4A 4IIYA 4JS0A 1LKZA 1NUUA 4JKIA 4B3SB 4L7VA 5C0OE 4C4TA 1JSRA 4ITRC 3FUXA 2NO0A 1W8DA 1EZ4A 2XT9A 3RSOA 5C46F 3G8AA 4AF7A 2KMLA 3WE7A 5IM4A 1EQ2A 4ZKEA 3WADA 1NRXA 3OTHA 2VDKB 1AUXA 4LBWA 5BN3B 1PGNA 1MRSA 1FUYB 4X6YA 2O4UX 3FKQA 1C3OB 3KEGA 3AF6A 1NI5A 2Q8PA 3BQNB 3G9UA 3WGVA 1SKYB 2HCJB 2DUUA 4YQEA 1WEHA 3EIOA 4LUCA 1YH3A 1YIAA 1DDGA 2C1EA 1P17A 2WVAA 1BXRA 1JW9B 3O8LA 4BIMA 1ZYUA 3DEFA 1G8SA 2BH9A 2GUGA 3L7JA 4EVRA 2Q7DA 5KOYA 1FSFA 2PUEA 4E4RA 4BB5A 3BD9A 3RBXA 1BX3A 3TCKA 3NHYA 2FMTA 5J1TB 3KLNA 1P2UA 1TKCA 2V98A 3R44A 3VVCA 3QVVA 3QV1A 5TC4A 5KWIA 3TW8A 4YMGA 1QKJA 1FEZA 2W2KB 2Q5LA 2GASA 1EX1A 2RJOA 1B3RA 1OXXK 2FW0A 3H2YA 3GLHB 2J46A 4WBXC 4J0QA 4A9AA 5HKAA 3LUHA 1YASA 5M04A 2X2OA 4YRNA 3H16A 3WIEA 1VJCA 4IFTA 2Z83A 2GLTA 3V9AA 4KPUB 2YJ6A 5KTPA 1E1CB 2X2EA 3FJ1A 1Y63A 3QI2A 3KVOA 1FDIA 2XOXA 3HACA 2NOAA 2ZIGA 2OKCA 3AERA 1ISIA 3M6WA 1C1XB 4L50A 2OAP1 3ZHZA 2NP6A 4YAKA 1QCDA 1RYNA 2ZJ4A 3BX1A 5G1OA 4HNAB 5CYGA 3PYMA 3HEBA 3QKWA 3KXKA 3AEYA 1XWWA 3FNQA 4LV5B 5A1TA 1HLFA 1B26A 1BHO1 4MW9A 1X87A 2X86A 1Q7EA 2F3SA 4ZU3A 3FLMA 1CJBA 3OPYB 4DQKA 5BPFA 2OL4A 4KFTA 4JI3B 1N1MA 4RY2A 4B7XA 3KE9A 4WZBE 2NUTA 3PSAA 3Q0TA 3DW1X 1UAAA 2FZVA 2P1ZA 1T9CA 4CM9A 4M36A 2QHXA 4A7PA 2OQIA 3DXXA 4KGXA 3B9QA 3IQGX 3D2CA 1P4HA 1QWOA 3PCTA 3R0XA 5EE0A 1FP6A 4C7OA 2Q2VA 5IAJA 1WCYA 3KSAC 1KAHA 1VGQA 4CM1A 3D1VA 1Q19A 3A28A 4XYMA 4LXQA 1E4EB 2CLSA 2FLVA 3MMPA 1Z0IA 3S2UA 2X8LA 3N7UA 3KQVA 2FEAA 2ZBFA 1DPFA 1KI3A 2GXSA 4DIBA 1BNCA 2WNHA 1J97A 5CVCA 1XUOA 3MJHA 4GMGA 2A5FA 5CT9A 2WHRA 4UAVA 4NKRA 1R3DA 4BZXA 1USIA 1KDYA 2YMPA 3DEYX 4HI0E 2QUAA 3VTAA 5A6VA 5JQWA 5K4HA 2QROA 3H42B 3HCRA 1XN4A 3RUFA 3VYWA 2HFJA 5TVKA 1KAOA 4UXIA 1II0A 5H5JA 2XOKD 3DEIA 2MCFA 5GM2A 3Q7RA 3SFZA 3HP4A 2X0RA 4DC1A 1NKSA 3F49S 1I5EA 3CRQA 4REQA 3T4UA 4ZKDA 4Q6WA 3NTQA 1X9HA 1TMOA 3CTPA 1XOIA 3BREA 1T9AA 2RHRA 1XF9A 3E3OA 4N9QA 5EZYA 3IURA 3WMXA 3N8KA 3GI1A 2E6KA 4MB2A 4UZSA 4YMIA 5CLIA 1I2BA 3D4NA 3W8RA 2PH3A 1WB4A 1E79D 2VDMB 1ZNXA 3CFYA 3KDSE 4BGUA 3F71A 2GBIA 1KEVA 1ULSA 5G1NA 2A0KA 4EMUA 1U8TA 3C3PA 3HUUA 5LUBA 4F5WA 4S0ZA 5F78A 2GAFA 3KB8A 4IWYA 2ZROA 2YV3A 3JYLA 1ENZA 1QOPB 1YA4A 3N0VA 3SS9X 1C0EA 5GONB 1YFZA 3HYNA 1I3NA 5CX1A 5JYCA 1GQOA 1NJFA 2LPMA 4QEZA 1H9BA 1NAIA 2FR8C 3ZLTA 2P2DA 3DC2A 1RKUA 2B9VA 2CKDA 3JZFA 1MTZA 3WIUA 3K32A 3LSTA 1ZX1A 3F2VA 3ZIDA 1VPWA 4YT5A 2BSAA 1GLVA 1W52X 4G8CA 5I9BA 3WB0A 2QV0A 4W5RA 2VF4X 1ONPA 4XR4A 4ZT4A 5EOVA 3UO8B 2H17A 2H9AA 4PANA 2PGDA 1U5BA 3E3LA 3RVSA 4DQLA 4ZI2A 2DBRA 1WBDA 4HNVA 1LNZA 4C7JA 5HWSA 4HRXA 3CF6R 3GUYA 5A7HA 3MCUA 3D5TA 1HNXB 4EITA 1CUCA 3RC2A 3RASA 4RMGA 5C1BA 3ZHRA 1WV1A 1M9NA 5AUQA 2BM0A 1T2FA 4B4WA 3K1TA 1DJPA 5HG0A 3PI6A 5FL7D 1NU6A 5JPCA 1OAOC 4PNEA 6CHYA 1GA1A 3UHJA 2A9OA 5DK4A 2C2KA 3V55A 2C00A 1WKCA 3EW7A 3GLFB 3AJ9A 3TVDA 2G28A 4J16C 3VH3A 4TLLB 5M34A 5G0SA 4MRMB 4RPJA 1NSFA 5JARA 3QNUA 4Y9UA 4FFPA 2Q45A 3CKKA 4YP5A 1OYYA 1Q44A 1ULUA 3GNLA 3IQXA 2OFPA 1KQGA 1RYYA 3F5MA 1S8NA 4E51A 2MSKA 2H85A 4YRBA 1MOQA 1ZD3A 4QTTB 4QNMA 1VZ2A 1XNGA 3QJYA 4FBGA 4XVHA 4DMHA 3P4UA 2IU3A 3A2KA 4CIAA 5AI5A 1XTTA 3QPWA 1MHTA 2EBWA 4P3KA 1EEHA 1U02A 2G7ZA 1SY7A 4TSFD 3TD2A 4XWOA 4N3NA 5CNMA 2I6XA 1ZLXA 3BWVA 5DX1A 1AT1A 1YZUA 3GPBA 2K5UA 3Q3HA 3EB9A 2YWJA 3SQLA 4U7TB 1A9RA 1DTSA 4OHKA 2YYYA 4FS8A 4HN4B 2Q1SA 1OYWA 5EJ4A 3F90A 4ZQHA 4P4LA 4KB5A 3U3ZA 5EJ6A 5CD1A 2RE8A 1DDOA 1G8FA 4L6CA 4D92A 3H2KA 1QYIA 3SI7A 4EO7A 4LI3X 5TT0A 1LI7A 1V6CA 1E64A 3AETA 5C5CA 1I0IA 4LNUA 3U16A 3PXBA 5SY4A 3UAOA 4UNPA 1B14A 4L5AA 3IKMB 3OF3A 4C7BA 1OFUX 9GPBA 5FTMA 3X3HA 1XQ6A 2FG6C 2JCBA 3UTDA 3I37X 2DBQA 3BIFA 4YECA 2I4TA 4CM8A 3WYCA 2CL0X 5DOZA 4F3NA 3P0EA 1U1IA 5CDFE 4OX9Y 3AUTA 4UHFA 3BT7A 2CE2X 1GSIA 4GX2A 4EDHA 3ZS9A 3WB2A 4B7CA 3ZZUA 1Y3IA 3VDRA 1CY7A 4OV6B 5AXCA 2Z6QA 5FWYA 3U4QB 1Z0DA 2HEGA 2W2MA 1R0LA 2DTDA 2WHXA 2E4ZA 2W42A 3DA8A 5GAJA 2OWEA 4FPXA 3KCQA 2J4DA 3O4FA 4DG5A 1IOWA 4MNTA 3I04A 2PKEA 4KQ2A 2Q3MA 1E3WB 1RFLA 3IQHX 4MPRA 1GWNA 3NETA 1N6RA 5L3QA 2ZZNA 3A10A 2NTVA 3MJDA 3KG2A 1N0IA 3SKVA 2R79A 3R76A 4D5EA 5JYEA 3LBAA 1G9SA 1C2TA 4C4AA 5EIEA 4BLTA 2EWMA 2D2XA 1ZZGA 2Z2JA 2EU8A 4P86A 1B8VA 5AI6A 1VCMA 5D2CA 3UJPA 4BLPA 1MXFA 1GADO 7AT1A 5FBVB 2O8BB 4OYLA 1U4NA 3AKCA 5L3ZA 3VQTA 4EHNA 3RLFA 4QOHA 1K5DA 2X8JA 4NXMB 1G7TA 4JB8A 5KDOA 3P94A 2PVSA 4CLHA 1XQ9A 4XGKA 1FNNA 2Z2ZA 2A1IA 3Q0IA 1M73E 1YA8A 4UZFA 5AOAA 1XCMA 5KZMB 1U2DA 3QLVA 1FJXA 1PUJA 3KZMA 5AK5A 4Y9RA 3IUMA 1NBEA 3DFIA 4P7FA 5JQGA 3KBBA 4I3GA 4M1ZA 3CLKA 3G2NA 2IP4A 1N1GA 5KNDA 3W2GA 3GUCA 1Q7RA 8ATCA 4NBWA 4FWBA 1UDAA 2X4LA 1RAGA 5F5NA 1LTQA 2A3NA 2WNIA 1F5NA 4HUJA 2OHXA 2VR1A 5DNAA 3U48A 1WXHA 2LGJA 4D6YA 3QX8A 3OC6A 5E7QA 3AR8A 1YZTA 2BM9A 3W78A 5CH8A 5EIOA 1A77A 4H7PA 5H83A 1EXWA 4BGVA 1G0OA 1N1EA 1F48A 3LYHA 3OIYA 2QE7A 4WZ6A 3OKFA 3EGXA 4PG4A 3OQJA 4YP6A 1VBFA 3RSQA 1R66A 3GFOA 4MQEB 2PUFA 3HZZA 1MX3A 2CFCA 2M6KA 3S2FA 1KMIY 1LVGA 2V7TA 3DDZX 5JS8A 1EYZA 4BVLA 5J4YA 3TNYA 4G5SA 3TQFA 4KMMA 3HO8A 4WL0A 4B45A 3P9SA 3G17A 4KN5A 4LRWA 4MJLA 4UAJA 3K16A 3RGGA 4H16A 1RAEA 1OD6A 5K45A 3TFQA 2DXIA 1XJ5A 4IYJA 2D8AA 1JJFA 2VSXA 1OAOA 2VUIB 3GD5A 2AD1A 3WTCA 1JYEA 1XTIA 3L0BA 1TIKA 5JSUA 1CNEA 2C4TA 2R7KA 1E3WA 2QN6A 3NPMA 4M0PA 1GQYA 4DZRA 3FWZA 3L8DA 5ELLA 1A1SA 1XKLA 4LXIA 1X7HA 4DDMA 5IF3A 4AG3A 5LB4A 2ORWA 1E18A 3DEHA 4EJSA 4FYYA 4RD6A 2XCQA 2ZQZA 1R6UA 1OH5A 3U13A 1EX7A 2XMGA 2WZBA 3CX7A 1GNLA 1SBQA 4PSDA 1QZXA 3PNMA 5E3IA 4J29A 5CB6A 4AJIA 1Y48E 2K4MA 2GMWA 2RGDA 5E3HA 4D8VA 4JR2A 1N2HA 1X6VA 2VATA 4PIMA 1FVFA 4LC0A 2PUGA 1BKDR 5JXWA 2Y77A 3PFNA 2GJKA 4NU8X 4D25A 1IZ9A 2MJLA 1BJKA 4UM7A 1XGKA 1ZBDA 2PKQP 3OCZA 5CVJA 1R74A 1E1NA 1ZK1A 2OCYC 1ZL2A 4FX2A 3ZXIA 3JXEA 3TOZA 3OTOB 5I4KA 5DLQC 1TCBA 2XCLA 2CYBA 4K86A 1CP2A 1UPUA 2A0WA 4L3WA 4DY4A 3FOWA 3EEBA 3H1PA 3RNOA 3DMYA 3G89A 1LWNA 3HCAA 4G0VA 3QXXA 5KQMA 1EE2A 3D6HA 3OZ7A 2ZUSA 3BSSA 3X1YA 4EW3A 1H2WA 2RB5A 3WL5A 3T5GA 5HE8A 3ES9A 1CC1S 4FGWA 2O2EA 3V6LA 3FVVA 4H6WA 1CUJA 2OYSA 5IAEA 3AY6A 3DDNA 4M37A 3PGXA 3Q41A 2HPHA 4DARA 3UOGA 2WR8A 1WU8A 4M9QA 5I9IA 5IH7A 1QQTA 3Q3VA 4YJGA 3PGKA 2I7CA 2JIBA 3JQEA 1I4WA 2OLEA 2AGVA 1YR9A 4JBYA 2ZI7A 2G4VA 3LA8A 3MGCA 2J59A 4HDNA 3HZOA 1X7WA 2WF7A 4FHEA 4F5YA 5F3WB 1JEQA 1WMBA 2WWYA 2PJUA 1RI5A 2QE7D 4FHGA 5BSKA 5BP7A 5SZIA 4AY6A 1SWVA 1HM5A 4OF4A 5EKDA 2H54A 4W7SA 1NSTA 1NOIA 3F73A 2WSSA 1AS2A 3EAQA 4EGCB 4KO3S 3P20A 5K05A 3LPAA 4WVFA 3KSBC 4L27A 3WICA 3ACCA 4O2AF 4ISBA 1YZ3A 2I55A 2QR3A 1KEUA 2YUIA 16PKA 3EIHA 3G23A 3CNQS 1UBJS 3QKRA 5KNDD 3Q3IA 4DRYA 2I2AA 1HDOA 3EN0A 1XVLA 1O97C 2VJAA 4BX0A 2IX3A 1OYVA 2FPSA 4LHYA 1JQ5A 2JI8A 5K0BA 4D0NA 4EI8A 5IFKA 3E9ZA 2GA8A 4BP8A 2ZIEA 4ZYXA 2OO5A 3QKRB 4LQLA 3ZUGA 1UKVY 1QC5B 1K1EA 4FYKA 2PSDA 1OLSB 1PX0A 2GI4A 4YALA 2IELA 2ZK7A 2OAQ1 1CRPA 5EGSA 2PIAA 121PA 1SVNA 3RUDA 2PSJA 4GOKA 1XZFA 2LP4Y 4FJ0A 3MTAA 4CQJA 5DX0A 3ZQJA 1ZO8A 3QI7A 3BL5A 2E5LB 4DR7B 3GJ7A 1IONA 1TA4A 3L5KA 2RJNA 2D7JA 2HWWA 4HRYA 4NF2A 4YAOA 2W7TA 1Q3HA 2X5OA 2J32A 1QM5A 3BAFA 5DTMA 4LKRA 2B8WA 4U7DA 4LFBB 5ELMA 5T67A 2UAGA 1AHNA 1GIAA 1Y1LA 4EAQA 3EGXB 2QSJA 3SX4A 5LD2C 2DFDA 2XQVA 4M8KA 2G06A 4TWRA 1C2YA 1GQFA 5C5IA 5C9ZA 1GDTA 3D3WB 3QITA 3JSAA 4QDJA 2FG7C 4IOLA 2VDRB 4G5OA 4HV4A 3H5AA 1AQYA 3EVDA 3A1FA 1EXDA 1TQHA 4U00A 3KZOA 2GESA 3IAXA 2IXEA 1PZGA 4EUEA 3K05A 2O3SA 3RHZA 1M6VA 2J3IA 2A5YB 4XPZA 2YV4A 3FM9A 2PV7A 4BQOA 3G7SA 3EBOA 3W8EA 2XF8A 1FP1D 3NIFB 1L5RA 1GTMA 3DB2A 4G3XA 1N5MA 4CNBA 1N5OX 3CN9A 4HH4A 4CODB 4LX0A 4WRRA 3ZW9A 1JNXX 1WMEA 2ZRCA 2XXJA 5F3DA 1JAYA 3HTXA 3G82C 1YQXA 3L4EA 4KHZA 3UJBA 3V4FA 5L7WA 4ZFNA 2JNWA 4FJ1A 2PKWA 2SHKA 1OH6A 3I6BA 2FVYA 1UIMA 2C9DA 3K5HA 1PDOA 4EJSC 1VLLA 2BFOA 4D9MA 3WDLA 2P4UA 5BV2P 2YN4A 4QXMA 3LXUX 1REQA 2UZ1B 1JE1A 1E2PA 2Q27A 3I73A 3VNBA 1QO0A 4RBNA 2CJWA 1QK5A 1ADJA 4TYNA 1FFYA 3B9RA 1WP4A 2FUG1 2Z09A 3U31A 4TTAA 4C30A 3RAPR 1WXWA 5JS7A 1NR7A 4LF5B 2DVMA 5EJIA 1OFGA 1OWNA 1S8FA 1JMVA 3I9FA 2C82A 3FCUB 2JZCA 4FZRA 3U19A 1H6AA 2BM8A 2PL9A 3ERCA 2WYIA 1PHPA 4O4JA 1V35A 3G0DA 3T9BA 1JB1A 2FUKA 2D00A 1MB0A 2VF8A 3TGPA 1IBKB 4PNPA 1MLDA 1PZMA 2IV3A 4RNDB 1G291 4LHEA 1RCFA 4IL5A