1QVZA

Crystal structure of the s. cerevisiae ydr533c protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
236
structure length
235
Chain Sequence
APKKVLLALTSYNDVFYSDGMKTGVFVVEALHPFNTFRKEGFEVDFVSETGKFGWDEHSLAKDFLNGQDETDFKNKDSDFNKTLAKIKTPKEVNADDYQIFMASAGHGTLFDYPKAKDLQDIASEIYANGGVVAAVHGPAMFDGLTDKKTGRPLIEGKSITGFTDVGETIMGVDSILKAKNLATVEDVAKKYGAKYLAPVGPWDDYSITDGRLVTGVNPASAHSTAVRSIDALKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YDR533c protein
publication title Crystal structure of the YDR533c S. cerevisiae protein, a class II member of the Hsp31 family
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
total genus 81
structure length 235
sequence length 236
chains with identical sequence B
ec nomenclature ec 4.2.1.130: D-lactate dehydratase.
pdb deposition date 2003-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qvzA00
3B36A 3EFEA 4UCFA 3UOWA 3ZJ5A 5IP5A 1IPHA 3L3BA 4ZGGA 1CE8B 4Y1EA 4Y0NA 1IZYA 1VCNA 2AB0A 3VU3A 4B40A 3L7NA 1QDLB 2R1TA 1JDBC 2VXOA 4AJ9A 4LRUA 4UZSA 1KWGA 1P7ZA 4AUMA 1PDWA 3MIIA 1Q2UA 5SY6A 3OT1B 2ZUWA 1GGKA 2LXNA 4HCJA 1GGFA 1GGHA 3KKLA 4ENPA 4ENVA 3P9SA 1N57A 3PQ6A 5SY9A 3FSEA 1KA9H 4L8WB 3TTSA 3F71A 3TTVA 1GGJA 3PQ3A 4B5KA 5LIRA 1C3OB 4WINA 3PQ5A 1T0BA 2RK6A 3TTXA 4L95C 4BIMA 3PQ2A 1C30B 4QYXA 1KXJA 3ER6A 4GE3A 1VHQA 4AULA 2R1UA 4GE0A 4ENTA 1QVZA 3P9PA 1FY2A 3UK7A 3NVAA 1QWSA 1A9XB 2VRNA 2ABWA 5K4AA 1CF9A 2YWBA 3D54D 3CYFA 4OFWA 3NORA 4ZDJA 1OX6A 4E08A 5DFAA 4OIFA 2A9VA 2R1TB 4JQSA 4N12A 5JZOA 2NV0A 3EN0A 4RKYA 3B3AA 4BFLA 4LGYA 4XLLA 3R74A 1PDVA 3ZR4B 4L78A 4AUEA 1S1MA 2RK4A 4ZDIA 1I1QB 2YWDA 1P7YA 4I4NA 4ENSA 4WXYB 4L8FA 1OX4A 3EWNA 1QF7A 1M6VB 3BWEA 3TTTA 3TTYA 3FIJA 4P2GA 1GPMA 2VDJA 1U9CA 1Q7RA 3PQ4A 4P36A 4B7AA 1T36B 1GG9A 4OJYA 1O1YA 1KEEB 2VKTA 3F5DA 4R7GA 4B31A 1OY1A 3PQ8A 1SOAA 4ENRA 4S0ZA 3L18A 4I2NA 1P5FA 2ZUSA 2XF2A 3R75A 4P5PA 3SF8A 3EZGA 2NV2B 2ZUVA 3NOOA 4OGGA 1PV2A 3SF8B 4ADSG 3UJNA 3MGKA 2V4UA 3CY6A 4I46A 4UOQA 3CZ9A 5SYAA 4AUNA 1BXRB 1R9GA 3BHNA 3R76A 2ZUTA 3GRAA 2ZUUA 1QVVA 3RHTA 1IZZA 1J42A 1ONSA 4OGFA 1CS0B 1VCOA 5SY4A 3N7TA 1K9VF 2VPIA 1FYEA 4N0MA 3SOZA 3P9QA 3TTWA 1JVNA 3WFZA 1GPWB 4P34A 1T3TA 4D1YA 1OI4A 2GHRA 1SY7A 2GK3A 4K2HA 4MTCA 3ZJ4A 1OX4B 1VCMA 2OR3A 2R1VA 4MGHA 1L9XA 3NOVA 2ISSD 2W7TA 2R1VB 1GGEA 3B38A 1WL8A 2D7JA 2WJZB 4B2YA 4ZDKA 5E9AA 2YWJA 4UNIA 3PQ7A 2H2WA 4Y1GA 3OT1A 2YWCA 3P9RA 5BV2P 1I7QB 1I7SB 3UGJA 3CZAA 4L7QA 4P35A 2AD5A 3TTUA 4PXYA 2IUFA 1OX5A 3UMMA 1P80A 1P81A 1PE0A 4Y1RA 3M3PA 3NOQA 4ENUA 4Y1FA 3EJ6A 5JZMA 4GUDA 4Y1RB 2FEXA 4MNTA 1G2IA 4UOZA 2RK3A 4BTEA 4ENWA 3NONA 4RKWA 4OQ4A 3TQIA 1KWKA 1UCFA 4L8YA 1QVWA 3L4EA 3CNEA 4QYTA 4E5VA 4ENQA
chains in the Genus database with same CATH superfamily
2QAIA 1EA7A 5TQ2B 2DLCX 4GXQA 5AK0A 1QO0A 1Y3BE 1KOJA 3I34X 4NBRA 2QX8A 3CLRC 2O5CA 1XAGA 1HR0B 3PGVA 1SURA 4KZPA 4LPSA 2EBFX 5LOVA 1I3OA 3TE7A 2FPPA 5IZCC 4QDJA 3U2QA 1LC3A 2VZLA 5EIOA 5L40A 1RJFA 2OWEA 2OLKA 1AGRA 1O77A 4PPGA 1JYEA 4MS1B 2GXQA 1FDTA 4EKNB 2XD9A 5LLDA 4JI0B 2J3EA 5JSZB 4F7DA 3PUIA 2WHYA 3BTUA 3JQ8A 3KTDA 5DNAA 1ST3A 3V80A 5LDHA 1USIA 4ODIA 5EP3A 1A0OA 4UE2A 4URYR 4BNFA 3Q0IA 4FLEA 2VBFA 5CXXA 4YAIA 2AN9A 3IERA 4IV8A 1US8A 3T4PA 2EG9A 5ALFA 5KSOA 1ZMTA 1DSSG 4H6WA 4F3YA 4KWHA 1FXUA 3H04A 5FV4A 3MINB 1BVYF 3O8QA 4JEHA 5BQOA 5LM3A 4US1R 5EIAA 2H48A 4MJ7A 2JLCA 4EQ6A 1JDSA 4QBGB 3RG8A 5CIWA 5CBPA 1OSNA 3MGAA 4CN9A 3R40A 3M6AA 4HYEA 4DDTA 4WK0B 3DQPA 3DSRA 4M89A 4NJEB 4CU2A 1U0BB 3W7AA 3C3YA 4ER7A 2I54A 1UF9A 3MT7A 2I9KA 1WF3A 2OLJA 1D0IA 4U4AA 1C1XB 1QGYA 2EP5A 5IYZF 4GD3Q 3TOSA 4ECAA 1NN5A 4O63O 1ZD8A 4TOIA 5AWFC 3O2NA 4ZQIA 5J5AA 4ZRMA 5TDHA 4GVPA 2HWWA 4OB6A 3HSYA 1CUEA 2OB2A 3JVIA 1SBHA 2JD0A 4H7DA 4MKXA 5KYKA 2PUEA 5L7TA 2OGZA 2Q2VA 3R75A 3VHRA 1A50B 3RHSA 1J5EB 1NJGA 1PWZA 5C4MA 1AMOA 4XX0A 4F9TA 4OGGA 4CYMA 4CV0A 2C3YA 3NZEA 3ZS9A 5KTRA 4CIYA 1DXHA 1ZY2A 1W4BA 3I1IA 3K9LA 3R3UA 3CM0A 1LQUA 1TL7C 4AWXA 1D2AA 1N3IA 3QV2A 4KAXA 3U26A 1OH8A 1JFLA 1EQAA 2OB1A 2WAXA 2GF2A 2G07A 1ZCAA 3N7TA 2GFQA 3RUPA 4Y18A 1U7PA 2DQYA 4ARCA 2EW8A 4R84A 3ZXXA 3ZY4A 2ZTHA 1BFKA 2FZVA 2F3QA 4EPRA 1JAXA 2VDUE 5BW4A 5JVDA 1E2JA 1E9BA 3H5OA 5IZCA 3DLAA 2BFFA 2JFOA 4MEAA 2ZIUB 3VC2A 1Z6PA 2AD1A 3I2IA 4HNQA 2DBVO 1NI4A 3ENKA 3INTA 4ZCPA 5JC1A 4ZCSA 4AJ4A 4Q4JA 1XZDA 3IOYA 4Q37A 2ZG6A 3VBEA 2B9VA 3OHMA 1PG5A 1GA1A 1TLLA 1UKVY 2Q5QA 1RQLA 3LKDA 1F6DA 3TPCA 3N07A 5DRTA 3ZHCA 1ZXLA 1P5RA 2WD7B 1DKLA 4EYEA 2CNOA 2V7PA 3KDAA 3UT5A 3M1LA 3HZZA 1BHO1 1JHRA 4WXRA 3T54A 3QY0A 4FLFA 3IE2A 3K16A 5BT8A 4OFZA 1ZK0A 1WV0A 3EVGA 2C59A 3RC2A 1JFFB 1N5MA 2F43B 3PPWA 2A33A 3R0XA 2C4HA 3E22A 3AEQA 4LMPA 4LXHA 4R41A 4MR7A 5CA0A 2XYRA 1Q19A 4DILA 4ZVVA 3NI2A 3BSFA 1V8BA 4MX8A 3E05A 3RJ9A 4PLFA 1HG0A 1SFRA 4B6GA 1Z06A 4K03A 1PKXA 3QPWA 1IOWA 1B8PA 1TM2A 2YUTA 4ZT2A 5DOZA 1Q2UA 1Z4JA 2R6GA 2O2DA 4OJMX 3GUCA 5TS3A 5EMMA 1NIJA 3B1YA 3PDCA 3PQ6A 4RDXA 4BBJA 2YBDA 4IV0A 3OC6A 3VTKA 4I9FA 1HMPA 2UUPA 3GEBA 4BIMA 1QZZA 3TG8A 1K8QA 3LECA 1DKNA 4P3NA 4HVCA 2ZJYA 1I4LD 4X60A 3WSVA 4LJ9A 3AEKB 1V3UA 2FPIB 2X58A 1N8NA 1PFYA 2BJHA 1UOEA 1X8XA 3GHYA 3O9MA 4BASA 1U0LA 3OZWA 3NWPA 2HZ7A 3FR7A 4K6GA 1H1LA 4RLQA 1EP2B 5CH5A 3L7IA 3BXPA 2R9VA 5JNRA 3OPYI 1OX6A 3G1UA 3K6RA 1QZTA 1SK9A 5DDIP 4OHRA 2WHQA 3BIWA 5J3JA 3IUEA 3JWHA 5CDTA 1ENYA 4TQUS 4KH0A 5L3QA 3R9KA 3K6SB 3LP8A 3MCZA 1JHVA 2QG4A 2XGSA 4KXLA 3SEAA 3N6VA 2QQFA 4DA6A 4KSBA 1QCYA 3TOXA 2I3AA 3IAM1 5HUQA 4BE9A 1O5OA 1H2BA 5FXMA 4AL4A 1M8PA 4UE3S 2L42A 1IVYA 5K8IA 5EZ5A 3SK0A 1LVGA 1KJZA 4EAAA 4QULA 2GK7A 1BKDR 4UVDA 3W6OA 2WQ7A 1ONOA 4UJ3A 3DLHA 1TU4A 221PA 2G6BA 2DFDA 2Z2JA 2F17A 2O57A 1LBHA 2ZRBA 5G41A 4EQZA 4GH5A 1OPXA 1T8WA 4W1QA 3VYWA 1L4FA 2R44A 1PTKA 3HUUA 4G67A 3G2KA 3O8DA 1OLXB 2FPMA 3Q7EA 5G1OA 4RTOA 1J1IA 2LW7A 2Q3HA 4PO1A 1BA2A 1GN8A 2IHVA 3EY9A 2P4UA 2WIFA 2PT9A 3CY6A 2BZSA 3GLHA 4OKSA 2YZ7A 3JAWA 4RE5A 1TT5B 1XVUA 3WGZA 4AROA 1BDMA 4PIPA 4C1NA 2YN2A 1B4DA 2EQ5A 3DMRA 1O57A 3IQZA 5JPCA 2FW8A 3L9WA 5E6RA 4OHMA 3RLFA 1KSHA 2FV8A 1QORA 5EGNA 3V2UA 1OH5A 4MW2A 1WEKA 2BONA 1HE8B 3ADDA 1X7WA 5F7OA 1FJ2A 2G4LA 4YJ3F 4YP1A 3AIKA 3GXOA 4QGGA 4KPUB 3RQSA 5A9RA 1FFEA 4OLFA 5B36A 1G5QA 2ZYUX 4RTSA 1QBKC 4U7FA 1XEXB 1D0SA 2FN9A 1WL8A 4ZKEA 1NVWQ 5CA1B 3C7CB 2UUBB 4BJ6A 2Q4BA 1GCIA 1Y0BA 1EMDA 3EIOA 2YZKA 1NXVA 1CQIA 3I2JA 3KSDO 3M6VA 2WABA 3A1DA 2HZBA 3UWDA 4II3A 2J6HA 1QHXA 1B00A 3AXTA 1X7HA 3T5BA 1UBCA 2CV1A 2DQZA 2PZBA 4ENWA 3STVA 2R6R1 2IZ0A 4GUAA 4MUMA 1H8HD 1PL6A 2OFOA 1NZFA 5DISB 5EIWA 4GC9A 3V1MA 5JLJA 4DEVA 4UW9A 4YROA 5IJXA 3QEAZ 2EEZA 2VTBB 1J20A 1GUDA 1OOEA 2IOYA 2NZ2A 2NQ2C 4JD5A 2YNMD 4MRNA 1DRJA 1PFGA 4IAOA 1W5TA 2VYVA 3U4HA 4E88A 4MYTA 3PTAA 4DMUB 2B0CA 2FLKA 3FW1A 3GRZA 1JQKA 4XDZA 4E1AA 3VNQA 1XPUA 3L8MA 2GA9A 1VG0B 4OGKA 4EFMA 2C96A 2Z8YM 2ZI5A 1W0JA 3TIIA 4Q1DA 3ZTWA 5LN1A 2XB2A 3PXEA 3QYPA 2V45A 1JTFA 2PUTA 2RHGB 4XJTA 1UWVA 2MWMA 4IFBA 2Y0DA 3PT9A 3WK4A 1YOVB 3ZWAA 2B1GA 3HCPA 1SPBS 4NJOA 5LIRA 3CRZA 2VP3A 1GPUA 3TEJA 1AG9A 1T0BA 4JGBA 2H65A 2NGRA 2EEPA 4PHHA 4K9LA 2CY0A 2PBLA 4V0LA 4BQSA 3FSGA 2WT8A 2CNBA 4ZEXA 4C7BA 4A36A 1LTQA 1VPVA 1Q7CA 2QUJA 4TWZA 1EUCB 1NXQA 4EG3A 3QF4A 2FJ0A 3EOZA 4JWKA 3WQSB 3GFVA 5JUWA 3AL0C 1R0LA 1Z6TA 3FBWA 4ALMA 3RJTA 5IAAA 1VIYA 3LVQE 2YJ4A 3P5BA 1J2TA 1ULZA 3A7EA 3IOMA 1SOUA 3P8ZA 3D31A 3Q2IA 1DX4A 2EX0A 5YASA 3VI3B 2RK4A 3E2MA 1RMQA 2H16A 4JBWA 1Z62A 1M2FA 5MN5A 2B7BA 1SOWA 1AQ6A 3OX2A 4XVRA 3LJKA 3PLNA 4W4TA 1K92A 3SVZA 5JS8A 2ETXA 4R1QA 1JR3D 1W25A 3M5PA 4HEA6 5EI5A 1QE0A 5FJIA 5BYKA 3OEED 1TMYA 4L4UA 1RLTA 2PZGA 3LS2A 4NCJA 3VYSB 4Q9IA 4J1TC 4MK4A 4UTZA 4PZEA 1MB3A 5KOYA 5JWOA 2F8SA 1R0ZA 3EBPA 1H23A 5KYUB 2JHGA 1U0NA 2CE2X 3EGDB 3MJTA 4BBPA 1JGTA 2PL9A 5IXYA 4Q4CA 1X7XA 1QONA 2Y1EA 5CDFE 2IKSA 3NHJA 2KS6A 1NC3A 3B7WA 4OU5A 4CLEA 4B2IA 1YQQA 2EG5A 4D5EA 1UPCA 4OGFA 1CS0B 3I9V1 4YJFB 3UAGA 4AWBA 4DEXA 1U7OA 4D9JA 1QYCA 3TAHA 5HZHA 3TLMA 2BHSA 3UIEA 1EP9A 2EKQA 2ET6A 2FUG6 1K5DA 2ZSUA 1Q5PA 1GV0A 3FBTA 2W71A 1X14A 3F47A 2IE8A 3IQHX 5DZSA 3N86A 2PWYA 1L7PA 2AW3A 4M22A 5FULA 2HM7A 2QYHA 2W2NA 4HB0A 2IY9A 4IDPA 4P82A 2Y77A 3PHBE 5HF8A 4EY7A 3CW9A 3AUKA 4OGLA 2WYWA 2XKKA 1NNSA 3QLTA 4M9SA 3PNOA 4UPEA 1AV6A 1B2LA 2J5RA 1PVOA 4UCXA 3GF4A 2P5YA 4G9BA 2ZSIA 2C00A 2DFVA 4CQMD 1U1EA 1XX6A 3IMCA 3IAFA 1L3CA 5MFZA 1PJSA 3LUHA 1FP7A 3KWFA 1AZWA 3GGJA 3UHOA 4OF4A 5LU8A 1Z73A 1XLTC 4ZVLA 1RAAA 1E66A 3H9QA 3WBJA 2GS9A 2FJPA 3D1LA 5IKXA 4BFZA 1E2EA 1UMKA 1IBSA 1QFYA 2AN5A 2EZ8A 3DT8A 2FFAA 2QTHA 4KCGA 4O4JB 4WXPA 4DMGA 4PZZA 1S3FA 4I55F 1J99A 3D3QA 1Z08A 2NSJA 2EERA 1F9AA 4JP8A 1GGKA 3I0NA 3KTFA 1EDZA 2BBWA 1GSIA 1LJUA 3MEQA 3NDJA 4GKVA 3ULKA 3PHHA 5IT9A 3U7FB 1CVRA 1NT4A 2R68A 4MQLA 5BNIA 2IV7A 1YDGA 3HBFA 1HY3A 3LC0A 3PQ2A 2V7VA 3RV3A 2RHLA 5K6AC 2CJWB 2Z4SA 4J1TA 4X61A 5LYYA 3TCXB 1NYTA 2JGKA 4WWHA 1XELA 2XI4A 4QEKA 1F2VA 1P3DA 3KSAC 1TQDA 2JH8A 3B89A 2RDMA 4JDPA 5ECDA 2CKDA 5C9ZA 1SK8A 2QMQA 3B48A 1QB8A 4Y7CA 5JIBA 1QX3A 2WIBA 4G86A 2C5EA 3KVOA 4L5CA 1W5AA 1O2DA 2QZSA 4NCHA 3AKDA 1T9KA 2DOKA 5KSZA 1XZJA 2JLZA 1NRWA 4A92A 2ZM5A 1OZFA 2QRHA 4KN6A 2VT6A 2XH8A 4JBLA 4RLFA 1KEUA 1Y7IA 2NWQA 3QW4B 1P5JA 4WHMA 4Z8YA 3WGLA 4UBOA 3OIWA 3IJEB 4Y9SA 1DADA 3UA3A 3O8NA 1PFQA 2QTNA 5KYYA 1VBNA 1W94A 4RHFA 4G5SA 1E94E 3CT6A 4I4NA 1WKCA 4N6NA 2CBXA 2BMDA 2QPTA 3WHLA 4YUAA 3UJHA 4Z7QB 5D5PA 3S2SA 2Y0EA 4MRPA 3H2IA 1DAEA 1H5NA 4D98A 2XNJA 5JXWA 3DOIA 4WZAB 4X92A 3WBFA 5BSHA 4REOA 5DM4A 3ZX5A 4AKEA 4DA7A 1RKVA 5I7RA 3QIAA 5D84A 1RLOA 4ENRA 2PH3A 3TF5A 1KIMA 3OSUA 5DXJA 5T64A 3RWMB 3PJEA 3VPFA 2ZRFA 3OQVA 1ZN9A 2BVNA 3ADCA 5CRIA 3OETA 4LV5B 2J87A 2QSJA 2OCLA 3PG5A 5HKAA 1UPXA 2ZREA 2WJYA 3DMGA 4IICA 4MJXA 1E79A 2XT0A 3QW2A 4Z99A 2OZVA 1LX6A 1IAVA 1P9RA 1XLTA 1KZYC 2YVKA 4N9QA 3BE4A 2QM7A 2QMEA 1I14A 2OXTA 5JD4A 2BFMA 3PEUA 1AURA 1NBMD 3H3FA 3EAGA 3MUEA 2YCBA 4NK5A 3RJZA 4DCNA 2MT9A 2WM2A 3UAYA 5EHNA 1TYDE 3NALA 4IFTA 4WLUA 1JHOA 1RJGA 1QR6A 2F67A 3ILSA 4A23A 1MDBA 3M6IA 4L4XA 2ZVQX 1SCIA 3GARA 3I9OA 3R5HA 2LKDA 2F3SA 2ORWA 3ZWMA 1N4DA 2ZP1A 1U8UA 1V1RA 3PQFA 4K9QA 3NWJA 3OD1A 3RFCA 3HE3A 5FWYB 4C4ZA 1X74A 1KMCA 3O9VA 4UNNA 1ZJWA 5MHTA 5K6AA 4RULA 3E9CA 4H9GA 2PKYX 5KVSA 4ZVPA 1T15A 5HFAA 1C7RA 3MNFA 3QRWA 2FW6A 1B23P 2NACA 2CF6A 4FCCA 4DRZA 2NP6A 1N5KA 2I87A 3Q10A 1TGVA 3ABOB 3B36A 3ZDYB 3EAQA 4X3OA 4M7OA 4BFUA 4RKFA 4Z49A 4MW9A 2D3TA 1QZUA 1VKNA 1UQTA 2JD1A 4JROA 2RAUA 1L8OA 4QOFA 5DI9A 1GAQA 4IXTA 4J3NA 4AZVA 4EARA 1RWMA 1I6LA 2X1MA 2P9ZA 4ERXA 1QU3A 1WDLA 1BU5A 4V0OA 3VR6D 3ZY6A 5JI2E 1R7RA 1IUKA 4ZRDA 4ESEA 3ACCA 1E5LA 4QEDA 3ZBPA 3CEHA 4OQPA 2Z1MA 2XBMA 1M74A 4DSTA 3EW9A 4EVIA 1KAHA 3LLSA 2V96A 2VHXA 2H5IA 1AM4D 1C2YA 1ZUIA 4IYRA 4CM4B 1X9IA 3GWZA 4ZV7A 5T8KC 1ND6A 1H1DA 1Q1BA 2P67A 4L74A 3VC3A 4TVKA 2BFBA 1E2GA 4L4YA 1HOXA 1XTSA 1MXHA 3QU2A 3ROTA 3D0RA 5E9WA 2DSTA 2PYIA 2ZIAA 3B85A 5CVJA 2JHFA 4KQ6A 5BSKA 4M8SA 4ZAGA 1Q84A 4XIJA 5EIFA 3CNQS 5BV8A 3AVTA 4C03A 5TX7A 4FJ1A 2DUMA 3CUTA 3UYLA 5IHPA 1EXMA 4IIGA 4M1EA 2GCOB 4KI7A 3V1UA 4M1YA 1P74A 2B25A 4KBFA 1L0BA 4JN6B 4MAFA 4MYSA 1TM1E 1YDFA 3I5MA 1WUYA 5REQB 1ZMBA 3E3OA 4J0GA 2P5UA 3TRKA 2XIJA 4AIRA 4BLSA 4YP9A 2Y6UA 3KL2A 4L7VA 1Z6GA 3LXXA 3F3SA 1QAMA 4XKJA 3SKXA 1Y9EA 3ZHSA 4Y2SA 3R5TA 3IVRA 4E4YA 5A2QA 3IR7A 1WXEA 1WZIA 1HRKA 3N6XA 4DIUA 1NLFA 1TQ6A 1DINA 2W00A 2ZSJA 1HTTA 3EXIA 1TTQB 4I46A 3ZDDA 1KVSA 4OYYA 3E81A 1R9GA 4EY4A 4V2IA 2DHQA 5JS2A 4MR8A 4RVHA 4NDZA 2A94A 1K4MA 4H1TA 3TIXB 2B5VA 4QXOA 1L5GB 3SYRA 5HGXA 1U04A 1YR8A 3UM9A 3ZVKA 2UKDA 1QGAA 4EGSA 3FXAA 4YT2A 1KAQA 2BMVA 3EVNA 3TR0A 1QFJA 4CQMB 3R5FA 2DFTA 4FQ5A 4E51A 4HDNB 3G2LA 2F48A 2HJWA 3ZV3A 3ZVRA 2ATIA 3V8BA 5H82A 1F4LA 2ZBFA 3R0QA 1G5FA 3HU1A 4C5AA 4WKBA 4BWGA 2MOKA 3ZYCA 2GETA 3W04A 1EX7A 4HH4A 2PVPA 4D82A 4ZMRA 2CUNA 2EL7A 3FGOA 2QBYB 3CX4A 1MJ5A 1JIKA 3KB1A 1IM8A 3GDFA 3EWSA 2GHQA 3ZU4A 3SC2A 3TUIC 2I6FA 3T0IA 3WWYA 1DZ3A 1ULUA 3DKKA 3GJ7A 1MQ9A 3ZLBA 3KZNA 2C7VA 5T8KA 5DM60 1WW3A 3DTNA 1S3SA 1HOTA 3CQ9A 1IPFA 2WIKA 4QBTA 5B3JC 2R00C 1PW5A 1FOEB 2TRSB 4NSNA 5TGZA 2R65A 4D26A 4CMJA 3B5IA 2DX7A 2DG2A 3VNBA 4PYIA 4Q7KA 2JHPA 4TUYA 5DIFA 4YRZA 1D1TA 2EQBA 3JRXA 4BRWA 4BVKA 3K5WA 1NJ8A 3GVCA 3ITKA 4TVOA 2IOFA 4CM6A 5CG2A 4NYMR 1Y80A 4CR8A 1TD9A 1VDZA 1DXYA 3LTEA 3DYIA 1O9BA 2KYRA 2AFVA 3D8SA 2V3CC 5DTEA 2O52A 2R4UA 1KIAA 1V47A 2JNWA 3RDPA 4BO4A 2VNIA 2H3HA 3D6MA 5LZ5A 3GG2A 4JVLA 3EULA 4YMSA 1C7QA 3WDSA 4CMAA 5KZMB 1D3AA 2JKZA 1VLVA 4PG4A 4TVSA 4UOEA 3OZEA 2Q3LA 1I3NA 1VSVA 4GECA 4OBXA 4TT3D 1RFGE 2XGJA 2FDXA 4FNMA 3T5TA 2PKXA 5JCJD 5JNWA 4HX2A 1ESDA 1YONA 2YX1A 3T7JA 2Y27A 1JKIA 3CNLA 3IIMA 3WLEA 4DNQA 5CEJA 3LLUA 3U0BA 4D9MA 1AK9A 1ECJA 3ANYB 3BJMA 5DBGA 3RT1A 5HHTA 1GRNA 3ZPXA 2OK8A 2X9GA 3LQFA 3VR5D 4Q9DA 2IGTA 1J7KA 1BXZA 2JJ8A 2REQA 4GMFA 4IQ4A 2IBMA 2KPOA 1RJDA 3GBVA 2PK3A 1QQ6A 1W59A 2CFOA 3PFWO 4LQLA 4P2GA 1G4UR 4DQ0A 5BR8B 3Q8WA 1RWBA 1T13A 1XCGB 4HGNA 2XOKA 4KFTA 2D0OB 3THRA 2L18A 5T6MA 1ODCA 3THOA 1XYGA 1T1EA 1DQSA 3P0IA 4XXHA 2DTXA 2A9JA 1XMSA 4ZO6A 4PW0A 5LMZA 4DA4A 3Q9LA 4JJ6A 4D7AA 2VSOA 3KBOA 2CDNA 3BRQA 6NULA 2PVSA 1WMFA 1DRUA 1ZEJA 2HPZA 1BXKA 1MC4A 2P6NA 3PHJA 3QELB 1BXRB 1YQDA 1E9DA 2Z58A 1AZLA 5B3JA 4DM3A 2ZUTA 1JFVA 2R00A 5D3MA 1E96A 1A5ZA 2RGCA 4MVJE 3TI9A 3L6OO 1U1DA 4BJ3A 4DIBA 3ILXA 5CB8A 2PFSA 4LHYA 2XDQB 1HEIA 2QD4A 1RYBA 1IUPA 1V7QA 4MVWA 1GUYA 2P8JA 5TQ2A 3K09C 3TLYA 1FUUA 3ZWNA 4GXNA 1OI4A 2FMXA 4GPD1 2OMKA 4TSRA 1TQ4A 5J2TB 1SEPA 1G3MA 2R1VA 2FYTA 1J07A 1L9XA 5NULA 1QMGA 2HGSA 3PUWA 4N7RA 5FTLA 1P5ZB 3CPSA 2H57A 4B2YA 4Z5XA 3JASA 5INTA 5D7NA 5ERYA 2H2WA 1KGSA 1FVFA 4MS1A 2QRQA 2VEOA 4FFRA 2XV1A 3BA1A 4B6EA 3H1TA 2WWVD 3AZOA 1N5IA 4EJ6A 5EPEA 3LQYA 3CWZA 2NO4A 1UOQA 5L6LB 1QM5A 4UTXA 4P4GA 2C5FA 2ANCA 4EW6A 1KI3A 3I04M 2HJSA 5JYEA 1SC6A 3MPUA 4Z53A 4X85A 4B6JA 1H0HA 3DVLA 4NFHA 2QXTA 4GBJA 4RD2A 1PSWA 3D8RA 1OBHA 4GVXA 4G56A 1Z0JA 3EGIA 3MINA 4GLOA 5HIMA 6GPBA 2QN8A 1BMFA 3QK7A 1JDBB 1FW6A 3ZDFA 4B87A 1LDEA 1UT8A 4FZ3A 4Q12A 5DW3A 3BC1A 5JBNA 1OQAA 3BCRA 5I7HA 4EA8A 2IOHA 1WDMA 1X92A 2RGXA 4WBSA 5EKTA 3V1KA 3NMUF 1JH8A 2X1HA 1YJQA 2AJCA 2GBFA 4RD6A 4WSOA 3W5VA 2P9CA 4PNZA 4PGFA 4W9RA 1I94B 2IEAA 3QI2A 4AZTA 4K1LA 3V4SA 5IEBA 1C1XA 4PG6A 3O75A 1UAGA 3CLVA 3VUFA 3ZCPA 4BO6A 5GV8A 1F4PA 4YO8A 4QYXA 1G8FA 3FTQA 5IC4A 3RASA 4PBRA 3C4VA 3JS5A 3P9PA 4Z3DA 4EO4A 4BRSA 4MA0A 1TTPB 2J4DA 3LFTA 3P94A 3WMEA 5I4KA 4MYRA 4TZ6A 3KPUA 5B4VA 4IFEA 5DEOA 2XYGA 5IUNC 5BXQC 4UFNA 1K7SN 2NO5A 5CJPA 1KK1A 3I01A 3URKA 3VOAA 1Q95A 3O0TA 4QJ4A 2A5JA 4HEHA 3GLGE 2NV0A 1GOTA 2NN3C 5J1TB 1UZNA 4J3FA 4X9XA 3DBOB 3K09A 4URZR 5E7QA 1Z5UA 1GDTA 3DHYA 2ENWA 2WW8A 1I36A 5IABA 1ORRA 1EXWA 3AHEA 1PFWA 3VR3D 2OZLB 1LRJA 2X9VA 4ZQEA 2IEBA 2ZJAA 1T2NA 5EXSA 1XHEA 3PUYA 4QA9A 5HKLA 5HSGA 5EJ5A 2WTUA 3USZA 1P9WA 4EY8A 4RYLA 4B6PA 1E58A 1SOAA 1D9ZA 2V9ZA 1Q50A 1W48A 4US0R 3O9ZA 2SICE 1AHIA 3S1AB 4L22A 2WD7A 3DYBA 1XCMA 3GT0A 4EGCB 1Z2AA 2IYYA 2XIQA 1I6KA 1N3YA 1ZXBA 3HV0A 4XEUA 3BCUA 5DKFA 1ID1A 3Q7RA 4KQ1A 3EVEA 2HBQA 4MHOA 4FE4A 2JEZA 3JYHA 1WR8A 3NYWA 4F86A 1O5IA 4MW5A 5A71A 2X7XA 1O95D 1JFFA 2F43A 2VF2A 3SFZA 2JH3A 3OZVA 5EUQB 3NIBA 1NONA 3KB8A 4FU0A 1OF1A 2ZSFA 4MPRA 3CZMA 1VI5A 3L82B 1OLUB 1UXHA 4FMBB 4KB5A 4BBAA 2I3DA 3LUJA 1HDGO 4D02A 1E2MA 3PC2A 3WOVA 4AY4A 4EPWA 4I14A 3PQDA 1E18A 3HSSA 3BB4A 1WSAA 1W9HA 5TVGA 2AH5A 3WB9A 1AHPA 4DRXB 3T5AA 1HE3A 5DE3A 4D4LA 2JLUA 1YQXA 4KIFA 1Z4PX 1KFJB 2DUJA 3OIUA 3UHPA 3NNDA 4N54A 4R4JA 4IJ5A 4LF8B 1C8BA 4HEJA 5AKLA 3EHEA 1ZMRA 4ZU6X 2OSBA 3HXQA 4NQZA 1E0AA 1VG1A 4V0QA 3MT9A 4KR6A 1UCFA 2OQ2A 3DP9A 2C83A 5LUAA 3G17A 5H4GA 1Q7GA 1QFXA 4BX9A 2FPIA 4Q4AB 5MDHA 4ASUA 1E6CA 3I04A 2WDZA 1RE0A 1M6NA 1A7UA 3O1JC 4FFMA 4PSDA 2I5PO 2ZK7A 3IA7A 1N92A 5EY5B 1L1EA 2J9GA 3CF2A 4WXHA 4WZBB 4YRQA 4UTVA 4R8LA 4YRMA 1NQVA 2ZI6A 4HLDA 4O4HB 2A0FA 2RG7A 4OYLA 5AKXA 1D0VA 2RHOA 1SXJE 4XWYA 3PRJA 1C4KA 1Y4ZA 1GJRA 1ISJA 1R9MA 3B3FA 2VXCA 2W2MA 3FI0A 3GGCA 1FPMA 4G84A 1ZRMA 4MW7A 5FR2A 2DC1A 3K6SA 2Y2VA 3PNLA 3W5AA 3T1YB 1V4BA 3IPXA 3HXPA 3NIFB 3RE1A 3PCXA 1RXSA 5IJWA 2XQGA 1HRDA 1SC3A 2WMYA 3PA8A 5ALZA 1NXSA 3AR5A 3PQ3A 2GD0A 3U80A 4DNPA 4QGSA 4YUYA 2Q21A 1EXDA 1F5SA 4PBSA 2JI8A 5DCYA 1ELOA 2NU6B 4BX2A 4QFCA 4QAQA 4RH1A 3V4LA 2DH6A 3GGSA 1D07A 3EW7A 5GJVC 1OLXA 1NJ6A 5AHKA 4B7UA 3E5NA 1KR5A 2TMDA 2BP7A 1UINA 4PTLA 4B4OA 5LP6F 4E3ZA 4DGQA 3JSAA 1ZH0A 1UBFA 1NU8A 1H6BA 1ZD2P 2OC4A 4N6GA 4CLOB 1R66A 2WFLB 3LNTA 4MR9B 5C7IO 4YRJA 1TT5A 5DBEX 1VLHA 3Q6IA 4AIIA 3HJUA 1KOFA 4B3RB 3MJ4A 2J3HA 4Q18A 1MT0A 1UEXC 1FLVA 4IPTA 5K01A 4E11A 1VG8A 2FVXA 3K9GA 4P83A 4WKGA 4EX7A 1IU9A 5C4IA 4LK3A 2CLKB 3KUCA 3AQIA 3IP9A 5H9VA 4KPUA 1G3UA 4ZAWA 1JU4A 1U9CA 1XEXA 1J56A 5CA1A 2HSJA 3H17A 4G6ZA 4DLWA 5E0OA 2QT9A 2WM8A 5JQGB 1G7RA 4CTNA 1ADFA 3DE7X 4PRKA 1B8NA 2EX1A 3V55A 4X41A 2CXSA 2XDWA 3PRKE 2Y2UA 3PFNA 5CITA 3JU3A 1XZIA 6AT1A 2HQSA 1FVOA 1UJMA 3SZGA 4C4PA 4YQZA 7MDHA 2AXPA 3GP8A 3WOHA 2WZBA 4WDQA 3RFTA 3JARA 1KQGA 1NBAA 5K3AA 5FWXB 1QVVA 3NWOA 4F1WA 1G5IA 4YR9A 4NABA 5CJ2A 2WKWA 5BWMA 2HCFA 2VTBA 1ESZA 3N0TA 5EWMA 3T7IA 2ZU6A 1Q0QA 2JGAA 1HNNA 2YXPX 1OA0A 3NTLA 1E4OA 3GGDA 1COWD 2CF5A 2DFKB 3H7IA 3QNUA 3FUTA 1YDEA 1CUHA 5ES4B 3G49A 3W9UA 1KTVA 2W7TA 1VCHA 3ZQUA 4AO7A 5AVWA 1ZK3A 3E27A 4EPTA 2PD6A 1POWA 4OXNA 2Q6LA 1NVEA 2Z8XA 1EXNA 1NYLA 3SVLA 1TZ2A 8ADHA 3G5UA 2R6FA 5GPBA 4WGGA 5KREA 1U9ZA 1KRWA 4IKOA 1UZLA 1H3NA 4CKCB 2D4AA 1TLTA 1PE0A 1ZLYA 4MRAA 5K8VA 5BW6B 1YOVA 4NAVA 3T41A 1LB1B 3I64A 4FEYA 4K5QA 3TLXA 4B83A 2O2HA 4EEZA 1YTUA 3A1UA 4OQ4A 2VDLB 1GPKA 2VHYA 3L7MA 3R6DA 4JSTA 2BH2A 1NN3A 1B26A 3H05A 4Q1EA 4Q3CA 3QPUA 3CNEA 4FFWA 4KDRA 3K30A 4R16A 5GGYA 5IDWA 3PVSA 3TG2A 4DCTA 1Q12A 4DJJA 1V25A 3AF4A 4QO8A 4BRZA 4E14A 2WJAA 1EUCA 4RKRA 4TRJA 2O8BB 4AJ1A 3VU3A 5HZMA 2IV3A 4ZJUA 5G2OA 1O6CA 2X3UA 5AVXA 1LRLA 4R8KA 3QMVA 1TZKA 3Q9SA 4MVJP 5I4BA 3GH3A 1XMVA 2A9OA 4QQRA 2H4FA 4ZHQF 2V4ZA 1KBZA 1SIBE 2I7CA 2IHYA 5BN5B 3S68A 3T1QA 4AJKA 2ZIEA 4V0RA 3O90A 5DI3B 1DBVO 2BEWB 2WUWE 2XEDA 3U4GA 3N8HA 4PN7A 4GOXA 5FYDA 4KPYA 1AXEA 2AMJA 4MOWA 3E0QA 2CL0X 2Z2XA 2P2SA 3QXHA 2HMSA 1JG7A 1VL5A 3EA0A 1GQSA 1CQWA 3FCCA 3NWBA 1L7OA 1ZAKA 4I2VA 2YYYA 1WV1A 2Z3VA 1I1HA 2DTDA 3WB1A 3EOBI 1QPZA 2ON6A 4PSCA 2IBSA 1K8XB 5F2OA 2IYFA 1GLNA 1H6CA 1KO1A 1OGYA 1R37A 2CJXA 5KYUA 4F7WA 1E32A 1B41A 3EGDA 2QN9A 2VO1A 2ZUBA 3ETGA 1KBQA 4A1FA 3GLVA 1GR0A 4OREX 2RGGA 3QLVC 1U99A 1XKXA 2GPTA 2HO4A 4CKBB 2P9BA 2PKCA 3H5WA 3QVJA 1G8HA 2WFAA 4R8SA 4JC5A 1CS0A 4YJFA 4TXNA 1PKEA 1VKRA 5FA8A 4JI6B 1OXKB 1X39A 3TZHA 2QQGA 2ZSEA 3RC7A 4LV6A 4X00A 1GQRA 5AW9A 1WMEA 2B21A 4OIMA 5FPPA 5ILGA 3SDSA 3PWKA 3ABSB 4XUDA 2ZSHA 3CVWA 2QVCA 3FTFA 2BKVA 3OQJA 3D0KA 4V0ME 1CR4A 2DPMA 1F1JA 1ZD1A 1ZUWA 3UXHA 4Z7JA 1BE0A 2XVYA 1TJ5A 3A1VA 4EP1A 5BMVF 5FPQA 5I7FA 1CC1S 3K8YA 3K0CC 3GIDA 4R7TA 1IN1A 2AW5A 1C7EA 2AFIB 3T95A 3TE6A 4Y6OA 1C2TA 1T4CB 4E1BA 5K3CA 4B85A 1JRLA 3I9FA 4QT4A 3W8DA 2HLDA 2P4EA 1K89A 1JR6A 1V5GA 4K2AA 3OSZA 3ROEA 1KP3A 1EE1A 5JAOA 2C54A 4FHFA 1Z2EA 2YZ2A 3A4TA 2VT2A 5FNZA 3EDRA 3N2EA 5SZJA 4MPDA 2Z2YA 3L7OA 3PENA 1M8FA 2OO7A 4NOJA 4ZVQA 4AKTA 3FOZA 1VC2A 3KXDA 4G8BA 2HPAA 1AQNA 4MI6A 4I3FA 4PZYA 1RRVA 3NJRA 4F5YA 5EAIA 3T7SA 1W87A 2IGBA 4CGYA 4H1HA 1Y1LA 2ATCA 4Y30A 2ZUEA 1GO2A 3OZXA 3V8NA 2IY7A 1JS1X 1L5VA 1W47A 1ZN7A 1Y5IA 4O4JA 4QXQA 5IEJA 5F2EA 2HT1A 1CSEE 3RLIA 3E23A 4A2QA 4GI5A 1Z6YA 4M0UA 4R0VA 1WRBA 4P3PA 2ZUCA 4R01A 4GL4A 3PDJA 5EESA 5JS1A 5ALXA 3HKDB 5IBPA 2HLPA 1U7WA 3VI4B 3ZQJA 5ADHA 2ZJFA 2CJWA 1J2EA 2NVUB 3DM9B 3TN7A 4BB6A 1RHUA 1EFCA 1Z5WA 1L5YA 2E4YA 4C89A 1B76A 1YS7A 3FCAA 3A2MA 4FYJA 4CXMA 3NVKI 3HBJA 1Z26A 2QHXA 2WJJA 1DEAA 3H3JA 3QLVA 4NAHA 1AKYA 4QBIA 2WVHA 1ODJA 1L5MA 5K3FB 3R7BA 1FMTA 4LZAA 4EB6B 2E4UA 2IEYA 5ADVA 1F51E 3REOA 2HDHA 3G82C 1O5TA 1LVUA 5A3QA 2H00A 1KH1A 1EBUA 2QZJA 3VDQA 5BRNA 1C1DB 3NIGB 4IXDA 4UNRA 2JB9A 3AGPA 1RKUA 1EA5A 3AFIA 2FPLA 3EIHA 2WIDA 1BE1A 3HL4A 1KHTA 3K73O 2CC2A 3N8DA 4K9OA 1IQUA 2VAXA 1N3BA 2R7KA 3W6UA 3N6RA 2X2OA 3SYMA 4B35A 4KBYA 1KKMA 8AT1A 5FX2A 1DV1A 3K0CA 2QLFA 3A37A 3OURA 5BY2A 4WZAA 1PT9A 3BQ9A 1ST2A 1TF7A 4IM7A 2EATA 1N2GA 4ABTA 2G4CA 1F38A 5AHRA 4JL6A 2HW8A 2H1HA 3D54D 4RGBA 4DSUA 4DUGA 3NORA 1WW8A 4FT2A 5F4ZA 1IC6A 4LXTA 4PGAA 3UMFA 5JMOA 1TQ8A 2J5QA 4IVNA 1S4QA 2E37A 4LJ5A 4PYRA 3TSCA 4ATNA 5E4YA 2W9XA 2OOSA 4YMLA 3BYZA 4KQWA 1LUAA 2NO0A 5EE5B 5KWSA 1F0YA 1Z12A 1W36D 1H8HA 1L7EA 2EOAA 3IJPA 3TNLA 1Y7HA 2UYQA 2BFPA 1FUEA 3GPDG 5KPDA 2XGGA 4C2TA 1CLEA 1HE1C 1YFZA 1LF0A 4IXNA 5HE9A 1L5NA 5LBTA 5DYTA 3DL7A 3IYLW 4JBIA 2QD1A 3TK1A 3AM5A 3WLRA 3OCXA 1Z2OX 4MRRA 2QP4A 3TFQA 2GILA 5J43A 3RU3A 1SRRA 2IJGX 1NVKA 4TN1A 5C51B 4XB6B 1JHDA 3DL2A 7AT1A 2DUNA 2RHHA 1GLGA 4B2LA 4HT3B 3RKRA 3OA2A 3ZW7A 4A15A 4UMFA 3Q5DA 3CZCA 3FTDA 4QUEA 3PYMA 4N8SA 3T06B 5DHPA 3BIJA 3FVVA 4JVMA 2BF4A 3MQ4A 1NMZA 4QHSA 3P0JA 4A0GA 1RPJA 3ZVMA 3N39C 2H1SA 4YH1A 4OHXA 4EYQA 4NYJQ 5EMLA 4KC0A 2C07A 1KL7A 3NXKA 4D3YA 3AUUA 4Z0PA 3EEQA 3GY0A 2BFNA 3LC1O 2I1LA 5B3KA 4R9UC 1QO7A 3TAXA 5LQAA 3T1HB 3FOAA 5G4LA 4DVGA 4IWYA 4U3JB 2VDRB 1JSXA 1U8YA 3NBFA 4TV8B 4MAAA 3CVXA 1H93A 1NY5A 5AI5A 1UBHS 4IF4A 4PFJA 5P21A 4OHZA 1HURA 1BQ4A 2DVMA 2IOQA 4MHTA 2BHLA 3VPDA 2QXUA 4WBXC 4WNYA 4EHNA 5A4IS 3L0SA 1G9XA 3RYIB 1WTCA 4E5YA 4C4TA 1RTTA 3B5EA 4ZI7A 4ALNA 5B55A 4CM4A 3RUCA 5CFRA 3G9TA 4QYTA 1V96A 1SVOA 3M6UA 4FXPA 1VE7A 1JSLA 1NXPA 5AM5A 3QSYA 1A96A 1E1KA 1ZOPA 2QTBA 1CIVA 5KUTA 1J06A 4ZCQA 3HBLA 3WLQA 2O06A 3OEEA 1Y3DE 3S81A 3ETEA 3OJXA 4Z7OB 3MUNA 3FPGA 4ZTZB 1L4HA 1V71A 1P60A 1T8SA 3JCZA 4NAUA 2I33A 1IWPB 2PZLA 4RANA 1JG1A 5EXPA 3DWEX 2GCOA 4FGUA 3EVAA 3HUTA 3VU8A 3NHUA 5CFQA 4RBNA 5CFOA 1CQPA 3NTVA 5FRDA 1BEUB 4QVKA 1XLWA 1AKVA 5TR9A 2IYXA 2OUIA 3QYJA 4XQCA 3OZIA 3ER6A 4DLPA 3LGXA 1VHQA 5FPSA 4KN8A 4UMDA 4PRYA 2J3KA 1QHIA 4YS6A 4F85A 3DDUA 1NOIA 4EW1A 1MENA 2D1TA 1TO6A 2Z3WA 3FNGA 2IXAA 2WM9B 1YA4A 4JEIA 4P7JA 4D2IA 3SDZA 2SCUB 1ZNQO 4CRWB 4M2LA 2UZ1B 4J6FA 1E4VA 3M6XA 1DWOA 3PDHA 4TV9F 3TFWA 1CD5A 2FI1A 2O05A 2Z6QA 3AHDA 1PYOA 5ER6A 5LB4A 4XZ3A 3T4XA 3W2TA 4ZKDA 5K0SA 5JJKA 5IM5A 1FFDA 5COBA 2LDBA 4B3MB 1AQUA 3K0FB 5FOTA 2W93A 4HVLA 2P7HA 3H5TA 1SQGA 4HDNA 3AL3A 4LZLA 3P4XA 4QODA 4C5BA 4E7OA 1PR6A 3IDOA 3AY3A 3SJUA 2I6SA 4YP6A 1YU6A 2PM8A 2Z2IA 4KQ2A 1UDBA 2QBYA 4B84A 2BFAA 3ZN2A 1TFRA 2I3BA 4K05A 1EFLA 4LQDA 4OJKA 2TMYA 4EBBA 5A4AA 1VL2A 2F8TA 2XTJA 3OUUA 4LNHA 3WWEA 1SHTX 1YZKA 2XMRA 2Z3ZA 5JXJA 1MAVA 3L7AA 2RI1A 1KMQA 2R84A 3S2YA 5CHEA 3TOZA 3VA7A 1EIZA 4YC7A 2XY4A 5BWBA 2PX5A 2W0SA 1H2RS 3SHFA 3UW1A 1FVXA 3ZCVA 1P4JA 1TO1E 4MGHA 4ER3A 2JFNA 2IEZA 2Y66A 3B8HA 2VDNB 4MJ3A 4EW2A 2Q5OA 4OJNA 1GEGA 5EE3A 4DB4A 3DKIA 1JLLA 3GT7A 3DS8A 2A0XA 1Y5MA 2DJIA 2ONYA 3KHTA 5BNZA 4ENUA 1K2WA 1KI4A 2YV5A 4MS4B 1FDUA 3V4PB 4YRAA 5BP7A 3T7EA 1OU0A 3WI7A 4KP7A 3T7AA 3VKVA 5CXSA 2B3TA 2SHKA 4FMPA 4HBZA 3G0HA 2DWUA 3RIEA 1YBAA 5TXGA 1U1IA 3CVOA 4HSGA 3ZU5A 4EH1A 3OX1A 4RSGA 2QT0A 4J07A 1DJLA 2JCYA 3CX3A 3P71T 3NM4A 4J16C 4Z4CA 3PC4A 1MAHA 1C80A 4CM8B 3Q1LA 2OD9A 1GFSA 2OHIA 4BDTA 4QHTA 5EMHA 5K05A 3DZKA 4D9FA 1DBPA 1JDBC 1Y89A 3GPIA 4AJ9A 4HD8A 4BEVA 2HJHA 1JVBA 3DH0A 3VPSA 4CEJB 3J81k 3T7TA 1I80A 1KQNA 2A30A 5KVQA 4ENVA 3ODPA 3P5SA 2YY6A 3OE5A 3Q41A 1YV9A 4N8DA 5A0FA 5C1IA 1YCFA 3JYLA 2XR1A 3KR9A 1FX0B 2FW0A 5L51A 1SXHA 1VOTA 3GRUA 4ZOEA 3WIUA 2XB9A 4D79A 4ZALA 3A05A 1W88B 5SZIA 5TNXA 3AY6A 4EKEA 1GL3A 4ME6A 4CKZA 1GN9A 3LUDA 1G64A 5T41A 1NBMA 1QHSA 3GUHA 5CGZA 3EWAA 5DXAA 2H1VA 3OHPA 1N2SA 4LKOA 1W36B 2ADMA 2FE4A 1LK5A 3O38A 1T0PA 2GYUA 4XIIA 1FXWA 3LRTA 3AETB 2CFCA 3QELA 2YWRA 5F7JA 4HXEB 5TF4A 4L6IA 5DV9A 4BLQA 1BXRA 4CZ2A 4ESVA 1DXOA 1WBJB 1MHPA 3AP2A 5ECWA 3EF1A 3DO6A 4E13A 4GI3A 4EUNA 1AXRA 5AHOA 3X3HA 4BWVA 4X6UA 2XDQA 1KDPA 3N8KA 2FH5B 4I8DA 3QBTA 4XPIB 2BI8A 3OOEA 3EUEA 2VF4X 1FTYA 2VZ8A 4BIIA 4BO3A 5LXTA 5J2TA 4CKEA 2GN8A 2HB6A 3ZWDA 4C21A 2AGVA 5FNVA 4A0FA 3ZZ1A 3T5GA 1GXSB 2UZIR 3FCSB 4X3PA 3IIKA 1SWVA 1MAAA 2ICAA 3GEPA 5DM70 1R0BA 2D8MA 3L8GA 2JFPA 4HQOA 3CC8A 4E15A 5ALKA 3DQZA 3BIXA 1ISMA 2WT9A 3DUWA 1U1FA 1Z38A 3IKVA 4WFKA 3DO8A 3K1YA 5SYAA 3RANA 3A9VA 1E2LA 3R1IA 2R6JA 2JGNA 2ZATA 1Y4SA 3CFYA 2E87A 3E5HA 3QG5A 4G4JA 5H68A 3WJ1A 5ALMA 2GVDC 3T7RA 4J16A 2JBHA 3IDAA 4MRMB 2E6KA 3C6BA 4GOLD 3WBBA 2KWIA 2X0FA 4NARA 2WT4A 1XJ0A 2BTQB 3C6XA 2IW3A 5HKKD 3SWWA 5ALHA 3S2FA 2JFYA 4A16A 3MBIA 2NU9B 3K4PA 1XDBA 1ZRNA 1GKLA 3V3KA 4D5GA 1C9DB 4EPVA 3H87A 1YNOA 3QXJA 4ITVA 2ECOA 1NE7A 2H1IA 3KLMX 5TMDA 2NV6A 1V8PA 4GGMX 3VISA 1ETUA 8GPBA 1YR2A 1QHNA 1U5AA 5TJHA 3ZDXB 1T2DA 3Q5GA 4ZVUA 5CB4B 4XGIA 5HS4A 4KQ9A 3Q3GE 4FD2A 2AEEA 2ZRJA 2DHDA 4PWZA 3ZIAD 2J6CA 3CISA 1FYFA 1HT2E 1IUOA 2G1PA 3UNXA 2H4ZA 1GTJ1 2XQKA 3ISTA 3VVBA 2BMWA 1FBTA 1E9RA 1TTHA 2YJ3A 1DUSA 1NUSA 4I50F 4JZYA 3DTVA 4Z86A 1VL1A 2QVGA 3N8NA 2ZITA 3ZCUA 1V9LA 1C3LA 1NQWA 1WU7A 1KAGA 2IXEA 2J4CA 2XXBA 1C8LA 2KW5A 4WCDA 5C4GB 4BE7B 5I45A 3LYAA 3V1NA 1KZ7B 5J4KA 3DOJA 1S2OA 2ZJ6A 5JD6A 1H4QA 3BZUA 3NEPX 1SUFA 3RSZA 1FLNA 4KE6A 3M1IA 3Q5EA 1KJWA 2OZLA 3ZV6A 1DCFA 2I8LA 3P9NA 3O1HB 1UL1X 3BCSA 2ZRGA 3HB4X 1LCIA 4CDMA 2CYBA 3N5CA 1A7KA 4DREA 3OIVA 4ZYTA 4GXRA 4KOAA 4M53A 5ESXA 4AG5A 4JB8A 3N0VA 3F6EX 4AW9A 3D4IA 5CFNA 3CRQA 1WXFA 3JQ9C 4TN5A 1ZHOA 1DAGA 2VT7A 1NUHA 3QOWA 5ALNA 3LUAA 3L0IB 1Y6JA 1YB6A 2NSDA 3S1AA 3F6SA 1QSGA 4B3HA 1H9CA 3PIRA 3TB6A 4MWBA 5D7BA 3O4HA 4PXAA 2AHOA 3MCUA 4M21A 3H4IA 4NZMA 1T1SA 3G8DA 4GLBA 4I08A 4QM6A 4YYEA 2I4IA 3GRYA 1WZUA 2DPYA 1CUVA 1BGVA 1XQ6A 1A4RA 1J90A 1OPRA 1RJEA 2DP4E 3GVHA 1MJFA 5FBQB 3R74A 2OHVA 4MQMA 4W5JA 3E5RA 2QJTA 4D42A 5BOSB 4IXWA 1XQ1A 5BR4A 5CB4A 5JY6A 1R5NA 1SIOA 1LBSA 1W2GA 3NM5A 1NVAA 3NV9A 1PFUA 4LZOA 2AR9A 4A2PA 5B6JA 2AKAB 4DUZB 2JZOA 1QVRA 4FMDB 2VA9A 1FTQA 2ONCA 3U9SA 4B7AA 3U3KA 1PVVA 4MGKR 3T61A 3W7BA 2C0CA 3B6IA 4DRXA 4NC9A 5JAMA 2CUTA 2DQKA 3GRKA 4MEBA 4LGVA 3WSTA 3MWGA 4PQFA 3N2ZB 1I2MA 1U7XA 2GUWA 3DPSA 3GU3A 3N2KB 3VH2A 4B0OA 1VMKA 1Z56C 3CSDA 4L72A 1A8HA 5KU7A 2NPFA 5B1DA 5BQ3A 3DE1X 1UXOA 3MHPA 3ZCQA 1FNMA 2O7SA 1MB2A 5JXIA 1Q14A 1GAWA 1DRKA 2PTHA 3OWHA 3Q7TA 4Q3BA 4C05A 2O6LA 3JVDA 1E0DA 1M2HA 1VCOA 2EZUA 5JD3A 2JHAA 1P9OA 1C4XA 2GNOA 4NBLA 2I2WA 5JS7A 4JJ4A 4E6PA 4HMPA 2FSUA 4WZBA 1FFYA 3E3LA 1N2CA 1NW9B 1DJQA 1GR1A 1Q0PA 4FGZA 1M2GA 4GLLA 4O4HA 4R83A 4BNHA 1EK1A 2W6OA 2ZT5A 4QU8A 1KYZA 5F73A 4IDEA 1QU2A 4O4LF 5A7FA 2D00A 5K0FA 2VK1A 3FMVA 5LP1A 1C5KA 3QOYA 4D8TA 4CGZA 1UK9A 1SU4A 3P9RA 2XKJE 4U2KA 4TT3A 2FSHA 4Q47A 1KARA 5JCJA 3CR3C 4N7BA 4EG8A 2B92A 3QFRA 1XRRA 3MRTA 2QI9C 4HAUA 2H0AA 1IYZA 4W5TA 4MKGA 2ZYTX 1DQRA 1WD5A 3PCTA 4XIFA 2C2WA 2HTEA 4QICA 2IUUA 1N2JA 3JQ9A 4RKWA 3TQIA 2HFJA 2NU6A 4X45A 4C0JA 2QD3A 1ZC4A 1IN5A 1HMYA 1UDCA 2H6EA 3UAVA 4XLZA 1SUPA 1P0QA 1O6GA 2YQ4A 5DHAA 5B57C 1GZHB 2ZJ5A 3L1KA 4ITUA 1MA3A 4WVLA 3WMFA 2B69A 4UFPA 4IDFA 5C5EA 4L27A 4DR1B 2QLTA 4BE4A 1XD9A 4Y1EA 4CLOA 2WFLA 4MR9A 4S2UA 4Y0NA 3VKHA 4RNDB 4EKDA 4CF4A 3NM6B 5FWNA 3H4TA 4RFVA 3LBFA 3TLEA 3WL8A 3EQ9A 2G77B 1MXFA 3KT0A 3CIFA 4XSVA 1A82A 1WX1A 3FAZA 1XDZA 2KB0A 5K99A 4RYDA 1Y63A 2I0FA 4X8OA 2QJRA 1IY8A 2HC9A 3PSAA 1ENZA 2Z83A 4IIUA 4R54A 4EMUA 1X7ZB 2QRLA 4M9UA 1IIBA 3GEGA 3AB8A 2GDJA 3NU1A 3IVAA 1B8OA 1C3VA 1ZIDA 3BOSA 4JL5A 1X7DA 1RQRA 4MI9A 1BH2A 3RC8A 1FRQA 3EDYA 4LBVA 4MSUA 4TTJA 4ETMA 4AULA 3F5SA 3WLTA 2L17A 16PKA 1JTEA 4MI3A 2X0KA 1IPEA 3QVSA 4TS3A 4F8YA 1WPGA 4QG3A 5EQTA 4ALKA 5JQGA 1TK9A 4IHQA 3P9KA 2PXXA 5JSZA 5DNYB 5LBUA 1N32B 6Q21A 2PS9A 2WWTA 1DBWA 3D7SA 5DGTA 1NFQA 2PZFA 1J2RA 5JZSA 4DR3B 1XG5A 1I5OA 1XOIA 4XTCS 1KPIA 1LKZA 3OX4A 1ORVA 1RRFA 1MG0A 3LIIA 3MA0A 1JIIA 4HDKB 4FONA 5FWXA 3ONEA 1M7HA 3RSQA 1PBNA 1OBCA 2H2FA 3GLHE 4MWEA 1BU8A 4L4SA 2XWQA 4ZDIA 5JYBA 2NT4A 3HRKA 4M4SA 1YHYA 4TKVB 2R6HA 1VB3A 2I6XA 1JWAB 2PPLA 3H86A 3LUBA 2NP7A 2J5KA 6ADHA 2YXDA 3PEYA 3PGMA 3MM4A 2EJVA 2VQ6A 2GAOA 3FCXA 5IKOA 4JJAA 3DAOA 3LHSA 4NBNA 4BC0A 1P1IA 2EJUA 4X1KB 4H0CA 1DT3A 3AF1A 1U0GA 4GOKA 4YDRA 4CKCA 2W6JD 3AY7A 3G02A 2DSNA 3VV3A 4AVYA 1T24A 1S0UA 2BHRA 2BFEA 3IAXA 5JSFA 1QH1B 4FIDA 1VLMA 4D6XA 4FNGA 4OQEA 2FUEA 2GVZC 3UATA 3RIMA 3FUVA 2QIPA 4YHBA 2DYKA 1MP0A 3S44A 2QVYX 3NH9A 3CEAA 3VTAA 1V7CA 1SM4A 2XUJA 3BUSA 3JZDA 4C7XA 1WQ1R 1P7VA 4NBKA 4ZVSA 2YWGA 3HVJA 2ZROA 3VMFA 1NJ2A 4S04A 2O8BA 2R60A 1G8MA 3OD5A 1XRPA 1IBLB 3QQPA 4JI1B 1PR1A 3AVXA 3UAWA 2AN3A 1JXOA 3M4XA 3W3AD 3ZWQA 4H7IA 3A9SA 5AM3A 3FLAA 5EIXA 1DMRA 3KX2A 5B7PA 3P27A 1U94A 1YZYA 3W5SA 2C7QA 1Z7GA 5BN5A 5KEIA 1VFPA 3TTUA 5DI3A 1ZZEA 1KQOA 1P6XA 2VPYA 3CEJA 2BEWA 2I7VA 1ADGA 1D09A 1TCCA 3C6QA 3ORQA 4REMA 5EZ6B 3RRMA 5ELMA 5EHGA 1B42A 1Z5NA 2PLRA 3AHIA 3CPHA 1IY2A 4MNTA 1CUGA 4NCXA 4PO3X 4BN5A 4BTEA 4D3FA 2UUAB 3E58A 3LKZA 4U9IS 4YREA 1RSZA 2FPXA 3BDVA 3A8TA 1KGDA 1G17A 5ANRB 4F2GA 3GGOA 4P5EA 4PPQA 3MMPA 1DCKA 4QTTB 3VR3A 4HPWA 3I23A 2C77A 2CZGA 1Z6QA 4MIYA 3GJXC 4NENB 3UPUA 3QBJA 3D8UA 3DZHA 2HA7A 1ODKA 4A6DA 4MUKA 2Z2KA 4YI5A 4YA6A 1G7CA 1PX2A 2AUMA 3ML1A 3NJ4A 3D8HA 4B40A 5AUQA 721PA 1FRVA 1OFTA 1XVVA 1UZMA 2WWFA 2CJPA 4YB8A 4AN0A 4CKBA 3IIIA 1Z5ZA 1CUFA 2VHEA 3DOFA 3QEOA 4OK5A 4TMFA 1XPOA 4N48A 4D3XA 1H2XA 4Z4EA 3KWMA 3VM6A 2PGNA 1IZ0A 1J4AA 1V3TA 5TB5A 1N57A 2RJ3A 3K8QA 1ULAA 3KHKA 5CK5A 3KU1A 5G1NA 3A4IA 4I7EA 3TTSA 4DLSA 3WRXC 4UMVA 5FF9A 1ORWA 1V6SA 1DGQA 3L5KA 4O1IA 4BQRA 3SY8A 1PJ4A 2JLBA 3UCFA 2HU2A 2CD7A 2Q6KA 4V38A 2W4QA 1HDIA 2GYYA 3TRDA 2R62A 2G67A 3L8FA 5LOVF 1YBHA 5KQSA 3IPYA 4CMKA 1MJGM 2XAAA 4X6YA 2AFIA 4R31A 2VJDA 4L15A 5F2KA 3SE0A 3BSSA 3DDHA 3EF0A 2MINA 4KYIB 4ZO7A 4JB0A 5L95A 2X8AA 1T4CA 3C6MA 3ORHA 2HJ9A 2Z0MA 2WTAA 3INGA 4HEA1 1C41A 3EPRA 4K6FA 4MB0A 3FTEA 3KQSA 4CCWA 4UDNA 2VP0A 4RXMA 1K98A 5JHHB 3I1JA 4D9IA 3AI1A 3ZE8A 3U1BA 4OBBA 3ZR4B 5ALVA 1TT7A 2GBIA 1N25A 5CH8A 5HOQA 4BNLA 1N5OX 5FTJA 3EZXA 2G28A 1LQ2A 3TTYA 1KRHA 2HMWA 4MQ4A 1PT7A 2ZGVA 1XO1A 2VDJA 3ABQB 2QUBA 3HCNA 1XP8A 4J4TA 4MB2A 4HAYA 4QVIA 3DJYA 3V7YA 3FVQA 3FDZB 2YHBA 4JB2A 1PJAA 1UJ6A 4W5NA 3IOEA 2CXRA 2R96A 1Z6AA 2M2IA 1NMXA 1W4LA 3KZVA 4FJ0A 5GZ1A 3T1NA 1L1QA 2FUG1 1JA9A 3SXPA 2HA4A 3BMCB 3BSYA 4H7EA 5EKDA 2VA8A 3ESXA 1BN7A 3VAAA 4Z1MD 3T15A 4CIAA 2EJBA 1GCOA 3HKDA 3W3ZB 1GL6A 1N1DA 1XZAA 4ZCRA 1EBBA 1UM9B 4CF5A 4NYJR 2NVUA 4RS4A 3W6ZA 2D1SA 4GU5A 1UP7A 2JFWA 2MSCB 4OQQA 4R05A 2ZIXB 3FA2A 3UVEA 2FN4A 3L40A 5LB2A 1T9AA 4B71A 5F35A 2ZB2A 1BE8A 3LPLA 4IRXA 5K3FA 3IELA 2WINI 5AI4A 4EB6A 3RKSA 4OD0A 1V41E 1T4GA 4AZ0B 3SYNA 3U7QB 3WL5A 2V54A 2YVAA 2II6A 1C1DA 3AG5A 5KTOA 3CVUA 3PEFA 3N05A 1GPDG 4DLAA 4KO8A 2P1ZA 3WRXA 2WHEA 4EUSA 1R74A 1YK1A 3NS7A 4O5AA 3ZXUB 1N2HA 1RYMA 2R5WA 3NUQA 1R6AA 3E82A 1EG2A 2Y8EA 3IE0A 3UWOA 2W6ZA 4QGBA 5T6BA 2NYUA 3LH5A 1JEJA 2DRIA 3NRCA 4PFSA 4I1PA 1OWPA 2AF4C 3LW8A 3SIPA 2JK0A 3BMNB 1IHDA 4PLCA 3I2KA 1DWUA 1XTBA 4LRQA 3QYAA 1CJKC 1H0SA 2ZRNA 3NB0A 4INPA 5CB6A 3MAGA 4Q00A 2V0NA 2W6ID 3IP8A 3LC7O 2YH2A 3AU8A 5ER9A 5FBRB 1NJSA 1WMSA 3D3EA 3ABIA 3U56A 2BEJA 5DLEA 1DJPA 3IT1A 1S3IA 1ZM3A 4UAGA 3RVMA 1BKYA 2R11A 3RVPA 4PG8A 2O8NA 3O7WA 1OILA 2J59A 3NDPA 1AX9A 2QY9A 3P9YA 1DHRA 5ALIA 3MVEA 4YAGA 1YAHA 1NW5A 3O4RA 3QEKA 1U65A 3FIUA 4GPBA 5DGCA 4DMKA 2B99A 4MCAA 4MUJA 1N78A 3IP1A 1JV2B 2FQWA 1E0SA 5ITWA 4C6TB 3G68A 1COWA 2FR1A 1OZHA 3G7UA 3HB9A 4KBGA 2B61A 4JKIA 5D51S 1QP0A 2I91A 1MJGA 4AQYB 1GRQA 3CVJA 5EZYF 3HN7A 2VYQA 5JRJA 1EKXA 3U9TA 4HAWA 3TNFA 3ZDRA 2JGIA 1SRQA 4F3RA 4BUCA 3IUQA 1ZYUA 4MKIA 4K0KB 5CW1A 3E8XA 2P77A 3H11B 3FPKA 3V4RA 1A9RA 5FLXA 1NVMB 1P2DA 1I2BA 1TIKA 4OMUA 4QLAA 5AW6A 1SHZA 2JJQA 2VJKA 2NU7B 5HR5A 4Q1CA 3DYVA 3IT3A 4ENSA 1R4NA 3BXFA 3REQB 1A71A 3HB7A 5FORA 2WICA 2SKDA 2JZCA 1U3VA 2JZNA 1RXUA 4RMNA 1JLHA 4ZT5A 4BV8A 3OE1A 1H2HA 2H1FA 4U3JA 4BYGA 3W5CA 2VUUA 3FNEA 1KYXA 2XWBF 4TV8A 1Y8RA 3KOOA 3PQ8A 1F9EA 3MCTA 1HYEA 4AJJA 1VPDA 1GUBA 4MJLA 1Y3AA 3RJ5A 3DXFA 5BR7A 3AVQA 1L5SA 2WKQA 3H1BA 3RRJA 3WYBA 4CCYB 1TJ4A 2XJ4A 3RYIA 3WFIA 2Z4RA 1DC6A 5H02A 2ZW9A 4B7CA 821PA 5AOBA 1FSZA 1L4KA 2CBZA 3F7TA 3V1YA 3UJ3X 4EY3A 1OFUA 2IHBA 4M0MA 3PWSA 4PX9A 1QZ3A 4B8YA 3ACBA 1P2BA 2PCJA 1ZIPA 3VO1A 1TEHA 3B2EA 3F49S 2V7EA 3A6ZA 5F1OA 4GKBA 3I1YA 1S7CA 4OPMA 2HV8A 1UAYA 4A91A 4N7MA 3TKYA 4WDRA 1I1NA 1RQ2A 5F4BA 1L5FA 1IB0A 4UNIA 5EKSA 1WNFA 2A5LA 1IEVA 1RRMA 3QNWA 2EARA 3CW8X 4YRRA 1PUXA 1H05A 1NG1A 3AJAA 2RGWA 4LY6A 5KC8A 3EC7A 4W9NC 4J2HA 5AT1A 1F2DA 1GLVA 4NYIQ 1NLUA 2JPDA 1EXVA 3FHLA 3FWPA 3LL7A 1N34B 1QRUA 3LLMA 3O0DA 1QIFA 3HO1A 4JLWA 2FSPA 1K7XB 2ZTMA 3TJZA 5HQJA 2EBHX 2H17A 1X87A 4NBVA 3EEOA 1QV7A 1E61A 3DP7A 4L73A 3MAAC 2J0VA 2VPPA 4HUJA 2C7OA 1QVAA 2IDZA 2ZJ4A 4JR0A 1CUJA 1CTQA 3FNFA 3OEYA 4U9UA 2UZ1A 3FMFA 1FW8A 4F92B 1E5TA 2AXEA 5BWOA 3IDZA 2UAGA 3M6WA 5AKJA 1SZCA 2R48A 4TYMA 1JQLB 4TWJA 1KETA 1TPYA 2ZZKA 3EXEB 3GFBA 4URWR 2O8VA 4PVCA 3WB0A 3ZY2A 5LJLA 1G8GA 2B8EA 2J7PA 2YVQA 3Q72A 4HCJA 4CEHB 4U1RA 2XF8A 4OHWA 3TLBA 4YIHA 1RW4A 3CUEF 2OHJA 1CDZA 1XI2A 4WLFA 3HA5A 3K0FA 4B17A 1VHLA 2IODA 1KDYA 1QRRA 4O02B 5KCMA 3VYUB 1X0XA 1LS6A 1YGYA 3C3WA 4AY6A 1IOZA 1TVKB 1XLVA 2E4XA 1HEUA 2JAOA 4IKEA 1GUFA 3U7JA 5I3ZA 3A25A 3FN4A 4R3WA 1NOKA 5J9FA 3MQ2A 4M38A 3RVJA 2GO1A 1IY0A 2WUFA 3GZ4A 4Y2UA 2IIVA 2PMDA 1NA5A 2QENA 1RZUA 3INRA 1KOLA 4D56A 4WLOA 5KOHB 1TAUA 1II9A 1DFHA 2FFRA 1MC1A 4K9RA 1JIUA 4HX5A 1FDIA 3GP3A 3NGLA 3TL2A 4LGYA 3D6VA 1UXKA 3QX8A 1ES9A 1QDUA 3ELWA 5CIQA 1AOXA 2RHRA 2GAFA 3H3XA 1N6LA 2WWXA 5BNFA 3QV1A 4LDJA 1P7YA 2WNHA 5AKKA 4L8FA 1F48A 1NWHA 4J7UA 1PLKA 4OOEA 1UXJA 2P6MA 4X44A 4B33A 1R8XA 3B51X 3E7FA 3B1VA 1LJ8A 2GK6A 3I09A 2RBGA 3HB0A 4Z3OA 1IN8A 1ZMXA 4TROA 4U39A 1RKXA 3RAJA 1D03A 2FMKA 4W9NA 2C5HA 2I9PA 3MTDA 2MSEB 3IQEA 1FA9A 3V7NA 1XSEA 5DGHA 3CNOA 3HWSA 4MO2A 3QWIA 4MS4A 4HDRB 2YASA 2V5UA 3MRVA 2TMKA 3FROA 5ULLA 4CIDA 1KJ9A 3VYTB 5C53B 4B4KA 4KXNA 2WPNA 3DF9A 1XT6A 3JWGA 2RKOA 3UO8B 1N0VC 3PFIA 2VATA 4NQRA 1M2OB 3NT4A 1TCUA 2FPSA 1OJLA 1ZDMA 4W8OA 4AU1A 4GOJA 4PGHA 1RCTE 1REQB 2CV2A 1P2VA 4P34A 4AC9A 4CM8A 1J0DA 1FDSA 5BUZA 1OX4B 4BU0A 1GZ5A 5EZSA 3F7OA 5IM4F 1YR7A 3DE3X 1J0CA 1E9AA 1YSCA 1R0SA 4TYYA 4CEJA 3CJRA 4GF5A 1N5RA 2H4XA 2F9LA 4LE0A 2AZTA 1WMBA 1NWCA 4QRHA 2QE7D 5EUBA 3MOGA 4FINA 1LSJA 1P80A 1XFAA 2DBRA 1ODFA 2HCJB 2TECE 2GZMA 2WHRA 1T9CA 4NPHA 4XFJA 5KJ6A 1Q0LA 1L7DA 2OYCA 4G0ZA 4KE7A 5CNIA 4WN3A 3OQPA 4WNCA 5K3DA 1W88A 2FEOA 5B5SA 3L0BA 4PC1A 1RRGA 2DKNA 2OV3A 1A1SA 4IRMA 3KUUA 3R4VA 3OJEA 1JJFA 2OV4A 3CH6A 4MP6A 5HDBB 4OP2A 3SAJA 3ZQKA 3JD0A 4EF4A 4D45A 1II8B 2FFQA 1HQKA 3WL4A 4MI1A 4TTRA 4M9QA 3WR5A 4FOSA 3M6MD 4XJSA 3AETA 4JBHA 3WZLA 2P7IA 1UKEA 1VP9A 1VCNA 4HPJB 5A03A 2YIJA 4DDWA 2PE5A 3O84A 5CYGA 5HKOA 4DV0B 1Y1PA 1NR5A 2QM8A 4AYTA 4L1KA 3Q2KA 4K86A 4NOLA 1V39A 3ZWXA 1DE0A 1ZUNB 3OZAA 2M1ZA 1RWKA 1SCUB 1PR0A 2BDUA 3PR2B 1NDHA 4XPIA 5CLLA 3FM9A 3G5TA 3B5JA 1SD2A 1TUEA 4X71A 4DE5A 4N0QA 1VLQA 5BYJA 2FMTA 1WJGA 3ZVNA 1KVTA 2NYAA 4LGCA 5D3KA 3K4QA 2VOEA 2QE6A 5EUMA 3GBSA 3R7SA 1GXSA 2OEPA 3WLMA 3FUCA 1YZ3A 1GZVA 2OORC 3SPXA 5TS2A 1I7DA 2QMUA 3CVVA 5DULA 2IYEA 2Q7OE 2FTKE 3LVRE 4M76B 3CYFA 3U37A 5FWDA 2J45A 5DYIA 2PH7A 2O8EB 1AKEA 2POQX 1PS8A 1L5LA 5GY7A 5G4KA 5CMLA 1EFUA 3OZ7A 3ZDBA 1P1BA 1L5HB 3IO3A 4BNTA 5C46F 2N9UA 1OA1A 1UMDB 4MRMA 3KJNA 3GT3A 5B3LA 3NHRA 3AF2A 3CKLA 4MUHA 1EM6A 2BTQA 2CW5A 5CCXA 1BSVA 3WLOA 4LMRA 1S02A 3UJAA 3HVKA 1EGMB 3WYGA 1QDEA 3ZE2B 2NU9A 1ZVKA 3SM3A 4AS3A 1D1QA 3DL0A 5SV2A 2FG6C 1EHCA 2ZE8A 1FS4A 3GOQA 3QEBZ 3VR1A 1Z7WA 3R3VA 4XARA 2IYWA 1NJ5A 2MYPA 1M67A 1JU3A 4RF3A 3IKTA 2WUGA 1J9EA 3PPYA 1ORDA 2HYIC 3L18A 1X9GA 2FSSA 2BCGY 2ODAA 4PR0A 4UHDA 5FTKA 3H2JA 3HO8A 1DXQA 3W2EA 3WNQA 4EHKA 5B30A 5BQFA 3E5MA 3BH0A 1I9GA 2JLQA 4Q05A 5DTJA 1V5FA 3SU8A 1XQWA 1Z37A 1AKUA 2HT6A 5IAEA 1ONBA 2JVJA 4Q1BA 5BUSA 4C0XA 3SBEA 3DE2X 4DLLA 1ADBA 2OAQ1 3NANA 1SVMA 4NTZA 4X1IB 1Y8CA 4EB8A 4RTPA 1KIFA 4FX5A 1CERA 2LV8A 3EMDA 3PHLA 3HYCA 2V6JA 4PC2A 3PFCA 2YOFA 5AKEA 2OA0A 1YE3A 1T3TA 3MERA 3N2GB 3NCTA 1UP4A 2QRUA 5DLYA 4QIHA 3S2UA 2F55A 1O6ZA 2GKSA 1CZLA 9LDTA 3X1XA 2HNAA 2V0CA 5G3YA 4EL5A 2PR2A 3FYTA 2Q29A 1OTHA 4AZ3B 2I65A 1ZG3A 2F8MA 3I05A 4UNQA 4P98A 5E7JA 3L7LA 4HAXA 3TM5A 3EA5A 1JI3A 1OBOA 5FOWA 1SD5A 3S2EA 2WSSD 2BMJA 2GFIA 1XZCA 2NUPB 2GFHA 2PGLA 3DB2A 4WV3A 2FETA 3KKPA 4UOZA 2AXQA 4ZI3A 4YJHB 2GEDA 1ETHA 3ST7A 1C9YA 4DBLC 2OORA 5F78A 3DHEA 1RIIA 4NZYA 3SXUB 1UEIA 2BZGA 4G97A 2H4JA 5FBVB 3CZPA 3EHDA 2NSYA 3JW8A 4EZIA 3LX5A 4U6SA 7YASA 4MLZA 4CT5A 3HU5A 5B7QA 4OQXA 2FDRA 3OO0A 2HXSA 5BPFA 3S2IA 1XMOB 3DC7A 2R86A 1XN1A 2Q6IA 3CLKA 1BX1A 1F14A 1IATA 1OAOC 1XZMA 1Z2NX 3R6LA 1FU7A 2LCIA 1E62A 3SQOA 4DLKA 6ABPA 1MIOA 2WHPB 4WRRA 2W6QA 2ZUWA 2W5UA 4EHIA 5L8VA 2WWIA 1HYHA 2DTEA 3ICOA 1XGKA 2WPDD 3BJZA 3DBLB 3QTBA 5BOSA 3DLBA 4GMHA 2WE8A 5CTJA 5BSUA 4MWOA 1G2PA 5CLGA 2XVZA 4CKWB 4HDMA 4KR0A 4ND1A 5IT5A 2Q46A 2OQIA 2NX2A 4R98A 4ZEOA 1PQUA 1A9SA 2ZI4A 4UAJA 2PYZA 1RNLA 5HUHA 3MC1A 1MO4A 4JXJA 5BV1A 2HA5A 4QD3A 1UZUA 2PYDA 3LX6A 3WGHA 1TYBE 2OD2A 3DG9A 2CHFA 3G2IA 1D04A 3IKLA 3NHPA 4BATA 5M29A 1ECFA 3GFPA 5JCPA 2B98A 2D62A 1P6UA 4AJOA 2OCYC 2BYTA 1A77A 3F1LA 3KPVA 4ZT6A 3RUIA 2UYOA 1RJWA 4K88A 3WJAA 1PRYA 4C7VA 2H5EA 3RROA 5A02A 5D6OA 3QTTA 1W30A 5TE9A 5LMCA 2BTEA 2R2GA 1FFAA 3CCBA 3KT8A 3R7FA 3OFKA 5LDDC 2PU7A 3QVKA 1SG6A 1EM8B 2BGKA 2RIRA 1NVUQ 2HU5A 2B20A 2X4LA 3GJ6A 3K35A 4NR0A 3WZ2A 4R3UC 5SZKB 1R4MB 1F0KA 2F1RA 3UZUA 2V7BA 3I0ZA 3FIJA 1E3SA 4FQ7A 2PRJA 2AA3A 3D7KA 3DEAA 4JUFA 4C22A 1CYEA 4TQ9A 3A6FA 2GN1A 2XTAA 4LY9A 3RREA 1TF2A 1CEEA 1DBRA 3SSOA 3WHKA 3M34A 3LA6A 5EQJB 1Y3IA 5LQSA 1KO5A 3NCHA 3QUSA 1WB6A 1YJ8A 3UMRA 4BNVA 4EFNA 4EJSB 5H3LA 2GLUA 3AW8A 3JTEA 4WASA 1F5NA 3DAHA 3FYUB 2GXAA 1N5JA 2JFBA 3EDCA 2G3YA 3OTOB 4YN3A 4HN4B 4NULA 1M0EA 4K3UA 4RIEA 2PFGA 1KQFA 3NX4A 4R9SA 5IVIA 4DJTA 4HZUB 1CDDA 1SKBA 4NZZA 3LCCA 1A2QA 4PYNA 5HIIA 2EDAA 1Q15A 4OI1A 2IS2A 1OAOA 1PD0A 1E6WA 4QTYA 1KJNA 3A6HA 1A98A 1L4YA 2AK3A 1HDRA 1G63A 1QRAA 3DFUA 2QLNA 5EJ8A 4MYDA 4I4LA 2CJYA 1RBZA 4B45A 3PPVA 2IH4A 1RHKA 4I1YA 2CLDX 2DETA 2Q5FA 1UT5A 4MV7A 1Z16A 3DEIA 3EIUA 4GM0A 5E8JA 2YY7A 2E85A 2C2HA 1X7ZA 2NZJA 4Q1FA 5C7YA 1YIOA 2G9NA 1J1ZA 3QKTA 1U7TA 4J0EA 4Q15A 4Y1RB 4KNYA 3E53A 4P4SB 3AHGA 3QBEA 4OYRA 4B7ZA 3R3ZA 1ZD5A 4NOKA 3CXUA 1CVIA 4DPMA 2PJRA 1Q1QA 2E21A 2HV9A 1P1RA 2VUTA 4DDUA 2ZM6B 3KJXA 4KXMA 4G8JA 2D0DA 2FFHA 2N0SA 1XL1A 5FA6A 3ZZNA 3C15C 5CR9A 1LU9A 3PV0A 4LI3X 3JQEA 3EPJA 3L3BA 1WCWA 5IM4A 5AXBA 3IFSA 2F9FA 3CX7A 2R4QA 2NXNA 5ERXA 2GKOA 4A8JB 4CBVA 1JYSA 1GTG1 2PUBA 3VDNB 3BGVA 2P41A 3NYIA 2VTEA 3NASA 2GI4A 2H59A 3AZPA 3DPIA 1M34B 2O23A 3I8OA 2B2NA 2OM6A 4XVQA 2MSNA 3EGEA 1FP4A 4TKVA 2GCEA 2D2EA 1R8YA 4JJ7A 1SVNA 9ABPA 1A8UA 1W4RA 4QDUA 3ZLTA 4ALIA 3KQHA 2Y1KA 4TUYF 4AG6A 4DLYA 1IBMB 2JFVA 2R7MA 5G1PA 4YVFA 4N5HX 3ZTTA 1K3UB 4X1KA 2AE2A 4D4MA 4DIEA 5A3RA 3H75A 1H2WA 5AKIA 3PBKA 3B1FA 1CK4A 3EYAA 4L28A 3COZA 4Y8VA 2AL7A 3KLBA 1QH1A 1RI5A 1BNCA 2DY0A 3CH5A 3GNLA 2BM9A 3M81A 3N8GA 4Q16A 5HM8A 1VSQA 1N8SA 1Q0RA 2OG2A 2WNIA 3HGTA 3K9CA 4N3CA 4JLSA 3REGA 5C8ZA 5LKAA 1MKYA 4TMTA 3H16A 4ZOAA 5AW1A 3PTZA 3TVTA 1WXDA 1GUAA 2EBUA 2FZ5A 3QLJA 5JAIA 4DV2B 2D5BA 2FHSA 1MPTA 3FVTA 4OFXA 5CXUA 4GGPA 4XTRA 5TGDA 4LBWA 3ZK9A 3FUUA 3S2ZA 3PRYA 2AJLI 1O94C 3DVQX 1M1ZA 3EEFA 4UUNA 3H1PA 3AUTA 1QYDA 1MIHA 4H1UA 4EI9A 3GZNB 4XB2A 2DERA 4H7KA 4F3NA 3D64A 1CZHA 4DQDA 4RZQA 4G0OA 3H18A 2HK6A 2X6TA 3ICCA 1Z8NA 1Q3HA 4OMDA 3NHSA 5I6DA 3FNQA 5G53C 1YU9A 3KPJA 4HNHA 4AMYA 3K1ZA 4X1YB 4COKA 4FGLA 3C3KA 4X20B 5HBGA 4Z4FA 4ZZ3A 1WETA 4KWEA 1Z2DA 1IZZA 4JLJA 1F8UA 1SQ6A 1HL7A 2PHZA 3HDJA 1OFIA 1XVTA 1ZK1A 2GO7A 2GESA 4NENA 4R81A 3V4VB 1PK7A 1VKZA 2JC3A 3K1TA 3HDHA 4Y9RA 5FOSA 5ECGC 2PY6A 4FOPA 2TSYB 3HHEA 2PSHA 1DTWB 3WYAA 4PNHA 1SN7A 3TJRA 1BJTA 3OICA 4N1AA 4ZDKA 1EZ1A 3M8KA 2D1YA 4D0LB 3C5WP 2GN4A 3IOCA 4OJQA 2PX2A 3T3OA 1DRWA 2X76A 1ZGAA 4FXOA 2X8BA 1OX5A 1UKCA 3CMCO 4IL5A 3NHMA 1M75A 4L02A 4UPVA 2XXAB 2X3YA 4EVSA 4LBZA 5KJ1A 4H1VA 3DZJA 4WN9B 5HF6A 2F1KA 3NUZA 1C29B 1V16B 3IMEA 4F11A 2QTLA 5EIHA 3SS9X 2BRUC 2Q7XA 3C87A 3E9EA 3DDNA 2IIBA 2IZ6A 1GG2A 3DCJA 4KQMA 4ISBA 2XKAA 2QZPA 3EWIA 4FYVA 2EZTA 3DLPX 1YUMA 3F6CA 1VJRA 3Q88A 1XDDA 4HUQB 1UBLS 2QW8A 2ODPA 3LNCA 1MZVA 4J0FA 2OCAA 5E7MA 1MQ8B 3FWNA 2F3TA 4P1ZA 1YIDA 2XMSA 7ABPA 2J3LA 4LOKA 1D6JA 1D9XA 2J3IA 3WLHA 2YJGA 5I7EA 2ZYGA 2XB6A 1VLZA 1YRHA 3JALB 4R2LA 2HRRA 1ABEA 3FRJA 3K32A 3QUBA 1O94A 3TQQA 4YCLA 1NBOA 1YI0A 1CF2O 2Q0QA 2XOXA 4L8WB 4L9AA 4WA7A 1NAIA 1U81A 4V02A 2GTPA 4UBIA 4FNAA 4WCFB 2PS0A 1AF4A 1UUFA 3IR5A 1TYEB 4JKOA 4N82A 5T5QA 1P0CA 1O7JA 2NTVA 2VPWA 2WG1A 3FDZA 1XEWX 2FA9A 3CNBA 3I4CA 3NETA 2E82A 1MABB 2O0JA 5C2JB 2OZEA 1PR5A 1JALA 1E7MA 4HTAA 1GNPA 1G8SA 2KQUA 1JF8A 1I4EB 1VPTA 2GR9A 3BMCA 1GKUB 3O92A 5KTSA 4ZC1A 4B3GA 1CEYA 1U3GA 4J94A 5FO1A 2Y9PB 4ER6A 3Q7QA 3KR0A 4OGWA 4BX0A 4E0BA 1TTTA 1UFVA 1J8MF 3VNSA 1UM9A 3ZWPA 4YPFA 5DHFA 4Q9JA 4DMMA 2ZJ2A 4ZCMA 1CT9A 3UPTA 1VGQA 5A4MS 4JP1A 5A62A 3IP6A 1E5XA 2ZIXA 2FEMA 2XGOA 3GOHA 2WOJA 4HWTA 4RWEA 2WOOA 4Q9LA 3Q3HA 2C9CA 3AH8A 4QQ8A 5JYDA 5GP1A 1Q6YA 4TMKA 4AN4A 1E7WA 1KYYA 1VRCA 5HEKA 3OPXA 2P1DA 1WZEA 4BNWA 1F4VA 1X2EA 1NMYA 1TJYA 1TU3A 4Q3KA 1PGNA 4AZ0A 1DP4A 3U7QA 2HO5A 1HYBA 2Y9MB 4CG2A 4MQFB 2DXIA 1P7PA 1DIAA