1QVZA

Crystal structure of the s. cerevisiae ydr533c protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
236
structure length
235
Chain Sequence
APKKVLLALTSYNDVFYSDGMKTGVFVVEALHPFNTFRKEGFEVDFVSETGKFGWDEHSLAKDFLNGQDETDFKNKDSDFNKTLAKIKTPKEVNADDYQIFMASAGHGTLFDYPKAKDLQDIASEIYANGGVVAAVHGPAMFDGLTDKKTGRPLIEGKSITGFTDVGETIMGVDSILKAKNLATVEDVAKKYGAKYLAPVGPWDDYSITDGRLVTGVNPASAHSTAVRSIDALKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YDR533c S. cerevisiae protein, a class II member of the Hsp31 family
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
molecule keywords YDR533c protein
total genus 81
structure length 235
sequence length 236
chains with identical sequence B
ec nomenclature ec 4.2.1.130: D-lactate dehydratase.
pdb deposition date 2003-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qvzA00
2NV0A 3PQ6A 2ZUTA 3B38A 4BIMA 1GGJA 3EZGA 3CZ9A 2YWJA 4D1YA 2RK6A 4UOQA 1SOAA 1GGFA 3NORA 4Y1EA 1S1MA 3GRAA 3CZAA 2ABWA 2R1UA 3NONA 1IPHA 4L78A 2GK3A 1BXRB 2YWCA 4JQSA 4P34A 4PXYA 5SYAA 2VDJA 3L18A 2H2WA 3WFZA 5JZOA 2VRNA 2WJZB 3CYFA 4GE3A 4Y1RB 1M6VB 4S0ZA 1P7YA 3TTWA 3PQ8A 1VCNA 2FEXA 3B36A 3ER6A 2R1TA 3PQ2A 3TTVA 2YWDA 4QYXA 1QVVA 4OJYA 3P9SA 4MNTA 4BFLA 4UOZA 1P7ZA 3F5DA 4Y1RA 3NOVA 1SY7A 3UK7A 4ADSG 1I7SB 2R1VA 4AJ9A 3ZJ4A 3OT1A 3TTXA 1GGEA 4ZGGA 3TTSA 1GPMA 1Q2UA 4LGYA 4QYTA 2R1VB 4AUNA 3P9RA 3PQ4A 1FYEA 3CY6A 1GGKA 4ZDIA 3D54D 1GGHA 2ZUWA 3F71A 4LRUA 4RKYA 5K4AA 3R76A 1OX5A 4MGHA 3TTUA 4ZDJA 1KWGA 3NOQA 3L3BA 1UCFA 4GE0A 4P2GA 4OFWA 1CS0B 1CE8B 1PE0A 2R1TB 1GPWB 1OI4A 1JVNA 2W7TA 4I2NA 2VXOA 3ZJ5A 4E5VA 4WINA 2GHRA 3PQ5A 3P9PA 5DFAA 1PDVA 4ENQA 3UMMA 1Q7RA 2D7JA 1O1YA 3TTTA 3UOWA 4I46A 1FY2A 3BHNA 4L8YA 3NOOA 5IP5A 3FSEA 1K9VF 1KEEB 2RK4A 2VKTA 3M3PA 4ENUA 4OIFA 1JDBC 3OT1B 1QWSA 3L4EA 1N57A 3B3AA 5BV2P 5SY6A 3MIIA 4OQ4A 1A9XB 4Y1GA 3L7NA 3UJNA 2RK3A 3BWEA 4B7AA 5SY9A 3SOZA 1OX4A 2LXNA 4L8WB 4OGFA 4P36A 3ZR4B 2AD5A 1R9GA 4ENTA 4P35A 1CF9A 1I1QB 1OX4B 1P5FA 1U9CA 1C3OB 1C30B 4ENWA 1QVWA 2ZUVA 4ENVA 4ENRA 1T36B 2A9VA 1QVZA 2ZUUA 3R75A 3VU3A 2XF2A 1KA9H 3EJ6A 1PDWA 3KKLA 4L7QA 4AUMA 4Y0NA 3RHTA 1QDLB 4AUEA 4ENSA 1PV2A 4UNIA 5LIRA 4WXYB 4HCJA 1ONSA 1OX6A 1T3TA 4L8FA 4I4NA 4P5PA 4UCFA 3TTYA 4B31A 4R7GA 3EFEA 5E9AA 1VCOA 1KXJA 5SY4A 2YWBA 4N0MA 1IZZA 4Y1FA 4E08A 3EN0A 3PQ7A 2OR3A 4OGGA 2AB0A 3CNEA 4N12A 3TQIA 4GUDA 2NV2B 4MTCA 3SF8A 4B2YA 4B5KA 3NVAA 2IUFA 1WL8A 3MGKA 3P9QA 4L95C 3FIJA 4UZSA 1I7QB 1IZYA 1VCMA 4AULA 2VPIA 5JZMA 2ISSD 4K2HA 4ENPA 1P80A 4B40A 4ZDKA 3SF8B 3EWNA 3R74A 1G2IA 1P81A 1J42A 3N7TA 1L9XA 1OY1A 1QF7A 1GG9A 1VHQA 2V4UA 3PQ3A 1T0BA 4BTEA 1KWKA 4RKWA 3UGJA 4XLLA 2ZUSA
chains in the Genus database with same CATH superfamily
2P8JA 1D0VA 4ZCRA 2XVYA 4BAZA 3H7AA 2J9YB 3HH8A 4WLUA 3KKMA 3TGPA 3QE0A 1U99A 2JEZA 3K1ZA 2PUGA 1XSEA 4AF6A 1JEQA 4WK0B 5IXSA 4CCYB 2FPLA 1D6NA 1P44A 3G5LA 2IV7A 2GK3A 2NZ8A 5H70A 5FULA 5BW4A 2BF7A 1A71A 3MJEA 4WK2B 1RKBA 3MD9A 3L7CA 1KH3A 1HL7A 2XUFA 1PYOA 4CMCA 5JNSA 2CHEA 2RHWA 1D2NA 3EISA 1WZNA 1LPAB 1OWNA 2R7NA 1REQA 3RIMA 3UAVA 2GZHA 5C1OA 5FEUA 1CUBA 1Z4MA 1R6BX 3PF8A 4QO8A 3VZPA 3G59A 5LU9A 1W85B 1V96A 4XM2A 1GGEA 1H8EA 1Z6PA 3ESAA 3H17A 4KKVA 3BZBA 4NU5A 1X19A 1MOSA 2CB0A 3M6AA 1Z4LA 1GCAA 5DHQA 2JFQA 5FWXA 1KDYA 4LE2A 4QGBA 5KSWB 1PW5A 4KLRA 4EFMA 5F4ZA 4P3KA 4MINA 5BQFA 3CZPA 3CEJA 3T5AA 5IVKA 1GSAA 1WPXA 2FJPA 2ZE8A 1JPJA 3OZGA 4LGMA 4MEAA 4MROA 5EE0A 4BO7A 3TW8A 1FBNA 1JQDA 2ZBPA 3DWEX 3LQKA 5UKDA 1YF3A 3EOAI 5JQWA 2AG6A 1PRYA 3CR7A 4JYPA 4MUNA 2BIFA 3BMQA 3FH0A 4OKNA 4CG0A 2WKPA 1Y4AE 5K0CA 3O4HA 4L2IA 3UOWA 4I46A 4WN3A 1M2VA 5DSTA 3MWDB 4G4GA 1VPVA 4TS9A 4ZAGA 4A0SA 5JMOA 3OZSA 3CW8X 4UFNA 1OU0A 1WIWA 2XRYA 3I6IA 3DOEA 2B5VA 4B0PA 4FXPA 5BUZA 3ZQJA 1DWOA 1LNQA 2JD0A 3OLYA 1PTJC 4DDHA 2NU7B 5REQA 5KTPA 4DIBA 4GM1A 4OGFA 1VL5A 5EKSA 2XOKA 4YLYA 3CCFA 3DMPA 5K4HA 1AXEA 5CAEA 4L08A 2MINB 4O4LA 2YFQA 3B5JA 5DYIA 4NBNA 3VKUA 3HCPA 3HL4A 3AILA 3DTVA 3WNDA 1BS2A 4OB8A 3I9MA 1XEXB 4EBBA 2D74A 2V03A 4HP8A 4F9FA 5HYVA 2E5FA 1N6RA 4M0CA 4P53A 1TU0A 4RS4A 4Y2YA 1DXYA 1WCV1 2FQYA 1UJ5A 4HH4A 3PG5A 5JAPA 2OV3A 4UUQA 2H4HA 4IP0A 3EQ7A 3O4RA 4A9AA 1TVEA 3H87A 4R2IA 1E60A 3TLZA 4E15A 3T9AA 4NTZA 2DOKA 1U90A 3RV4A 1EEXB 1RWXA 1N8NA 4UVEA 3CNHA 2BKVA 1SUDA 3DV9A 3VO9A 4BKPA 2Z1MA 1NWHA 4CI0B 5KO2A 1ECLA 2DQ4A 4I3HA 3HSSA 1QG0A 2Q8PA 5TPZA 2QM8A 4DV0B 2AX3A 2QUJA 1CUGA 3SC3A 4X3CA 3A06A 3ISJA 2QTGA 1UJ2A 1Z34A 2PUJA 5ALJA 4C1BA 2XUJA 1RYFA 2QJTA 1XWIA 1YVRA 2GHQA 3RVRA 1TA4A 2ZKIA 1JIJA 1THMA 3GJZA 1OILA 3I09A 4IILA 3VR2A 2OM2A 4JLDA 3L4KA 4CG1A 4P4NA 2PZBA 4UDOA 3BHIA 3B7GA 3N2LA 3GD7A 1SXJD 1CP3A 1EGHA 3I30X 5ELMA 1XRMA 3AF6A 2VZLA 2YWCA 3EQ9A 5BN1A 1W29A 3LBHA 5BN5A 1CUAA 4Y3UA 1AQJA 1FSPA 1GNSA 3U48A 2NW6A 4Q0MA 1UBRS 1BXGA 1P33A 4UEJA 1PD1A 3A05A 3ONNA 1JEDA 1RHMA 3PFCA 4XQ9A 3OPNA 4P4LA 4EIWA 5LVAA 3F5MA 3D1JA 2VF2A 4B85A 4G0ZA 5I9SA 2XODA 4CIYA 4BFYA 3RUPA 1RE1A 3L8YA 2XBUA 1Q7CA 2NTNA 2VHEA 2TRSB 3QEJA 4LGYA 4Y6LA 1SXIA 2FPMA 2VSNA 3P9RA 1N33B 3HCOA 3AVUA 1S5PA 2XCOA 3GJ8A 2BFWA 4HAVA 1KWGA 4JI3B 1H5QA 1RIIA 4CVNA 1KERA 1JQLB 4M1KA 5B4VA 5FPHA 4P9NA 2I9PA 1W0JA 3JWEA 4A8TA 2W8BA 5EIEA 3KL2A 2JAUA 1L5VA 1YB7A 3OLXA 4HBZA 1L5OA 2B4KA 3ELUA 4DA0A 2HSZA 2PUWA 3P0IA 4INOA 4JLBA 4AK9A 5C4MA 3H5RA 1TAUA 1F4LA 4U2EA 4AY3A 5CCBA 5HP4A 2BUCA 2G6TA 5ALFA 3SE7A 1F9EA 1Z0AA 2PV0A 1RRCA 3BKXA 3LRTA 5U1PA 3DBIA 3QG1A 1OBOA 5AH0A 3TW4A 2RBEA 4AD8A 3K0HA 2IE8A 1OWOA 4NEQA 1F17A 4YACA 2J9GA 3PX3A 3S27A 2ATCA 1PNRA 1S0UA 3G0DA 1AZWA 4X64B 1DHRA 1GUBA 1YE3A 1SC6A 1GLVA 1KO4A 1PTKA 4UHDA 4WXHA 2J31A 3CE6A 4JL6A 5ALXA 3VAAA 4R0MA 3MWKA 4DL9A 4E4TA 4J1TC 1FFYA 1LSSA 2FV8A 3K96A 1TYEB 1PZGA 1SKQA 3GA7A 1ZN2A 2HMUA 4DDUA 1L1FA 2XHEA 1JWBB 3IE1A 2VQDA 1CY0A 2FWAA 2NU9A 1R0CA 3KSAC 3EYAA 2AT1A 4WXYB 5CCEA 1NF9A 2C97A 5I7AA 1K6JA 1OAOC 3NR2A 3EPJA 1GR1A 1EHCA 3AOEA 4DJDC 4WZ6A 1EHIA 3O3OB 3UJ8A 1QF6A 4URWR 1USGA 1EYZA 1Z4KA 1IDN1 1NYRA 1UWKA 4NCNA 2O7NA 5BQXA 4NYMQ 2ODEA 4J75A 2B2NA 2D4HA 4GUDA 4L51A 4PZUA 5FWYB 2OFFA 3TE7A 4LHYA 4B5KA 4RHXA 4R1UA 1ZK0A 4HGRA 2I4IA 4WOCA 3SMQA 4AS3A 4D3SA 1BX0A 3MLEA 3VVCA 3R24A 3WZ2A 2BBSA 2OT3B 2HSWA 1DGQA 2W2LD 3EQ8A 5ESXA 4IDHA 4DMFA 2IF2A 1MHPA 2G70A 1KTVA 2RG1A 3HBAA 4G65A 1OC2A 5KX5A 2AI2A 2QYSA 4IQFA 1UXHA 2Q99A 3THYB 3JX9A 3P2EA 1E3IA 4B2LA 5H8WA 4XB2A 2HX1A 5DYYA 4AZTA 1AXGA 4L7VA 2UXBB 3FFTA 3IDQA 3N0VA 3B9QA 4EGQA 4GMGA 3NEJA 2X8JA 5CFLA 3U81A 3BIXA 4XDHA 4FYIA 4XJSA 1E2BA 1R4NA 4JI7B 3A3PA 2R6GA 2WSYB 1BXRB 2RHRA 2DMRA 3NBXX 3WFZA 4H59A 4KDRA 1C9YA 2AFHE 1KEWA 1XQ9A 2W83A 2X40A 4MS3B 4YJFA 1WCIA 4YMGA 5JS7A 4ZO9A 5DPMA 3NT2A 4F2HA 2QKYA 4GPZA 4JUFA 2BTQB 1C9JA 1I2MA 2P5YA 3PC4A 1NVFA 1RLJA 1M1YA 1PWHA 1VPTA 2FFBA 3EMBA 4FDTA 3H7IA 5AHRA 1JSZA 2BRUA 2WNSA 4LYJA 4E2YA 2I6FA 2O2XA 3LLUA 2CY0A 2M6RA 4ADSG 4YY3B 1NF2A 4KGDA 2ZATA 4ZD6A 5AOCA 3ZHUA 2XB8A 3MAJA 4WESB 1EP1B 4HUQB 3NLLA 4I9FA 4WADA 3DHEA 3OOJA 5DTJA 3DOOA 3BT7A 2G72A 2ZUCA 3JYLA 3U1TA 3VKWA 5AD1A 2OHOA 2WILA 2FWBA 5IRCD 3GGJA 4IHAA 1J2YA 1ML3A 4XZ3A 2VNKA 1XDZA 7AT1A 1H05A 2VF5X 1LS6A 3T5MA 2I91A 2BJHA 2WC1A 4A6PA 2PWAA 1NULA 1KJNA 1W1UA 2Z95A 4Q19A 4Y9RA 1BXZA 1LTQA 3BB4A 4R3WA 3TB6A 2WIJA 5KPJA 1A8IA 1IN1A 3IOCA 1W4LA 1NE7A 1P18A 2VYCA 1CEEA 2GTIA 4WEQA 3O3NB 5DWVA 3OEWA 3TI9A 1PR0A 2OL4A 4Q4AA 2VP3A 2P2NA 5IYZF 2OXTA 6AT1A 2QMYA 5EGNA 1UOPA 1GU1A 4NE7A 4LZNA 4Q7MB 3OQHA 4UHBA 1JVBA 2ZVPX 4E3ZA 3F0TA 1XEWY 5GIOE 3ACCA 1RKXA 2PSFA 4UNRA 3VZCA 5J58A 1DUVG 1XA0A 3FN4A 2NVUB 1AB6A 1CIVA 2BDEA 1KP3A 2QRZA 1XTKA 2AGVA 5EP4A 2NOAA 4ZVKA 2GVZC 3UG7A 5E3JA 4LDQA 4X20A 1UMCA 2Q41A 2QX9A 2ZJBA 3GAMA 1Z5NA 2PMDA 4GL2A 2OEPA 1V0JA 1QS0A 5DT2A 4B4VA 3LUPA 2PWZA 3K9QO 3IEXA 2JI4A 1KMHB 3OMLA 1CZLA 4JV5B 1UPFA 3F5FA 1DC4A 3H04A 3NIFB 2QT1A 4U2GA 3B6EA 2H65A 3M70A 3OFSA 2ZSHA 1B6SA 1Q44A 1UBMS 2PUVA 3FPAA 1J2EA 5DWQA 3ZHRA 1YQQA 4IDPA 1UF9A 4HR7A 3FUTA 3NGLA 2VTKA 1IBCA 1R6DA 3CLKA 1T3SA 2AHOA 2EP5A 5DE3A 2FQ1A 3QYAA 4I4TF 1OFGA 1QX3A 4NMMA 2PLFA 1PGOA 5AI4A 1UFOA 1HYEA 3N86A 3WL7A 1H9BA 2Q5CA 2GZ1A 4R84A 3GCGA 3EIOA 1NYLA 3QEAZ 4J0JA 2JJQA 1XDUA 2BOVA 2FMFA 2WHPA 3FVTA 3I58A 3L5KA 4FFDA 1UBEA 4HX9A 4RJKA 4HS9A 1XKTA 1NATA 2IPXA 5F3DA 3WY9A 5LQDA 1OGJA 2WP0A 1JI0A 1ZHFA 1FLDA 5JNLA 1NXOA 4OP2A 4BMOB 3M2PA 2YNMA 3N7TA 3T54A 4RLQA 1E77A 3HYLA 5TMDA 4C0JA 3IJRA 2I1QA 1O3YA 3VSAA 4EPYA 5BURA 3FYSA 2CDRA 4M53A 4U6SA 1EK6A 3LRXA 4EY7A 2FXVA 3ANTA 1WB4A 3OUZA 3WWCA 2GB4A 4D82A 2UU9B 1T1RA 2Y6UA 2IRWA 3R5KA 3CF4G 4G3XA 1PN3A 5ALLA 3WYEA 1ZNZA 4LYAA 1W4AA 2GPAA 2PXXA 4GW3A 4O3MA 4IDBA 4ND3A 2C03A 1XE3A 3N70A 3OT5A 1JHZA 3H2BA 3WGTA 5BR7A 4O4HB 2FMTA 2AI1A 1Q15A 3LVQE 5A05A 1OGYA 3MMZA 5FUBA 3ZDZB 5BMVA 4QM7A 3P8ZA 1B00A 3LUKA 1FIUA 2CXUA 3R7LA 4AWAA 3AY7A 3U44B 2OCIA 4JI5B 1DTWA 2WJIA 4JLKA 2QI9C 3ZLVA 4WD3A 3C3DA 2EQ5A 1I3OA 1MTZA 4UUMA 4YDHB 2AN1A 4R5HA 2NUAB 3EVAA 3SYRA 3PSAA 3WL6A 2F3SA 1DCKA 1X80A 1SBZA 1UH5A 4PHFA 1TAGA 4WLOA 3MWYW 3F74A 3NALA 5DM0A 5JHHB 4UDYX 3BX1A 1NURA 1QS0B 1Q1ZA 3INNA 3E35A 3FFXA 2N42A 3DOFA 2QPOA 1K92A 1XZDA 2HAEA 2SKDA 3LPNA 3ZX5A 4DCCA 1YAJA 5HF9A 1N9ZA 1KVSA 1AKYA 5FOVA 5KCZA 2PX3A 3KDSE 1DAFA 1MOQA 2XOEA 3TBKA 4RM2A 2D1FA 5C8YB 2CB9A 5G0UA 1K0FA 2FRXA 3EX7C 1BEEA 1KFJB 4HWPA 1JJAA 4C7MA 1T2UA 3N9IA 5FTKA 4B6EA 3GA5A 3HXTA 3CRMA 1RM4A 1JR3A 2WV7A 4FINA 4X8HA 1QF9A 3U13A 4WXRA 3V9PA 1YB4A 1Y63A 4XPZA 2BHSA 2XZLA 4IMRA 5IP5A 4F6CA 4FILA 3KDAA 5TF0A 1G7SA 1RIFA 1Q57A 2XF8A 3EIQA 4P58A 4XWYA 4YH1A 1W5BA 4MVWA 5EEHA 1XZEA 4FCCA 1OFUA 1QLHA 3KQNA 5JROA 1UANA 3L7JA 2D2IA 1G8HA 3PEUA 4N65A 5I3ZA 5HNKA 5GJVC 4DLYA 2D00A 4TT8A 2QVZX 3K9WA 4E2FA 5AWFC 3NFRA 3TVYA 1OX4B 4J4HA 4NOJA 1BRMA 4ER6A 1L4FA 1H3NA 1UXOA 1E9FA 3KO8A 4YUAA 1XTUA 3LPDA 3GLIA 5BSTA 2WQ7A 3FDZB 3F8SA 1XAGA 5KVCA 5A1TA 1GZVA 3ZZ1A 3M1AA 4MWBA 2JATA 4XGRA 2R68A 4HNQA 5D87A 2LBPA 3ZBQA 1CEYA 4WCDA 5L40A 1GGMA 3G1WA 1Q74A 2V6IA 3VSEA 4C0QC 3B6MA 3B9BA 4G8CA 4RZ3A 3I9V6 1FLNA 4J07A 2OV6A 2JGFA 3O75A 2VP6A 2IXFA 1RRPA 1FXSA 4HGZA 2AMYA 4IRUB 3W4JA 2EBHX 3OHSX 4E30A 1YJ8A 2FLVA 2HRBA 4ZI7A 5BXQC 5C1DA 2ZBQA 2XRZA 5BW6B 2HXSA 5B3LA 5FXMA 1UINA 2IVFA 1XK6A 4IIVA 3V8EA 4DXHA 2B2XA 2CSUA 3HBNA 2QVBA 1C1DA 3TQTA 4XDGA 5IUKC 2BKEA 2VAPA 4HZUB 5KSYA 2QQEA 4ZP1A 4JJEA 1E98A 3PNMA 4DIMA 1II8B 1RRVA 3AU8A 4E14A 3C43A 1KI2A 2V6FA 2ZI3A 3KSZO 4RUKA 2FTKE 3D8TA 3EHDA 1K75A 4ND2A 2GPYA 3M3HA 4I1SA 1QB8A 1U8TA 4NK5A 2ONZA 3N8KA 4A6EA 2NNLD 3EVBA 5AXBA 1VPEA 1WMSA 1NVAA 5LQAA 2AR7A 4C2AA 4TYMA 3NYIA 5KNCH 3KR1A 2Y0EA 1NVMB 1NVBA 5KNLA 1WDTA 1J8DA 2ZCUA 1F1JA 2CMHA 3O83A 3O5AA 4G24A 4IV5A 1D4ZA 1EGAA 1KGSA 4LBYA 3TL3A 4YT2A 1P7ZA 4QPJC 4O29A 4OBXA 5TT0A 4YV0A 3FDIA 1U2DA 1YZYA 2OCPA 2QD5A 3I9OA 3AUTA 2JHAA 2B69A 4IS3A 1UQTA 5GMOA 1CR0A 4CLOA 1U9JA 3UBTA 4HDRB 4C6SA 3ORRA 3TZQA 2Q2QA 4ZI2A 4P0TA 2C42A 4B87A 4BLOA 5LBUA 4OH7A 3SDSA 4EB6A 1P60A 3FNBA 1W5AA 4OKSA 1EUYA 3LUFA 2O50A 3IKLA 2LW7A 4YFVA 1P0QA 3EAQA 1V8BA 4GF5A 1IEVA 1VG1A 3QH4A 1IQRA 4L16A 5HK9A 4MV8A 1JTEA 4N3AA 1YUNA 3HLTA 4H15A 1FYFA 3E9DA 2VOEA 3ONVA 5B3JC 3EF3A 4KJZA 4NU0A 3EC7A 1LB1B 3FR7A 2HOQA 1OZAA 2R6R1 1KQOA 1F60A 3ICOA 4PR0A 1UQRA 1J4AA 2BZGA 3AUAA 5E2AA 2JLVA 3U7IA 3EMDA 5ERYA 1KQNA 2P6OA 1ACJA 1A8QA 3DS8A 4IEFB 3KXKA 4KPUB 3ZBPA 2WWGA 3T9EA 3TVTA 4EVRA 3AR7A 2PT9A 1DIOB 2WFLA 3QLTA 1CUHA 4MUMA 4R4JA 3OIFA 5FI5A 4RX1A 4F04A 3O8QB 2IPLA 3MAGA 1PZFA 3FYUC 5EJIA 5EG5A 5H0IA 4DCUA 4EA9A 1ULSA 4ID3A 2WM3A 2A1TR 3DBHB 5EIOA 5HILA 3WYNA 4J16C 2HK7A 3HY4A 3A9UA 1T0JB 2IXGA 3LW8A 2FZEA 3TPZA 2QL5A 4BRUA 4BP9A 3MERA 4AZ0A 2YV5A 3F9CA 3MIZA 3GVCA 1DP4A 3R41A 4UW9A 3VPDA 5C9ZA 5EHXA 2N0SA 4GXTA 1QUFA 4YRJA 3AGQA 2AXNA 3A1CA 1N6KA 4TTJA 4Y9DA 4MUHA 4NS1A 1Y3BE 4XSVA 1H2FA 3CRRA 4CEJB 2O2GA 1FU4A 1MJHA 3GJYA 3VMFA 4FE7A 3CVJA 1XDBA 5HF8A 2VHXA 1NBHA 1A0OA 4M22A 2NZXA 5KYTA 4LF8B 1U9ZA 1LQUA 2WU0A 3TAUA 2PXAA 4MVJM 3G2NA 4NHOA 1J8VA 4RHCA 1MX5A 2R47A 5EIXA 1RABA 2IEBA 3GUYA 3OCXA 4R01A 1PR2A 4Q21A 2C31A 2XCRB 1SCDA 3QE2A 2XEDA 5EIBC 1I4TD 2PWYA 4DNQA 1Z3IX 1ZNWA 3S68A 2FWIA 4IKOA 1G98A 4M0FA 1XZIA 3W1WA 3UHFA 4DZZA 3IAS6 3A2NA 3NEAA 1OGIA 3L8HA 4UQPA 1KDVA 4BFXA 4BCDA 5B2EA 1AXRA 1E58A 1JMVA 2YL2A 5BV7A 1I2CA 4JX9A 2DWOA 1SHTX 2AFIB 1T3LA 3R40A 4MQ4A 3UMRA 4JEIA 4GWLA 3V1KA 4QUAA 3WZLA 4IH9A 1NW5A 3K32A 3X1XA 1EUQA 3DMRA 4QDOA 4FFPA 3WGNA 4BNXA 2D2VA 1QONA 1TPYA 4QU5A 4S24A 1VB5A 3UAZA 1Z6AA 1KDZA 3RVSA 3VZDA 4KDFA 2W71A 4HQ0A 3GP3A 4K9NA 4IVPA 4IOMA 1MD9A 3L82B 3BOSA 4EELA 3LF2A 2P35A 5E1OA 4EGSA 4PYJA 2NU6A 2E4ZA 3A1UA 1QH8A 2OHIA 4JJKA 1WS6A 3TTWA 4ZYUA 4QZVA 2BH2A 2O19A 3RBVA 2VK2A 4PSCA 2JZCA 1V71A 1EQ2A 4OA8A 1QHYA 2H9AA 2P9HA 3E18A 4KH0A 3TINA 3WAGA 3FOEC 4ZHSA 1A4XA 3L6DA 5H80A 4FWTA 4MDFA 4RGYA 2WJAA 1TO6A 1NBMD 1L5YA 4H60A 4FGJA 3ZI0A 3SYKA 4WIAA 1ZGJA 2H63A 4CN9A 3R9IA 1DHTA 4HAWA 4KV9A 4Q6WA 4UCWA 2BYTA 2DLCX 2VUIB 1KI1A 4OYLA 3U4QA 3WIVA 3ICQB 3U17A 2UV8A 3CWCA 5DOZA 1RHQA 2HJRA 2H1FA 5IM4A 1NWCA 4LYHA 3LU1A 2BE7A 2IYFA 4ZYVA 4HWGA 1ZVMA 3DNFA 3CUEF 3VR5A 1XVVA 4UZEA 3GDGA 4R0NA 3STHA 1IY8A 3UAWA 2WD9A 1ECPA 4K9RA 3G5UA 2UZ4A 1F0PA 1M6VA 1E5TA 1RPAA 1J07A 3K94A 3PVCA 2XMQA 1BQ4A 4O4IF 4XEUA 2AVDA 2WPDD 4G97A 1Q0SA 3ZK8A 1DRUA 2AHRA 3ZE0B 1W94A 4WK4B 4PZEA 1JA0A 1UWCA 4AECA 2GEVA 4OIFA 3LQ2A 2IKSA 3U0BA 4LN1A 1XB2A 7REQB 3IDAA 1DLIA 1OPRA 2ZQYA 2P3SA 4G25A 4P8RA 1A97A 4UTNA 1IEQA 2XYHA 1A7JA 2A9FA 1XVIA 4F8YA 4BZQA 1I6MA 3DULA 1H4SA 5BVGB 1YRYE 3AVWA 1XGKA 4YAGA 3RAJA 4Q7EA 4ENVA 3D2AA 5I7RA 4JWKA 2WT8A 3ILSA 1J2RA 2NUBA 3TNYA 1QDLB 3QQ5A 3GJQA 3BCHA 3L77A 4L50A 3TOSA 5EWMA 3OETA 4UTZA 2B99A 4AJ4A 4WQMA 2ZP1A 5HIIA 5JEEA 3NS7A 2ADMA 3I42A 2IYLD 3CRNA 1SAYA 4KCGA 3AC0A 3PVSA 5LFAA 2N3ZA 5G4KB 2PZ8A 5KCMA 3OWXA 3WRVA 3BVPA 1I94B 2CL7X 3QKRA 4KR2A 1PK8A 2IV2X 2YRFA 4B83A 3QMMA 4BDSA 4E5NA 1G5QA 1F3LA 4B2YA 4C29A 2IT1A 1XZKA 4UQOA 5BWMA 3ZWCA 3LX8A 4YR9A 1GPDG 1V8OA 4AZ0B 5BWLA 4PSAA 1HQKA 1K97A 1WF6A 1S2MA 1ZMTA 3JRNA 3HSKA 1CY8A 2E9SA 1WE2A 3EQ6A 5HHTA 4K9DA 5L3VA 4WW0A 1U31A 3C3AA 5F5LA 3ZV7A 2YRWA 4ZQEA 2I1LA 4Q66C 3BH0A 3KU4A 1QF7A 5G1OA 1D2MA 1MF7A 1R5NA 3F90A 4OHRA 1KH2A 4Z1OA 5C5EA 1KWKA 4ABYA 3IEMA 1QOPB 3RFCA 2RHDA 3NBZC 3JALB 4MS1B 4J1SA 2MR6A 2Z2IA 4KR9A 5I7EA 3I12A 3TZHA 1VE3A 2IUYA 1W44A 1H2WA 3S7ZA 4CZ2A 1X8XA 4NKRA 2RCYA 4HQFA 4UUNA 4G81A 4ZAWA 1KF0A 1LZKA 1PNQA 3SEAA 3TQFA 2PPLA 3UOAB 5BSHA 3N8GA 1NW4A 2V8OA 3IAAA 4KAJA 5SYAA 1Y1LA 2ZJYA 1DMSA 2IYNA 2QR3A 3BEDA 5HG0A 2VSOA 4FMDF 1A2OA 1JHVA 2NTEA 4N5LA 1BEUB 4RLHA 2EDCA 3L0IB 4MIOA 2R4TA 1IZ9A 2DM6A 3B5IA 2P2GA 5JH7A 2ZSIA 3HACA 2EFYA 3GPLA 1QLJA 1ADYA 1SH7A 3Q7SA 3ONDA 4JKIA 3NX4A 1J90A 4MHTA 2GJ8A 1BDJA 3PFNA 2QV7A 4KMRA 4PTZA 2NT3A 5F3RA 1Z8FA 2ISQA 1NVKA 1NUQA 1IHYA 3QPUA 1VC2A 3CY6A 1GGKA 4I99A 5DW0A 2XT9A 2CHQA 2VEDA 4FW8A 4LRUA 1NLYA 4AURA 4CKCA 1K5DA 2MHCA 3MSXA 3CEHA 4WUTA 1U8FO 2GQ0A 2WHRA 1TEXA 3GLGB 1E94E 1NYQA 2ODAA 3LX6A 2R44A 5CBPA 2O59A 1JMKC 1Q11A 1TYZA 2C88A 1VE7A 1JHOA 3JAKA 1D8TA 1RBMA 3ZNNA 4CIXA 1DFGA 2VHZA 1OWMA 4P08A 3KZNA 2OBBA 2XECA 4ZYYA 1YIDA 4ZYZA 1QG6A 3DLHA 2J08A 3IVMA 1L5NA 1O6CA 2JFFA 4V0MA 2OZLA 1HLGA 1ATZA 3EW9A 4ZDWA 3V2GA 1P6QA 1QIHA 4X0EA 2YWXA 2QRVA 3DE0X 2VG8A 5G0SA 2I66A 2EFHB 4Q16A 5FCDA 3S29A 3HCNA 3M1LA 1XCBA 5CGQB 3SHOA 4YP7A 5HKLA 3ST7A 4KW7A 1KEUA 1XIVA 3AMVA 1CXZA 3OESA 4CKWA 2UZAA 4IOKA 1P5JA 2FUG6 1RZUA 2GN9A 1P1RA 4J4TA 3G1TA 1EJ2A 2BFPA 3C6ZA 2P67A 4MEBA 3F3SA 2B1RA 3PV0A 4D0NA 1IXYA 5IBPA 3MJDA 4RELA 4YMLA 3LK7A 1CQXA 1N2CB 2B4QA 4JROA 3FUWA 3OSUA 1Y6ZA 2O5VA 1Y9AA 5TDHA 3LY8A 5ED0A 4BVLA 3Q10A 1T9DA 3D6AA 1B93A 2BBTA 3PJEA 3PHIA 4IYRA 3HUUA 4YLEA 4UQLA 5IJ0A 1HNNA 3JD2A 4Q4JB 1EE2A 3ITNA 2QROA 1QCYA 1K5GA 3KAQA 3WBKA 4EECA 2A3NA 2QNBA 1NXTA 2VDUE 2Z56A 4XXHA 4BP3A 5DGHA 1YI0A 4R9NA 4BVEA 2M1ZA 3S1LA 2X23A 2RAVA 5IM4F 3NHYA 2YJTD 4Z9YA 1XHLA 4KITB 2KE5A 4MTCA 1FQOA 1Y37A 5B2ZA 5JJ5A 2D8MA 2OGUA 1SZPA 5LZ4A 2ISSD 3WLSA 1PKXA 1W48A 1R27A 1Z6YA 2BM1A 2CXHA 2Q2NA 1O03A 2NYAA 1S6YA 3BK1A 4HUJA 4NY1A 4P3XA 9LDTA 1MG5A 1W36C 1RQRA 2P2SA 3D2BA 5KOYA 2ZAYA 2HWKA 1CETA 2ETVA 3NP9A 2GI4A 4RIGA 2QEQA 3WNZA 4QLBA 4DLNA 3FYUB 4N7JA 1LSJA 1JDSA 4REOA 3C15C 1HG1A 3NV9A 4Z4GA 1NF8A 3Q41A 3NAGA 1JW9B 4MR8A 4P93A 3LFUA 2ZWOA 4RGQA 1XVTA 4OI1A 3A2KA 3GNLA 1BW9B 5MFPA 1NM5C 4QLAA 2I4LA 1VL8A 3KEGA 2JAWA 1NDUA 2B5OA 3J81A 1H6DA 2E82A 4KN6A 4E03A 4IQ8A 4RVNA 2QRHA 3OFJA 3F6YA 2IE0A 3SXJA 1TE2A 4AU1A 4OB6A 3FROA 3VC7A 1JQBA 3C3YA 5A7FA 2PU7A 4K05A 3A04A 2P2DA 2XNSA 1KRHA 4RBNA 4V0ME 1UMCB 4RGBA 3GGSA 3RIGA 1OR8A 1U3GA 4JP1A 3P2OA 1S9DA 1TF2A 4FYYA 4ALLA 5LOVF 1I7SB 1NW8A 1U3DA 1M0SA 1SC4A 1JFSA 1N32B 3DZDA 3VH4A 5K9ZA 1IN6A 4NF2A 3V4VB 1AA6A 1RI4A 4AUNA 4CIDA 4AO6A 5ADHA 2MSLA 3AZQA 3DUWA 5BRNA 2Y1CA 3I72A 3TOXA 4ALIA 4FLMA 4BFZA 3A6GA 5KJ1A 2HV8A 1GIAA 3C3MA 4HVLA 3NI2A 3SSOA 2HJ9A 4FOTA 5EKDA 2I2WA 3GZTB 1A9TA 2J0EA 2Z9CA 2XYVA 2FCRA 3LPAA 4ALNA 4DUPA 3P0HA 4TS4A 4HGQA 2VXOA 4J91A 3RVPA 1L1RA 2ESRA 1L0BA 1VRCA 2FJUA 1FW8A 4DY4A 3FF4A 4ZXPA 3TW0A 5MN5A 1Z5VA 1QR2A 1ZGGA 1SVSA 1YBVA 4YEDA 1Q7RA 1G6Q1 3M2TA 3NRCA 1XMVA 2IYPA 2OCGA 4HAZA 2TYSB 2E4UA 1HYGA 1I9GA 2ZRAA 3OE1A 4NE9A 1JF8A 1X1BA 1TXGA 4U3JB 5IHXA 2VTBB 1LW6E 2JIMA 3FSEA 3UPDA 4H1VA 2LKDA 4QODA 3WGZA 4D2IA 1JKJB 2ONYA 3UKJA 4X6LA 1QB7A 4TOIA 2FZWA 1ZD3A 2I87A 2VSQA 4YRFA 5LCXA 5FT9A 3ZHZA 1N2XA 3F96A 1MGPA 1KAQA 4ANFA 5EVJA 1M1YB 2IUEA 3UCFA 2ZULA 1GUYA 1Y4ZA 2EHDA 4Z3OA 2O1EA 1I3NA 1NZDA 3Q11A 1WDMA 1M6HA 3LV8A 1N5DA 3QXSA 5JWRA 5G3ZA 3K0AA 2RAFA 2O8EB 3VPCA 2P6RA 1ESDA 2AOUB 2VJQA 2CUNA 1SEPA 5B4UA 2BMAA 4K6GA 1S3SA 5FA8A 1R9JA 5J4VA 3TLKA 3TRIA 3N28A 2JGJA 4KQ1A 1DSSG 4X24A 2YXPX 3K0FB 2HMYB 6GPBA 1ZC3A 1I3KA 1NG1A 1V26A 5KWIA 3LL4A 1AB5A 5JD6A 4HB0A 1KYYA 1KOJA 1IJFA 2WSSA 3FTCA 3RODA 4WOJA 3TRHA 1JHXA 1RRGA 2HY7A 1GSOA 2BBWA 2HB6A 2Z8YA 3L0CA 1EESA 3KVYA 1Q0UA 5LXTA 621PA 5DISB 3PYXA 1Z3CA 3IS3A 1JQEA 1RI2A 4G5QA 4S12A 4XDYA 5DSXA 3EEFA 2CWDA 5LZ5A 3WKBA 2ZT5A 3U61B 1HE3A 4GZ3A 5IJ9A 3SJCA 2GEFA 1M5RA 1M2FA 4IF6A 5DULA 1G0NA 3L4SO 4G4SO 4K6CA 4QT0A 2F8SA 2OORA 2Q9AA 1LDNA 3LWDA 5CAEB 5JHGB 1HE8B 1NN3A 3EHEA 5AM0A 2HREA 3BL6A 3L8EA 3FVQA 5C1IA 3TQSA 4NV0A 1Z82A 4EBFA 3MLBA 1G3QA 3ABQB 1DC8A 2BFMA 3FNEA 2P69A 3GGPA 3QPWA 3T1VA 3PXUA 3V1MA 1ZOIA 3I2FA 3IV7A 3PTZA 4NZPA 4YJ3A 4DV4B 1NA5A 2ZRMA 3PTLA 2EL7A 4P34A 3TRFA 1XCOA 4CLEA 4DR4B 3EXEB 3ICPA 1HDXA 2PRZA 4JLUA 3T5DA 5AW6A 4X66B 1KAMA 5EXEA 1X9GA 5GIPE 3VJLA 5ADVA 1RRFA 4FYJA 4BZZA 1N0UA 1EJBA 4U9IS 2L17A 3D5TA 3GYGA 3NTVA 2GUWA 2Y9PB 4KNWA 4AX4A 1PK7A 4Q39A 2F1KA 3PB3A 2ZRLA 3CF4A 3SVZA 3UT0A 1U3VA 1J24A 2VRCD 2PGJA 2WYWA 4UTXA 2XDQB 2P4UA 3R09A 4NARA 3DLTA 2YYAA 3HCCA 5AI0A 4GOJA 4J9UE 3N39C 1IHOA 1UC8A 3BH7A 1GZUA 1IBLB 2UVDA 4A0RA 2HF7A 4N5IX 1JYEA 3I2KA 1IXZA 4RZHA 3OQMA 4F1JA 1SD2A 1Q77A 1SHKA 2H8GA 5DLPA 1NFRA 1YVEI 1SG6A 1R6UA 3WS7A 4D9FA 1PG5A 1C1XB 4EGCB 5CFNA 3H9BA 2AC4A 4O4LF 2ZB2A 1KNXA 5KYVA 4QSHA 3U5ZB 2QAJA 1UMDB 4MO2A 2O3UA 1BE1A 1NPDA 3A2LA 4DG5A 1H69A 3I3OA 1NQWA 2APJA 5AVXA 5KU1A 4FZRA 1ADBA 2PWBA 4RD2A 3KE9A 1DAEA 1QH1B 1X3SA 3AZPA 1XDSA 3JW8A 3VNVA 4WECA 4E32A 3NYWA 2J4FA 1YMVA 2JJMA 2QLNA 4HFRA 3TDKA 4KN8A 2ZCVA 1LQ2A 2QTVA 2P9BA 2XTMA 5MN6A 2RGDA 1RD4A 1OTXA 1LBEA 1ZH6A 2J3LA 4GDMA 4RXUA 2DQYA 4R9RA 3UMFA 4BRWA 1TTPB 3ED1A 4PQFA 1PHPA 2I4NA 1TJYA 4MGZR 3KOWA 1M73E 2QBYB 4X6UA 2WF6A 2C4VA 4YC7A 3T8YA 1XP8A 2ZVDA 3EUAA 3HNRA 4AP5A 4F6RB 4TM7A 2X7JA 4XVRA 5CB4F 1Y7LA 3CNLA 3LUBA 2FG5A 2EL9A 1PCXA 1T24A 3ICCA 1SXGA 4MS4A 3TKLA 2ZI7A 5A2GA 2O1SA 3MTBA 3MEQA 4EHIA 3MHTA 1F2UA 5JFTA 1YHNA 4Y7CA 4AP9A 1BRTA 1P7CA 1TJPB 2XI4A 2YHAA 3B7WA 3GGCA 4G0OA 4TLCA 5K3FB 1WXHA 1SK8A 4FZ3A 1MQ8B 2QA5A 2RHLA 3B1YA 3GLHA 2J3KA 3DLIA 3FRHA 1HT0A 1EI9A 1EFVB 4RIEA 4ZVQA 2QTLA 5AJVB 1QHXA 2YVUA 2HHLA 3RC2A 4N8DA 3A7DA 4GD3Q 2EKDA 1XQXA 1HLFA 4M4SA 2ZSDA 1BFDA 2Q46A 4F4CA 2PCLA 1OBHA 2OWEA 1H65A 3IUYA 4X94A 3W6OA 4B8ZA 5FH9A 1C80A 3OQIB 1M6NA 4FYHA 2AMJA 1R12A 3KEFA 2HWWA 4HRVA 5P8WA 5KI6A 3B2EA 3TWOA 2MSCB 3ZGOA 2AMVA 2HL6A 3HBMA 1QRRA 1W6UA 4INPA 4OXNA 2E4VA 1QQAA 3HFSA 4HDKB 4JASB 4ZTZB 3TQRA 4FDMA 1RJWA 3DSRA 1JHPA 4HEHA 5FTJA 4C3ZA 5K99A 2YFYA 3OZVA 2OBYA 4TTVA 4QASA 3VSDA 5CIQA 3NONA 1IK6A 2YWRA 4UEOA 5A2QA 2ASVA 3U7JA 3SM9A 3GVIA 2RI1A 4PY2A 1SPBS 3BM5A 4RDCA 2X0EA 5IC4A 1UKAA 3T4EA 2AUMA 1NMQA 1UZLA 4L02A 4Q4AB 4W5WA 3P5SA 3UM9A 3O8CA 2G28A 3EZLA 4MWZA 1CG6A 2EGHA 1LNZA 4M89A 5JD4A 1IHDA 3B8EA 3EZ2A 1HY3A 2GVDC 5DIFA 1IBSA 1II9A 3DHWC 4DBZA 4H4CA 1PS0A 4L2IB 4OJKA 3O8LA 4JK3A 4J0FA 4BPRA 1OWLA 5K0GA 3U3OA 5BUSA 1KK3A 1BHSA 3PC8C 3MJ4A 1XCMA 3H16A 4CT0A 2HA2A 5AW0A 4N48A 1W36D 4OA5A 1FMJA 1BD4A 5I7SA 1FDVA 2VP4A 3W9BA 1X8KA 3KYDA 2C7RA 5IABA 2AKYA 1UDXA 4IDNA 2CMDA 4HYEA 3BXPA 5BPFA 3BSSA 2OFOA 4KDEA 1MH1A 3O0DA 2ZTVA 1B43A 2ZYAA 1ODSA 3DF9A 1UP7A 3S0JA 1KU0A 2Q28A 2RHGB 3PHJA 4DYDA 4NH0A 4RTKA 4A10A 3G2KA 1OYOA 5LJIA 2C29D 2PMFA 3P9YA 4JX8A 5JWOA 3RVOA 5I51A 1Z37A 4IGFA 5H3LA 4U2FA 4JL5A 5EJ7A 1ZR2A 1CYEA 3MIIA 5FNZA 3HKEA 1SA0B 2EKZA 1UDRA 3PPVA 1RRMA 1WY7A 4XLZA 5AKXA 3A3OA 3RHZA 3UH1A 1Q0LA 4TSRA 4A4DA 2QJWA 2WDZA 3ZE2B 5CDFA 4C76A 4DAEA 4EI8A 5DLDA 3DAYA 3WWEA 3OQNA 1IUKA 3HXKA 5SZIA 5JNRA 1T4DA 1VGQA 1JHAA 2H1LA 8LDHA 2QTCA 3TOCA 5B30A 2IHVA 3KFLA 3AU9A 1L7OA 4URFA 2FHPA 1NF3A 1VIDA 3GBSA 3L8ZA 2VDWA 3PRKE 1GQRA 2TECE 3OE7D 5CX4A 2FZVA 1HRDA 1A69A 1H3EA 3L6RA 1H1TA 3ZTTA 3QVMA 5C5IA 2G6BA 2P75A 1RJ9B 2JIZD 3AUKA 1US8A 2DFVA 2PUHA 1QM5A 3EIXA 4U2CA 5E9AA 4AI6A 4U39A 3TQOA 2TMGA 4BKRA 4DQXA 4UHCA 1JR4A 2QN6A 2L0XA 3NOXA 1JEEA 4WT7A 1JNXX 3H9CA 5LXTB 4EW3A 5DHFA 3STXA 1DAGA 3SJBA 3TQIA 1XT6A 2P1DA 1ATIA 1H42A 2QTVB 1E2PA 4D45A 2WJPA 3NUGA 1D6SA 3VNBA 4HQ6A 3A2MA 5ALSA 3TMYA 3NUQA 4HAOA 4B7UA 2J6BA 1U11A 1W0CA 5D51S 4XYLA 3NVKI 2Y1LA 1AQ6A 1FS6A 1TVMA 5LLSA 5TQJA 4CMGA 1XQYA 4LOKA 4DIEA 1NZFA 2DAPA 3PDWA 1J49A 2IOYA 1KI6A 3E5MA 3FPLA 4I1RA 3UCXA 3FSGA 3QU9A 1FFCA 4K40A 3IUSA 3TLXA 4M1MA 3VZRA 3DB1A 3W5SA 5C4IA 3TM5A 5IT4A 4OHCA 1LK5A 3EASA 2GAFA 3PIIA 4KFRA 4EO4A 1FS5A 1GD1O 2G71A 1AE1A 1WAMA 2C5FA 2X0RA 3C85A 3N2IA 5EPOA 5FF9A 4DJEC 1SXJE 1X0VA 1ZSYA 3MTEA 4G86A 4YLGA 4YIHA 3ANNA 5H16A 1AURA 2C0QA 4HXGA 3GX1A 4PHCA 3QU7A 3AY6A 4BWFB 3D31A 3H84A 2OE2A 4F38A 2QWXA 3D8BA 1OIXA 3IJEB 4I1OA 4GRDA 2J3IA 2VTBA 2RARA 5IASA 1DJMA 4GS5A 4MR8B 3RQSA 2AOVA 4MRVA 2Z9BA 2DH6A 1KY4A 2VNJA 1QKIA 1OF1A 1XTBA 4UAUA 4P92A 1SJ9A 2IZ5A 5DHUA 5F23A 4IRXA 3BZUA 3NWOA 2VR1A 4R2WA 2IDZA 1W49A 3REFA 2HQ1A 2Y1OA 5F2EA 3WGGA 3SSMA 4B6RA 3TD9A 4AQ7A 1KARA 1XF1A 2UVPB 4TSFA 5TEWA 4DSOA 5J5VA 3SC6A 2ZITA 1CE8B 4WFKA 821PA 1R9NA 5FIUA 5KQGA 3KFVA 2JASA 3ESYA 5FORA 1H8HA 4PAMA 4MV0A 3ZOKA 2CW5A 3ER9A 3WWZA 3KPJA 4LNHA 1T3HA 1WF3A 1M7HA 2E1PA 3LT1A 3R7WB 5A4KA 2GK4A 3EBOA 1VE9A 3W5CA 1YJQA 3HABA 2H1WA 3P0JA 4K0RA 1T36A 2D7JA 4IIFA 3M33A 3PPXA 4D4GA 3KX2A 4P22A 2BV3A 4XJXA 1G291 5FEMA 3AW9A 3W9SA 1PQYA 4ZAVA 3NP7A 3P94A 1CS0A 1T1EA 2DHRA 1IB0A 1DKRA 4MPJA 3WMFA 1AS3A 1HTTA 4NONA 2JLYA 1KYWA 1SR8A 4L8WB 2H1VA 2PZJA 3OZXA 4WZAB 2KHZA 2ZYIA 5DGXA 2DBRA 3T5GA 3KQOA 3PC3A 1N9GB 4OQLA 5FUMA 4LWZA 2LZ0A 1RCFA 1E2NA 3BFPA 3T7JA 1N2GA 1YL5A 1Z4JA 4BFUA 1ZIDA 2XE6A 1TCCA 2O0MA 4LYDA 4NU8X 5K6TA 3B2NA 3PFFA 2GOYA 1YRHA 2DUWA 5CFOA 3K20A 4Q9DA 4BVAA 1BE6A 3IULA 3N2KA 1A5BB 3MRVA 4WDQA 2Q49A 4G5FA 4RTMA 2ORYA 4GPBA 4GIBA 1YB2A 1F2UB 2X2OA 1C3EA 1SC9A 2H11A 2V7XA 1BN6A 1KFCB 2HUNA 1Q2XA 2H7XA 2QLFA 3B6ZA 3OPQA 3QMWA 3SPXA 5ALIA 2QLMA 5DI3B 1KSFX 3TL6A 4LUCA 2DF8A 1A8UA 2A57A 2VDLB 1ZRSA 1EINA 4RPJA 1LEHA 2H2DA 4MB6A 4ZWNA 2AN5A 4P81A 3GLGA 1AF4A 4KP7A 1MN6A 3ZIAA 2V7PA 5KEIA 5IXJA 3MUEA 1F4VA 2E4YA 4CQMD 2CLOB 1E4EA 5CYGA 4W5HA 1XNGA 2VDOB 4KX5A 4OU5A 1PEAA 1AK1A 4FJ0A 4Q3NA 1UBUS 1V11A 1DCMA 3HCBA 2E3JA 4HXYA 1IPEA 1KIMA 3RFXA 4JQCA 1O97D 1S2NA 3KZVA 4U7HA 5BMOA 4GOOD 4ETMA 3KD3A 1QRTA 3WTBA 1BROA 5A02A 3AHFA 4PM4A 1WXEA 4KQMA 5B36A 4RENA 5D3KA 1FZQA 2NAPA 2DFDA 3OIWA 4MO9A 1TT7A 2EG9A 3OSZA 3BWCA 4YGXB 3WYGA 3IGFA 3AR3A 3I92A 5ITZA 1ZAKA 4FNGA 2CVQA 3PEEA 2BFFA 1VIAA 2H4JA 2R1TA 2C5AA 1WKBA 3O3MB 3SR4A 1NZJA 1LQTA 3AM5A 1YJ5A 1MT3A 3PHHA 4UOZA 2JVJA 1UK8A 1R74A 5K0TA 5A0TA 4CEIA 2C94A 2ICAA 4B32A 5IJ9B 1ZD8A 4YUVA 4FYMA 3S2UA 3QW4B 4GX2A 3JWGA 1U9IC 4OI0A 3OM8A 2FUG1 1UXIA 3RWBA 2D1RA 1AQNA 3RYFB 4P0QB 2G5GX 2XPCA 3ETDA 5ALYA 2R8YA 5HIAA 1ZHHA 1IEWA 2EFGA 2P9JA 1GPWB 4PO8A 3SZLA 3F7OA 4H1HA 3ZDXB 3ORQA 3WJ7A 3DPIA 2V4MA 3NT5A 4K1LA 3JATB 5EJGA 3W8NA 2B9VA 5I5EA 3ZJTA 1VHLA 1YU6A 3QI7A 3MAAC 4UM9D 2WHXA 3ZY2A 2BONA 4WXMA 2B3TA 1GVHA 1ADFA 4HN9A 2HZBA 1WUHS 3IT3A 4RDIA 4R6XA 3LWNA 4V39A 3RABA 4YRNA 3V48A 3AHIA 4PNEA 1KEEB 2FLKA 4GX0A 4OHZA 1KO1A 1OT3A 4OK5A 2Z57A 1M1ZA 4G07A 5TQVA 3WK7A 4A2CA 2NX2A 3DC2A 1XTSA 1R50A 1N4AA 3GMIA 1GV1A 1AKMA 3SOZA 3IBYA 4HGOA 4Q4HB 3H2JA 4LNUB 3PHCA 4B3RB 4JEHA 1R9GA 1QH9A 1GUZA 1Z73A 3I32A 3P2JA 5EE1A 3F49S 3LKBA 1WMDA 3NFYA 1NJ5A 3ZWYA 4MA0A 1C1HA 1GP2A 1Z0DA 3CB4A 4QUJA 4NMLA 4ZI7F 1ISSA 3K8ZA 2XNJA 3OIGA 5CA0A 3FMOB 4ND6A 2WVAA 2O2JA 3IRVA 4PSKA 4ZEWA 1KEEA 4O0MA 1JIUA 1YCDA 2VF8A 1SURA 4L8FA 2B7BA 4MKZA 4OQFA 3VDXA 1ILEA 2J59A 1FZTA 4WBNB 2WUWE 5WRFA 2WYOA 3OF3A 3CISA 1R6AA 3CIFA 3O92A 4Y8VA 2XUHA 4NAVA 2DZDA 1NN0A 2CK3A 2H5JA 3AL3A 1VYVA 1UK7A 3IH5A 2Q1WA 2W2NA 3CG4A 2I34A 4MTLA 4BO1A 3UT5A 4MJXA 1E9DA 1E5VA 1GZ7A 2BMDA 2XA1A 3GCDA 3JCZA 1DEOA 2ZUDA 4CM6A 4TPKA 1JR3D 2A9QA 4ZGBA 2WVGA 1U7OA 4WBNF 3BDAA 1G2IA 4A7PA 3VR5D 1TZ2A 4KOAA 2WKWA 1ZDMA 4LMAA 3U5TA 4MZXA 1S89A 3AWIA 4MXDA 3UAXA 3JVUA 5EJ4A 1WPQA 4FQ7A 3BE6A 2AV6A 3RYCB 2PX2A 3H0KA 1EP9A 1VKZA 4BU1A 4R2JA 3V00A 1SXQA 4H16A 2JFVA 2E87A 3GEHA 1J7KA 1E9RA 4ZK6A 3HWRA 3LRPA 3QVKA 4ZVLA 5H1YA 1PJ2A 1CUJA 1F6DA 2EEZA 3K5WA 1SFRA 4EF4A 4IJ5A 4TX1A 1MOZA 3ZKAA 4H31A 2H2IA 5GGXA 4F9EA 2YMLA 1JU3A 4LPSA 1DC3A 3VHXA 4BAGA 5JZVA 2QAGB 4LQCA 4NXMB 1MB9A 2VSXA 3B1XA 4MB0A 3NKVA 4FGUA 2YQ5A 1QRAA 1TW2A 2HH9A 2O6HA 1L3BA 3H1AA 4PFJA 1C3JA 5TE9A 3F73A 5DNEA 4ZAFA 3ELBA 3G5MA 3CBGA 3USZA 1GPMA 3IUEA 4QO7A 5T41A 3SIWA 3IR6A 1B0PA 2AMLA 3CB2A 4FGLA 3N58A 3LCVB 3ZW8A 4V0OA 1EFDN 3ASZA 2FDRA 4BLWA 1SZCA 1YQ9A 2GHIA 3QJGA 4HYQA 4WKNA 3TIXB 4MP6A 4X95A 3UENA 2XCIA 4DV3B 1OLSB 3E8XA 2Q1UA 4FZJA 2J1LA 2OVFA 3PD7A 2Q3CA 3GCZA 3D3WA 4MUGA 1VZ2A 2JCGA 1ZCZA 3UG6A 2CHUA 3OZUA 4CMBA 5KYGA 3ADPA 3Q9UA 1LPNA 5C0OE 5DX0A 1GPKA 1W4BA 1PEKE 3AKEA 3RBAA 2JI9A 2BF4A 3A6LA 3PR3A 4IUDS 4CL8A 1C3VA 3ZWOA 1WV0A 1Y3HA 3E3AA 3PHLA 1B2LA 3D6MA 3E84A 3W6NA 5F51A 4O3FA 5TV2A 3ZXSA 1ST2A 2Z04A 1PZHA 3DDSA 3ANLA 3EW7A 4INAA 3RTCA 5BV2P 2XIJA 2A7XA 3O47A 5JD5A 3ZW9A 1YBFA 2Y1FA 4N5NA 5DCLA 3I3SR 3FWPA 5IKOA 3WK5A 1I3MA 2X2PA 2WF9A 3KQSA 3NWPA 5CVUA 1GITA 3D1LA 1INLA 2BHRA 3ETEA 3HJAA 3HYTA 3TD2A 4E11A 1U0BB 5DX8A 2CGEA 5HJ5A 4WWHA 1UJBA 3KPVA 4ZU6X 4B3JA 2EATA 3G5AA 5LMCA 3CLSD 2RJOA 4UBMA 4O4IB 5JYEA 5JU6A 5LL6P 2OD7A 1TEZA 3WBJA 5JZ9A 2F3RA 2W48A 2W6ZA 2GZAA 4P7FA 4QDUA 3LF1A 1O8BA 5CK4A 4DBLC 5LNK1 5BN3B 1ID8A 1OD6A 5AM5A 4XTRA 2CK3D 1TYAE 4B81A 4CF7A 5HUQA 1YNOA 4N0MA 5JJIA 3V2UA 2F9FA 4MYSA 4ZEVA 4LC9A 1VL0A 2HT6A 2VCYA 3KD2A 4IPTA 4O8CA 2H3HA 4W6ZA 2Z3VA 3H42B 4L5YA 3LGXA 1G41A 4TZTA 4LF5B 1P1CA 3Q7PA 3MD0A 3EMVA 5JCOA 2PZGA 1ZH8A 3AP1A 3MGKA 4Y2GA 9ATCA 4QDZA 1GPLA 1A77A 4IXTA 2WQ6A 3C70A 2QTZA 5HOEA 2HHAA 4RVHA 1AV7A 4GR9A 1J8FA 1RM0A 3L01A 1ZJ4A 1MAHA 4WLNA 3FPSA 4HY3A 5AOBA 2OGSA 3ESRA 5CPFA 3E15A 3UQYS 1SKMA 2REXB 2BFDB 1ZXLA 2O2ZA 2I2DA 4GMDA 5K5EA 4YAWA 3DEZA 1I1HA 4UOEA 2EU8A 3W2GA 1G63A 3AFNA 4K9PA 3E3OA 2F55A 4I5EA 2RHBA 2KLHA 1Q6YA 2C7BA 3AJEA 3UWSA 4CIAA 3S8YA 3H4VA 4K2AA 1NV8A 3NC4A 3QYPA 4QTZA 5JT1A 4XX0B 4NS4A 3X2EA 4K9KA 1FX0A 2H92A 3C7KA 3SYMA 3DBHA 1GNLA 3W2EA 1DNPA 2MYTA 3JTMA 2XVMA 1UPTA 4ND8B 1YL7A 4QXAA 4OXQA 2PRSA 2HK9A 4ZU1X 4Z0PA 3KJZA 4JJ7A 3TLBA 2J7KA 1IN4A 3L7BA 4I3FA 5BR4A 5FV4A 5KTNA 3FRIA 3JVVA 1NQUA 2Q0HA 5GPBA 3DEFA 2D5BA 2JAOA 3NHZA 3OHPA 4JITA 3I4CA 1TK2A 1W25A 3KQTA 3MXOA 5HZKA 2YXLA 4V0NA 3KS9A 4KIUA 3IQGX 3QFFA 3HXQA 5J43A 1IN5A 3D7RA 3EXFB 2JJ1D 3DKIA 1V4BA 2DTEA 4MYRA 3NTLA 4EARA 3SQDA 4CR7A 5F1YA 3TXAA 4EMBA 3EPKA 3QFRA 4Y7DA 2IZOA 4EITA 4B1FA 5CM8B 3V4LA 3MBIA 3T1TA 1EFCA 3Q87B 1JKMA 3PC2A 3FLBA 4LHSA 3JTEA 1U8XX 1ZINA 3HG7A 4IHJA 4M98A 1NMEA 3NBFA 4YP0A 2ZWVA 2G77B 3CCCA 1TJNA 1FY2A 3MCUA 4CF6A 3QWHA 1GA4A 4DQVA 1TM3E 4QOHA 3AB8A 4C5CA 3IUPA 3KP1A 1H0RA 1OASA 1RQNA 3PGLA 4RF2A 2A0KA 2Z98A 2AYYA 3V2IA 3FKSD 1AGRA 1E8NA 2GCNA 1COWA 2GM9A 1X0XA 2UUOA 4IJWA 2AXPA 1PYGA 5DI3A 4CT5A 2CHFA 4HXEB 3A28A 3E2MA 5E9QA 1QE3A 3HMKA 5SZHB 4B46A 4C4RA 5KSZA 2X0NA 4HVAA 1OX4A 4Q15A 2OYRA 4XGNA 2C82A 4F3KA 1N1EA 4X8MA 3VYVA 1XLUA 1U6KA 4JXJA 3SC4A 4D02A 3CGGA 5E9JA 2BCGY 5IUNC 4M7WA 4A0HA 4LGCA 4NENA 3MYRA 3EK2A 2H4XA 3ENQA 3UC9A 5C51B 4KI7A 4LKOA 1C8BA 2F67A 2Q6KA 4QOEA 3QEOA 3ZI7A 5KOHB 4OM7A 3VR6D 4X62B 2W42A 1ZD1A 4I5IA 5ELLA 1BYIA 4DADA 3EG5A 3O8OA 1C0EA 1GL6A 2O2EA 3Q5EA 4FOOA 1EP3B 1PHRA 4C30A 1VL2A 4M88A 2DERA 4HNHA 5ENDA 5K3BA 2X86A 5JAIA 3IPLA 3LP5A 5KWVA 4WZAA 4G36A 2X7XA 5FLXA 1YMUA 2P4EA 1M2KA 3QTTA 4MMYB 1PKEA 3K9CA 1LW7A 4JQZA 4YWHA 1NXQA 3GY0A 1CUYA 2DHEA 5AIBA 1AHPA 1XVAA 1VCMA 4ITUA 2OAGA 1DFIA 2FU5C 2QR2A 3VNSA 4BNZA 4KPUA 2OKGA 2VPWA 2NV6A 3K6KA 3VPBA 1M67A 4ZVTA 2MINA 2JRCA 3M6VA 2QGZA 3MHPA 4M8SA 4OOFA 4B71A 4U5XA 4FTWA 3RGWS 4BNGA 1XTZA 1CR2A 2P5SA 3LUGA 3LZDA 4R68A 1WBBA 2BFCA 4N03A 3P9CA 4BJHB 4EG1A 3L8FA 3DDOA 4CPDA 4ZTUB 2G1PA 4B6SA 4EY6A 1NSTA 3FI0A 4TZKA 4PX3A 1R2QA 3FSGD 3THXB 2BGNA 2QJOA 2I22A 3RYFA 4ONEA 1MW9X 4BZWA 3V1LA 3EPLA 2JIOA 3DM9B 4W6QA 1J9EA 1S2GA 5LQNA 1QFXA 2KM1A 3R6DA 3BN3A 2VWPA 1M6VB 2RCNA 3MT8A 2C1XA 2Y1KA 3UGKA 3ZWDA 3UF0A 4HNTA 2AC2A 4HL6A 1ZRMA 3C5CA 2I62A 2ZBVA 1P75A 4PGHA 4B75A 3QNWA 1OBCA 2VHCA 4WBXC 2UYGA 2JJ2D 2XLBA 1R6TA 1H8HD 3F6RA 2XJ9A 1EX1A 3PFKA 3RS8A 4ARSA 1D03A 4TMXA 5IVDA 4RVGA 2YXEA 2QN3A 3DE1X 2CEKA 4UZFA 1EBFA 1ORWA 3CO5A 3NWEA 4PO1A 3C4JA 4RSGA 4Y30A 5IPFA 3GFFA 5K4AA 1W47A 3WLLA 1BGWA 1KTIA 2JA2A 1FJHA 1KC3A 3F1KA 4Y6GB 2CNBA 5K2MA 1EGQA 3LL7A 3RRBA 2BTQA 3DXXA 5DHSA 4M9CA 2C7OA 1G7RA 5EY5B 1EM6A 2BFAA 2NVOA 1FK8A 4LXXA 5ELXA 4JR0A 4II2A 1JAIA 1T5IA 4X1IA 3ZJ5A 1IJEA 4KSYA 2LIVA 3NHKA 1P31A 3QRWA 4UUOA 1PJ4A 4CM1A 4EY8A 2B83A 2BFFB 3LLCA 2BR5A 5GY7A 2EWWA 2ZTSA 2GCOB 4NWIA 4WGFA 3C2QA 1RLUA 4JODA 4GBGA 2GN6A 3IHTA 4BYMA 4EUKA 3M3PA 1E6CA 2G08A 3TSWA 4FR2A 4DNXA 4X90A 2FPGA 4ZHQB 1C7RA 1I7PA 5EXDA 1RNLA 4IIJB 4DC0A 4JC8A 1NP3A 1KMHA 2Q5FA 5FX2A 4YUWA 3S8EA 2IUSA 2ZJ8A 2XYQA 1A4IA 2ZIEA 3F5QA 4I55A 3RS5A 3Q5DA 3E5RA 2PG3A 3QPCA 1G7TA 3LT2A 2FR1A 3C6XA 1Q6ZA 4IGKA 1HE4A 2FWRA 4OYRA 4NZYA 4R71A 2NO7A 5AKEA 3KXIA 3CVOA 2CYBA 1UADA 3QKSA 1ZW1A 1OX6A 2JLBA 2PIAA 1ULBA 3SJZA 5CT4A 3CW2A 3A1WA 1NJ6A 1FMCA 1USKA 4FLFA 4E4YA 4V38A 1PFWA 3PXXA 1X1QA 3AY0A 3JQCA 4EHFA 7GPBA 2B1JA 4DW8A 4E88A 5KKNB 1QU3A 4MQFB 2XWSA 1GADO 1YB6A 1V3UA 1XELA 3C3PA 2RH4A 1JRLA 3DUFA 5H68A 1TD9A 2C59A 1NQ5A 5EFOA 2ATEA 4R83A 3WAKA 4A36A 4CUZA 1U0LA 2G9ZA 4PYOA 1L4UA 4J16A 2VDVE 2ZUBA 3BRSA 2G9NA 1ZUNA 2R11A 4MICA 1UPUA 3SG0A 3WYCA 3OPYI 5ITVA 4R1NA 1M2OA 1SUIA 3MWLA 4PLVA 3JYPA 1C3OA 2I0FA 1A2KC 2CVZA 4AXBA 2HLDD 3A4IA 3PQ3A 2DUMA 3AJRA 1GPH1 1P5ZB 4MI6A 1C1YA 1DINA 1QIKA 3JAWA 3A4LA 5JMPA 4JS0A 4MRPA 3R23A 1XHEA 2H1HA 2LIPA 4G4SP 3V34A 4XYEA 3U6KA 1JUDA 2VPPA 4NI5A 5TGZA 3WYDA 1X6VA 2H17A 4ZANA 5C32A 4OGKA 2ZB3A 3EQZA 4Q03A 1GCOA 3WGKA 4YRQA 2NVUA 2EJBA 1J70A 1P5HA 5K8VA 5JV5A 3LLVA 3P32A 4ACBA 3IUQA 3N0TA 3U9TA 4NCJA 1CQZA 3B52X 4FJ1A 3R3JA 2E2WA 5CTAA 3RVBA 3ZIUA 3NW9A 4AJJA 1K7YA 1K0UA 3CRW1 1NW7A 2XQKA 5A06A 4LF4B 4CM8B 2H2AA 1Q1QA 4Q3OA 1QV9A 5FWAA 4LYFA 5C46F 5A9SB 3WDSA 3DM5A 3IOEA 4HV4A 1FL9A 4AJIA 5KB3A 2E5LB 4O4HA 4D9IA 1PWXA 3W9YA 4DLUA 421PA 4GE0A 3EGIA 4D8WA 4CT4B 3ZGVA 1XL1A 3KKEA 2CMGA 4S1TA 3H1FA 3STTA 4EGFA 4KYTA 1RQGA 5EINA 5T4EA 1CJTC 3UTCA 4CL2A 4EI2A 1L4KA 1XXHE 1G3IA 4R8KA 1KU6A 5JATA 3AF0A 3H2YA 1AMUA 4FOPA 5DNWA 1CSEE 4I6EA 5FAKA 3BXEA 2X0JA 3AB7A 2FFHA 4FFWA 2ONCA 2LV8A 1SUFA 3FWKA 2D0OB 3G2HA 3PI7A 4NH4A 3RTEA 1X7HA 4NYJQ 3LHDA 4KYVA 3RNOA 4WHMA 1Y81A 1XP5A 4MS3A 2FPIB 3IAM6 4YI5A 2Q0SA 3WB2A 1NG9A 3GHHA 3K15A 3RTBA 3SQXA 4LJ4A 4LOIA 1DT3A 1VP9A 1YUBA 3NAMA 4PO3X 4WOBA 5A6VA 2QAGA 3NTUA 3WP1B 3ZPXA 4J8PA 4UU0A 4BQSA 1Y7PA 5T4FA 4RFSB 3WHKA 1E2MA 1KFKB 2Y05A 4KO3S 4YAOA 4A91A 4EPXA 4ZZ1A 5AFSA 5JSFA 2VJKA 1W96A 1TKCA 3OZIA 4JJZA 5GINE 1OBVA 1XXHA 4RL6A 5FL3A 2QXUA 3RSOA 2GAIA 3KT6A 1B4DA 3GN2A 4KO4S 1RYZA 4PHHA 4UBKA 2A35A 5ALTA 2VHJA 4OQMA 5JSYA 3KUDA 4FI3C 3F4BA 4K0KB 4ILKA 4AWBA 3PA6A 5EZYA 4Y1FA 3IA7A 4RXTA 2O9JA 2B6NA 4L4UA 4YASA 1HNWB 1SOWA 3TQQA 1Z2OX 2JS7A 2W93A 5C7OO 4YJKA 4YJ3F 4XGQA 1OXVA 3ENZA 3E22B 3OF5A 2DWQA 5KPDA 2MDTA 5B58T 2DEUA 3ZGZA 1C81A 1G64A 1UKBA 3I04A 4OV6B 5AK0A 4ZALA 5A3SA 1XD9A 1G20E 2JKVA 2OZVA 2JBWA 2RGNA 4I81A 3RNLA 2E21A 3KXLA 1QYDA 1X13A 1LJLA 2OCKA 2XOXA 3Q2KA 1LV8A 1PR3A 1SQ6A 2JI7A 4KE8A 4MB2A 1MDBA 3ZYCA 1OWPA 2NUTA 5E4FA 3L7IA 3SBDA 2Z83A 2O8BA 1U7PA 1GO2A 5E7JA 2CKDA 4J6EA 5F76A 5EIAA 1IBRA 3UA3A 1NXSA 1YQEA 2QRPA 4DMCA 1ZMXA 1ZI8A 3RJTA 5CEJA 1A7KA 4PG6A 1H4VB 1OFHA 3FGPA 1E2DA 3ZWWA 2OG1A 1JQ3A 1U8CB 3THXA 1BWPA 1CP2A 2D5LA 1TMYA 4OHFA 5BSMA 1IIBA 1G2PA 3GELA 3WAJA 5ED4A 1D4AA 2A88A 2XDWA 1DQPA 3ILVA 2OD9A 4IIGA 3INGA 4RNDB 3BBLA 4A0QA 2WG0A 3COWA 1XNJA 2YQZA 5EWJB 1BX3A 4YMUA 3GLKA 4G4IA 1MA3A 4ME6A 4U1RA 5HS6A 1ZEJA 2EXXA 1GRCA 5KKAA 4KLNA 1SEVA 3GAFA 2A5FA 3D0OA 4OCZA 4EA8A 5B2FA 3C8UA 3OU7A 3V6MA 1K66A 3DZKA 3IP5A 4FR5A 4TLBA 4P7GA 3BWYA 2I55A 4QYTA 4QEDA 4W8HA 3N53A 3WL3A 4P5DA 3AR2A 2O05A 2YH2A 2GDZA 4LRXA 4WY2A 4P2GA 3IKMB 4JI0B 2O8DA 1MAWA 4CMJA 4K9OA 4UU8A 4POAA 4W5JA 3FYCA 3URMA 3I6ZA 4B09A 3DDNA 4TGLA 1JHQA 1OROA 1SB9A 2YNMD 3DZJA 4B2PA 3ESXA 3ZNPA 4BUJA 4GDFA 2GEJA 2VSYA 4AJLA 3RC3A 2Q62A 16PKA 3A58B 2E4WA 5LD2B 3KLPX 1ZUWA 1CWUA 2X4DA 1YRBA 1T9ZA 3GT0A 5AESA 2EAUA 1RPJA 721PA 1EBBA 3C7TA 4NNJA 1C7FA 4FEGA 2CUTA 5CA0B 3HLYA 3RVLA 4NYMR 3U7FB 3WXMA 1VSVA 2FW1A 1FMLA 4WZZA 4YMHA 2PGDA 2P3OA 3VR2D 5MGBA 1GPBA 4ZZIA 3IMFA 4G0PA 3AXSA 5LN1A 2FG7C 1CZRA 3OTGA 4O4LB 3VPAA 2J0QA 4OGWA 1I51A 5K20A 1U5AA 3USCS 5HQ3A 1NT2A 3B20A 2KPOA 1DZIA 1XTQA 3WIEA 4XRGA 1AQLA 1JMYA 2IJGX 3IVCA 1DV2A 1PQWA 1RLOA 2NU7A 2QPTA 5REQB 1SHLA 3NB0A 1ZW6A 1OJLA 3RWMB 4BX0A 1J5PA 2LUOA 2KMLA 2P78A 4HTAA 1EQUA 4MHSA 3PUHA 2YASA 4NBVA 4AUEA 2XAUA 5C31A 1FRNA 4ZRNA 1E89A 4BO8A 5TC4A 2PRYA 1IULA 2WWIA 3M4NA 3OP1A 3B8HA 4K9MA 1M2WA 3AVXA 3UHPA 3M49A 3QPDA 4QGHA 4O4HF 2R8XA 3FR8A 1J8YF 4A1FA 1KYZA 1NX6A 4REQA 4PAQA 3GEDA 4ABTA 4K6OA 4QAJA 2FGKA 1NW9B 4PLYA 1WOMA 4K6FA 3RFUA 1G8PA 3DQPA 3I37X 4C20A 2VYQA 3F8WA 1CUDA 3GIDA 5EWJA 2VXYA 4CNBA 4HLNA 1IHXA 1H23A 1W4RA 4TLLB 2M1XA 3JD0A 3D6JA 3P0FA 3W5HA 3W06A 4PN7A 3WLFA 1AGYA 3O4GA 5KVQA 5LIPA 4JEMA 1LRLA 1UOQA 1CX9B 1V3QE 1GNPA 1JSLA 4US0R 2W2XA 3IEKA 1QK5A 3IEPA 4REQB 4CFZA 2DR0A 3DE2X 1LV7A 2I3GA 3N3BC 5BV0A 4B74A 3MMXA 3QVGB 1QCZA 3T7CA 2IYUA 3OUUA 1E62A 3KIPA 1UJ6A 2Y93A 3F1LA 4RD1A 1NTOA 4ODIA 4RNCA 5EIBD 4LMPA 2X9QA 2HR1A 5CLJA 2OV2A 4BZXA 4AROA 2BPOA 3A6KA 1Z17A 4BBJA 3EY4A 4RCZA 2EEPA 4B8WA 4RCVA 1EAYA 5CVCA 1FX1A 1NLZA 2WG2A 3HSYA 4QARA 2FN8A 1XC7A 2NQTA 2F8MA 1PUJA 3D6NB 3UWPA 2OSBA 4D98A 2A9JA 3O73A 3L41A 1P0IA 5E7QA 1RAAA 1T2VA 3AIMA 3NV7A 3OQPA 3OI7A 4JN6B 1NNI1 1XKLA 2R1VB 3QZUA 3L7OA 2WOOA 5FWYA 5EXTA 1OX5A 1A5ZA 1HDZA 2C95A 2F6RA 2RH8A 1B15A 3MTAA 1QQTA 3OPYB 4JB8A 2I2CA 2C8JA 2X4GA 2GJ9A 4AMYA 1CT9A 3DW1X 2EKLA 3KVNA 1G59A 1EMDA 1EWRA 1GNVA 1Y3IA 2GM3A 1CPYA 3CSDA 3VXKA 3NNSA 4AP6A 4WCFB 3HPRA 2YOGA 3I2YX 1M8GA 1OC4A 1YE8A 3E70C 2CCKA 4MVJP 4A8PA 2JG3A 3F46A 2JFZA 5LUAA 4HLUC 1H2YA 2EVWX 2FKNA 4P98A 4G5GA 3CF6R 4RK1A 2FSVA 2VQEB 2P9GA 4NZOA 3EBPA 4DWJA 4YJ3B 1V8DA 3LI2A 3EZXA 2VJPA 3LY7A 3OCVA 5EWMB 5DBEX 1JWLA 2R7MA 4CEHA 2EC5A 1MFPA 2I2AA 4GP9A 2PYIA 1X39A 3ORYA 1E5DA 3WLHA 1UBCA 3K8YA 4X1YA 1Y8QA 3UV7A 1UBOS 3WZMA 3IURA 1F2VA 3M5DA 4RXMA 5IT9A 2FK8A 1JS1X 2VDNB 4QIHA 3SGLA 3DBRA 3USES 2FR8C 1IRIA 1EXNA 1RM3A 4BRSA 9GPBA 2QIPA 3IR5A 1J2UA 1LU9A 2W11A 1KE2A 4ENWA 5I4KA 1HZZA 1ZD4A 4KBGA 2VUUA 4L6IA 4BQOA 1T10A 2HPZA 3OE5A 3D43A 4TV8A 3ROEA 2YWFA 3B6IA 3PCTA 4ZT4A 4ISBA 4S1OA 4YCMA 1XEAA 1F0YA 2HIMA 2CMFA 1P2DA 2IGTA 4PNHA 3P4XA 1ZEMA 3EGWA 3OFVA 4JMLA 4DA9A 3BFJA 4DKXA 1EWKA 2HPVA 5GVSA 4AKIA 4HS4A 3RC1A 2IEGA 4QBGB 4JJAA 1GUFA 1M0WA 1OE0A 4QUHA 4XWTA 2EOAA 2VDQB 4H7FA 5DMXA 3KWJA 5B64A 3K92A 5IJAA 2FQWA 1L5HA 1N3LA 3YASA 3ZX4A 5KQRA 3DP9A 2O7RA 1JJFA 4RKEA 2QTAA 3HUFA 4D8TA 5LWQA 4QGSA 1VKHA 1Y9ZA 3QLJA 4OREX 3QMVA 3MT7A 4CLHA 3OLZA 4DC9A 2CDAA 1JHDA 2JARA 5K8UA 1CQIB 3TE6A 3WRWA 3LYHA 2AH5A 2WWYA 3EAFA 5HM8A 1FNBA 3SC2B 4JZYA 5TR9A 1KORA 1ZO8A 5CHEA 4RA9A 1NQTA 4BNHA 2FWMX 2HWXA 2Q6VA 3S5UA 4G0VA 1HXHA 2NSHA 3SBEA 4BLPA 3NTQA 1IDOA 4ON9A 1ESZA 2HMTA 3FMFA 4WPGA 4A92A 4C0AC 2PS3A 3NPAA 2Y1GA 1SKUA 1RYHA 1RXIA 5EJ9A 2AZDA 3MBKA 1DTEA 4HBGA 5HVNA 5K2OA 1VA5A 2R5NA 4MV7A 4II3A 1CLUA 5BN4B 4A23A 4BEWA 5BQ3A 4QOIA 3KSBC 2XWQA 3CTPA 5KOIA 2D54A 4WXEA 5L3QB 5T8KC 3ZI4A 3WLQA 4RTQA 3HDHA 4RJLA 2PJDA 5JXWA 1OOEA 2AFIA 1YCGA 1QHHB 2IYOA 3KZMA 5FUXA 1U63A 4XIGS 4E5KA 4AMUA 1P9NA 4ZPXA 3F2VA 3UAOA 3WLIA 1LTHR 2XV1A 4LJRA 1TAHA 4L9RA 2VAVA 3AERA 1EU1A 4GQIA 3H0EA 4RPLA 1EJ0A 5CJPA 1NPTO 5ESDA 4DLBA 1U5BA 1R00A 1G6OA 2OHGA 3DE3X 4QVIA 4FMBB 1GZHB 4B7XA 2QZZA 2KB0A 3F2IA 4I55B 1N75A 2MSDB 3I9KA 3IAM1 2ZLBA 4JCCA 4WK6A 1T6YA 1YQTA 2JVIA 1JB1A 1FDWA 4DBVO 5B6JA 1VI5A 5K45A 3QP9A 1VLLA 5TPWB 1NVEA 4YGYA 5CT6A 4D4LA 1XCLA 2JGRA 2WSBA 4NV1A 2NIPA 3PNOA 1MO4A 4XEHA 3NMUF 3SCZA 3E9CA 4FU0A 5FPQA 4ZFNA 1K86A 3MJVA 4HHEA 1A98A 1IVSA 4QVGA 3KBBA 3V4PB 3L84A 3K0KA 2I67A 2O5EA 2XNCA 3OKPA 3ABIA 1ECFA 2FMIA 4ZV9A 1U4NA 2P40A 5CNJA 1W9HA 2B21A 5DRYA 1IUOA 2OCYC 1VCHA 5DOVA 1QH0A 2CBZA 2EJUA 2OC4A 3EARA 1KL7A 1T8RA 1TZKA 4BGIA 4B3SB 1O77A 4FE4A 4Q37A 1H0SA 1QGAA 2WMYA 3UHJA 4DNOA 3EEOA 1ZJWA 2XRMA 1XWFA 2YUIA 5AJTA 1QHGA 1E99A 4D9CA 3I01M 1NYTA 1GDDA 1AQYA 1BNCA 1F8XA 2GBLC 1VMAA 3BE4A 4KXMA 1YDMA 2HRCA 1VCOA 3I9NA 3OTIA 4UVIA 1Y48E 2VNAA 3HA7A 4JOCA 2I7XA 3ZV6A 3LT4A 3T61A 1BFKA 1CUFA 2YNMC 1DVRA 1C9MA 1G3MA 3CNBA 2EF0A 4C87A 4D8YA 3V7NA 3CNEA 2J45A 4QDXA 3DOCA 4GVLA 4GT1A 4IM7A 4DUYB 1CJBA 1VP3A 2FPOA 2ZU0C 3HI6A 1ZOLA 3OO0A 2P9EA 3D8NA 1PTJA 1Z68A 1F1BA 2HGSA 3RUHA 1EDZA 2RBKA 1W0KA 1Z2EA 4KIFA 4AS1A 2ZBFA 2VJBA 4BB5A 1IFXA 4RQUA 4E5SA 3EEQA 2V6JA 3WA6A 2BH9A 4UPDA 2W70A 3T4XA 4D6YA 1L7RA 3GGGA 3K30A 4G67A 1BYUA 4O2AA 3QVXA 3EVZA 3ELYA 4NMXB 4IL5A 4R51A 5CXSA 4UPEA 3K70D 1O57A 1C3LA 2F1OA 4DR1B 1G21A 5K05A 3PRYA 3CR3C 1XU4A 2H0AA 3EODA 3OIVA 1N77A 2R8BA 1TLTA 1UPBA 1KMQA 3NYRA 4RF3A 4F5YA 6CHYA 1G1AA 3C6YA 3G6WA 3KOOA 2QIOA 2YN4A 4KGVA 4N40A 4FB4A 2XCTB 3AVYA 1CJMA 1RZ3A 1CB7A 1JYSA 1ZP6A 2E7ZA 2FP4B 4OQPA 2W4IA 4X8LA 4C0HA 2AEFA 4QSMA 1U2QA 4RYDA 4EFKA 1W5TA 1WHSA 5JLJA 1Y4UA 3A1NA 5CIWA 1GTVA 2XH8A 1E2EA 4HDMB 3KQMA 2EARA 3L7LA 3KKPA 2AFHA 1XZBA 4OBBA 3LH5A 1KDRA 3NGMA 2VT2A 5CBPB 1G8KA 2VNSA 2JH3A 4C9BA 1K6EA 5D3MA 5DHPA 2W6IA 4ZQFA 1G19A 2FPGB 1T4GA 2G04A 4DMLA 2IBSA 4K87A 2HJVA 4B44A 2P9ZA 1DAIA 1PJCA 2C2MA 3PGVA 1AG9A 2BBOA 5TQ2B 3TZKA 3MWGA 3TJRA 4ZDIA 4J7AA 3JZAA 1C7JA 2PZFA 1SCUA 2A58A 2UZ1B 3CLTD 2NPFA 3NOQA 3ICWA 1R88A 3ZN2A 3DR3A 4WOPA 2G1KA 2CSXA 3GXOA 1FRZA 4QM6A 2Q6OA 1X7ZB 1A2QA 1FFWA 4IIJF 4LVOA 4Q1EA 4EY5A 3T5PA 3CEAA 3TG8A 3NHAA 1Y3CE 3KSUA 3Q8KA 2CVPA 1AD2A 2FN4A 3C8MA 5GJCA 5A3VA 2Q4BA 2C9MA 3BWVA 2Z6AA 2QY9A 2WLSA 2ZRPA 3CZCA 1X7ZA 4D9MA 1HQDA 2R87A 3IHLA 3NJRA 1E0DA 1N9KA 5KYWB 3SYTA 5LU8A 5FR1A 1GGNA 1DKLA 2DPHA 3DE6X 2VLIA 5KUTA 4YHHB 2WJWA 1U2RA 4NCXA 2AR0A 5AVZA 1JEQB 2V7TA 4RPIA 1RFGE 4C0XA 1TTQB 4LXGA 3X2SA 2HLNA 2Y0BA 5FUWA 1QV7A 2JLZA 2CLIB 1PS9A 3SHQA 3F9IA 5HKOA 5HE8A 2ZR7A 1N5JA 2VN8A 1MG0A 2LXNA 3PNQA 2X1VA 1KZ7B 2JBAA 4M46A 3UANA 2H9YA 2AI3A 2N46A 3CHYA 4Y2QA 5E2IA 4M60A 4LRWA 3RT9A 1JG4A 1YXMA 1PSWA 1TCBA 3DP7A 2A9VA 2FMXA 3BMNA 3HNOA 5FBWB 4JYMA 3W2TA 3UMVA 5GTDA 4M7RA 3ZLJA 1A3CA 1N2ZA 1RQPA 3FTNA 4ZQCB 4NYIR 2ZSFA 1A5SB 1CFJA 3B1WA 4R40A 3O6VA 1JLSA 3ZZNA 3C97A 5CFMA 5CITA 2BEVA 1WVIA 1M34B 2L42A 2X8WA 2Y27A 3FGZA 4P4GA 3QKRB 1SHJA 3VR4A 3O4FA 4C4OA 2XT0A 1VYHA 3IKTA 3EFHA 4XVUA 1ETHA 3TH5A 1K6MA 2X8LA 4LFCB 1Z0SA 3FOFC 3WGYA 2YN0A 1DAOA 3BREA 1U7ZA 5TARA 2IH2A 1SG0A 4TLMB 3I1YA 1HKHA 4TVBA 3JWHA 2YR0A 1RT9A 3AO0B 4N6GA 5PNTA 2PT7A 3O93A 2OB2A 1N6HA 4HLDA 1SVNA 3ZHBA 2OZKA 3WGOA 3MT9A 1LBHA 2CYAA 2PFSA 3QXXA 5A7HA 2PL5A 1Q1BA 2O1XA 1J25A 2OAQ1 4GOXA 4TXHA 3H4MA 3G7NA 3IAXA 4LBWA 1XPOA 2VBIA 5FV7A 1RVDA 1TMGE 2RC6A 4PLGA 1JL3A 2O8CB 2H3EA 2NPIA 3G9XA 4GPAA 1F8GA 3P27A 2BDTA 5COBA 1RE0A 1RYNA 4HTFA 4MIKA 1YFJA 1I13A 3BA1A 1PJQA 4R2HA 5A71A 3W78A 2O06A 1C8LA 1U7XA 4IBOA 4JA2A 4MLCA 1IQPA 2GZSA 4MQUA 1NUUA 4B6JA 4L5JA 4Z51A 1K63A 1X7WB 1L1QA 3RR2A 2EZ4A 5DX1A 3FPBA 3I0NA 4EJSB 1DLJA 1S3GA 4JC5A 1K8XB 1L4MA 3DDZX 1JEYB 4DT1B 3OURA 1DT5A 3F5SA 2DHDA 2FOIA 1P2VA 4Q24A 1A9YA 5THQA 4RJ2A 3U7EB 2A2ZA 4G1VA 2V9ZA 4DG8A 4JHLA 2HBRA 1FFXB 3AKDA 4RETA 5AKZA 5LZ2A 2GRJA 3CVUA 4DJJA 3GCWA 4BQPA 1IZ8A 4C2BA 3PDHA 2EIHA 1SU7A 2VL7A 1CY4A 1THZA 1UFKA