1QVZA

Crystal structure of the s. cerevisiae ydr533c protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
236
structure length
235
Chain Sequence
APKKVLLALTSYNDVFYSDGMKTGVFVVEALHPFNTFRKEGFEVDFVSETGKFGWDEHSLAKDFLNGQDETDFKNKDSDFNKTLAKIKTPKEVNADDYQIFMASAGHGTLFDYPKAKDLQDIASEIYANGGVVAAVHGPAMFDGLTDKKTGRPLIEGKSITGFTDVGETIMGVDSILKAKNLATVEDVAKKYGAKYLAPVGPWDDYSITDGRLVTGVNPASAHSTAVRSIDALKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YDR533c protein
publication title Crystal structure of the YDR533c S. cerevisiae protein, a class II member of the Hsp31 family
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
total genus 81
structure length 235
sequence length 236
chains with identical sequence B
ec nomenclature ec 4.2.1.130: D-lactate dehydratase.
pdb deposition date 2003-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qvzA00
2VXOA 1CE8B 3EZGA 3TTXA 3NORA 3MIIA 3ZJ4A 4ENQA 4ENWA 1I7SB 4GE3A 4PXYA 4UOQA 1KA9H 3SOZA 1UCFA 2GHRA 5JZMA 5JZOA 3UMMA 3EJ6A 3PQ2A 1QDLB 3D54D 3B36A 1L9XA 1Q2UA 2YWCA 3NVAA 3TTWA 1J42A 1FY2A 1CS0B 3ZR4B 4AUEA 1OI4A 3UJNA 4QYXA 3L3BA 2XF2A 4Y1RA 2YWJA 1I1QB 1P7YA 1U9CA 2AD5A 1GG9A 1SY7A 3L18A 3L4EA 3MGKA 4RKWA 3R75A 3FIJA 5SYAA 3TTTA 4ENPA 4ENSA 3WFZA 4GUDA 1Q7RA 3CYFA 2W7TA 3PQ5A 4I46A 4N0MA 2A9VA 2H2WA 5SY6A 1WL8A 4UZSA 1T36B 4LGYA 3RHTA 4B5KA 4L8FA 4OJYA 3P9QA 4L78A 2ZUSA 2ZUWA 1VCOA 3P9SA 1QF7A 4XLLA 4ENVA 4OIFA 3ER6A 3UK7A 1T0BA 1BXRB 3NONA 1IZZA 1K9VF 3OT1B 4MNTA 2VRNA 3TTUA 3UGJA 4OGGA 2FEXA 4LRUA 4P34A 1O1YA 4AJ9A 3R74A 1OX4A 4ENUA 3GRAA 4B31A 2ZUTA 4BTEA 3PQ8A 1P80A 4MTCA 5LIRA 4ZGGA 3PQ3A 1VCMA 1P5FA 4Y1EA 4L8WB 4L7QA 4OGFA 4GE0A 4Y1GA 4BIMA 4UOZA 2ABWA 1KEEB 2WJZB 1KXJA 1ONSA 4L8YA 4D1YA 2VDJA 3B3AA 2YWBA 1S1MA 3NOOA 4P35A 2RK6A 5DFAA 3R76A 3TTSA 4P36A 2ZUVA 2D7JA 3EN0A 4P5PA 1GGJA 3NOQA 1I7QB 3L7NA 3VU3A 1JDBC 4UCFA 4QYTA 3CZAA 2IUFA 1M6VB 2R1VB 1PDVA 3B38A 4ZDIA 2V4UA 2VKTA 4N12A 3TTYA 4B2YA 1IPHA 1QWSA 1SOAA 1T3TA 5SY9A 3SF8B 2GK3A 1C3OB 1JVNA 2R1TB 3UOWA 2NV2B 3TQIA 4B40A 1N57A 3CY6A 4I4NA 1P7ZA 3N7TA 1CF9A 3BWEA 4L95C 1PDWA 4ZDJA 1GPMA 1OY1A 4OFWA 2RK3A 2YWDA 3PQ6A 4K2HA 5K4AA 3ZJ5A 4I2NA 3OT1A 5SY4A 4ENRA 1OX6A 2VPIA 3EWNA 4WXYB 4Y1RB 1C30B 1A9XB 1GGFA 1P81A 3F5DA 2R1TA 3SF8A 1PV2A 4ADSG 4R7GA 4AUMA 1GGEA 4MGHA 3CNEA 2LXNA 4AULA 3KKLA 1OX5A 1QVZA 4OQ4A 4S0ZA 4ENTA 2RK4A 3NOVA 3F71A 2ZUUA 3PQ4A 4UNIA 1PE0A 5E9AA 1VCNA 4E5VA 1FYEA 3CZ9A 4BFLA 4E08A 2ISSD 5IP5A 1G2IA 3BHNA 4Y0NA 1KWKA 4B7AA 3P9RA 2R1UA 1VHQA 5BV2P 3TTVA 1R9GA 4ZDKA 3FSEA 1GGHA 1QVVA 4HCJA 4AUNA 1OX4B 1IZYA 1GGKA 3PQ7A 1GPWB 1QVWA 4P2GA 4Y1FA 1KWGA 2NV0A 2OR3A 2R1VA 4WINA 3P9PA 4JQSA 3EFEA 3M3PA 2AB0A 4RKYA
chains in the Genus database with same CATH superfamily
4YAUA 2Q46A 3PXBA 4ND2A 1QG6A 2J6CA 1Z74A 1K27A 2BJWA 1U0FA 5EVJA 3C3JA 5L3SA 3MIIA 4UEQA 3W05A 2ZT6A 2HA2A 2OBMA 2OCDA 2CFOA 1IVYA 1NN5A 3TM4A 4K88A 5DX8A 1ARZA 4B2PA 2QD2A 1RRKA 4XFDA 2A1IA 1KK0A 4G0ZA 1GCGA 3UICA 4AUEA 1H85A 3VV2A 1MH9A 2I2XB 4R2WA 4RTMA 2FGJA 3Q2KA 5EWMB 3NRBA 3SFVA 3N3BC 4F2PA 1VI5A 1RBQA 5D51S 3CTMA 3KKMA 1Q0RA 5K8LA 1UAGA 2AE2A 2Q8QA 3G2KA 3EG9B 3UMVA 3AUJB 1CJCA 3ASVA 3QE2A 3C6ZA 2HRZA 3UUWA 2RKBA 2CXOA 4HZGA 3U6KA 1CX9B 4HDSA 1RMTA 3WSWA 2O0JA 4A16A 4K6CA 1WSWA 1XF9A 5EWMA 1E32A 4P6VF 1QH1A 4DCPA 1W88B 3RTBA 5C3MA 2Q5CA 3U6BA 4RKFA 1N36B 3PGA1 1QE3A 2WJ4A 3ABOB 4GQAA 4C0WA 3P71T 3OFVA 1ORIA 2FSVA 3EG9A 1I0ZA 3T3DA 1YZKA 1RQ2A 1YE8A 4XGQA 5DVZA 1H2EA 2QD4A 2BZGA 1Z39A 1KZHA 5AI9A 1I9CA 1K4YA 3ZWMA 5JJLA 4JLMA 2AG5A 5DCWA 1Z0IA 2D7CA 3AEQA 4FX5A 4L7QA 3IA7A 1PL8A 1S96A 3VKGA 4J0QA 1XMJA 4GOXA 5FTWA 1CKEA 1JU3A 4QYMA 4YP1A 1U28C 4GC9A 5D3ZA 1VCHA 3JQAD 3MFYA 2OFPA 3UUEA 1OPRA 3GARA 4UAJA 4PM4A 4NARA 1ZNYA 2NXEA 3T9BA 1UODA 3FYSA 3L0DA 2FZWA 1PGNA 1XVLA 1YHNA 1JDBC 2GVDC 1BVRA 2ISCA 4FDUA 1XFAA 4EM6A 3NYQA 4DIFA 1M6VB 4ZVNA 1WKBA 3A25A 1O2DA 2C2WA 4MUMA 4O4HA 4BNUA 4BP3A 1EJ2A 3ITKA 1BWPA 2VP2A 2YFYA 4B8WA 4CNBA 4DV4B 3UHOA 1FDOA 1KBOA 1ZI8A 2AUTA 3EH1A 4H7JA 1HYHA 3M4ZA 1BOOA 3OICA 5DHFA 5AUQA 3BFXA 4QJ3A 2G17A 2XD4A 3M4XA 4DLXA 1VZ3A 5AW4A 2J0VA 1Y3FE 3RS7A 5IEBA 5ADWA 5HK8A 2ZU6A 2ZWPA 2VPIA 1GEGA 1Y9AA 4QL3A 2RARA 5KINB 2C42A 4JC8A 1GZDA 1P60A 5CVTA 2FLVA 1KGDA 1ZCBA 3JALB 3LDFA 1UZNA 4R1NA 3RYHA 3SZGA 3LOQA 4KN9S 1EGVB 2W00A 3UUFA 4LXIA 2QBYA 4ON9A 5IXJA 2I4LA 1Z17A 2RH9B 5L95A 1KYTA 3AKYA 4G4IA 4WFIA 3QMVA 5K3OA 1SA0A 2GD2A 4MVJM 3I9LA 4CCSA 1LDYA 3UOAB 5GINE 4L16A 2W93A 4TT8A 2P67A 1S2MA 4LJAA 4Q1VA 3FVRA 5TMEA 3R3VA 5KYYA 1KQFA 2PZ8A 5CP8A 5FPHA 4M1YA 1YB1A 1M2GA 3LT4A 1UAYA 6NULA 1FOEB 4YA6A 1KIAA 1MAHA 3MAAC 4L0CA 4RVFA 4WVLA 1U3WA 4G0YA 2X4GA 3EDQA 1QONA 3E9DA 5CK5A 4D7AA 5ITZB 4EI7A 3AR6A 3WA6A 3OWOA 2ZREA 3WOVA 1WUJS 4LRWA 1MX5A 3SI7A 5KNDH 5THXA 5LUAA 2DBVO 3NBFA 2IY9A 4LMPA 1VE5A 5JS1A 4DMFA 1FY2A 1TNDA 1KHHA 1OXVA 1GXSB 1P7YA 2GPYA 7REQA 1M54A 3AX6A 3VYVA 2FPMA 4DQXA 4ZMRA 3ISJA 2QTMA 3RW9A 3TLCA 4NDNE 4RMNA 2CVQA 2QU8A 1T5TA 1JIIA 3JWHA 1B0UA 5JARA 2DXIA 2EP7A 2X15A 1DJPA 3G1TA 3NC0C 4EZIA 2ZIUB 2FMFA 4QGFA 2Q4BA 2VP6A 1IHYA 2PT7A 3CUKA 3OEED 4MRMA 1VCOA 3C6MA 5F9MA 2R5WA 2XGOA 3SVTA 1AUQA 3UFXA 4AJEA 1IHOA 3O31A 4TTPA 2FI1A 1BH2A 3MA0A 4DIDA 3R40A 4K9PA 4M83A 2IEIA 4GIBA 2RGWA 4EG8A 4EEZA 1FS4A 3JQCA 1W4BA 4NZYA 2VPTA 4PFSA 3DZKA 1H4TA 5JCJA 3UMJA 5ALZA 3H4MA 3O8OB 1QIKA 2FWBA 3E3NA 5HILA 4BMNA 2Y9PB 3GZJA 3LHIA 1A5SB 3SJCA 1DJOA 2EL7A 3UJ8A 4ZYLA 3S70A 1KEZA 3I83A 1THTA 4LJRA 2I1VB 1KDPA 1V9LA 3LV8A 4N5IX 1F4PA 1A2QA 1EAYA 3EIEA 2ZUVA 4MMXB 4U0KA 4XD7A 1TJ5A 4F11A 2XE7A 3T35A 1PZGA 2QTVB 3F8SA 3R3YA 1C1XB 4I99A 5DBOA 4N5HX 5C52B 5DOZA 2OUIA 3AF2A 4Q12A 5BY2A 1BXGB 2G9QA 1PKEA 1UKZA 2WBLC 3JASB 4C4PA 3OZAA 1Q7GA 1FBTA 1RE1A 3AEXA 3K6KA 4QWWA 5L7YA 3O3MB 2YQ5A 1M8KA 5LL6P 3W3ZB 1DKOA 2V55B 4MPRA 1TYBE 3T7RA 1SVUA 1O9BA 3MTDA 1GR1A 3KUXA 3DZ8A 4IDGA 4DV3B 3KR1A 3OESA 4MW2A 4BMVA 3BD8A 1UZLA 3NHWA 4LRQA 4CM9D 3MMZA 3HA5A 4DSZA 3JASA 4RTJA 1P45A 1WG8A 2PGNA 2PU5A 3ECSA 2X2OA 3LLMA 4L51A 2FJPA 3W04A 2OM2A 5IYZB 1F5NA 3GLQA 2EWVA 4LV5B 3QNWA 2HPZA 2QLBA 3D81A 5EWJB 3ZE1B 2HIGA 3S2IA 5LC1A 4YJ3F 1MRNA 3DMYA 1GZ6A 2ROQA 4G5QA 3BHNA 3E9QA 3GRZA 1UPXA 1KRHA 2WHRA 3LP5A 1QFZA 4HBGA 4JQOA 4NMXB 4Q66C 4BMSA 3FWKA 5KWVA 3ZOZA 2QUBA 1XMPA 4YP7A 3RV4A 5BOSB 3BIJA 3KDAA 1H23A 3DEFA 1L5FA 4JQCA 4V0OA 4Y67A 5CPBA 3RC3A 1SOUA 1GNLA 4RHYA 3SZLA 1P2SA 4UNQA 3TRFA 4CL8A 4EKEA 2QRJA 4Q6BA 1ISFA 1H3FA 5L6LB 2J9YB 2Q4DA 5DSTA 4FD2A 3DDUA 4AKSA 3ID6C 2OAGA 1NBMA 4TTVA 2XUIA 5ALSA 5BMVA 1Z4NA 1O4WA 3L0IB 4MQEB 1VRWA 2WJYA 2JLRA 4AUKA 3V4RA 2H31A 3VH1A 4G0VA 1AS2A 2UXBB 2B37A 2FUG1 1ZRMA 2B5VA 4N4AA 2R4UA 4UVDA 2OXTA 5IX8A 1YMUA 4WZAA 2XKJE 1XRSB 4LMBA 4WCFB 4FTWA 2DX7A 1YU9A 5DB4A 3ZKWB 5IANA 1PJCA 2ZJAA 4QYXA 3WFIA 4I36A 2O48X 4N1AA 1PFYA 1K6IA 4UUBA 2XT6A 3R75A 1GG2A 4TKUA 3LWZA 1W35A 1O89A 1WY5A 2IY8A 5COQA 1E66A 1QK3A 1A9PA 3JVEA 1QKKA 2CZCA 4UDYX 5KS2A 5SY6A 5H4GA 1VMAA 1ZEJA 5JXWA 3PK0A 4OXNA 1HYQA 4FE4A 4P3YA 3BMCA 3ICEA 4FXOA 4OJQA 4H6WA 5H1YA 3QEBZ 4Y0AA 4C7VA 4Y9TA 5CNIA 1A5BB 2IYXA 3RASA 4GWKA 1JT2A 2IOHA 2W2NA 3FTCA 3QLJA 4G07A 4JUCA 1QH8B 4YS6A 4DV2B 3GUCA 3LVRE 5J2UA 3HO6A 1FMFA 4RPKA 4P5EA 3M6AA 4ZQHA 5ALDA 4OQFA 1DAFA 4ZYVA 1IJEA 3SM3A 3EMDA 4ZYYA 3A6LA 4Q1FA 1GV1A 4G5XA 5B1HA 1K92A 2QKYA 4HC4A 1OIWA 2HC9A 2E4XA 3GDOA 5FOXA 4BN5A 2EKDA 2IOYA 3I1FA 3PUWA 4M53A 4JLUA 3S40A 2PGXA 3RPEA 4HDNA 4DA9A 1QH8A 2NZ2A 1G6KA 4EB8A 2AOTA 2YBDA 4UJ5A 3ZYCA 2G06A 2K2WA 3EQ6A 2Z0MA 4D02A 4WK6A 1QHYA 4MVJP 2XCQA 1LV8A 3DEHA 3RSLA 3LNCA 3VAAA 3FHOA 1FNBA 2H7XA 3O4VA 5LU9A 2IIQA 5CH3A 2X9QA 1R0XA 2BH9A 4OVKA 3PC3A 3JTMA 1E1CA 1OREA 2XUAA 3A31A 3KD2A 4LDJA 4TYWA 1Y5LA 2HO5A 4MYCA 3TLKA 5JSHA 4C14A 2XKBA 2RG7A 1EFVA 3D8BA 4YASA 2O2EA 3V80A 4UVHA 1GPMA 1T2CA 1G98A 1D5WA 1WU8A 1UH5A 1K2WA 3SFTA 1YRBA 4ARZA 3H1EA 3ZNOA 4C6SA 2XXAA 2AC2A 4MEJA 3G2QA 4Y9UA 3K0EA 5H3HA 1REQA 3Q41A 2QLMA 4UHHA 5KJEA 4E12A 4TM7A 4UBKA 5EKSA 5I4IA 4P0PB 10MHA 1JWAB 5HCNA 1A2OA 5IKXA 5EA2A 3UENA 1N6IA 4JVOA 4YALA 4RTLA 1MXHA 1VECA 2HN9A 2J87A 2C5FA 2Y2UA 4PFQA 5M3BA 2WTBA 4C5AA 3IAM6 2VAPA 1CYDA 1NQOA 1W0KD 1YRLA 4Z9AA 1OX4B 2PU7A 4JGBA 3IB6A 3R7DA 3C7KA 5CLHA 3VPFA 1NI4B 5K01A 4EF4A 3DEJA 4LGVA 4W5NA 1ZG3A 3H5WA 3MQFA 4WJZA 2PL3A 4NCBA 3COSA 5KYNA 1Z5ZA 4RA9B 4ESOA 1LUAA 3B6EA 2DY0A 2W6OA 3H42B 4AP5A 3WO1A 1XIVA 3GOHA 1ZNXA 1U11A 3AM5A 3KQYA 2GBCA 1OWOA 4GI5A 4PPNA 3CJQA 4A6XA 4HVAA 3DFUA 4DRZA 3LBIA 4R2KA 1LK5A 1X9HA 1XCGB 2F1RA 4Y6GB 4ZOQI 2WG0A 3JWEA 3I32A 3NVAA 4RFSB 3H5AA 4IMRA 3AB8A 2WMNB 1CQWA 4X60A 4D8UA 3IDAA 5G0SA 1BJTA 4DCTA 5EIBC 5AUNB 4R1PA 1T10A 5EE9A 1UMKA 5FR2A 4B76A 2C4WA 2EFEB 4P0QB 1NPDA 2Y1FA 3ZI4A 1S2IA 2F3PA 1QUFA 3S29A 1OZ0A 3VU9A 4X41A 3UV3A 1PNVA 1E4OA 2UZ1B 2WEKA 3HE3A 4G97A 4PQGA 4RFSA 3RG2A 1WV0A 3BTOA 4NJMB 3RUPA 1HSOA 4ALNA 1F6DA 2QW0X 1E0AA 2QQFA 3SQLA 2PBLA 4PGAA 2IXTA 1Y7TA 4R98A 2WU1A 4NMMA 5F33A 1Q83A 1VB5A 1CUZA 3SC3A 3U4HA 2P3LA 3ER8A 5TMBA 4EUEA 2D5AA 3HCRA 4JUFA 3C1UA 4LOKA 1FTYA 2WB2A 5IAJA 3JWJA 3L8CA 4MPTA 1JFRA 3FOFC 4ZCIA 1QVAA 1G5RA 1F14A 1TAGA 3EDYA 4UHFA 4Y1GA 3UB4A 4LF7B 4C2TA 3W9BA 1E2JA 2VJDA 3ECCA 3HJRA 4A1FA 1VJTA 3EQ2A 3KX2A 1BC5A 4GRIA 4ARIA 4FDAA 3QVVA 4NR0A 4DIBA 1YCFA 1PBNA 4G0MA 4V0NA 1EFKA 1UFQA 4Z8YA 1NW6A 3SQOA 2NTYC 4F91B 1SPXA 1IN8A 3A3YA 1PZHA 3DJFA 5B58C 1PR9A 2F3UA 1I1NA 1RJ9A 1U04A 3HWX1 3QGMA 4ETWA 5HHTA 4JLBA 4BWGA 1LFAA 4JOQA 4H1WA 4G0WA 4LHEA 3OX1A 4YCDA 3DKVA 3N8KA 3H5OA 1YDGA 1TFUA 4JDPA 4BFUA 2J5QA 4WFKA 1HLDA 3DV0B 2EZ8A 2K5UA 4DRYA 4W5HA 2CXNA 5JUWA 3A7EA 1XYVA 1SGWA 1WW8A 1MW9X 1QGDA 4MARA 4DUYB 3HRIA 3QVJA 2AF3C 4O2RA 4D42A 5KQLA 4HS4A 1N6HA 5FLKA 4N48A 4W1QA 1YZFA 2GN1A 1L4YA 3AXTA 3DUFB 1JHYA 3GNTA 4MUIA 4TL8A 4IDNA 4X84A 3CUVA 3P5SA 4URWR 2WD9A 5BSRA 2MR6A 2WTEA 1FFGA 5A2QA 2C9MA 2EX4A 4G01B 4RGQA 3TXAA 1CUHA 1M1YB 3HVJA 5THQA 3ZWQA 5JCJD 1Z3IX 3SIWA 3U5TA 2KBEA 3LLUA 4FR2A 1SHZA 1U6IA 4OUDA 1VCNA 4YJ2A 1VBMA 2J4FA 4OBXA 4EEXA 4EY8A 1DKMA 4L9RA 3BK2A 2FZ5A 5EYPB 3CZ5A 5KQGA 3N76A 3HXPA 1W46A 4JEIA 4XD7D 2P75A 3G9ZA 4HS9A 1KMQA 1Q7TA 1MG5A 5E2IA 4P3NA 3ROMA 5KDDA 3N0VA 2FN3A 3NQ41 2V7QA 1M1YA 1NVKA 2VA8A 3M83A 4NWIA 4TMWA 2HH9A 3T7CA 3G2PA 5KYWB 5AW5A 2VF8A 3WE7A 5H80A 1CDEA 1UZUA 3I04M 4BLOA 1TJPB 4YV2A 3PXXA 3VI3B 1ORWA 4Q3KA 3C3CA 5EYPA 5GV8A 2LWIA 4KO3S 3BTUA 4RJJA 1AXRA 5CCDA 3MTGA 1LSSA 1N5OX 4HSEA 3GVPA 4S1TA 3W4IA 4PXSA 1POWA 4NU6A 1XVUA 2QPLA 4FB5A 5C7LO 2PV0A 4M2LA 1BS2A 1SVOA 3EBPA 1QK4A 3CRW1 1AO0A 3SYKA 3K8ZA 2DUJA 4YUAA 4G1CA 4MLZA 1ST2A 2PNFA 4BO1A 5BVHA 1RAEA 3BIOA 1GZ5A 1QOZA 1D6MA 2JIQA 2OZVA 3A2KA 3WX0A 4UQLA 2B4QA 4WH0A 2IV2X 4E4TA 1JTEA 1KJZA 3KEOA 1R3DA 4HZIA 3NDBB 2PZEA 1LRJA 3IAHA 4IFIA 4RY8A 5CFMA 1WXQA 5EKDA 2WIDA 1DAHA 2DWQA 1J8QA 3KQTA 4OIMA 1C9KA 1FFSA 3ZYZA 2WPDA 1A97A 2QZPA 1H5UA 3KO8A 5BW5A 3T5AA 2EGUA 1M0TA 4C7BA 2YASA 1G4UR 1NSYA 2F6RA 3MTEA 4JU8A 1W59A 1N6PA 1MAAA 2DQSA 3DC7A 3JQPA 3KOYA 2QD3A 4UAGA 5EJFA 3V1NA 3ZV4A 4LDPA 5JI3E 1D9ZA 1K4KA 1ZZGA 1RWKA 2QN3A 4KGVA 5K3EA 2DHDA 5EZ5A 5E6UB 5BNIA 2LV8A 2GEVA 4BECA 4YIHA 1YZGA 3N6RA 5KC8A 4UQPA 2H18A 5HMLA 4S3MA 2Q5HA 3IPRA 3TEMA 2HYDA 2BELA 1NBMD 2GYYA 2PMKA 3W5HA 3WIEA 2BF4A 4XJVA 5LQRA 5BYJA 2PNJA 1QJCA 2QYSA 4Q03A 5K0NA 1LPBB 1X1EA 2FPPB 5C8VA 1QOPB 1CUJA 3AR9A 3W5JA 5F12A 1HZZA 2C4TA 2ZBUA 4G6ZA 4MGYR 3ACDA 4F4FA 4WT7A 2QNIA 4C2UA 1K5PA 4MIKA 5KSOA 3FCOA 1QFXA 1EDZA 5AI4A 2CHUA 1ZICA 2EZUA 2J8ZA 3L7MA 3ZHCA 1H2YA 4JUAA 4M89A 4FCTA 3RUDA 2C8JA 2Q2OA 2JLBA 2A84A 3T9EA 1E6CA 4M86A 2WIKA 2X4DA 1JVNA 1AKVA 1TJNA 3MMSA 4OM7A 1LBSA 1UJMA 1CJSA 4I66A 3BF8A 1HDRA 1L7NA 3IUMA 4KVZA 4M60A 3U19A 2D54A 1JSCA 1NHWA 5J1TB 5IJZA 1EUCA 1FMTA 3WDSA 2BFFB 4M36A 2D7DA 1CZRA 2ZS7A 1QIHA 4EB0A 3PWSA 3GBSA 1MOPA 5JT1A 3ETGA 1EM6A 5HRUA 4IHJA 3KSAC 2FPKA 3H0CA 2EKZA 5GJWC 5I7FA 1YI1A 1A7JA 3FHJA 3PFGA 3T4XA 4P4GA 4E5SA 1MC5A 3GMTA 3VH3A 1CUIA 2JBAB 4CETA 1HYGA 1FRQA 3SHOA 1PVDA 5EJ6A 2OZEA 5J4KA 5IT4A 4NS4A 5F1PA 1XWFA 1WVGA 3ZEAA 4Z6KA 3ET5A 3BWXA 3AHEA 1VLJA 2CK3D 2O7NA 5IZCC 1CUUA 1DC8A 1GVHA 3LK6A 2F64A 2P3OA 1PR3A 3N39C 1XZEA 2WZDA 3MLBA 4ASUA 1HDEA 1VHQA 2A9OA 4JC5A 1ZQ1A 1ZBQA 3R4VA 1E1RA 1KSFX 2GA8A 4IOLA 2P62A 4HF7A 2ID9A 5FTMA 3EXHC 2XQKA 3MS7A 5LP1A 5HM8A 3OPYB 4QHSA 4H7KA 4QFCA 2B78A 2B7CA 3KLOA 5MN5A 1JH9A 3DTTA 3MUOA 5LA6B 4TTTS 3IKLA 2VQDA 2P9QA 4JI8B 1EVJA 1MD9A 1P9OA 1T35A 3GOQA 1CR4A 1F2UA 4LJYA 3Q8LA 3KLNA 3RWOA 2VZ8A 3ZXYA 3DMTA 4YP5A 1K6XA 3HJTA 4D81A 4A8HA 2WNHA 1FRVA 1ENYA 1PFGA 4RDXA 3B5EA 3OPYA 4FSHA 3SC6A 4EYQA 2Y1CA 1Z56C 2OENG 3GHHA 1RWWA 4KUEA 4LJSA 1SZJG 4R01A 1CUAA 3ZCQA 4BU0A 4EGSA 1DWPA 1P9LA 1Z5UA 2H4JA 3O2NA 5LPNA 2JH8A 3MJCA 2W7TA 3PQ5A 1D0SA 4YC7A 2FX5A 3HVIA 1S0UA 2ZR8A 3TR5A 5IUJC 1X86B 4AWBA 1LDNA 5JJBA 1VPWA 2FZEA 2Q1XA 3NHPA 4ZAFA 1NMQA 5FPKA 1M6YA 3HSSA 3EULA 4Q9JA 3CVXA 1T0BA 1T2AA 1GFWA 1Y3HA 2HF9A 3IRVA 4JWKA 3RYFB 5GGXA 3IBCA 2F9FA 1EVIA 1FU8A 1ACLA 1I4OA 2SNIE 2XWJI 4C43A 3E1GA 1FP6A 5EUQB 5BWLA 2FR1A 3HR8A 2HMTA 1F1BA 4BNNA 1Q77A 1JEAA 2Q2NA 5JLAA 2ECPA 4EPYA 3DS8A 3GBVA 1RKVA 3GQVA 3ZWPA 4YV0A 3RAJA 1TUIA 2QTHA 4LJLA 4A2QA 5A3RA 1Z2OX 3E0QA 4FFSA 4X93A 5C8DA 2IX3A 2YWBA 2PUCA 3ZGXA 2G3YA 3EGVA 1UP7A 4KE9A 2RHWA 5FFFA 3GGCA 1JBQA 1CQJA 1WZUA 3KHSA 3TRDA 3CZPA 2LCFA 4MI6A 2VK2A 3WLHA 4AN1A 1XN1A 1CUYA 2CL6X 2UUPA 3NP7A 1FSSA 3M6MD 3R6WA 4O2BF 3M5PA 2OAQ1 3M6WA 1W19A 1QTQA 2V0CA 4HXYA 3QRWA 4YQEA 1H0KA 1C3OB 1E2MA 4M6WB 5AOBA 3WZLA 4QYIA 3VDNB 3ZWVA 2NO6A 4LVCA 3E18A 1T6YA 2JIDA 1ONBA 2E55A 2Q0QA 3JXEA 1EKXA 3H3JA 1X7WA 4JVSB 2GZMA 5K1ZA 4AYWA 2BP7A 2F8LA 1DPFA 2FFRA 3A05A 3GLHB 4F6CA 4WXHA 4TVOA 4LX0A 4DR6B 1IVNA 3E9CA 3OCVA 2O3UA 4RK1A 3UAXA 4EK9A 1ILEA 2G4CA 3VPDA 2P30A 4BNWA 2YJ6A 3GJRA 5CGQB 1P81A 2CLMB 3NV9A 5HYVA 2AX4A 4M6WA 4QKQA 2OFOA 4Q7EA 1U0SY 2HNKA 2ZDGA 1M2EA 5CX1A 3KFVA 1V2HE 2GAJA 4ZFNA 5AUOB 3I6YA 8ADHA 5A06A 4I6EA 1AQLA 1QGUA 1ZBDA 2LVBA 2QD1A 4BWYA 1ORDA 3W6NA 4KODA 1ZR2A 1NQWA 2W2XA 4O4LF 4XIJA 2HA0A 2FPIA 4Q37A 4C7JA 5I7SA 2NT3A 1ACMA 1JFLA 1R9MA 3IEIA 4H3KB 5EHQA 1J24A 1W73A 3KDPA 1HQCA 1U0HC 2NTVA 2P9JA 1RAAA 2VDRB 3QUCA 1DRJA 4FONA 4IIFA 2LCQA 2GPAA 1R4ZA 4L22A 3PHGA 1H5QA 5JMPA 1O95A 1O57A 1KKUA 2BFPA 4KMMA 3UK1A 4WDRA 4DF3A 4QVGA 2WE8A 3INTA 4D9KA 3SXJA 4FYYA 5FPQA 3LQ4A 1WLYA 4YRZA 4RO0A 1G5PA 4Y2VA 2YHAA 4A6EA 1KA9H 3EGWA 2AR9A 3AYXB 1PCXA 1N8KA 1Q0QA 4FK8A 4KQJA 3LKDA 2OM6A 3O91A 4Y30A 2BLNA 2Z3VA 4GSYA 3FMGA 3L04A 3UPDA 1NVFA 2Y4OA 1I1QB 2H8KA 4GYYA 5JIBA 1W5BA 3P2YA 2YN2A 1G8AA 1LNQA 2RGCA 6REQA 2AJ8A 4AWXA 1AE1A 1GKIA 1QTNA 4QGSA 3WYDA 4EPWA 4FFPA 1YH3A 3G0OA 3COZA 4QJIA 2GFIA 3O38A 4Q93A 3WYBA 2OP1A 2C84A 1NLUA 3ER6A 2BGIA 3R8XA 3D8UA 4N7RA 4HDOB 4KUHA 3SHQA 3T3IA 1XQWA 4WXMA 1CP3A 1IBCA 4GPBA 1IN5A 4DCJA 2OK8A 4TS4A 3JQEA 4WY2A 3T38A 4BNHA 3HUTA 4EBBA 5L40A 1Y1TA 3VR0A 2ACEA 5EZQA 2V7QD 3FVWA 1LI4A 2H2IA 3IO5A 4YJGA 1JDJA 5EQTA 3KJNA 4WA8A 2I87A 1UANA 2IYSA 2HNBA 3PPXA 1CUGA 3GBPA 3I2YX 3Q11A 4AXBA 2R5FA 4LOJA 1TRKA 2P6RA 1QH0A 2JVKA 3RUHA 3U31A 1Z29A 2BT4A 1AGRA 1OXUA 3BFVA 2YYAA 4AVYA 4F7DA 1Y3CE 2WU0A 1O77A 3IJ5A 3ZIAA 4CMKA 4E4RA 2I8CA 3CWCA 3JARB 3IUNA 5IDWA 5TIIA 2WTUA 1MX3A 4K9DA 4P7KA 4L74A 1ONOA 1GPKA 5G0TA 1TEVA 3CGGA 3QYJA 1E5LA 2C31A 1V8BA 3I9NA 1GSOA 4XB6B 1ODTC 1SHKA 2GBIA 3AUYA 3LYAA 1VBKA 4KEAA 1SG0A 1XHEA 1Z2CA 2FLWA 2K4MA 4YTEA 5CPFA 4ZQEA 1OSNA 4GI1A 1CHNA 2YJGA 1F1JA 5FYDA 4JA2A 4K6MA 4XFKA 1E4EA 3PNKA 3HI4A 1Z0SA 1P4AA 3D7LA 4NOMA 1NUUA 1FL9A 5CNMA 1IQ0A 1KY5A 1O96B 16PKA 3FPJA 3ZTTA 1NRXA 1ZM9A 2B2XA 4G36A 1P4GA 2WPDD 4EPTA 5AVRA 2FYTA 2VF5X 2I9KA 2Y71A 3KZNA 2ZBEA 1YNSA 2YHBA 1WZEA 3DBHB 3ZWCA 4P3XA 5FWXB 3MNFA 4A9AA 4G5SA 1EHIA 2J9XB 2IOFA 3D7SA 2AF4C 3QXJA 3UCEA 3T3PB 3W1EA 5CB4B 1UQTA 3WLTA 1FB5A 2JIPA 3BRQA 3GWZA 4PZZA 1G4AE 1YR9A 5BR8B 4I1IA 1B42A 2Q0HA 4XIFA 3OPQA 4DCSA 4KQ6A 5HE8A 1N1MA 5DBIA 1Z7BA 1JSLA 2RHGB 3T5CA 3WNDA 3L0YA 1JDVA 2B1JA 2BGNA 3MAGA 3N74A 5DCLA 5EZYA 1DQSA 4I8XA 5FWXA 3C48A 3L8HA 4JKOA 4KQCA 2G1AA 2OB2A 4QASA 3P26A 1SKYE 2I4OA 3KEGA 5KQRA 1C7QA 5D84A 2WIFA 1NGSA 3IDQA 5KWEA 3HU3A 2XDYA 4QHTA 1VMEA 4YAJA 1P4RA 3HY4A 1DAOA 4A2PA 3SSNA 5AIAA 2I3DA 3L6EA 2IS1A 2X23A 3MCWA 4KH0A 4F92B 5CVDA 2Q21A 4KK3A 2C2YA 3A06A 4XKJA 4ZVLA 1A95A 3RIYA 2FX3A 1JEJA 1T6BY 3OX3A 3ZDBA 4NS1A 2YJTD 4P7JA 4CF7A 3FFWA 1SUSA 3OQJA 4AB1A 1LTKA 1NF3A 2J09A 3KB1A 4UFNA 1SHUX 1YDWA 2CNLA 4YMTA 3SYNA 3KKQA 4KNWA 3SICE 4D99A 1OOEA 1E9FA 4EKIA 5JZMA 3M82A 5AJHA 4DJTA 2VQEB 3NAGA 3PDUA 5JBQA 2MYUA 4R5MA 3HXOA 1UT6A 3MLAA 1U80A 4EAAA 4N47A 1IMJA 4DDMA 2AQIA 4I46A 4EG6A 2QRVA 4YJFB 4JUDX 1WHSA 1GGVA 1JQLB 5EMNA 4LGYA 2FWIA 3W06A 1AMNA 3W5BA 2ZVQX 4Y2SA 1OZGA 2HA6A 1F8XA 4G81A 4EQZA 4DKXA 2ZWOA 1SIOA 4ASUD 4UNRA 2IK8A 2P79A 3HRKA 3NNNA 4PTYA 3PQEA 1HEIA 1IZ0A 2XCLA 3RTGA 5F7XA 2ESRA 4AY4A 1IZ9A 2Y68A 4J4TA 3O9MA 5CFLA 4YREA 2ES4A 2VWPA 4FHZA 4FWIB 1DFGA 1TM1E 4F8EA 4DMKA 5LMZA 3HCFA 5A6SB 1O6FA 3MWDB 1KS2A 1W85A 2DF8A 4R2MA 2HIAA 3WGQA 2Q6LA 1OH8A 3ERCA 4FSDA 1KXJA 4DR4B 1T9GS 2QJWA 2I4NA 4TXHA 4KH1A 5HDBB 4LKOA 1S1MA 1X94A 2H0RA 4UDOA 2MYPA 4J1TA 1Y37A 4GRAA 4L9AA 2CE2X 3ESQA 4HEJA 4ZAGA 3TDNA 3KBBA 3UXYA 4FDMA 3ZU5A 4YRGA 1KYIA 5ICMA 1GAJA 1RP7A 5KX5A 4NE9A 5DBGA 3L7NA 2XB6A 1WXWA 4P54A 4JI2B 3U09A 2VTVA 4G2NA 4J0FA 4NVRA 1SRRA 5G0UA 1KDYA 2OQ2A 4D3YA 4X8OA 1KH2A 3C8DA 3ZQJA 1AA6A 3D0KA 2WWHA 4H7IA 4PNPA 4PIMA 1JZTA 2NTEA 4P82A 5AK5A 3FFAA 1W4AA 1U1FA 4O4JF 1PJ2A 3Q9NA 1EWQA 1NC3A 1E3DA 2P3QA 1J9GA 2P7HA 3I0MA 3OZTA 5K8CA 1ZC4A 2UYOA 3IESA 4IJQA 4YAGA 4Z86A 4DDTA 4LCJA 3A1UA 4A7PA 3L7OA 3PEEA 3AY0A 2HMSA 4U8GA 2TSYB 3BE5A 1USVA 1JFFA 3QFFA 1VJRA 1LXCA 2GLXA 1DG3A 2VN8A 2WFLB 2XRYA 2B4YA 2A0UA 1UBUS 2VJPA 1K8ZB 4IO0A 3Q9UA 3D4PA 4S2UA 4XW2A 4Y2UA 5BUQA 2EEZA 4J3NA 4E1AA 1ZUD1 5KNCA 3SQMA 3V3KA 3EXEA 3IUQA 2IYFA 2DHEA 3F3YA 4DWWA 1ZEMA 3K72B 5HM6A 3C3EA 1DIAA 2R84A 2P9GA 3ACCA 3I9KA 1NQUA 5REQB 1QK5A 1E64A 4X44A 1P4HA 3TIGA 5JFTA 2CYAA 1W4RA 2V7UA 4CKCB 1MQAA 1TJ4A 5HIJA 4EW1A 4BMXA 3D3KA 2ZRNA 3EZFA 3PGXA 4WWHA 3WGHA 4DS3A 2YYYA 4BNXA 4DQKA 1EXMA 1U3VA 1DO2A 3DAHA 4N6GA 4XQEA 5DSXA 5AR1A 2XA2A 2X0NA 3AUKA 4CQJA 4JL8A 4V0RA 4TV9B 4UPEA 5FPYA 5L7TA 3ZDQA 4WNCA 4QBGB 2QXTA 4EPXA 1HI9A 2M32A 1AQYA 3Q7TA 3D7RA 1ZCFA 5D3KA 3ZDAA 4KJZA 3GEBA 3E0XA 4RHEA 3RSSA 2CLSA 1U2RA 1P1IA 4K6OA 4LOLA 3E2IA 4ZPJA 2QRMA 1KK1A 1U3GA 3AT1A 1MVNA 3CUWA 1V6SA 5CNJA 1BVUA 3ZHVA 4PFJA 1AOXA 4EFLA 4HK4A 3PHHA 1WS6A 1ABEA 4F9TA 3K0KA 4O1IA 1L4MA 3OKFA 3GJ0A 3NRJA 2R0QC 1RKQA 4L75A 4ZEXA 4QDUA 5DYTA 4EI2A 1V71A 2FP4B 2YR0A 1TT7A 4I55B 3L18A 5PGMA 4ALMA 4EENA 2B9VA 4FVTA 2CW5A 3E9ZA 2JHCA 4PY2A 1XKQA 1OXXK 4B82A 2V03A 3EC1A 3LPCA 4O8ZA 1U31A 2B8WA 2EQBA 3DP9A 4XWTA 3PUIA 5I5GA 5CLFA 2Z8XA 1V7ZA 3FRJA 1I0LA 2C4VA 2AUMA 2GKGA 4BV9A 1E92A 2FEOA 4WBSA 4QD3A 5IT0A 2X3YA 1X2EA 3KOXA 1EB8A 1VSBA 3L6BA 4FZ3A 2XEXA 3OOSA 4KTTE 5JC1A 1OMOA 1HPLA 1G8MA 3FVTA 5CT8A 1Z0AA 3N2KB 5FADA 1PK8A 3OQ6A 1EFUA 4NSNA 1UBMS 2EFJA 4FFBB 2VRWA 4MICA 4EHHA 2GEFA 1XTTA 3PDCA 5BR4A 3O5AA 4JJ7A 4Q01A 1O95D 4F2GA 1KNQA 4EKYA 4D80A 1P5FA 1MO5A 2WFAA 4L8WB 4I50A 1HYBA 3DTVB 3KSDO 4D56A 3VNRA 1PS8A 3TMYA 2BW0A 3KWJA 4PU0A 4PSKA 4D5EA 1CF2O 1GNQA 4GM4A 3S4YA 2QG9A 1I4EB 2PH3A 2BE9A 5AW7A 5FI1B 3EEOA 3MXTA 2Q0XA 2YZKA 3V4LA 3FNGA 2ZJ2A 4KDEA 1GFIA 2CE7A 3HDGA 4R7TA 4AJJA 3IQEA 1W6UA 5BWOA 1NIPA 1AV6A 2Z30A 4OA5A 1T0IA 1EYZA 4PC7A 4B83A 2ZR0A 2H3EA 2RHBA 1U6JA 4N0EA 1UIRA 4P86A 3A6GA 3FVQA 1G7TA 3SF8B 2R1TB 3LY9A 2VT6A 1CFJA 1NVEA 2XQVA 1O54A 4P31A 4RE5A 1E1LA 1PW5A 3NEYA 3ODGA 1GQQA 3D4IA 1NLZA 1UBRS 4NJEA 4RK5A 3KSBC 5A9SB 1A2KC 4ZT5A 5KCMA 2LZ0A 5BNWA 1L5HB 5F4ZA 4ZYTA 4KNVA 1B26A 1U7XA 3UHAA 5BSUA 3PL1A 3WMFA 1TQHA 2A5LA 5CB6A 2G9VA 4K05A 2KPOA 3QTBA 5GIPE 2CJWB 2C5GA 3FDZA 1V4VA 3N2NA 4EAQA 5FV7A 2Z8YM 3SF8A 1CXZA 2R1TA 1P5HA 1ZY2A 4WEOA 1JKJB 4IDEA 5IF3A 2FW0A 2WC1A 4FYVA 4DM4A 2V65A 1TMKA 5C1PA 4OREX 1W44A 5A9SA 3ZVMA 3LA8A 3UK6A 5CFOA 2R3SA 1TDJA 3B3QA 3L7AA 1L5HA 3KL4A 3KQKA 1JPVA 5LUBA 5AP9A 4AG3A 3LQRA 5F7JA 4A3SA 3GRFA 3ZIAD 3WK4A 3LL7A 3E9MA 3A4TA 4UM5A 2X9LA 4M0DA 1YHYA 3RS2A 3F0TA 4IG4A 3GH3A 3MS4A 1T4MA 2IHZA 2FF5A 1LLUA 5HFAA 3TZHA 3TZKA 2CXQA 3WRXA 5KPJA 5KU1A 1GGKA 4FXPA 3L07A 1XE3A 1XCLA 2JHGA 2PQ6A 2ZI9A 4F1JA 5AM2A 4L9WA 4TT3A 4ATNA 1YE5A 3UANA 3NHSA 4H3VA 4IOKA 4PZEA 3PDIA 4MX8A 3B9QA 1R0LA 3EGXA 4E21A 1TT5A 1ULBA 2QAGB 3MT9A 4B2LA 1CUWA 2B8JA 4BLQA 1BD3A 4LYYA 4AJ2A 1H2WA 5HWSA 4RZ2A 4URFA 1E7SA 3QM1A 4DLTA 3TLAA 1UOQA 1ZMBA 2YWHA 4RL4A 1O5IA 1N2JA 1XAHA 2PRSA 1Y42X 4G5YA 4J0IA 4G1EB 5EY5B 1UT8A 2JLUA 2RH5A 1BMTA 1I3MA 3ZZMA 1WZ2A 4TUYA 4ZXFA 1TXGA 2RHHA 3E22A 5DIZA 4PTLA 2PYZA 2GF0A 1LKZA 2Q3LA 3LCRA 4X20B 2OCAA 1QV9A 1UMBA 5KSWB 3WHLA 1IAQA 1UKYA 1H6AA 2H2AA 2SKCA 1OBFO 4L8LA 4O4IA 4Q0MA 4GW3A 3G2LA 4FM9A 4OJKA 4OMDA 2X7HA 3Q4GA 4Y2GA 2NVUB 4RVHA 3MB5A 4UZSA 1LVUA 1PZFA 4GOJA 3DQPA 4E09A 3ZD9A 4EHKA 1FVXA 2GO7A 3A0RB 2RJOA 5HZHA 1YC5A 4CQLA 1ZPDA 1EK1A 4U4AA 3UJ3X 3AY7A 4RK0A 5J59A 3V8VA 3W6ZA 4P7FA 4DADA 2FSUA 3I61A 1BEZA 1DOAA 1JLRA 1P44A 3E70C 2NUPB 2X1MA 2VS1A 4X20A 3WICA 4DNQA 5CDTA 3E58A 1O1YA 1QHIA 1QDEA 2PS9A 4QOHA 4TRNA 3IFSA 1FRFS 4XDGA 2FG5A 1AG9A 3KLBA 5B1EA 1BEUB 2MWMA 3HEMA 4Q7LA 2UYYA 5K0BA 3T7SA 3U7RA 4EG3A 1YCGA 2AGVA 4W5OA 3RU3A 2FETA 3IXMA 1N2ZA 4JHXA 1FLDA 4QQ8A 1M1NA 3NTQA 4UNPA 4PRZA 4OU4A 1HDIA 2BMAA 2ZK7A 3TLGB 2K7FA 2V45A 3EPRA 1WD5A 1NXVA 2YV4A 5ESXA 4BV8A 1M2OB 1L8XA 2EARA 2X13A 3WMGA 4HWTA 4TYNA 3H2BA 2XQIA 2H7CA 3HBFA 4GR9A 4HQLA 3NC4A 3NH9A 5CA1A 4PLPA 5LZ4A 4BX3A 1M0SA 1E9VA 2K87A 3AZQA 4JUIA 3T7EA 3GRYA 4Z53A 3GAMA 1KAMA 4ITRC 2JL1A 4HEHA 2JGAA 2OV8A 4CVNA 2UZ4A 1P0FA 1Z62A 2GCPA 3PC7A 4QT0A 1QYRA 1YZLA 2Z58A 2GXQA 3PDHA 3I9V6 5BSGA 1T9CA 2EJBA 4RJKA 4XEHA 2IV3A 4C05A 1M2VB 3AL0C 2IW1A 4MDHA 3RE1A 4CM8A 4UE2A 1IN1A 1XTUA 1HTBA 2F43B 5AVQA 1J8MF 1TM4E 2HRBA 5EN4A 5F73A 3G2HA 1SXJC 4KVFA 4LWPA 2JGDA 4CQMB 1D2AA 2HIMA 1P18A 2WYIA 2EC5A 4R7GA 1MJGA 1ZGBA 3Q6IA 1R8YA 2QD5A 3L7DA 4TZKA 3L1HA 1DTSA 3ZW9A 4AULA 3FHTA 4ZZ2A 2O2HA 5LIRA 4RSGA 4PCUA 4Z3OA 2QL9A 1ZH2A 1CVRA 3ABQB 3I2GA 3ND7A 2FQYA 4NCAA 3C2QA 1CUXA 8MHTA 3EQ9A 4HL6A 1PSDA 3M9LA 3EXFB 1ONPA 1LEHA 3GZNA 2DPYA 2F43A 3H1TA 3LCCA 3CSDA 4XM2A 1PZMA 1N0UA 4LSWA 3ROQA 3RVLA 4LIPD 5F3RA 1JXQA 3VR4A 2WSSA 5M2QA 4HZUB 5HQ3A 5C4MA 5EIXA 1UKAA 2FE1A 2V6FA 1E2KA 2IELA 4C21A 4CT4B 2F9LA 1N3YA 3PGKA 4KI7A 3NBAA 1FP4B 4C7MA 1LX7A 4UD2A 4AC9A 3CIFA 1XKXA 4L3OA 1QZUA 3RVDA 1J2RA 1FFHA 3THWB 3WGOA 1WDKA 2QN2A 1N5RA 1EMDA 3NAZA 3VJKA 3FPCA 4HP8A 5TPZA 1SBHA 2PMFA 2CWDA 4I08A 1FFAA 2OECA 2VXYA 5TQ0B 4DZZA 1L7BA 4ZYXA 1KK2A 2VH1A 1WMEA 1UK7A 2OHJA 2D0OB 1QR6A 1E0DA 2QMQA 2VA9A 4IJMA 4MEBA 2A8YA 4U02A 3P2KA 5H02A 4HUJA 2ZQZA 1X3LA 3CR7A 1P2TA 1SC4A 2DUUA 2BE7A 2H08A 4PIVA 1KKMA 4RA6B 4Y0VA 2PA3A 3OZUA 4RULA 2ZYAA 4R9SA 5KNCD 5DRTA 3LWDA 1M6EX 3OJEA 3BGDA 3G6KA 3W8NA 2ZJ8A 4CKYA 5IM4A 4MW1A 2ETXA 1QU3A 1EBBA 4MPDA 3L1VA 5KYUB 2XGJA 5BPFA 4KCGA 2POCA 1L4BA 4FZ5A 3Q40A 4RD4A 5IJ9A 3QNUA 2TMDA 4OQLA 4C3UA 2R6FA 2L18A 2ZB2A 2UVPB 3LC7O 4QU8A 3TPZA 3VYSB 3A1CA 4EVRA 1T26A 5HIKA 1IVSA 3K6JA 4KLZA 1N4AA 4EA7A 4FYMA 3TTUA 4FZVA 1E58A 4UTVA 1I2ZA 3GLFB 4KTVE 4ZQIA 4JI4B 4C2BA 2QVCA 3HWRA 1I2MA 5KWIA 3D3WA 1TCUA 5KYUA 1TK3A 3H2YA 3PHLA 5FBVB 1E2QA 3CLSC 4YMVA 3W5SA 1Z15A 4TYMA 2OO5A 1M72A 1G2PA 1C9NA 5ALHA 1VL1A 3MW8A 1CJKC 1G3UA 4L1KA 2P9YA 4D5GA 4LK3A 3LX6A 4G8CA 2QMHA 1M33A 4EG7A 1BU5A 4HN4B 1XTIA 1HFWA 5DHSA 1GGJA 2DSTA 4H7EA 3K2EA 4URVR 3GEPA 1GPJA 2I22A 1J99A 4JUBA 1YQ9A 2AK3A 1OAOA 1PUXA 2IOQA 2ZRQA 5EJIA 3VPGA 1SCBA 1Q84A 3LP6A 3UXEA 1OFTA 2GKOA 4F56A 2GNPA 1DBQA 4GPZA 1THGA 2DUNA 3U4IA 4KNYA 3BRSA 2ZAMA 3TDMA 1VSTA 5TVGA 4RH0A 3A6DA 1T1EA 4JDUA 1GKKA 3F7NA 4GP7A 1YRQA 2V3VA 3QG1A 2QK4A 3RADC 3UAYA 3LQKA 1F2TA 1MC4A 3R3XA 3T1VA 1DUIA 1VKNA 2NNLD 1Q14A 3F9RA 3V4FA 3PQ6A 3VGPA 5BXQC 2GILA 3KJEA 2OV1A 3OT1A 3FWPA 3PD1A 2QAIA 1T29A 3OQ1A 4JSTA 1KPGA 2ZITA 3BXZA 1YBVA 4HAZA 3RSQA 4JC4A 4EJSB 2HQRA 2YV5A 2ZCUA 4YMLA 3G5AA 5C2JB 4ENUA 4GEGA 4MV4A 1I36A 3CRRA 2QJTA 4AICA 2XGMA 3KYIB 1RYHA 1C41A 1T9AA 2V7EA 3PUHA 3UCXA 5LQNA 1GZ4A 1T4CB 1CY8A 1XRRA 5JZ9A 2A94A 3CWZA 3H5VA 2CVPA 5LZ2A 4YRJA 1GPAA 5J58A 2V6JA 3F1LA 3GCWA 2WVJA 5FP0A 1DAMA 2XQGA 13PKA 3PQ7A 3RSZA 3EGOA 3UTCA 5G02A 3CF6R 3IIJA 3HFJA 1RLIA 2QZSA 1Y6ZA 3QE0A 3R7FA 2W2PA 2XZPA 1X8KA 4BQQA 1A77A 4B17A 1KOGA 4JITA 5AICA 2Q1WA 3GQBA 2W2VA 3SNKA 3ZU2A 4EGQA 4P80A 2CXSA 7YASA 2EWWA 3PC2A 1X7ZA 5IDYA 5HJ5A 1KGSA 1NXXA 1ULSA 1XQVA 4DILA 4EFDA 4GM0A 3FX2A 3QBVA 2C2KA 1SC9A 4F1WA 1JPUA 1QDLB 4PR0A 1GPYA 2PSHA 3BFJA 1AXGA 3H16A 4EW6A 3TOVA 5KVQA 4GU5A 2D3WA 1YK0A 4X61A 3E23A 2A9JA 4TS1A 3IBGA 4ZO7A 1A9XA 5B1SA 3DVQX 5CVCA 2CLHB 4PLTA 2QE6A 4EL5A 3COYA 3LRPA 2YFHA 4IMIB 4Z51A 3OKCA 3RYCB 3PWKA 4I14A 1IWPB 2IT1A 2A92A 2WWXA 4Q00A 4KRFA 2PD6A 3UT5B 4FZJA 3SDBA 1XZHA 3ZQUA 4UXJA 5FUXA 4MKZA 2F3TA 3GRCA 3GPLA 4ZOBA 2E9SA 4QOJA 4B3SB 2E3JA 1M6WA 3BZWA 1YGPA 3F6RA 1XNHA 1DWUA 4KV7A 3HUFA 1LPPA 2AKYA 5E4FA 2A0YA 5FLEX 2JI6A 4TT3D 3TGWA 1JHZA 2CLKB 2AMLA 2FFJA 4B4UA 3C6XA 2ZU0C 4CIXA 4GE0A 1WTCA 3EXIA 2ISQA 4MWBA 4P32A 3FGNA 3MWGA 1YQQA 2PCLA 2R7MA 4NENB 3R20A 1V11B 3R7BA 2P2NA 5L53A 1Z2EA 3AI1A 4ZO9A 4ITVA 1L4FA 1G3MA 2XMBA 1LPMA 3IL2A 3F47A 4OUKX 4P36A 5E0KB 3RABA 4YI5A 4ONEA 2FWJA 1FS6A 5K99A 1NMYA 1OC2A 1YL5A 4P4SB 2IWHA 3ROKA 1Z4KA 4QBIA 5FAXA 3FRIA 4WCVA 3ILVA 3M6IA 5FNVB 3UTDA 2Y0PA 4KQ2A 4QM6A 4PPFA 5DT9A 3GJ5A 1SXIA 3R5XA 4UHKA 3V7FA 3ZE9A 4LCBA 1YDHA 3WLMA 4ANFA 4C0AC 5L6MB 2YMPA 6LDHA 2YWXA 1N92A 2VHXA 3TF5A 3SX2A 4MVJE 3G59A 5IJAA 3RI3A 1TMGE 2WR8A 3T5GA 5C8ZA 1R5OA 4G09A 5L3ZA 2JLYA 3BWEA 3DO6A 1I4WA 2AXPA 2H5IA 5HX7A 2VHZA 2ICAA 2VSNA 1OD6A 4LA4A 4ARAA 3C5WP 1JP7A 1WCIB 2WKRA 3DZJA 5E6SB 4OI1A 5P8WA 3WNVA 1KARA 2JFZA 4D8WA 2AZTA 3H19A 3KWLA 3NIGB 5JOQA 5DEIA 3E61A 2NU6A 4B7UA 3ZY2A 2A5JA 3DPUA 3GYBA 4ZZ0A 3X2EA 4RZUA 2Q7XA 5JQGA 3WFJA 3L1KA 2QSYA 4PC3A 4L5AA 4NPHA 5AK6A 1A7UA 2AFVA 3AIOA 1SK9A 3P4UA 1NW7A 1GT6A 2KWIA 3NGMA 5E6SA 1CNFA 3DKKA 3PKIA 4HLNA 4PZ0A 4TN5A 1MZVA 2HA4A 4CEIA 2A3RA 1HH4A 1QHXA 1J33A 2GBLC 2CLOB 2JFWA 2R11A 4RTKA 1E9AA 1WB5A 2HA3A 3GFRA 3BZUA 4HWPA 1A88A 3LG2A 4PYLA 2CCJA 1CZUA 3MCZA 3TKYA 4F4UA 1IE3A 3TJMA 3PEYA 2OY0A 1FVHA 1TA9A 2ZCJA 2Y0EA 4EMUA 3FTEA 2OGTA 1G3QA 1J07A 1FDUA 1YE3A 3CINA 1ZO8A 5JRJA 1E3IA 1NAIA 4KGZA 3KCNA 1XHFA 2AB0A 3BF7A 4BGEA 2WYUA 3ZCPA 2ZIWB 2FE4A 4BPRA 2IH2A 5TY0A 3P2EA 3NEJA 4UE3S 4UUAA 2NQTA 2O8FB 3GFSA 4GZ6A 2ZP1A 1G7RA 3IP6A 1RBYA 4LXYA 2CN1A 3K09A 3BIXA 3REGA 3I8SA 5JZBA 2DSNA 2XCSB 3HR4A 2F1JA 1QQ7A 1SKQA 2ZR9A 2ZJBA 5E8JA 4U1RA 1H8HD 2WF6A 2JA2A 3HVUA 4G85A 2L19A 2Y1GA 4QAQA 1KE1A 1VQ1A 4BFXA 2J9GA 3BJMA 4U0JA 3PUJA 3MT0A 3KVRA 2W70A 1CZLA 1YACA 4Q3NA 1CU1A 4C3ZA 2O8CA 2GK7A 2G0NA 4EW2A 4M38A 3OZIA 1ETHA 2CCGA 1FC0A 4TV8F 4CL3A 3HLTA 4RL6A 5LJIA 1XQXA 4NYIR 3KPVA 3ZHUA 3ITEA 2LW7A 2VP4A 3QYFA 5HE9A 3ADBA 4L08A 3X1KA 1JHPA 4FDTA 4RUKA 1KMNA 4ZI2A 2PUJA 1HK7A 1OIVA 4NEHB 3HO1A 2O3TA 4MW9A 2JCYA 1R0SA 3GG9A 4NK5A 1X7YA 2ORED 2XCUA 4IIJF 2YC2C 5CJJA 3PWTA 5AM5A 3VR4D 2WSSD 2W48A 1JDPA 1CJBA 1QFMA 1W4LA 1V4BA 1VGQA 2GJ9A 2O2GA 2P0AA 3F5FA 3HJAA 5EOVA 3TW8A 3ZC3A 5D5HA 2R2GA 2BFEB 1X1TA 3A27A 5I9BA 4DPMA 4LF8B 1EE2A 1JECA 5T6BA 5LXTF 4IOMA 5CYOA 1OI3A 3HCOA 1N2OA 1ML4A 4I2VA 5IVDA 3TUJC 1QRSA 2XODA 2PKXA 3R9WA 1GUFA 721PA 4AMZA 1UT5A 2FSGA 3SLRA 5KVCA 4ZVPA 4UM8B 4DR5B 5E3JA 2WF8A 4JNKA 1BQ4A 3B48A 1CUEA 5D85A 3RTEA 1R1DA 1RC1A 3L7JA 5TPZD 3T52A 1HKUA 4GL4A 4L5JA 1GLGA 1LPSA 4AU1A 5AM1A 1B6RA 3GGOA 3WL3A 4UPDA 4EZBA 2VZ0A 3G8YA 3CV3A 2BFEA 1U5CA 2IC5A 2OHXA 2XMQA 2BVNA 4HMQA 4RWEA 2JAWA 3RFVA 4B87A 3VR5A 4UMFA 1CUSA 3F6CA 4ZYZA 1J0BA 4N3CA 2VAVA 1SU7A 5U4QA 4OBEA 4B43A 2AZXA 2JFXA 4IBOA 1HWYA 3WKEA 1L5SA 3DBRA 3KXLA 4MV8A 1J1UA 1GTL1 1OLXA 1P0CA 1P9NA 1U9YA 3IMCA 3JYNA 4U7WA 3IEVA 2QJRA 1U8XX 1EAMA 1GR0A 1F51E 5BUCA 4YONB 3SCZA 3TYXA 2REXB 2DAPA 3TBKA 1VLHA 3BSFA 5IHPA 4MMZB 2F8TA 4K9NA 2HO4A 3VSAA 1OF1A 1Z5WA 3EWNA 2BFAA 2BPOA 3F96A 5CT9A 3QLTA 2H9IA 3QZUA 4CM4B 3MGCA 5F98A 4HAOA 1JKFA 4J9VA 1TUBA 3EASA 4FGLA 1BHSA 1YT5A 4B0OA 3OJLA 4BB6A 1Q1NA 3HBLA 3NT4A 1R6DA 1QHEA 4I19A 3D6HA 5KJCA 1BA3A 4IV8A 3MJHA 1CERA 4MS4B 2DUMA 4V0QA 3K70C 1PG0A 2GEKA 3TQCA 3KHUA 4U2BA 3ZUGA 4F8YA 3I1JA 1NSTA 1S7CA 2FHSA 2YJ3A 4D9HA 1E1YA 1RM3A 2N46A 4C30A 4MITA 3I39X 4LBVA 1B16A 3LY5A 4IDCA 4EGFA 5J40A 4MW4A 4YRBA 2FFHA 3OIVA 3V1LA 4RZSA 1W2WB 3Q7RA 4MS4A 2C4MA 2G28A 4ZN6A 2QNRA 5JCXA 4MEAA 3BH6A 1NOIA 1G7CA 2D1SA 3TI9A 2F00A 3AI3A 5AW1A 5FYQA 2OGSA 2ODWA 1I2DA 4S0XA 2VIIA 3RWBA 1HYEA 2Y0DA 4JXKA 5DX1A 3GRVA 3UG7A 1VJGA 1DRUA 1W2GA 2C00A 3T61A 1RPAA 2P9FA 1AMOA 1H6BA 4UUMA 4RKWA 2QUIA 3I5MA 4PGGA 1ESMA 2QLTA 1Y33E 2AQKA 2F4NA 5BSVA 4YT4A 2YIMA 1N2CA 1E4VA 1QZZA 5KC9A 5FD8A 4OI4A 3AVUA 3D59A 4QDKA 3NYRA 3H9BA 5I9TA 3HWSA 4DLKA 1HO3A 1OI7A 1P29A 1SULA 2REOA 4C22A 3VKHA 3X1ZA 2AN4A 1K4MA 4BATA 4AX4A 3DLBA 4BX8A 1DEXA 4RXUA 4G1VA 3N6XA 1NP3A 1T1GA 3AEZA 3BXGA 4AO6A 3ROFA 4U7HA 2IWRA 3ZZNA 3A4YA 5DISB 2AMFA 1QZTA 2NN3C 2Y3IA 3JZDA 3QLUA 2YN0A 2RI1A 5EG5A 3T8YA 3ZIDA 4BCDA 3TN7A 2JG3A 4D3FA 5TEVA 5CVEA 4LNUB 3KTFA 3F90A 3HYTA 5CUQA 1RSZA 3W78A 3AI7A 3H2SA 1STOA 3GV0A 4WKOA 4CFZA 1GU1A 1PJQA 4R9VA 3WWYA 3E5HA 5DNCA 1I6KA 4R3NA 4A73A 3ENWA 2B4AA 1X9IA 2RONA 2X2PA 1NXTA 1RXSA 3IUBA 2XIJA 2MINA 2DRIA 1TYDE 2FDRA 2OCBA 3VU3A 4YRNA 2QRNA 5L3VA 1I5RA 3IMFA 3PBKA 3OE1A 3L6CA 1GUZA 1K2VN 3FBGA 3FI0A 3O21A 1O03A 2D13A 2WABA 3L05A 4H59A 4EY3A 3KSRA 1II9A 1XXHA 4KDRA 4XYBA 2IIVA 5DDIP 5AJVB 1T5BA 3D6FA 1OIXA 4ZA2A 3AGPA 4ZHQF 2V3CC 1XO1A 1E9DA 2R85A 3HNRA 4GECA 4P3PA 4TQUS 3FLEA 4X0EA 4CM1A 2OB1A 4ZDJA 4QGBA 9ABPA 4RDCA 1NAHA 2CMDA 3T5TA 4DIOA 2WZBA 1ZW6A 1R50A 1X7XB 1XZMA 2H92A 4UATA 2FTKE 4XI9A 1GGFA 5DYIA 3VU1A 2G80A 2XZTA 3D6JA 3OMLA 3VPSA 2CUKA 3C85A 2GPJA 5GIOE 2DHRA 2EERA 5BMOA 4D0GA 1I6WA 4QPJC 1YZNA 7GPBA 3L9WA 2PL9A 3T41A 1NLMA 2JJ1A 2YWGA 1GRRA 4HRVA 7AT1A 5IT5A 2FR8C 3G82C 3L93A 3IP7A 2BFBB 2F1HA 3KQQA 4ZXPA 4OP3A 3Q8WA 3G13A 3ZGNA 1UDAA 4P0TA 1OFVA 3AIMA 1DEAA 1ADBA 4OHUA 4WCFC 1A71A 3LBFA 2PKQP 4X1IB 5TRTA 3INGA 3LU1A 3SHTA 1WZNA 3NASA 5T6MA 1IXRC 1N9GA 1U2ZA 2CHVA 3JQRA 1JB9A 3L40A 1DU4A 4WBXC 3GJTA 4B33A 5IJWA 4JFRA 2FP3A 1CFZA 4GAEA 1EEXB 4OAPA 3GRKA 1A4UA 1CEEA 3BDAA 4D9CA 3LT5A 4MVJH 2VP9A 1GDHA 2ZUCA 3F8TA 1XCPA 1BSVA 2R25B 2DE0X 2ZSUA 2OYRA 4QXOA 1QFJA 1YD7A 3AWIA 3WB2A 3ZX5A 3K1ZA 4YUWA 1JE1A 2XUOA 1PL6A 2A6PA 4W5RA 4ZTZB 3GJSA 1RHMA 4A92A 5JSZB 4ZQFA 4AL4A 2C2BA 4GD3Q 1WHTB 4Q02A 4HVCA 1ZIOA 4Z49A 1UEJA 2IXEA 3TQRA 3BXHA 1BA2A 3EFBA 5DGHA 5G2OA 3TKLA 3HPQA 3R9XA 1UDXA 2AOUA 2NZVG 1JG2A 2BKAA 2JCGA 1RRMA 3S7ZA 1JL3A 1F0YA 3DM5A 4S2EA 2I2DA 2UYCA 1ZVMA 3OMWA 4KXWA 5C7IO 2Q50A 3CJRA 4URZR 2DFDA 3C45A 4EKGA 4UVEA 1OC4A 1RI4A 3FYDA 6ADHA 2DR0A 2XUFA 3IVGA 2HPAA 5H82A 5K9ZA 4KR2A 1BVHA 2E2WA 4YX9A 4YRKA 3KLPX 3HSYA 1YRAA 2EIXA 4XVCA 3V8RA 5IRCD 3KWMA 4LY3A 2O2DA 4IDQA 2J48A 1FTGA 2JD0A 3AR7A 4OX9Y 1XD2B 4HFMA 2ERYA 1PJAA 2AUNA 1R88A 5K45A 1Q95A 2XADA 2I0FA 3MSCA 4ERNA 4NE2A 4V0LA 5CA0F 3AO0B 4U5XA 3T5BA 4J2HA 2WJZB 2H65A 3N70A 4HLCA 4RGVA 5CRIA 2ATCA 5E2BA 4JJ6A 4EDHA 3LO8A 4YHHB 2IXBA 1S4QA 2VI5A 3QBEA 4P83A 3WMEA 4YJ3B 1L1QA 2ACVA 2FFQA 2ZIGA 4Y3UA 4OP2A 4RJLA 1DDIA 4XCQA 4D6PA 2PPLA 1QXSA 3H17A 4QNNA 4EF6A 1P7WA 2NSJA 1NBEA 3IQXA 1SUFA 4KFSA 3QMWA 4O4HF 4ZV9A 3H3XA 4JCOA 1CEXA 4LQ4A 3NTXA 5GP1A 4DT1B 3HM9A 1X80B 1UPUA 3G8CA 4CUKA 1K7CA 2D1RA 3SLKA 1SHTX 1JLLB 2J6BA 1JLMA 1VHJA 2HDOA 3J7TA 4IIGA 5JCOC 2I55A 1NUAA 4MGIR 5DHTA 4WLOA 3FYUB 2QUJA 2BZ0A 3QPBA 4AMVA 3Q5GA 2AI2A 2BR3A 1Z06A 3IELA 5SYMA 3T7DA 5CAEB 1VG8A 2OFWA 3IAUA 1Z2DA 2WHXA 4EI8A 4H0FA 5LYJA 5ITVA 3D2BA 3QPDA 4U39A 5ALIA 4AD8A 4NBVA 2QRPA 1X80A 3QKRA 4LC1A 2A9QA 1XMXA 4M87A 1OZAA 3R3JA 2YYZA 3MOIA 3S1AA 3VOSA 4IUBS 3GLGB 4RMGA 3ZDXB 1DBPA 3RS0A 2XWBF 2R7LA 2BFDA 1T6NA 2B2CA 3KQMA 5EKTA 2EJCA 5FTNA 2RGBA 4ZVMA 3WNBA 2EBUA 1NVVQ 2IU3A 3ROGA 2C61A 1OQAA 3QMPA 2VSYA 4Y98A 4E08A 4YP9A 3EDMA 5CW2A 4OFZA 3S27A 3R5TA 5KQPA 2NU9B 1Q3TA 3K35A 1G5IA 5BYBA 1VE3A 1AIPA 5ILQA 1IYZA 4KIGA 4J0DA 4QQKA 3KYCB 5FL7A 1E2LA 3JQFC 4M9ZA 3QU4A 4JR0A 4CMGA 4E88A 3VR5D 2DPMA 4QXQA 4W9NA 3CEMA 4OYHA 1TFRA 4BNTA 1K0UA 4D44A 2P5UA 3O9VA 1PV1A 4WN3A 5JMTA 2QGZA 5B1IA 3A14A 4UC0A 4X3CA 5CD9A 1D2RA 2NU9A 2GM4A 3OM8A 4ZC1A 4GMKA 1VBNA 1Y1RA 4PXAA 3RFUA 4BWFB 3RAEC 1D4AA 3LECA 1QB7A 5IC4A 1EFAA 4NDAA 2O7SA 3SMVA 5LP6A 3OZRA 4RD3A 4EY5A 1N6NA 3QI2A 5EIWA 1URPA 4Q7MB 2ADFA 4QLOA 4EDFA 1J2TA 1C30A 2HK9A 3PL5A 1FRZA 2GAFA 3NHMA 3DOFA 2EXXA 1R9NA 4IKOA 2B21A 4M7WA 1WPXA 2WAMA 3DZIA 2CNNA 3JQ7B 3KJXA 4C2AA 1PQUA 2O54A 1H8EA 3HKEA 4Q9AA 3CR8A 3DYVA 2GAIA 2DMRA 2QIOA 3P19A 5FJJA 3VFDA 3WLOA 2FSSA 3QVMA 2OA0A 4B5KA 5L3QB 5GM1A 2VDQB 4BNDB 1LK7A 1A1SA 2I4MA 2X6QA 2G72A 3C3YA 3P9SA 1ZKDA 3OJXA 5AOCA 3HC7A 4FUQA 1WB9A 5CIYA 5JXIA 4UCWA 4REOA 5PNTA 3DKIA 1K9VF 4JODA 3AIKA 5HIMA 3BGOS 3URKA 4F5YA 3M81A 4HLUC 4JP2A 2WJ3A 2Z5VA 3JQ7A 3W1VA 1N32B 4DQVA 3RGWS 3WK5A 3ZE0B 3TMKA 3VAZA 2E6KA 4JI6B 1P75A 4MS1A 2XB9A 2I6TA 2D2FA 4M1MA 2DQZA 5AJZA 2JD1A 4DCMA 1EFDN 1J2YA 4CV0A 5FORA 1UBNA 3I5AA 4CIDA 3U61B 2FW1A 1AX9A 5CIWA 5AXAA 3PLAE 2M9MA 1L8AA 4D0RA 1GLVA 3VR1A 2HRDA 4NCJA 4JGIA 4YHBA 5FDFA 5JS8A 3LM8A 2Q45A 2NO5A 1RCFA 4IILA 3K0AB 1FXUA 1R6AA 4KLCA 4L27A 5F2KA 2JVJA 4AIRA 2D1TA 1QWSA 3DQZA 3V8BA 1ACJA 4PZLA 1MAUA 2IUSA 3TQHA 3TAXA 1XDBA 3QHAA 3V8MA 2DZDA 4GYWA 1AHHA 1ADJA 1VJCA 4ZARA 4J2TA 1HGXA 4DR7B 2ZWIA 2ASVA 3ENZA 3KKKA 3PRYA 4GYJA 4ND8A 3SN6A 4C0KA 4C1BA 5H7XA 2G1KA 4IIBA 1NFRA 2MSCB 4LJKA 5H83A 2XUPA 1EWRA 2H06A 1G38A 1GUAA 4G9EA 3IODA 3OPNA 2UUCB 3KVOA 3PXCX 3VZBA 5B12A 1RIFA 1V1MA 4KN8A 1JTVA 3CPHA 3AHIA 3O8QB 4ES6A 4FFMA 2B25A 1MKYA 1OILA 2WIJA 4G25A 4PAWA 4GKKB 4DXDA 5C7OO 1RTKA 2G82A 1RIIA 4KE6A 1C2TA 4LQCA 2WD7B 4N5MA 2NUAB 2FUG6 1LVHA 5ALKA 4DA6A 3LAWA 4X00A 4EGJA 5ABPA 3NB0A 1CPYA 2C92A 3CB4A 1XDUA 4WOKA 2YHUA 2VEOA 4RY0A 1LZLA 1X13A 1WEKA 3AB7A 3K1AA 1SUIA 3FA2A 3PT5A 3K16A 4COKA 3CMMA 1FDTA 3L8DA 3UT0A 1MFZA 1XPJA 3AFNA 2BL4A 4KWEA 1DARA 2DULA 5B4VA 3O4GA 1VXRA 3Q9SA 4KMSA 4LNAA 2I65A 3DZGA 3N8HA 2JFFA 3TL3A 4ENQA 3KHKA 4R1SA 4RVSA 1DKUA 4JX9A 1W7AA 1KZ4A 3DHNA 4MJ7A 4K46A 4EJMA 2JC3A 1OXSC 3L1IA 3O75A 1PKXA 1FDIA 4MV9A 4BNJA 3V7WA 3KJGA 1L3CA 3B36A 3BXFA 4DEXA 4AF8A 1CS0B 4MLPA 2AC7A 2JGMA 4P1ZA 5AVZA 3KFLA 1SKBA 3VVLA 1DCTA 1DIBA 5FB3A 2X9GA 4IIUA 3MSXA 1L4HA 2HM7A 3L7IA 4FW8A 4DMRA 4MWGA 1E6KA 1OFUX 2ZYWX 2DCUA 4WKPA 1NLFA 1AXEA 3ETJA 4FSXA 2W0MA 1DAPA 4RFLA 3ZHBA 1T1JA 2JJ1D 2EW1A 5IULC 5HOQA 1YF3A 1GN8A 3B9BA 5J2UF 1JSRA 3DBLA 4MWZA 1MJNA 2ZBDA 3ZU3A 2BGGA 1Q16A 2IP4A 2NOAA 1R0CA 4KO2S 2R8OA 2YWRA 3P2JA 4F38A 2J3IA 1K8XB 1K86A 2P8SA 2VPYA 4YCBA 1TX4B 5KOHB 1RZVA 3N0TA 1WEHA 4OQNA 1ONSA 1DRKA 3WYEA 1BKSB 1XLVA 1D1QA 1IB0A 1UC5B 2OD7A 3G88A 4GR4A 4B7CA 4DV1B 3SG0A 1SRQA 2HU5A 1UBLS 3HG7A 3DAOA 4Q4LA 4PVCA 4UHDA 4XYEA 2J7PA 2PWPA 5EJ2A 3LQFA 1EDOA 4RU1A 3R6TA 3CX7A 4BVFA 1A96A 1YZQA 1MHPA 4A0FA 3QYAA 2UDPA 3VOTA 3FNRA 3BGWA 4LC0A 2PAFA 3QIAA 3AFIA 3OCUA 4EKNB 4DSAA 2ECQA 5LBIA 3L4JA 4HX9A 1RXWA 3D6AA 1A1VA 1E8NA 1HE2A 1S8AA 1S9HA 1QP7A 2SKDA 3MT7A 4GR5A 1L0BA 1TYZA 2CLIB 2CXTA 3A6HA 3MUEA 3ORYA 4LJ7A 5DCYA 1ZP6A 1SOVA 1EK5A 2HK6A 2Q9UA 2ZB4A 3DKRA 3NBUA 3QJ5A 4H6XA 3JAWB 4RSMA 821PA 4HH0A 1YA4A 4INZA 4ZPXA 2GX6A 2C96A 2FF7A 2HSZA 2PXHA 2YQ4A 4GGOA 2N3ZA 3COJA 1NQTA 1BDIA 2X76A 1OBVA 4FFNA 3DMTC 4JLAA 4CU2A 3CVVA 1GAXA 1Q7CA 3P52A 3PIRA 3ZI7A 2PX6A 4US1R 5D7NA 3RRNA 2XNJA 3GA7A 3KJHA 2R6DA 3R3HA 1YL6A 3VRHA 3BJEA 3WKAA 1L4GA 1FU4A 1WOMA 4MV1A 3SXPA 4B8ZA 4ND5A 1P1JA 4ZDKA 1RP1A 1QVVA 2I7DA 1HE1C 4ZJZA 3O94A 5JEEA 2J0SA 2P77A 1R8SA 2G0AA 4PHTA 2C9ZA 1DXHA 5JAMA 1SU8A 5J2TA 4CQNA 2ERCA 2KJQA 1Z88A 2ZLBA 2VAWA 3FSGA 3SQNA 1M83A 3QPWA 3MFQA 3LL4A 3P9PA 3A70A 1MNAA 1IN7A 3LBHA 2JFGA 2AG8A 4XXHA 1PJSA 4WHMA 2RDMA 1MO3A 3WLRA 2XX3A 1B0AA 2ZRPA 3DCNA 2Q3FA 4I8IA 1KZ9A 2FFBA 5A0TA 1J8VA 1ESEA 2ZCVA 4Q3DA 2H2DA 2PX3A 2VNJA 4YJDA 5DHQA 3S99A 1DPGA 4JNCA 3ZY3A 4D79A 2IBTA 2H2GA 1U65A 2IYQA 3Q8MA 4FCWA 4KIJA 3B7GA 3L3BA 1ZZEA 4IW3B 2P5SA 4P3KA 4Y1RA 1JTFA 3SGLA 2ZRMA 4WIAA 4URYR 3TTTA 2WJHA 3BCSA 3U3OA 4E3ZA 5JATA 4JMPA 1IPFA 1QB8A 2FUEA 3F97A 2PH7A 4DKJA 4LW8A 2QE7A 4YDRA 4R1QA 4A10A 3FWZA 4NHEA 3SE7A 3TNLA 3AERB 2PKRA 2Q3MA 2OMKA 4QBKA 4U3JA 4G56A 2J0UB 3WRYA 4OKIA 1PEDA 2PFGA 3RNOA 3IAS6 4BWVA 5JASA 3OQPA 2YVLA 4HFRA 5DYNA 4DLVA 3FPGA 3G6WA 4P4TA 1BRMA 1AUPA 5HTOA 3WBJA 4LZNA 1BXRB 2OOSA 2EG5A 2PIAA 3D7NA 3LWNA 4IFEA 1ZONA 3AKCA 3P0HA 1BWQA 2E18A 2J9FA 1YCDA 2QOEA 3I6IA 3PNMA 4H60A 1DIHA 3WO0A 1I6LA 1Q19A 1SPBS 3PPIA 4DBLE 4J75A 2PL5A 4JQYA 2GOYA 5HIIA 4ZK2A 1C7JA 4DNOA 2D0DA 3FLAA 4MQMA 1J25A 3TINA 5AESA 5G1OA 4AF7A 4LE1A 4S05A 2VNKA 1MH1A 4OHBA 5LWHA 4M8KA 4KBFA 2HJRA 5BWNA 4F4IA 3HM2A 2VZ9A 3G2NA 3MINA 1U0LA 4PONA 2GGSA 1Z6ZA 3VBEA 2RIPA 1QLHA 2QP4A 2O7QA 2WU3A 4IJ5A 5TF4A 1DHTA 3QF7A 4BQFA 2WJ6A 1O7JA 5AM4A 1LF5A 1IG0A 2A1TS 2MYTA 1W5EA 1WX1A 1R8QA 2V9ZA 2GASA 2IUFA 3CUUA 4V0ME 3ZH2A 2AA3A 2HBRA 1Y1QA 1LBTA 1WY7A 2WYVA 5I48A 1CR0A 1QKJA 1X8JA 2P9BA 2GEBA 2UUAB 3DULA 5DI3B 1SUPA 2H16A 4YUZA 4ZMBA 3SKVA 3P0JA 1KBZA 2FAXA 4F1KA 1UL1X 2F55A 3D3QA 3H7AA 3KPWA 1HETA 4PBSA 4RKQA 3E5NA 4JT2A 5FBHA 2QTBA 3EBLA 3RT7A 3S55A 4PN3A 3W5AA 1XTJA 4LXGA 3WB0A 2FJ0A 1IATA 4B45A 2SHKA 3NI2A 2R7NA 3PLRA 4JSRA 1A5TA 4LWZA 5SY4A 3ABZA 3CLUC 4BMOB 2O19A 5DHAA 1V37A 4BASA 4US2R 3K8QA 3L7BA 4YJ2F 5EC8A 3WGZA 3LVFO 1H2FA 2EL9A 2XRZA 1NY5A 1H0SA 4KDFA 1DIRA 4UNSA 2RGUA 4LHXA 4M4SA 1OR8A 3RYIA 3VU0A 2F59A 3EXG1 4DHWA 4IPTA 2A9PA 4S1OA 5KQSA 5FTJA 1D2CA 2RGAA 5GJBA 1X9GA 3QKSA 2ZJ0A 4GI2A 3X1XA 3JZMA 1CLEA 3I9MA 1N2IA 4GPIB 1OVMA 1QE0A 2Q6TA 1U0EA 2AE1A 5LQSA 4CEJA 2J3QA 3G2OA 2JZCA 1T9ZA 3L8ZA 4Q4HB 1Y9DA 2JGEA 1NRWA 2HWXA 3LE8A 3NWEA 3V97A 2W2LA 1D7OA 4M7OA 3A9UA 2M6SA 4HDMA 1G5TA 3M3PA 1VZ2A 1T5LA 1VFNA 4KAFA 3S3TA 5K3AA 4RK4A 3G89A 2CV1A 1UDBA 3F2VA 3L8EA 4EVIA 2CKMA 1VYVA 1YO6A 3SR4A 3UXHA 3S81A 2GT1A 4K9RA 1R15A 2OBXA 3AVYA 3WGGA 1JU9A 2IPMA 4OTZA 1VKOA 4FBLA 2NU7A 1VKZA 1ZOOA 1BGVA 4J7UA 1UJ6A 1RAHA 3HB7A 4LG1A 1DUVG 3RVBA 3ZCTA 2RHTA 4BQEA 1E2PA 3CH6A 2WHPB 4HQRA 3B52X 1RQPA 3Q98A 3WVNA 2JGJA 2FGKA 3UT6A 2XMSA 3OM0A 4O2BB 1LPAB 3UAWA 3BMOB 2A7QA 3A6JA 4FQ5A 4NJOA 5K4GA 3LPMA 4GQBA 3LPDA 5DP2A 3SBOA 5I47A 3OJ0A 2JAHA 2ZSDA 1T24A 3N07A 4M8IA 4OIFA 3L9XA 4NNPA 1VFPA 2H4YA 1OASA 1T3GA 1WDTA 4JZYA 3SS7X 3ZWYA 4OAQA 3U81A 2HHLA 5G1PA 1SVSA 3CVUA 3VZCA 3DR5A 3DO5A 4F7WA 1IXSB 3DHYA 3BMOA 4M0PA 1INLA 1SR8A 1US8A 1XZDA 2Z6QA 5F21A 4G41A 2SBTA 3ICVA 3R3SA 1KMHB 1NVTA 2A2ZA 1VCMA 2FEWB 3ELDA 4JJGA 3DVAA 1G9XA 2PRJA 1LC3A 2C5AA 4XZ3A 4YDHB 4FFOA 4FMDF 4JD5A 4GNRA 1SZPA 2IYPA 2CB0A 2W6MA 3KB6A 3T7IA 3UJDA 5IHXA 5AXDA 3RU2A 4DJ5X 3CQ9A 3H1FA 3PR1A 2BGRA 2J9ZB 1DGQA 1FFXB 1O94A 1Z4JA 5P21A 4O4LB 5K3FB 2PS0A 4KL8S 1KORA 1XSEA 1YBMA 3KT8A 1FX0A 4YAFA 5IBPA 3AL3A 5KKNB 3FOBA 4AJLA 4QLAA 1U2PA 3DEZA 4WN9B 3A1DA 3OZ7A 1VG9B 4R68A 1TTHA 5ELMA 4RF2A 1RAFA 1PLJA 4BVLA 5H9WA 3LUHA 2C0QA 4IS2A 3B89A 5DWQA 5FJIA 4BFWA 5ALGA 3KE9A 3Q3GE 4XPIA 3B1WA 1Y5MA 2YHIB 3MWLA 1P1HA 4IHJF 2QG6A 4FFLA 2OEPA 1ZR4A 1CQIB 3NP9A 2J5KA 4FHGA 4FN4A 5ALXA 5EZSA 1C7EA 3V4SA 3KQHA 3FF4A 4R83A 4WN9A 1L7EA 3H1GA 3IHWA 2PY6A 2R2AA 1J23A 4JB8A 4BJ6A 4Z1OA 4KU4A 3QUBA 5AIBA 2FMIA 1JEYA 1CJUC 2VQSA 5AKGA 2W2KA 1QRRA 2Y1DA 4WZ6A 2WWGA 1ZM3A 4NBRA 4Y8VA 1W76A 2PJZA 3FTPA 3PE3A 2F1KA 4LYFA 3ZZUA 2C5SA 1XCOA 1RXUA 1C7ZA 2DJ5A 2WIGA 3LC0A 5JTUA 1CUCA 3FCSB 4FZRA 2JK0A 2FUNB 4HPWA 4FNAA 1IWOA 1I14A 2WYOA 3NYIA 2ATVA 1AURA 1XDGA 1XEAA 2IVZA 2LRHA 1AF7A 3G2IA 2O05A 2ZE8A 3CEHA 3KOWA 3M8KA 4WEQA 2J7PD 3T9AA 3D5QA 4F45A 5LOVA 2GR9A 3EGDB 5B7NA 2LP4Y 2VHJA 3D6NB 3GLTA 1QVWA 2DFTA 2OSBA 3ZDZB 2FZ4A 4WOBA 2IP2A 1MIHA 1CS4C 1J49A 4TTSA 4LF6B 1EWVA 5FKJA 3NUGA 5A9TA 5FA5A 3X1DA 1DX9A 1YKFA 1P61B 4L2IA 3ETHA 3U3XA 1VB3A 4X54A 2IEBA 4FDVA 2C04A 3KU1A 3DMHA 2PLAA 4YFYA 3PYMA 5AKHA 1OB5A 1WDMA 4CR6A 5JHGB 1XGKA 1ICEA 1IDN1 2PGAA 2DFPA 5EE5B 4MQFA 3BRWA 1V95A 3DZHA 4ZJYA 1KJYA 4OSEA 3T9DA 2C54A 1P8JA 3F3KA 3HV2A 3USES 2QX9A 3AF4A 4MV5A 4A26A 2QL6A 4QDXA 4BV3A 1JILA 4E7OA 1GAWA 3QF4A 1A9QA 1QWOA 1ORTA 1TU3A 1YS6A 3QWIA 4P22A 1DKNA 1NT2A 2V5AA 1AT1A 2GWRA 2H51A 4ZEOA 2A7XA 4CLDA 4DA8A 3GLIB 4IX1A 1ZVVA 2IQ5A 4OB6A 2TYSB 1N5JA 2GPSA 2BCJQ 3QU2A 4N7JA 3CC8A 4B3GA 2ADMA 1Q1EA 1E7RA 3SHVA 1T91A 4TLAA 1EXVA 4EB6A 1OFGA 5CJPA 5AKZA 5EP2A 3E84A 2Z2YA 4DYHA 1RNLA 5M7EA 5MGBA 5KTSA 4LY0A 4XSGA 4TVSA 3F6SA 2Y8EA 2OBNA 4M54A 3AM1A 4O2AA 4QSMA 4UW9A 5EERA 4HG2A 3TM5A 5I7HA 1QO7A 1PTJA 2AQHA 4BO9A 5LZ8A 3FSGD 3DXZA 1DIOB 3DLPX 5F1OA 3RRJA 4JWTA 1E3WB 5EUBA 3DD5A 3UQZA 2ZT7A 3WHKA 1V3QE 4NV1A 5JANA 4I1OA 1DKLA 2AYZA 4CCAA 5I7OA 3TZCA 1HT1E 3IKTA 4NQZA 1L4EA 3S2FA 1F0NA 2EKQA 1NJSA 1JEQA 3R8CA 4H7DA 2OXIA 1R12A 3L8FA 1K89A 4F4CA 2IGTA 4DR3B 3AETB 4LE2A 3RTAA 5CITA 4YGYA 1T2NA 3P8ZA 1FW8A 4BYGA 3IP5A 1OLOA 2QE7D 4F3TA 2XUHA 1S3SA 4FOTA 4BGDA 1BMQA 1I8TA 1GFSA 4DARA 4H17A 3CLRD 2WYHA 3MVEA 1C9DB 1Q0PA 1KO7A 2VXCA 1S01A 2ZR7A 3NANA 4MSUA 5ITSA 1R0YA 2HDWA 3PJDA 5K6AA 4CTNA 4I2NA 4KXNA 2W83A 3O84A