1QW0A

Crystal structure of haemophilus influenzae n175l mutant holo ferric ion-binding protein a
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
308
structure length
308
Chain Sequence
b'DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKLSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-utilization periplasmic protein
publication title Presence of ferric hydroxide clusters in mutants of Haemophilus influenzae ferric ion-binding protein A
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Metal binding protein
total genus 109
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2003-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qw0A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qw0A01
3H03A 3TQLA 1P1NA 1PDAA 4LONB 3T9HB 4F18A 3C4MA 2DP8A 1SW1A 1JNFA 1MM7A 2DYXA 2V3UA 1BLFA 1KWHA 3UORA 2NUVA 1B3GA 1MY4A 3LBSA 4NF8A 5DTBA 3IOTA 2Q8JA 5CRYA 1N3WA 1I6AA 4LZ5A 4ZECA 5KCJA 3N26A 2XX9A 3SDFA 1RKMA 1MXUA 1MXZA 1TT1A 5KDTA 4WEPA 3SEWA 3HHGA 1FW0A 5DYHA 1LFHA 3E4RA 4EXKA 2OWSA 4GL8A 3OMBA 1XOCA 4OMBA 2FYIA 1JVXA 4HW8A 3GLBA 1P1UA 4Z0IA 3A3UA 1J1NA 3T96B 3U94A 4R2BA 5ICQA 4WKMA 4KR5A 2DVCA 1GR2A 2XXUA 1MPCA 1QW0A 4LVQA 1FTKA 4IB2A 1QKAA 4UA8A 3BBRA 4YKKA 2ZYKA 1B52A 2A5TA 4G4PA 1DSNA 4EDPA 2RC8A 3TYHA 1ELJA 2XXWA 4EF1A 1DMBA 3MVZA 2O1MA 2Y7KA 4QFKA 2VD2A 5AA2D 4ZE8A 4I62A 4R9GA 1S50A 3O66A 4F1UA 3DLNA 2O7UA 3ILTB 4GXAA 4LZ8A 3UIFA 5CI5A 1OIBA 5DEXA 1N7WA 1T0KA 4IGRA 3W15C 3HCQA 3IR1A 3KFMA 2WKYA 2DS9A 3IO4A 2XD2A 3OENA 1B1XA 5I59A 2UVIA 3I3VA 3TQWA 4U21A 2XXHA 3JZJA 4OETA 3IAZA 1LCFA 3VXBA 1PBPA 3IB1A 4NF4A 1NL5A 1QULA 3H6VA 4EUOA 2FA7A 3E3KA 1SQYA 4ZZEA 5ELVA 1IXIA 5H8NA 2PMSA 2O84X 3FV2A 2V3TA 4GWOA 4IO2A 1B0LA 4OEVA 3MAMA 1PB9A 3CVGA 4F39A 3S2VA 1LFGA 5M2VA 1H44A 2XXRA 3CFZA 2Q89A 3ODBA 3Q29A 5KCJB 4R6HA 2QS2A 1N04A 1JW1A 2BJJX 1JW5A 3V5AA 3DP4A 4X1BA 5KDTB 1IXHA 4QSCA 2Z22A 1AH5A 2VP1A 4BDNA 1S9TA 1B7HA 4GOTA 4BDLA 2IA4A 1SI0A 1O63A 1MH3A 5JK4A 5I2NA 1ZIUA 3LR1A 3W9WA 2O68A 3C35A 3PUYE 5TU0A 2B3BA 4HCWA 1UIVA 4EQBA 3ZSFA 1JQFA 2AYSA 2VD3A 3B6WA 1JEUA 3MP1A 3JV9A 4EXLA 3THIA 4JSDA 3SESA 3RN8A 4JXIA 2GRVA 4ZEKA 4IO5A 1XS5A 2AL5A 4PP0A 1B0HA 2YPNA 2B3FA 4PQJA 3KOSA 2REGA 1R6ZA 4GLIA 3SEUA 3KN3A 4QSDA 2HXWA 1MXWA 3RT6B 4GXSB 4OESA 1B58A 4LA9A 4OEUA 3CSGA 5H8QB 1M5DA 3VVEA 1MQDA 3H6WA 4KCCA 3G3KA 4AB5A 3OO7A 3K2DA 4IO7A 1M5CA 4ZZAA 1GVCA 2DE2A 5EHSA 4NF4B 1B6HA 3K6VA 3ONMA 4GVOA 2R71A 1ZBMA 4GL0A 4OFOA 1IEJA 4PETA 1EU8A 3HN0A 4YKJA 4OHNA 1MY2A 3MWBA 4BLAA 1R9LA 3O97A 4P0IA 3O6GA 3FVNA 3MVWA 1B2HA 3RUMA 2I4CA 5KZTA 4ZDMA 3K1PA 4YKPA 5I58B 3O29A 4KQPA 4RY1A 3H7MA 3SKPA 1UTHB 1EZPA 3K1NA 3U92A 1LCTA 3HPIA 4L17A 1A40A 1Z7ME 1IXCA 3RLFE 5L9MA 1B4ZA 4YAHX 1OVBA 5CM6A 1P1QA 2RKMA 1MPBA 5HBCA 4HTGA 1MDP1 3FUZA 2I4BA 4ELOA 3IOVA 1OVTA 1N84A 3G3FA 3QSLA 4ZEFA 4QFLA 5HPQA 1D4NA 5H8SA 3MBPA 1B3LA 4ELQA 2OZZA 4R2FA 3EHTA 1YPNA 3MPLA 1EH3A 1LSTA 2F36A 3OSQA 2FNCA 4U22A 3A09A 3IORA 1SYHA 3TPAA 3ZS6A 1H3DA 3UP9A 2HZLA 3BKIB 3QUFA 3IL1B 3IOUA 1NKXA 1VSOA 2Y7PA 2X26A 2NVUB 4YB7A 2Z8EA 3T93B 3HO7A 1ZMGA 1DOTA 1MQIA 5ITPA 2HEUA 3D4CA 4E0WA 4H65A 4ONYA 1PB8A 4Q8RA 4PFUA 2H4IA 4FEDA 1B1HA 1MS7A 3KOTA 3P7IA 3PMWA 4BDOA 1HSJA 4FORA 2RC9A 3DP8A 4GIZA 3U93A 5EYFA 1B4HA 3KJ7A 3PUXE 4BDRA 3UK4A 3QUJA 4G77A 2Z8DA 1VR5A 2XXIA 3BFTA 4YZZA 2ZNTA 3Q26A 2RC7A 1LAGE 3VXCA 5AA4B 4G8NA 4F22A 4G2ZA 4LZ7A 3TTNA 4TQUQ 5CMKA 2XXPA 3EHUA 2OLBA 3B7DA 3W9VA 1B3HA 4F3SA 1WDNA 3T9UA 2QPQA 2KLFA 4ZEIA 3C32A 1M5BA 3WAEA 1AMFA 1AIVA 1LFIA 5F1QA 3TTRA 1Q35A 4I8CA 4ECFA 2XHDA 5IKBA 5FTIA 3U1OA 3EPEA 1M5FA 4YICA 1FQBA 2D5WA 4GRKA 3MUQA 2DXRA 2H99A 3FVGA 3A3CA 3GXAA 5CBRA 3O9PA 1MM6A 4N6PA 3WAFA 3TDJA 3IO6A 4PFTA 3LSFB 1B40A 3TEPA 1TWYA 3K1MA 4M4GA 2Z23A 2XD3A 4EF2A 3FATA 4QSEA 3SEVA 1B51A 2Q2CA 2DVZA 1D3KA 2I3WA 3PUZE 2H25A 4U1OA 2I0BA 1WODA 4P11A 4H8JA 2P1SA 3OXNA 4IO4A 1POY1 4OENA 4NWDA 1UTBA 4RPNA 5ITOA 2QS3A 3TFLA 3M8UA 1OLAA 4I1DA 5H8QA 3IJOB 4ZS9A 4POXA 4X1DA 1SDXA 4M1VA 1MY0A 4DDDA 2DWIA 1N76A 2QL3A 4ZEBA 4C1UA 1LAHE 3PPOA 2QRYA 3K6WA 1QKBA 2RINA 2X7QA 1OMPA 4G68C 3RPWA 2F6GA 1Y9UA 1B05A 4AQ4A 3TKDA 2ZYOA 1Y1ZA 1SD3A 3KG2A 1L5TA 4GD5A 4YMBA 1FQCA 2PT2A 1A8FA 3MP6A 5IAIA 5AA3A 2R6GE 4F19A 3UA8A 1H43A 2DWHA 4XIGQ 3PD8A 5I57A 1B7UA 5I58A 1B3EA 4R9FA 5DVFA 3M3KA 4IY5A 5AE4A 1UTHA 2DE4A 3IK6B 4R73A 2HQ0A 3S9EA 1HSLA 3U8QA 1VE4A 1Y3QA 5AA2B 2PBWA 4NF6A 5H8FB 3TTKA 4TLMB 3PPQA 2XXQA 1WVJA 1FQFA 4IO6A 3TMGA 4FECA 3GBAA 2RF1A 1LBBA 3FVOA 1D9VA 4FAJA 4HS7A 3GBBA 3HV1A 4H6DA 3FXQA 5CC2A 3CRBA 1XVYA 1CE2A 2ESNA 1BIYA 2P2AA 3SEYA 1URSA 5I2KA 4THIA 3ZKKA 3R7XA 2GFEA 4YKIA 1Z7NE 4Z7EA 3K0VA 2O69A 3O6IA 2ONRA 4FE8A 3M3LA 3S9LC 4PFWA 1HSEA 1I69A 1B9JA 1UIUA 3K4UA 2OK2A 2ZNUA 5DT6A 3RQTA 5EHMA 3FXUA 2RCAA 1F9BA 1IUDA 4KI0E 3DP6A 1MRPA 2O7IA 1OQHA 3C36A 3G3HA 3MC2A 4YB6A 1MG1A 3VE1B 3V89B 5JEIA 4EQ7A 4MF3A 4R72A 1UTBB 4UACA 4JWYA 3FJGA 5BUUA 1B3FA 1AL3A 4K3FA 3PMXA 4AB6A 1SVXB 5CMMA 3H06B 3UN6A 3KJTA 1QVSA 1SW5A 2Y84A 3DM0A 3D4GA 3EHSA 3KN7A 2X7PA 1PC3A 3C34A 2ABHA 4KPTA 4O3BA 3K02A 5AA4A 4MH5A 2I6EA 4PFYA 2DSFA 3BFUA 2OJTA 1MXVA 1MQGA 3PPPA 3N5LA 1A55A 3VDFA 3EQ1A 4DXCA 1ANFA 5L9SA 4MLQA 3OEKA 3KN8A 4X48A 4NF5A 3N6UA 4OQOA 4FIMA 4OFJA 1Y4TA 5A5XA 1SBPA 2DXYA 4FJPA 4LQ2A 1NH7A 4R6YA 3K6UA 4OTEA 2HZKA 3N94A 2GHBA 2E1SA 4N13A 3T22A 4LUBA 3S4UA 5I57B 4QF9A 2XXXA 1YAEA 2I48A 4JDFA 4R74A 1H45A 3U72A 3LSXA 4XKNA 1A8EA 1USYH 3RGYA 3TUSA 2NOOA 4OVJA 4F31B 1A7LA 4NF6B 1LGBC 2Q2AA 1Y3NA 4ZEDA 2REJA 4NE4A 3SERA 1QUJA 4MLVA 1NNKA 2HAUA 2QMWA 3FJ7A 3KGCA 4TLLB 1POTA 1VFEA 1IXGA 3TZAA 5L8DA 3E13X 3V83A 4WEDA 4NWCA 3K6XA 2UXAA 3FZVA 3VLUA 4H0WA 3UGWA 3PV0E 1XVXA 3QAXA 1A54A 3FXRA 5I2KB 5FHNA 1Y20A 4H67A 1LBCA 1IITA 1R1NA 3CIJA 1US5A 3MPKA 5DVIA 5ICTA 2G93A 2ONKE 1PB7A 3CFLA 4XTCQ 3C33A 3PD9A 4HCYA 3V8XB 3C9HA 5AA1A 1GV8A 2D3IA 3JYRA 1DTZA 4F3GA 1XT8A 1MY3A 4XKPA 1BTJA 4LATA 1SW2A 4H1XA 4Q0CA 2LAOA 1MQJA 4KD5A 1NFTA 1B7ZA 3LUYA 2V25A 4O3CA 2V3QA 4G68B 4OWDA 4F1YA 1N0TA 4H5GA 4QRZA 3MQ9A 4RK2A 1URGA 1MXXA 1I6QA 5ISUA 1O7TA 3S9MC 2UVJA 2F6PA 4YMAA 3CSBA 2QSXA 2ZNSA 4TOZA 3I5OA 3PPRA 1SW4A 3C31A 4I9DA 1BP5A 1LAXA 1PBQA 4LQ5A 4O3AA 2VHAA 4QFOA 1QJMA 4P0GA 1NNPA 4BDMA 2DWAA 2I49A 2DOJA 3KZGA 1YCJA 3EF7A 2QS4A 2I0CA 3PGFA 5AA2A 3SETA 4NF5B 5H8FA 4ELRA 5A5XB 4E0XA 4RPOA 1XC1A 2G29A 2F35A 1US4A 4QHQA 2UYEA 3AXFA 5JTYA 1II5A 3MZ9A 4FEBA 1B46A 2HAVA 2F34A 3HSTA 2NXOA 5TP9A 3B6QA 2OWTA 1CB6A 4YU0A 4IO3A 1OLCA 4H8IA 1NNFA 4FATA 4OZ9A 2H9BA 5LOMA 1I6BA 2ALUA 1SI1A 1ZTYA 3N6TA 4EQ9A 2XXYA 5J1DA 4OXVA 4RA1A 3EN3A 1MY1A 3MZ1A 3MP8A 3QXMA 4YB5A 2V84A 1B5IA 1VFDA 4DXUA 1B32A 1TFDA 1ZLQA 3PPNA 2ANJA 3VV5A 3OELA 1DTGA 3FV1A 1QUKA 4XKRA 2OBGA 1LB9A 5F7VA 5I56A 2CZLA 3E9XA 4JWXA 2QMXA 4NEDA 2PVUA 2NWJA 3RY3A 1JW4A 3RT8A 4RNSA 4F3PA 2XXTA 4RK9A 3MW0A 3QYTA 3VLWA 3IJXB 4OFLA 3O28A 4F3BA 1YTVA 3IB0A 2XX7A 2PX1A 4DCXA 3OO9A 4H5FA 1AOVA 3TCGA 4IGTA 3G7WA 4U4SA 2PT1A 2DWJA 1EZ9A 2GH9A 1USYE 4MBPA 4KCDA 3T9VA 1P1OA 3G3GA 5K2YA 1MPDA 2ZYNA 1D9YA 1N3XA 2VGQA 2Y7RA 3M3FA 3FGSA 3KSXA 3K01A 1FTLA 3O6HA 2F7AA 1FTJA 1UQWA 5DVJA 3VLVA 4XKQA 1IQ7A 1O64A 1FTMA 1LLSA 3HHFA 2UYFA 2R9JA 4F2QA 2CMOA 3TAJA 2RCBA 4DCYA 3OOAA 3TTMA 4GF8A 2DE3A 1ZKBA 5B7DA 4LP2B 4JSOA 1MXYA 1XHYA 4OYVA 1LAFE 2Y7IA 4NF8B 5FHMA 3RTWB 4U1ZA 3ILUB 1FTOA 1B5HA 5JTYB 4QFNA 5B70A 2HCAA 2I3VA 1P99A 3S9NC 2Q9TA 2O6AA 1ZU0A 4Q30B 3QK6A 5TP9B 3DELB 5CMCA 3H6TA 4F1VA 4JWOA 3CFXA 1Y1MA 5CBSA 1PEBA 1B5JA 4U2RA 4U23A 4QFPA 3ZKLA 3LSLA 4IY6A 1Y4CA 3KSJA 4ZE9A 4N07A 1DPEA 2ZYMA 1NMUA 1Y3PA 1IZ1A 2M8CA 2HFBA 1P1WA 4G8HA 3PMVA 5HM4B 3FASA 3CG1A 2ZMBA 1GTKA 4Q5TA 3H3GA 3KEIA 4RYAA 3PUWE 5H8HA 3FVKA 2A5TB 1GGGA 5TPAA 1NNTA 2F8DA 4KYDA 1JEVA 2VOZA 3PUVE 3TCHA 3MVXA 3H6UA 5I56B 3K00A 1ATGA 4G68A 4KFQA 3TELA 4GFRA 4G8MA 2F78A 2F97A 3G3JA 1JETA 1TXFA 3ECRA 4DLDA 4OERA 5DEXB 1EZOA 3OSRA 2THIA 4RJZA 2QJEA 2PYYA 4F2OA 4MFIA 1ZJLA 1IIWA 1TFAA 2E0SA 3TCFA 2UVGA 1H76A 2DQVA 4PE5B 5I59B 3OO8A 3LSWA 3Q27A 1URDA 4ESXA 5I84A 1NH8A 2O1LA 4DZ1A 3I6VA 4POWA 3GZGA 3Q28A 2AIXA 1M5EA 2I58A 1MDQA 3USDA 4NMYA 2XXVA 3KBRA 4KHZE 2QS1A 4DXBA 2Z8FA 2D21A 4ELPA 2P0SA 5H8NB 4ESWA 4JB7A 2B65A 3VFJA 4F29A 3CG3A 4C0RA 2F5XA 1FQEA 2H5YA 1RYOA 5FTHA 3B6TA 3RTFB 2ONSA 4C1TA 4GQOA 3OD7A 4R6KA 3H4ZA 2ZXTA 2Q88A 1OQGA 3MJNA 3OO6A 2AL4A 1JVYA 1R9QA 3FJMA 2OCUA 3F11A 1LB8A 5K2XA 4DIGA 3QIMA 3R26A 3MVYA 1QUIA 3CI8A 2H98A 1Q1KA 5L9OA 3FIRA 3O2AA 3IB2A 1FQDA 3OEMA 3SEXA 2A5SA 5I2NB 3PU5A 3T9XB 3T66A 4U4XA 2UVHA 3G3IA 4ND9A 1MH4A 1S7YA 2GHAA 1FCKA 4ISUA 1A99A 3R6UA 5H8HB 3LC8A 2O51A 3MZBA 5TPAB 4JBZA 2Y7WA 4X9TA 4KYSA 4KYEA 1MQHA 3RNNA 1BKAA 3L6GA 4WXJA 2YJPA 1SYIA 3IOWA 3Q25A 5BWJA 1RYXA 2YLNA 2F7CA 1FQAA 3IX1A 2F7BA 2V93A 3TTLA 3VVFA 3L6HA 3FD3A 4DE8A 3TODA 4R75A 4XXUA 4NTLA 4BDQA 2IEEA 1N7XA 5CMBA 5FHOA 3VVDA 4RXLA 2W7YA 1DPPA 2XX8A 3CR9A
chains in the Genus database with same CATH superfamily
3H03A 4PBHA 3ROJA 3TQLA 1P1NA 1PDAA 4LONB 3T9HB 4F18A 3C4MA 2DP8A 1SW1A 1JNFA 1MM7A 2DYXA 2V3UA 1BLFA 4N4UA 2XWKA 1KWHA 3UORA 2NUVA 1B3GA 1MY4A 3NOHA 3LBSA 4NF8A 5DTBA 3IOTA 2Q8JA 4MNCA 5CRYA 1N3WA 2XWOA 1I6AA 2P3VA 4LZ5A 4ZECA 5KCJA 3N26A 2XX9A 3SDFA 4H45A 1RKMA 1MXUA 1MXZA 1LBZA 1TT1A 5KDTA 4WEPA 3SEWA 3HHGA 1FW0A 5DYHA 1LFHA 3E4RA 4EXKA 2OWSA 4GL8A 3OMBA 1SPIA 1XOCA 4OMBA 2FYIA 1JVXA 4HW8A 3GLBA 1P1UA 4Z0IA 3A3UA 1J1NA 3T96B 2CZIA 5FBPA 3U94A 4R2BA 5ICQA 1YYZA 4GWYA 4WKMA 4KR5A 2DVCA 1GR2A 2XXUA 1MPCA 4GWWA 1QW0A 1IMEA 4LVQA 1FTKA 4IB2A 1NV5A 1QKAA 4UA8A 3BBRA 4YKKA 2ZYKA 1B52A 2A5TA 2XA5A 4G4PA 1DSNA 4EDPA 2RC8A 3TYHA 1ELJA 2XXWA 4EF1A 1DMBA 3MVZA 4GX6A 2O1MA 2Y7KA 4QFKA 2VD2A 5AA2D 4ZE8A 4I62A 4R9GA 1S50A 3O66A 4F1UA 3DLNA 2O7UA 3ILTB 4NAPA 4GXAA 1FBCA 4LZ8A 3UIFA 5CI5A 1OIBA 5DEXA 1DCUA 1N7WA 1T0KA 4IGRA 3W15C 3HCQA 3IR1A 3KFMA 2WKYA 2DS9A 3IO4A 2XD2A 3OENA 1B1XA 5I59A 2UVIA 3I3VA 3TQWA 4P9KA 4U21A 4FBPA 2XXHA 3JZJA 4H46A 4OETA 3IAZA 1LCFA 1PBPA 3VXBA 3IB1A 4NF4A 1NL5A 4GBWA 1QULA 3H6VA 4EUOA 4NN3A 2FA7A 4OVRA 3E3KA 1IMCA 4GWUA 1SQYA 4ZZEA 5ELVA 1FBGA 1IXIA 5H8NA 2PMSA 2O84X 3FV2A 2WYKA 2V3TA 4OVPA 4P8BA 4GWOA 4IO2A 1B0LA 4OEVA 3MAMA 1PB9A 3CVGA 4F39A 3S2VA 1LFGA 5M2VA 1H44A 4O94A 2DDKA 2XXRA 3CFZA 2XWIA 3CHGA 4MEVA 3T1BA 2Q89A 3ODBA 3Q29A 5KCJB 4R6HA 2QS2A 3GYYA 1FBHA 1N04A 1JW1A 2BJJX 1JW5A 4O7IA 3V5AA 3DP4A 4X1BA 5KDTB 1IXHA 4QSCA 2Z22A 3IFCA 1AH5A 2VP1A 4BDNA 1S9TA 4QBAA 4PC9A 1B7HA 4OVQA 4GOTA 4BDLA 2IA4A 1SI0A 1O63A 1MH3A 5JK4A 5I2NA 1ZIUA 3LR1A 2O68A 3C35A 3W9WA 3PUYE 5TU0A 2B3BA 4HCWA 1UIVA 4EQBA 4NX1A 5DW8A 1K9ZA 3ZSFA 1JQFA 2FBPA 2AYSA 2VD3A 3B6WA 4OANA 1JEUA 3MP1A 4PAKA 3JV9A 4EXLA 3THIA 1FBEA 4JSDA 3SESA 3RN8A 4JXIA 2GRVA 4ZEKA 4IO5A 1XS5A 4AS5A 2AL5A 2HXRA 4PP0A 1B0HA 2YPNA 2B3FA 4PQJA 4P47A 3KOSA 2REGA 1R6ZA 4GLIA 3SEUA 3KN3A 1FJ9A 5IZZA 4QSDA 2HXWA 1MXWA 3RT6B 4GXSB 2CZHA 4OESA 1B58A 2OWZA 4LA9A 4OEUA 4MAGA 3CSGA 5H8QB 1M5DA 1MQDA 3H6WA 4N8YA 3VVEA 4KCCA 3G3KA 4AB5A 3OO7A 5ET5A 5LTCA 3K2DA 4IO7A 1M5CA 2B4LA 4ZZAA 1GVCA 3SZPA 2DE2A 5EHSA 4NF4B 1B6HA 2WYPA 3K6VA 3ONMA 4GVOA 5EQ8A 2R71A 1ZBMA 4GL0A 4OFOA 4LN5A 1IEJA 4PETA 1EU8A 3HN0A 4YKJA 1FBDA 2WBDA 4OHNA 1MY2A 3MWBA 4PAIA 2OX3A 4BLAA 1R9LA 3O97A 4P0IA 3O6GA 3FVNA 3MVWA 4OVTA 1B2HA 2PFYA 3RUMA 4N6DA 1NV7A 2I4CA 5KZTA 4ZDMA 3K1PA 4YKPA 5I58B 3O29A 2WBBA 4KQPA 4RY1A 4HE2A 3H7MA 3SKPA 1UTHB 1EZPA 3K1NA 3MSTA 3U92A 1LCTA 3HPIA 4MX6A 4L17A 4N6KA 2HHMA 1A40A 1Z7ME 1IXCA 3RLFE 5L9MA 1FPLA 1B4ZA 4YAHX 1OVBA 5CM6A 1P1QA 2RKMA 1MPBA 5HBCA 4HTGA 1MDP1 3FUZA 2I4BA 4ELOA 3IOVA 1OVTA 4AS4A 1N84A 1CNQA 3G3FA 3QSLA 4ZEFA 4QFLA 5HPQA 1D4NA 5H8SA 3MBPA 1B3LA 4ELQA 2OZZA 4R2FA 3EHTA 1YPNA 3MPLA 1EH3A 1LSTA 2F36A 3OSQA 2FNCA 4U22A 3A09A 1FPKA 3IORA 4UABA 1SYHA 3TPAA 4MIJA 3ZS6A 1H3DA 3UP9A 2HZLA 3BKIB 4KXPA 3PTYA 3QUFA 3IL1B 3IOUA 1NKXA 1VSOA 2Y7PA 2X26A 2NVUB 4YB7A 2Z8EA 3T93B 2FHYA 3HO7A 1ZMGA 2V4CA 1DOTA 1MQIA 5ITPA 2HEUA 3D4CA 4E0WA 2FIEA 4H65A 4ONYA 1PB8A 4Q8RA 2ZZVA 4PFUA 2H4IA 4GBVA 4FEDA 1B1HA 1MS7A 3KOTA 3P7IA 3PMWA 4BDOA 2HPGA 1HSJA 4FORA 2RC9A 3DP8A 4GIZA 3U93A 5EYFA 1B4HA 3KJ7A 3PUXE 4BDRA 3UK4A 3QUJA 4G77A 2Z8DA 1VR5A 2XXIA 3BFTA 4YZZA 1IMDA 2ZNTA 3Q26A 2RC7A 1LAGE 3VXCA 5AA4B 4G8NA 4F22A 4G2ZA 4LZ7A 3TTNA 4TQUQ 4JVIA 5CMKA 2XXPA 3EHUA 2OLBA 3B7DA 5EQ7A 3W9VA 1NUWA 1B3HA 4I40A 4F3SA 1WDNA 3T9UA 1FPDA 2Q74A 2QPQA 2KLFA 4ZEIA 3C32A 1M5BA 4HXVA 3WAEA 1AMFA 1AIVA 1LFIA 5F1QA 3TTRA 3KC1A 1Q35A 4I8CA 4ECFA 2XHDA 5IKBA 5FTIA 3U1OA 3EPEA 1M5FA 4YICA 1FQBA 2D5WA 4GRKA 3MUQA 2DXRA 2H99A 3FVGA 3A3CA 3GXAA 5CBRA 3O9PA 1MM6A 4N6PA 3WAFA 3TDJA 3IO6A 4PFTA 3LSFB 1B40A 3TEPA 3EKIA 2ZZXA 1KA0A 1TWYA 3K1MA 4M4GA 2Z23A 2XD3A 4OVSA 4EF2A 3FATA 1RDYA 4QSEA 1NV3A 3SEVA 1B51A 4PBQA 2Q2CA 1IMAA 3KC0A 2DVZA 1D3KA 2I3WA 3PUZE 3A29A 5IM2A 2H25A 4U1OA 2WX9A 1K9YA 2I0BA 2QVVA 1WODA 4P11A 4H8JA 2P1SA 3OXNA 4IO4A 1POY1 4OENA 4NWDA 1UTBA 4RPNA 5ITOA 2QS3A 3TFLA 3M8UA 1OLAA 2Y5KA 4I1DA 5H8QA 3IJOB 4ZS9A 4POXA 4X1DA 3IFAA 4XFEA 1SDXA 4M1VA 4NGUA 1MY0A 4DDDA 3E79A 2DWIA 4MJOA 1N76A 2QL3A 4ZEBA 4C1UA 1LAHE 3PPOA 2QRYA 3K6WA 1QKBA 2RINA 2X7QA 1OMPA 4G68C 3RPWA 2F6GA 1Y9UA 1B05A 4AQ4A 3TKDA 2ZYOA 1Y1ZA 1FTAA 4I3YA 1SD3A 3KG2A 1L5TA 4GD5A 4I3EA 1LBVA 4YMBA 1FQCA 2PT2A 1A8FA 3MP6A 3RYDA 5IAIA 5AA3A 2R6GE 4F19A 5I5PA 3UA8A 1H43A 2DWHA 4XIGQ 3PD8A 1RDZA 5I57A 1B7UA 1FPEA 1B3EA 4R9FA 5I58A 3BIHA 3LUZA 5DVFA 3M3KA 1FPGA 4IY5A 3HFUA 5AE4A 1UTHA 2DE4A 3IK6B 4R73A 2HQ0A 3S9EA 1HSLA 3U8QA 1VE4A 1Y3QA 5AA2B 2PBWA 4NF6A 5H8FB 3TTKA 4TLMB 3PPQA 2XXQA 1WVJA 1FQFA 1RDXA 4IO6A 3TMGA 1FPIA 2GQ1A 2VT5A 4FECA 2XWVA 3GBAA 2RF1A 1G0IA 1LBBA 3FVOA 1D9VA 4FAJA 4NQ8A 4HS7A 3GBBA 3HV1A 4H6DA 3FXQA 1EYJA 5CC2A 3CRBA 1XVYA 1CE2A 2ESNA 1BIYA 2P2AA 3SEYA 1URSA 5I2KA 1EYKA 4THIA 3ZKKA 3R7XA 2GFEA 4GX3A 4YKIA 1Z7NE 1NV2A 3FBPA 4Z7EA 3K0VA 2CEXA 2O69A 3O6IA 2ONRA 4FE8A 3M3LA 3S9LC 4GX4A 4PFWA 1HSEA 1I69A 1B9JA 1UIUA 3K4UA 2OK2A 2ZNUA 5DT6A 3RQTA 4NF0A 5EHMA 3FXUA 2RCAA 1F9BA 1IUDA 4KI0E 3DP6A 1MRPA 4MCOA 2O7IA 1OQHA 3C36A 3KBZA 3G3HA 3MC2A 4YB6A 1MG1A 3VE1B 3V89B 5JEIA 4EQ7A 4MF3A 4PFRA 4R72A 1UTBB 4UACA 4N15A 4JWYA 3FJGA 5BUUA 5I7IA 4PCDA 1B3FA 1AL3A 4K3FA 4N91A 3PMXA 4AB6A 1SVXB 5CMMA 1Q9DA 3H06B 3KJTA 3UN6A 1NUYA 1QVSA 1SW5A 2Y84A 2F3DA 3DM0A 3D4GA 3EHSA 3KN7A 2F3BA 2X7PA 1PC3A 3C34A 2ABHA 4KPTA 2WEFA 4G61A 5ET8A 4O3BA 3K02A 2CEYA 4O7MA 1LBYA 5AA4A 4MH5A 2I6EA 4PFYA 2DSFA 1LEVA 3BFUA 4PE3A 2OJTA 1MXVA 1MQGA 2CZKA 3PPPA 3N5LA 1A55A 3T0JA 3VDFA 3EQ1A 4DXCA 1ANFA 5EYGA 5L9SA 4MLQA 3OEKA 3KN8A 4X48A 4NF5A 3N6UA 4OQOA 1FPBA 4FIMA 4OFJA 1Y4TA 5A5XA 1SBPA 4JVDA 2DXYA 4FJPA 4LQ2A 1NH7A 4R6YA 3K6UA 4OTEA 1JP4A 2HZKA 3N94A 2GHBA 2E1SA 4N13A 4PFBA 3T22A 4LUBA 3S4UA 5EQ9A 5IGAA 5I57B 4QF9A 2XXXA 1YAEA 2VPNA 2I48A 4JDFA 2FVZA 4R74A 1H45A 3U72A 3LSXA 4XKNA 1A8EA 1USYH 3U65A 3RGYA 3TUSA 2NOOA 4OVJA 4F31B 1A7LA 4NF6B 1LGBC 2Q2AA 1Y3NA 1NV1A 4ZEDA 2REJA 5IZ1A 4NE4A 3SERA 1QUJA 4GWZA 4MLVA 1NNKA 2HAUA 2QMWA 3FJ7A 3KGCA 4TLLB 1POTA 4NHBA 1VFEA 1IXGA 3TZAA 5L8DA 3E13X 3V83A 4WEDA 4NWCA 1FPFA 3K6XA 2UXAA 3FZVA 3VLUA 4H0WA 3UGWA 3PV0E 1XVXA 1NV0A 4NG7A 3QAXA 1A54A 3FXRA 5I2KB 1NV6A 5FHNA 1Y20A 4H67A 1LBCA 1IITA 1R1NA 3CIJA 1US5A 3MPKA 5ET7A 5DVIA 5ICTA 2G93A 2ONKE 1PB7A 3CFLA 4PGNA 4XTCQ 3C33A 3PD9A 4HCYA 4DI3D 3V8XB 2JJKA 3C9HA 5AA1A 1GV8A 2D3IA 3JYRA 1DTZA 4F3GA 1XT8A 1YXIA 1MY3A 4PDDA 4XKPA 1BTJA 4LATA 1SW2A 4H1XA 4Q0CA 2LAOA 1LBWA 4N81A 1YZ0A 1MQJA 4KD5A 1EYIA 1NFTA 4PF6A 1B7ZA 2P3NA 3LUYA 2V25A 4O3CA 4PFIA 2V3QA 4G68B 4OWDA 4F1YA 1N0TA 4H5GA 4QRZA 2ZZWA 3MQ9A 4RK2A 1URGA 1MXXA 1I6QA 5ISUA 1O7TA 3S9MC 2UVJA 4N8GA 2F6PA 4YMAA 3CSBA 2QSXA 2ZNSA 4TOZA 3I5OA 3PPRA 1SW4A 3C31A 4I9DA 2B4MA 1BP5A 1LAXA 1PBQA 4LQ5A 4O3AA 2VHAA 4IR8A 1IMFA 2BJIA 4QFOA 1QJMA 4P0GA 1NNPA 4BDMA 2DWAA 3FXBA 2I49A 2DOJA 3KZGA 1YCJA 3EF7A 2QFLA 2QS4A 2I0CA 3PGFA 2MKZA 5AA2A 3SETA 4NF5B 4P3LA 5H8FA 4ELRA 5A5XB 4E0XA 1G0HA 4PTKA 4RPOA 1XC1A 2G29A 2F35A 4XEQA 1US4A 4QHQA 2UYEA 3AXFA 5JTYA 1II5A 3MZ9A 4FEBA 1B46A 2HAVA 2F34A 3HSTA 2NXOA 5TP9A 3B6QA 2OWTA 1CB6A 4YU0A 4P1EA 4IO3A 1OLCA 1FSAA 4H8IA 1NNFA 4FATA 4OZ9A 2H9BA 5LOMA 1I6BA 2ALUA 1SI1A 1ZTYA 3N6TA 4PDHA 4EQ9A 2XXYA 5J1DA 4OXVA 4RA1A 3EN3A 1MY1A 3MZ1A 1AWBA 3MP8A 3QXMA 4MHFA 4YB5A 2V84A 1B5IA 1NI9A 1VFDA 4DXUA 1B32A 1TFDA 1ZLQA 3PPNA 2ANJA 3VV5A 3OELA 1DTGA 3FV1A 1QUKA 4XKRA 2OBGA 1LB9A 5F7VA 5I56A 2CZLA 3E9XA 4JWXA 2QMXA 4NEDA 2PVUA 2NWJA 4DI4B 3RY3A 1JW4A 3RT8A 4RNSA 4F3PA 2XXTA 4O8MA 4RK9A 3MW0A 3QYTA 3VLWA 3IJXB 4OFLA 1INPA 1FPJA 3O28A 4F3BA 1YTVA 3IB0A 2XX7A 2PX1A 4DCXA 4GWSA 5ET6A 3QMFA 3OO9A 1NUZA 4H5FA 1LBXA 1AOVA 3TCGA 4GWXA 4IGTA 3G7WA 4U4SA 2PT1A 2DWJA 1EZ9A 5T3JA 2GH9A 1USYE 4MBPA 4KCDA 3T9VA 1P1OA 3RPLA 3G3GA 4OA4A 5K2YA 1MPDA 5A5LA 5LDZA 2ZYNA 4QXDA 4P56A 1D9YA 1N3XA 2L5VA 2VGQA 2Y7RA 3M3FA 4N17A 3FGSA 3KSXA 3K01A 1FTLA 3O6HA 2F7AA 1FTJA 1UQWA 5DVJA 3VLVA 4XKQA 1IQ7A 1O64A 3E78A 1FTMA 1LLSA 1VDWA 3HHFA 2UYFA 1QGXA 2R9JA 4F2QA 2CMOA 1BK4A 3TAJA 2RCBA 4DCYA 3OOAA 3TTMA 4GF8A 2DE3A 5F24A 1ZKBA 2Q8MA 1D9QA 5B7DA 4X8RA 3MYUA 4LP2B 4JSOA 1MXYA 1XHYA 4OYVA 1LAFE 2Y7IA 4NF8B 5FHMA 3RTWB 4U1ZA 3ILUB 1FTOA 1B5HA 5JTYB 3BIGA 4QFNA 5B70A 5ESYA 2HCAA 2I3VA 1P99A 3S9NC 2Q9TA 2O6AA 1ZU0A 4Q30B 3QK6A 5TP9B 3DELB 2PFZA 5CMCA 3H6TA 4F1VA 4JWOA 3CFXA 1Y1MA 5CBSA 1PEBA 1B5JA 4U2RA 4U23A 4QFPA 3ZKLA 3LSLA 4IY6A 1Y4CA 3KSJA 4ZE9A 4N07A 4HE0A 1DPEA 3B50A 2ZYMA 1NMUA 1Y3PA 1IZ1A 2M8CA 1KA1A 2HFBA 1P1WA 1FBFA 4G8HA 3PMVA 5HM4B 3FASA 3CG1A 2ZMBA 1GTKA 4Q5TA 3H3GA 3KEIA 4RYAA 3PUWE 5H8HA 3FVKA 2A5TB 5IZ3A 1GGGA 5TPAA 1NNTA 2F8DA 4KYDA 1JEVA 2VOZA 3PUVE 3TCHA 3MVXA 3H6UA 5I56B 3D1RA 3K00A 1ATGA 4G68A 4KFQA 3TELA 4GFRA 4G8MA 2F78A 4PAFA 2F97A 1KZ8A 2Y5LA 2XXKA 3G3JA 1JETA 1TXFA 3ECRA 4DLDA 4OERA 5DEXB 1FJ6A 1EZOA 3OSRA 2THIA 4RJZA 2QJEA 2PYYA 4F2OA 4MFIA 2KR0A 1ZJLA 1IIWA 3LV0A 1TFAA 2E0SA 3TCFA 2UVGA 1H76A 5EQAA 2DQVA 5EYHA 4PE5B 5I59B 3OO8A 3LSWA 3Q27A 1URDA 4ESXA 5I84A 2PCRA 1NH8A 2O1LA 1DBZA 3RPLB 4DZ1A 3I6VA 4POWA 3GZGA 3Q28A 2QVRA 2AIXA 1M5EA 4MNIA 2I58A 1MDQA 3USDA 4NMYA 2XXVA 3KBRA 4KHZE 2QS1A 4DXBA 1DK4A 1NV4A 2Z8FA 2D21A 4ELPA 3ISPA 2VPOA 2P0SA 5H8NB 4ESWA 4JB7A 2B65A 3VFJA 4F29A 3CG3A 4C0RA 2F5XA 1FQEA 2FIXA 2H5YA 1RYOA 1FBPA 5FTHA 3B6TA 4MMPA 3RTFB 2ONSA 4C1TA 4GQOA 3OD7A 4R6KA 3H4ZA 4XF5A 2ZXTA 2Q88A 1OQGA 3MJNA 3OO6A 2AL4A 1JVYA 1R9QA 3FJMA 2QVUA 2OCUA 4X04A 2KQZA 2R8TA 4JVCA 3F11A 4PF8A 1LB8A 5K2XA 4DIGA 3QIMA 3R26A 3MVYA 1FRPA 1QUIA 3CI8A 2H98A 1Q1KA 5L9OA 3FIRA 3O2AA 3IB2A 1FQDA 3OEMA 3SEXA 2A5SA 5I2NB 3PU5A 3T9XB 3T66A 4U4XA 4HE1A 2UVHA 3G3IA 4ND9A 1MH4A 1S7YA 2GHAA 1FCKA 4ISUA 5I3SA 1IMBA 1A99A 3R6UA 5H8HB 1NUXA 3LC8A 5IZ3B 2O51A 3MZBA 5TPAB 3B8BA 5J16A 4JBZA 4MNPA 2Y7WA 4X9TA 4KYSA 4KYEA 1MQHA 3RNNA 1BKAA 1XI6A 3L6GA 4WXJA 2YJPA 1SYIA 3IOWA 3Q25A 4P1LA 5BWJA 1RYXA 2YLNA 2F7CA 1FQAA 3IX1A 2F7BA 2V93A 3TTLA 3VVFA 3L6HA 3FD3A 4DE8A 3TODA 4R75A 4XXUA 4NTLA 4BDQA 2IEEA 1N7XA 5CMBA 5FHOA 3VVDA 4RXLA 2W7YA 1DPPA 2XX8A 3CR9A 4PGPA
chains in the Genus database with same CATH topology
3H03A 3TQLA 1P1NA 1PDAA 4LONB 3T9HB 4F18A 3C4MA 2DP8A 1SW1A 1JNFA 1MM7A 2DYXA 2V3UA 1BLFA 1KWHA 3UORA 2NUVA 1B3GA 1MY4A 3LBSA 4NF8A 5DTBA 3IOTA 2Q8JA 5CRYA 1N3WA 1I6AA 4LZ5A 4ZECA 5KCJA 3N26A 2XX9A 3SDFA 1RKMA 1MXUA 1MXZA 1TT1A 5KDTA 4WEPA 3SEWA 3HHGA 1FW0A 5DYHA 1LFHA 3E4RA 4EXKA 2OWSA 4GL8A 3OMBA 1XOCA 4OMBA 2FYIA 1JVXA 4HW8A 3GLBA 1P1UA 4Z0IA 3A3UA 1J1NA 3T96B 3U94A 4R2BA 5ICQA 4WKMA 4KR5A 2DVCA 1GR2A 2XXUA 1MPCA 1QW0A 4LVQA 1FTKA 4IB2A 1QKAA 4UA8A 3BBRA 4YKKA 2ZYKA 1B52A 2A5TA 4G4PA 1DSNA 4EDPA 2RC8A 3TYHA 1ELJA 2XXWA 4EF1A 1DMBA 3MVZA 2O1MA 2Y7KA 4QFKA 2VD2A 5AA2D 4ZE8A 4I62A 4R9GA 1S50A 3O66A 4F1UA 3DLNA 2O7UA 3ILTB 4GXAA 4LZ8A 3UIFA 5CI5A 1OIBA 5DEXA 1N7WA 1T0KA 4IGRA 3W15C 3HCQA 3IR1A 3KFMA 2WKYA 2DS9A 3IO4A 2XD2A 3OENA 1B1XA 5I59A 2UVIA 3I3VA 3TQWA 4U21A 2XXHA 3JZJA 4OETA 3IAZA 1LCFA 3VXBA 1PBPA 3IB1A 4NF4A 1NL5A 1QULA 3H6VA 4EUOA 2FA7A 3E3KA 1SQYA 4ZZEA 5ELVA 1IXIA 5H8NA 2PMSA 2O84X 3FV2A 2V3TA 4GWOA 4IO2A 1B0LA 4OEVA 3MAMA 1PB9A 3CVGA 4F39A 3S2VA 1LFGA 5M2VA 1H44A 2XXRA 3CFZA 2Q89A 3ODBA 3Q29A 5KCJB 4R6HA 2QS2A 1N04A 1JW1A 2BJJX 1JW5A 3V5AA 3DP4A 4X1BA 5KDTB 1IXHA 4QSCA 2Z22A 1AH5A 2VP1A 4BDNA 1S9TA 1B7HA 4GOTA 4BDLA 2IA4A 1SI0A 1O63A 1MH3A 5JK4A 5I2NA 1ZIUA 3LR1A 3W9WA 2O68A 3C35A 3PUYE 5TU0A 2B3BA 4HCWA 1UIVA 4EQBA 3ZSFA 1JQFA 2AYSA 2VD3A 3B6WA 1JEUA 3MP1A 3JV9A 4EXLA 3THIA 4JSDA 3SESA 3RN8A 4JXIA 2GRVA 4ZEKA 4IO5A 1XS5A 2AL5A 4PP0A 1B0HA 2YPNA 2B3FA 4PQJA 3KOSA 2REGA 1R6ZA 4GLIA 3SEUA 3KN3A 4QSDA 2HXWA 1MXWA 3RT6B 4GXSB 4OESA 1B58A 4LA9A 4OEUA 3CSGA 5H8QB 1M5DA 3VVEA 1MQDA 3H6WA 4KCCA 3G3KA 4AB5A 3OO7A 3K2DA 4IO7A 1M5CA 4ZZAA 1GVCA 2DE2A 5EHSA 4NF4B 1B6HA 3K6VA 3ONMA 4GVOA 2R71A 1ZBMA 4GL0A 4OFOA 1IEJA 4PETA 1EU8A 3HN0A 4YKJA 4OHNA 1MY2A 3MWBA 4BLAA 1R9LA 3O97A 4P0IA 3O6GA 3FVNA 3MVWA 1B2HA 3RUMA 2I4CA 5KZTA 4ZDMA 3K1PA 4YKPA 5I58B 3O29A 4KQPA 4RY1A 3H7MA 3SKPA 1UTHB 1EZPA 3K1NA 3U92A 1LCTA 3HPIA 4L17A 1A40A 1Z7ME 1IXCA 3RLFE 5L9MA 1B4ZA 4YAHX 1OVBA 5CM6A 1P1QA 2RKMA 1MPBA 5HBCA 4HTGA 1MDP1 3FUZA 2I4BA 4ELOA 3IOVA 1OVTA 1N84A 3G3FA 3QSLA 4ZEFA 4QFLA 5HPQA 1D4NA 5H8SA 3MBPA 1B3LA 4ELQA 2OZZA 4R2FA 3EHTA 1YPNA 3MPLA 1EH3A 1LSTA 2F36A 3OSQA 2FNCA 4U22A 3A09A 3IORA 1SYHA 3TPAA 3ZS6A 1H3DA 3UP9A 2HZLA 3BKIB 3QUFA 3IL1B 3IOUA 1NKXA 1VSOA 2Y7PA 2X26A 2NVUB 4YB7A 2Z8EA 3T93B 3HO7A 1ZMGA 1DOTA 1MQIA 5ITPA 2HEUA 3D4CA 4E0WA 4H65A 4ONYA 1PB8A 4Q8RA 4PFUA 2H4IA 4FEDA 1B1HA 1MS7A 3KOTA 3P7IA 3PMWA 4BDOA 1HSJA 4FORA 2RC9A 3DP8A 4GIZA 3U93A 5EYFA 1B4HA 3KJ7A 3PUXE 4BDRA 3UK4A 3QUJA 4G77A 2Z8DA 1VR5A 2XXIA 3BFTA 4YZZA 2ZNTA 3Q26A 2RC7A 1LAGE 3VXCA 5AA4B 4G8NA 4F22A 4G2ZA 4LZ7A 3TTNA 4TQUQ 5CMKA 2XXPA 3EHUA 2OLBA 3B7DA 3W9VA 1B3HA 4F3SA 1WDNA 3T9UA 2QPQA 2KLFA 4ZEIA 3C32A 1M5BA 3WAEA 1AMFA 1AIVA 1LFIA 5F1QA 3TTRA 1Q35A 4I8CA 4ECFA 2XHDA 5IKBA 5FTIA 3U1OA 3EPEA 1M5FA 4YICA 1FQBA 2D5WA 4GRKA 3MUQA 2DXRA 2H99A 3FVGA 3A3CA 3GXAA 5CBRA 3O9PA 1MM6A 4N6PA 3WAFA 3TDJA 3IO6A 4PFTA 3LSFB 1B40A 3TEPA 1TWYA 3K1MA 4M4GA 2Z23A 2XD3A 4EF2A 3FATA 4QSEA 3SEVA 1B51A 2Q2CA 2DVZA 1D3KA 2I3WA 3PUZE 2H25A 4U1OA 2I0BA 1WODA 4P11A 4H8JA 2P1SA 3OXNA 4IO4A 1POY1 4OENA 4NWDA 1UTBA 4RPNA 5ITOA 2QS3A 3TFLA 3M8UA 1OLAA 4I1DA 5H8QA 3IJOB 4ZS9A 4POXA 4X1DA 1SDXA 4M1VA 1MY0A 4DDDA 2DWIA 1N76A 2QL3A 4ZEBA 4C1UA 1LAHE 3PPOA 2QRYA 3K6WA 1QKBA 2RINA 2X7QA 1OMPA 4G68C 3RPWA 2F6GA 1Y9UA 1B05A 4AQ4A 3TKDA 2ZYOA 1Y1ZA 1SD3A 3KG2A 1L5TA 4GD5A 4YMBA 1FQCA 2PT2A 1A8FA 3MP6A 5IAIA 5AA3A 2R6GE 4F19A 3UA8A 1H43A 2DWHA 4XIGQ 3PD8A 5I57A 1B7UA 5I58A 1B3EA 4R9FA 5DVFA 3M3KA 4IY5A 5AE4A 1UTHA 2DE4A 3IK6B 4R73A 2HQ0A 3S9EA 1HSLA 3U8QA 1VE4A 1Y3QA 5AA2B 2PBWA 4NF6A 5H8FB 3TTKA 4TLMB 3PPQA 2XXQA 1WVJA 1FQFA 4IO6A 3TMGA 4FECA 3GBAA 2RF1A 1LBBA 3FVOA 1D9VA 4FAJA 4HS7A 3GBBA 3HV1A 4H6DA 3FXQA 5CC2A 3CRBA 1XVYA 1CE2A 2ESNA 1BIYA 2P2AA 3SEYA 1URSA 5I2KA 4THIA 3ZKKA 3R7XA 2GFEA 4YKIA 1Z7NE 4Z7EA 3K0VA 2O69A 3O6IA 2ONRA 4FE8A 3M3LA 3S9LC 4PFWA 1HSEA 1I69A 1B9JA 1UIUA 3K4UA 2OK2A 2ZNUA 5DT6A 3RQTA 5EHMA 3FXUA 2RCAA 1F9BA 1IUDA 4KI0E 3DP6A 1MRPA 2O7IA 1OQHA 3C36A 3G3HA 3MC2A 4YB6A 1MG1A 3VE1B 3V89B 5JEIA 4EQ7A 4MF3A 4R72A 1UTBB 4UACA 4JWYA 3FJGA 5BUUA 1B3FA 1AL3A 4K3FA 3PMXA 4AB6A 1SVXB 5CMMA 3H06B 3UN6A 3KJTA 1QVSA 1SW5A 2Y84A 3DM0A 3D4GA 3EHSA 3KN7A 2X7PA 1PC3A 3C34A 2ABHA 4KPTA 4O3BA 3K02A 5AA4A 4MH5A 2I6EA 4PFYA 2DSFA 3BFUA 2OJTA 1MXVA 1MQGA 3PPPA 3N5LA 1A55A 3VDFA 3EQ1A 4DXCA 1ANFA 5L9SA 4MLQA 3OEKA 3KN8A 4X48A 4NF5A 3N6UA 4OQOA 4FIMA 4OFJA 1Y4TA 5A5XA 1SBPA 2DXYA 4FJPA 4LQ2A 1NH7A 4R6YA 3K6UA 4OTEA 2HZKA 3N94A 2GHBA 2E1SA 4N13A 3T22A 4LUBA 3S4UA 5I57B 4QF9A 2XXXA 1YAEA 2I48A 4JDFA 4R74A 1H45A 3U72A 3LSXA 4XKNA 1A8EA 1USYH 3RGYA 3TUSA 2NOOA 4OVJA 4F31B 1A7LA 4NF6B 1LGBC 2Q2AA 1Y3NA 4ZEDA 2REJA 4NE4A 3SERA 1QUJA 4MLVA 1NNKA 2HAUA 2QMWA 3FJ7A 3KGCA 4TLLB 1POTA 1VFEA 1IXGA 3TZAA 5L8DA 3E13X 3V83A 4WEDA 4NWCA 3K6XA 2UXAA 3FZVA 3VLUA 4H0WA 3UGWA 3PV0E 1XVXA 3QAXA 1A54A 3FXRA 5I2KB 5FHNA 1Y20A 4H67A 1LBCA 1IITA 1R1NA 3CIJA 1US5A 3MPKA 5DVIA 5ICTA 2G93A 2ONKE 1PB7A 3CFLA 4XTCQ 3C33A 3PD9A 4HCYA 3V8XB 3C9HA 5AA1A 1GV8A 2D3IA 3JYRA 1DTZA 4F3GA 1XT8A 1MY3A 4XKPA 1BTJA 4LATA 1SW2A 4H1XA 4Q0CA 2LAOA 1MQJA 4KD5A 1NFTA 1B7ZA 3LUYA 2V25A 4O3CA 2V3QA 4G68B 4OWDA 4F1YA 1N0TA 4H5GA 4QRZA 3MQ9A 4RK2A 1URGA 1MXXA 1I6QA 5ISUA 1O7TA 3S9MC 2UVJA 2F6PA 4YMAA 3CSBA 2QSXA 2ZNSA 4TOZA 3I5OA 3PPRA 1SW4A 3C31A 4I9DA 1BP5A 1LAXA 1PBQA 4LQ5A 4O3AA 2VHAA 4QFOA 1QJMA 4P0GA 1NNPA 4BDMA 2DWAA 2I49A 2DOJA 3KZGA 1YCJA 3EF7A 2QS4A 2I0CA 3PGFA 5AA2A 3SETA 4NF5B 5H8FA 4ELRA 5A5XB 4E0XA 4RPOA 1XC1A 2G29A 2F35A 1US4A 4QHQA 2UYEA 3AXFA 5JTYA 1II5A 3MZ9A 4FEBA 1B46A 2HAVA 2F34A 3HSTA 2NXOA 5TP9A 3B6QA 2OWTA 1CB6A 4YU0A 4IO3A 1OLCA 4H8IA 1NNFA 4FATA 4OZ9A 2H9BA 5LOMA 1I6BA 2ALUA 1SI1A 1ZTYA 3N6TA 4EQ9A 2XXYA 5J1DA 4OXVA 4RA1A 3EN3A 1MY1A 3MZ1A 3MP8A 3QXMA 4YB5A 2V84A 1B5IA 1VFDA 4DXUA 1B32A 1TFDA 1ZLQA 3PPNA 2ANJA 3VV5A 3OELA 1DTGA 3FV1A 1QUKA 4XKRA 2OBGA 1LB9A 5F7VA 5I56A 2CZLA 3E9XA 4JWXA 2QMXA 4NEDA 2PVUA 2NWJA 3RY3A 1JW4A 3RT8A 4RNSA 4F3PA 2XXTA 4RK9A 3MW0A 3QYTA 3VLWA 3IJXB 4OFLA 3O28A 4F3BA 1YTVA 3IB0A 2XX7A 2PX1A 4DCXA 3OO9A 4H5FA 1AOVA 3TCGA 4IGTA 3G7WA 4U4SA 2PT1A 2DWJA 1EZ9A 2GH9A 1USYE 4MBPA 4KCDA 3T9VA 1P1OA 3G3GA 5K2YA 1MPDA 2ZYNA 1D9YA 1N3XA 2VGQA 2Y7RA 3M3FA 3FGSA 3KSXA 3K01A 1FTLA 3O6HA 2F7AA 1FTJA 1UQWA 5DVJA 3VLVA 4XKQA 1IQ7A 1O64A 1FTMA 1LLSA 3HHFA 2UYFA 2R9JA 4F2QA 2CMOA 3TAJA 2RCBA 4DCYA 3OOAA 3TTMA 4GF8A 2DE3A 1ZKBA 5B7DA 4LP2B 4JSOA 1MXYA 1XHYA 4OYVA 1LAFE 2Y7IA 4NF8B 5FHMA 3RTWB 4U1ZA 3ILUB 1FTOA 1B5HA 5JTYB 4QFNA 5B70A 2HCAA 2I3VA 1P99A 3S9NC 2Q9TA 2O6AA 1ZU0A 4Q30B 3QK6A 5TP9B 3DELB 5CMCA 3H6TA 4F1VA 4JWOA 3CFXA 1Y1MA 5CBSA 1PEBA 1B5JA 4U2RA 4U23A 4QFPA 3ZKLA 3LSLA 4IY6A 1Y4CA 3KSJA 4ZE9A 4N07A 1DPEA 2ZYMA 1NMUA 1Y3PA 1IZ1A 2M8CA 2HFBA 1P1WA 4G8HA 3PMVA 5HM4B 3FASA 3CG1A 2ZMBA 1GTKA 4Q5TA 3H3GA 3KEIA 4RYAA 3PUWE 5H8HA 3FVKA 2A5TB 1GGGA 5TPAA 1NNTA 2F8DA 4KYDA 1JEVA 2VOZA 3PUVE 3TCHA 3MVXA 3H6UA 5I56B 3K00A 1ATGA 4G68A 4KFQA 3TELA 4GFRA 4G8MA 2F78A 2F97A 3G3JA 1JETA 1TXFA 3ECRA 4DLDA 4OERA 5DEXB 1EZOA 3OSRA 2THIA 4RJZA 2QJEA 2PYYA 4F2OA 4MFIA 1ZJLA 1IIWA 1TFAA 2E0SA 3TCFA 2UVGA 1H76A 2DQVA 4PE5B 5I59B 3OO8A 3LSWA 3Q27A 1URDA 4ESXA 5I84A 1NH8A 2O1LA 4DZ1A 3I6VA 4POWA 3GZGA 3Q28A 2AIXA 1M5EA 2I58A 1MDQA 3USDA 4NMYA 2XXVA 3KBRA 4KHZE 2QS1A 4DXBA 2Z8FA 2D21A 4ELPA 2P0SA 5H8NB 4ESWA 4JB7A 2B65A 3VFJA 4F29A 3CG3A 4C0RA 2F5XA 1FQEA 2H5YA 1RYOA 5FTHA 3B6TA 3RTFB 2ONSA 4C1TA 4GQOA 3OD7A 4R6KA 3H4ZA 2ZXTA 2Q88A 1OQGA 3MJNA 3OO6A 2AL4A 1JVYA 1R9QA 3FJMA 2OCUA 3F11A 1LB8A 5K2XA 4DIGA 3QIMA 3R26A 3MVYA 1QUIA 3CI8A 2H98A 1Q1KA 5L9OA 3FIRA 3O2AA 3IB2A 1FQDA 3OEMA 3SEXA 2A5SA 5I2NB 3PU5A 3T9XB 3T66A 4U4XA 2UVHA 3G3IA 4ND9A 1MH4A 1S7YA 2GHAA 1FCKA 4ISUA 1A99A 3R6UA 5H8HB 3LC8A 2O51A 3MZBA 5TPAB 4JBZA 2Y7WA 4X9TA 4KYSA 4KYEA 1MQHA 3RNNA 1BKAA 3L6GA 4WXJA 2YJPA 1SYIA 3IOWA 3Q25A 5BWJA 1RYXA 2YLNA 2F7CA 1FQAA 3IX1A 2F7BA 2V93A 3TTLA 3VVFA 3L6HA 3FD3A 4DE8A 3TODA 4R75A 4XXUA 4NTLA 4BDQA 2IEEA 1N7XA 5CMBA 5FHOA 3VVDA 4RXLA 2W7YA 1DPPA 2XX8A 3CR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H03 A;  3TQL A;  1P1N A;  1PDA A;  4LON B;  3T9H B;  4F18 A;  3C4M A;  2DP8 A;  1SW1 A;  1JNF A;  1MM7 A;  2DYX A;  2V3U A;  1BLF A;  1KWH A;  3UOR A;  2NUV A;  1B3G A;  1MY4 A;  3LBS A;  4NF8 A;  5DTB A;  3IOT A;  2Q8J A;  5CRY A;  1N3W A;  1I6A A;  4LZ5 A;  4ZEC A;  5KCJ A;  3N26 A;  2XX9 A;  3SDF A;  1RKM A;  1MXU A;  1MXZ A;  1TT1 A;  5KDT A;  4WEP A;  3SEW A;  3HHG A;  1FW0 A;  5DYH A;  1LFH A;  3E4R A;  4EXK A;  2OWS A;  4GL8 A;  3OMB A;  1XOC A;  4OMB A;  2FYI A;  1JVX A;  4HW8 A;  3GLB A;  1P1U A;  4Z0I A;  3A3U A;  1J1N A;  3T96 B;  3U94 A;  4R2B A;  5ICQ A;  4WKM A;  4KR5 A;  2DVC A;  1GR2 A;  2XXU A;  1MPC A;  1QW0 A;  4LVQ A;  1FTK A;  4IB2 A;  1QKA A;  4UA8 A;  3BBR A;  4YKK A;  2ZYK A;  1B52 A;  2A5T A;  4G4P A;  1DSN A;  4EDP A;  2RC8 A;  3TYH A;  1ELJ A;  2XXW A;  4EF1 A;  1DMB A;  3MVZ A;  2O1M A;  2Y7K A;  4QFK A;  2VD2 A;  5AA2 D;  4ZE8 A;  4I62 A;  4R9G A;  1S50 A;  3O66 A;  4F1U A;  3DLN A;  2O7U A;  3ILT B;  4GXA A;  4LZ8 A;  3UIF A;  5CI5 A;  1OIB A;  5DEX A;  1N7W A;  1T0K A;  4IGR A;  3W15 C;  3HCQ A;  3IR1 A;  3KFM A;  2WKY A;  2DS9 A;  3IO4 A;  2XD2 A;  3OEN A;  1B1X A;  5I59 A;  2UVI A;  3I3V A;  3TQW A;  4U21 A;  2XXH A;  3JZJ A;  4OET A;  3IAZ A;  1LCF A;  3VXB A;  1PBP A;  3IB1 A;  4NF4 A;  1NL5 A;  1QUL A;  3H6V A;  4EUO A;  2FA7 A;  3E3K A;  1SQY A;  4ZZE A;  5ELV A;  1IXI A;  5H8N A;  2PMS A;  2O84 X;  3FV2 A;  2V3T A;  4GWO A;  4IO2 A;  1B0L A;  4OEV A;  3MAM A;  1PB9 A;  3CVG A;  4F39 A;  3S2V A;  1LFG A;  5M2V A;  1H44 A;  2XXR A;  3CFZ A;  2Q89 A;  3ODB A;  3Q29 A;  5KCJ B;  4R6H A;  2QS2 A;  1N04 A;  1JW1 A;  2BJJ X;  1JW5 A;  3V5A A;  3DP4 A;  4X1B A;  5KDT B;  1IXH A;  4QSC A;  2Z22 A;  1AH5 A;  2VP1 A;  4BDN A;  1S9T A;  1B7H A;  4GOT A;  4BDL A;  2IA4 A;  1SI0 A;  1O63 A;  1MH3 A;  5JK4 A;  5I2N A;  1ZIU A;  3LR1 A;  3W9W A;  2O68 A;  3C35 A;  3PUY E;  5TU0 A;  2B3B A;  4HCW A;  1UIV A;  4EQB A;  3ZSF A;  1JQF A;  2AYS A;  2VD3 A;  3B6W A;  1JEU A;  3MP1 A;  3JV9 A;  4EXL A;  3THI A;  4JSD A;  3SES A;  3RN8 A;  4JXI A;  2GRV A;  4ZEK A;  4IO5 A;  1XS5 A;  2AL5 A;  4PP0 A;  1B0H A;  2YPN A;  2B3F A;  4PQJ A;  3KOS A;  2REG A;  1R6Z A;  4GLI A;  3SEU A;  3KN3 A;  4QSD A;  2HXW A;  1MXW A;  3RT6 B;  4GXS B;  4OES A;  1B58 A;  4LA9 A;  4OEU A;  3CSG A;  5H8Q B;  1M5D A;  3VVE A;  1MQD A;  3H6W A;  4KCC A;  3G3K A;  4AB5 A;  3OO7 A;  3K2D A;  4IO7 A;  1M5C A;  4ZZA A;  1GVC A;  2DE2 A;  5EHS A;  4NF4 B;  1B6H A;  3K6V A;  3ONM A;  4GVO A;  2R71 A;  1ZBM A;  4GL0 A;  4OFO A;  1IEJ A;  4PET A;  1EU8 A;  3HN0 A;  4YKJ A;  4OHN A;  1MY2 A;  3MWB A;  4BLA A;  1R9L A;  3O97 A;  4P0I A;  3O6G A;  3FVN A;  3MVW A;  1B2H A;  3RUM A;  2I4C A;  5KZT A;  4ZDM A;  3K1P A;  4YKP A;  5I58 B;  3O29 A;  4KQP A;  4RY1 A;  3H7M A;  3SKP A;  1UTH B;  1EZP A;  3K1N A;  3U92 A;  1LCT A;  3HPI A;  4L17 A;  1A40 A;  1Z7M E;  1IXC A;  3RLF E;  5L9M A;  1B4Z A;  4YAH X;  1OVB A;  5CM6 A;  1P1Q A;  2RKM A;  1MPB A;  5HBC A;  4HTG A;  1MDP 1;  3FUZ A;  2I4B A;  4ELO A;  3IOV A;  1OVT A;  1N84 A;  3G3F A;  3QSL A;  4ZEF A;  4QFL A;  5HPQ A;  1D4N A;  5H8S A;  3MBP A;  1B3L A;  4ELQ A;  2OZZ A;  4R2F A;  3EHT A;  1YPN A;  3MPL A;  1EH3 A;  1LST A;  2F36 A;  3OSQ A;  2FNC A;  4U22 A;  3A09 A;  3IOR A;  1SYH A;  3TPA A;  3ZS6 A;  1H3D A;  3UP9 A;  2HZL A;  3BKI B;  3QUF A;  3IL1 B;  3IOU A;  1NKX A;  1VSO A;  2Y7P A;  2X26 A;  2NVU B;  4YB7 A;  2Z8E A;  3T93 B;  3HO7 A;  1ZMG A;  1DOT A;  1MQI A;  5ITP A;  2HEU A;  3D4C A;  4E0W A;  4H65 A;  4ONY A;  1PB8 A;  4Q8R A;  4PFU A;  2H4I A;  4FED A;  1B1H A;  1MS7 A;  3KOT A;  3P7I A;  3PMW A;  4BDO A;  1HSJ A;  4FOR A;  2RC9 A;  3DP8 A;  4GIZ A;  3U93 A;  5EYF A;  1B4H A;  3KJ7 A;  3PUX E;  4BDR A;  3UK4 A;  3QUJ A;  4G77 A;  2Z8D A;  1VR5 A;  2XXI A;  3BFT A;  4YZZ A;  2ZNT A;  3Q26 A;  2RC7 A;  1LAG E;  3VXC A;  5AA4 B;  4G8N A;  4F22 A;  4G2Z A;  4LZ7 A;  3TTN A;  4TQU Q;  5CMK A;  2XXP A;  3EHU A;  2OLB A;  3B7D A;  3W9V A;  1B3H A;  4F3S A;  1WDN A;  3T9U A;  2QPQ A;  2KLF A;  4ZEI A;  3C32 A;  1M5B A;  3WAE A;  1AMF A;  1AIV A;  1LFI A;  5F1Q A;  3TTR A;  1Q35 A;  4I8C A;  4ECF A;  2XHD A;  5IKB A;  5FTI A;  3U1O A;  3EPE A;  1M5F A;  4YIC A;  1FQB A;  2D5W A;  4GRK A;  3MUQ A;  2DXR A;  2H99 A;  3FVG A;  3A3C A;  3GXA A;  5CBR A;  3O9P A;  1MM6 A;  4N6P A;  3WAF A;  3TDJ A;  3IO6 A;  4PFT A;  3LSF B;  1B40 A;  3TEP A;  1TWY A;  3K1M A;  4M4G A;  2Z23 A;  2XD3 A;  4EF2 A;  3FAT A;  4QSE A;  3SEV A;  1B51 A;  2Q2C A;  2DVZ A;  1D3K A;  2I3W A;  3PUZ E;  2H25 A;  4U1O A;  2I0B A;  1WOD A;  4P11 A;  4H8J A;  2P1S A;  3OXN A;  4IO4 A;  1POY 1;  4OEN A;  4NWD A;  1UTB A;  4RPN A;  5ITO A;  2QS3 A;  3TFL A;  3M8U A;  1OLA A;  4I1D A;  5H8Q A;  3IJO B;  4ZS9 A;  4POX A;  4X1D A;  1SDX A;  4M1V A;  1MY0 A;  4DDD A;  2DWI A;  1N76 A;  2QL3 A;  4ZEB A;  4C1U A;  1LAH E;  3PPO A;  2QRY A;  3K6W A;  1QKB A;  2RIN A;  2X7Q A;  1OMP A;  4G68 C;  3RPW A;  2F6G A;  1Y9U A;  1B05 A;  4AQ4 A;  3TKD A;  2ZYO A;  1Y1Z A;  1SD3 A;  3KG2 A;  1L5T A;  4GD5 A;  4YMB A;  1FQC A;  2PT2 A;  1A8F A;  3MP6 A;  5IAI A;  5AA3 A;  2R6G E;  4F19 A;  3UA8 A;  1H43 A;  2DWH A;  4XIG Q;  3PD8 A;  5I57 A;  1B7U A;  5I58 A;  1B3E A;  4R9F A;  5DVF A;  3M3K A;  4IY5 A;  5AE4 A;  1UTH A;  2DE4 A;  3IK6 B;  4R73 A;  2HQ0 A;  3S9E A;  1HSL A;  3U8Q A;  1VE4 A;  1Y3Q A;  5AA2 B;  2PBW A;  4NF6 A;  5H8F B;  3TTK A;  4TLM B;  3PPQ A;  2XXQ A;  1WVJ A;  1FQF A;  4IO6 A;  3TMG A;  4FEC A;  3GBA A;  2RF1 A;  1LBB A;  3FVO A;  1D9V A;  4FAJ A;  4HS7 A;  3GBB A;  3HV1 A;  4H6D A;  3FXQ A;  5CC2 A;  3CRB A;  1XVY A;  1CE2 A;  2ESN A;  1BIY A;  2P2A A;  3SEY A;  1URS A;  5I2K A;  4THI A;  3ZKK A;  3R7X A;  2GFE A;  4YKI A;  1Z7N E;  4Z7E A;  3K0V A;  2O69 A;  3O6I A;  2ONR A;  4FE8 A;  3M3L A;  3S9L C;  4PFW A;  1HSE A;  1I69 A;  1B9J A;  1UIU A;  3K4U A;  2OK2 A;  2ZNU A;  5DT6 A;  3RQT A;  5EHM A;  3FXU A;  2RCA A;  1F9B A;  1IUD A;  4KI0 E;  3DP6 A;  1MRP A;  2O7I A;  1OQH A;  3C36 A;  3G3H A;  3MC2 A;  4YB6 A;  1MG1 A;  3VE1 B;  3V89 B;  5JEI A;  4EQ7 A;  4MF3 A;  4R72 A;  1UTB B;  4UAC A;  4JWY A;  3FJG A;  5BUU A;  1B3F A;  1AL3 A;  4K3F A;  3PMX A;  4AB6 A;  1SVX B;  5CMM A;  3H06 B;  3UN6 A;  3KJT A;  1QVS A;  1SW5 A;  2Y84 A;  3DM0 A;  3D4G A;  3EHS A;  3KN7 A;  2X7P A;  1PC3 A;  3C34 A;  2ABH A;  4KPT A;  4O3B A;  3K02 A;  5AA4 A;  4MH5 A;  2I6E A;  4PFY A;  2DSF A;  3BFU A;  2OJT A;  1MXV A;  1MQG A;  3PPP A;  3N5L A;  1A55 A;  3VDF A;  3EQ1 A;  4DXC A;  1ANF A;  5L9S A;  4MLQ A;  3OEK A;  3KN8 A;  4X48 A;  4NF5 A;  3N6U A;  4OQO A;  4FIM A;  4OFJ A;  1Y4T A;  5A5X A;  1SBP A;  2DXY A;  4FJP A;  4LQ2 A;  1NH7 A;  4R6Y A;  3K6U A;  4OTE A;  2HZK A;  3N94 A;  2GHB A;  2E1S A;  4N13 A;  3T22 A;  4LUB A;  3S4U A;  5I57 B;  4QF9 A;  2XXX A;  1YAE A;  2I48 A;  4JDF A;  4R74 A;  1H45 A;  3U72 A;  3LSX A;  4XKN A;  1A8E A;  1USY H;  3RGY A;  3TUS A;  2NOO A;  4OVJ A;  4F31 B;  1A7L A;  4NF6 B;  1LGB C;  2Q2A A;  1Y3N A;  4ZED A;  2REJ A;  4NE4 A;  3SER A;  1QUJ A;  4MLV A;  1NNK A;  2HAU A;  2QMW A;  3FJ7 A;  3KGC A;  4TLL B;  1POT A;  1VFE A;  1IXG A;  3TZA A;  5L8D A;  3E13 X;  3V83 A;  4WED A;  4NWC A;  3K6X A;  2UXA A;  3FZV A;  3VLU A;  4H0W A;  3UGW A;  3PV0 E;  1XVX A;  3QAX A;  1A54 A;  3FXR A;  5I2K B;  5FHN A;  1Y20 A;  4H67 A;  1LBC A;  1IIT A;  1R1N A;  3CIJ A;  1US5 A;  3MPK A;  5DVI A;  5ICT A;  2G93 A;  2ONK E;  1PB7 A;  3CFL A;  4XTC Q;  3C33 A;  3PD9 A;  4HCY A;  3V8X B;  3C9H A;  5AA1 A;  1GV8 A;  2D3I A;  3JYR A;  1DTZ A;  4F3G A;  1XT8 A;  1MY3 A;  4XKP A;  1BTJ A;  4LAT A;  1SW2 A;  4H1X A;  4Q0C A;  2LAO A;  1MQJ A;  4KD5 A;  1NFT A;  1B7Z A;  3LUY A;  2V25 A;  4O3C A;  2V3Q A;  4G68 B;  4OWD A;  4F1Y A;  1N0T A;  4H5G A;  4QRZ A;  3MQ9 A;  4RK2 A;  1URG A;  1MXX A;  1I6Q A;  5ISU A;  1O7T A;  3S9M C;  2UVJ A;  2F6P A;  4YMA A;  3CSB A;  2QSX A;  2ZNS A;  4TOZ A;  3I5O A;  3PPR A;  1SW4 A;  3C31 A;  4I9D A;  1BP5 A;  1LAX A;  1PBQ A;  4LQ5 A;  4O3A A;  2VHA A;  4QFO A;  1QJM A;  4P0G A;  1NNP A;  4BDM A;  2DWA A;  2I49 A;  2DOJ A;  3KZG A;  1YCJ A;  3EF7 A;  2QS4 A;  2I0C A;  3PGF A;  5AA2 A;  3SET A;  4NF5 B;  5H8F A;  4ELR A;  5A5X B;  4E0X A;  4RPO A;  1XC1 A;  2G29 A;  2F35 A;  1US4 A;  4QHQ A;  2UYE A;  3AXF A;  5JTY A;  1II5 A;  3MZ9 A;  4FEB A;  1B46 A;  2HAV A;  2F34 A;  3HST A;  2NXO A;  5TP9 A;  3B6Q A;  2OWT A;  1CB6 A;  4YU0 A;  4IO3 A;  1OLC A;  4H8I A;  1NNF A;  4FAT A;  4OZ9 A;  2H9B A;  5LOM A;  1I6B A;  2ALU A;  1SI1 A;  1ZTY A;  3N6T A;  4EQ9 A;  2XXY A;  5J1D A;  4OXV A;  4RA1 A;  3EN3 A;  1MY1 A;  3MZ1 A;  3MP8 A;  3QXM A;  4YB5 A;  2V84 A;  1B5I A;  1VFD A;  4DXU A;  1B32 A;  1TFD A;  1ZLQ A;  3PPN A;  2ANJ A;  3VV5 A;  3OEL A;  1DTG A;  3FV1 A;  1QUK A;  4XKR A;  2OBG A;  1LB9 A;  5F7V A;  5I56 A;  2CZL A;  3E9X A;  4JWX A;  2QMX A;  4NED A;  2PVU A;  2NWJ A;  3RY3 A;  1JW4 A;  3RT8 A;  4RNS A;  4F3P A;  2XXT A;  4RK9 A;  3MW0 A;  3QYT A;  3VLW A;  3IJX B;  4OFL A;  3O28 A;  4F3B A;  1YTV A;  3IB0 A;  2XX7 A;  2PX1 A;  4DCX A;  3OO9 A;  4H5F A;  1AOV A;  3TCG A;  4IGT A;  3G7W A;  4U4S A;  2PT1 A;  2DWJ A;  1EZ9 A;  2GH9 A;  1USY E;  4MBP A;  4KCD A;  3T9V A;  1P1O A;  3G3G A;  5K2Y A;  1MPD A;  2ZYN A;  1D9Y A;  1N3X A;  2VGQ A;  2Y7R A;  3M3F A;  3FGS A;  3KSX A;  3K01 A;  1FTL A;  3O6H A;  2F7A A;  1FTJ A;  1UQW A;  5DVJ A;  3VLV A;  4XKQ A;  1IQ7 A;  1O64 A;  1FTM A;  1LLS A;  3HHF A;  2UYF A;  2R9J A;  4F2Q A;  2CMO A;  3TAJ A;  2RCB A;  4DCY A;  3OOA A;  3TTM A;  4GF8 A;  2DE3 A;  1ZKB A;  5B7D A;  4LP2 B;  4JSO A;  1MXY A;  1XHY A;  4OYV A;  1LAF E;  2Y7I A;  4NF8 B;  5FHM A;  3RTW B;  4U1Z A;  3ILU B;  1FTO A;  1B5H A;  5JTY B;  4QFN A;  5B70 A;  2HCA A;  2I3V A;  1P99 A;  3S9N C;  2Q9T A;  2O6A A;  1ZU0 A;  4Q30 B;  3QK6 A;  5TP9 B;  3DEL B;  5CMC A;  3H6T A;  4F1V A;  4JWO A;  3CFX A;  1Y1M A;  5CBS A;  1PEB A;  1B5J A;  4U2R A;  4U23 A;  4QFP A;  3ZKL A;  3LSL A;  4IY6 A;  1Y4C A;  3KSJ A;  4ZE9 A;  4N07 A;  1DPE A;  2ZYM A;  1NMU A;  1Y3P A;  1IZ1 A;  2M8C A;  2HFB A;  1P1W A;  4G8H A;  3PMV A;  5HM4 B;  3FAS A;  3CG1 A;  2ZMB A;  1GTK A;  4Q5T A;  3H3G A;  3KEI A;  4RYA A;  3PUW E;  5H8H A;  3FVK A;  2A5T B;  1GGG A;  5TPA A;  1NNT A;  2F8D A;  4KYD A;  1JEV A;  2VOZ A;  3PUV E;  3TCH A;  3MVX A;  3H6U A;  5I56 B;  3K00 A;  1ATG A;  4G68 A;  4KFQ A;  3TEL A;  4GFR A;  4G8M A;  2F78 A;  2F97 A;  3G3J A;  1JET A;  1TXF A;  3ECR A;  4DLD A;  4OER A;  5DEX B;  1EZO A;  3OSR A;  2THI A;  4RJZ A;  2QJE A;  2PYY A;  4F2O A;  4MFI A;  1ZJL A;  1IIW A;  1TFA A;  2E0S A;  3TCF A;  2UVG A;  1H76 A;  2DQV A;  4PE5 B;  5I59 B;  3OO8 A;  3LSW A;  3Q27 A;  1URD A;  4ESX A;  5I84 A;  1NH8 A;  2O1L A;  4DZ1 A;  3I6V A;  4POW A;  3GZG A;  3Q28 A;  2AIX A;  1M5E A;  2I58 A;  1MDQ A;  3USD A;  4NMY A;  2XXV A;  3KBR A;  4KHZ E;  2QS1 A;  4DXB A;  2Z8F A;  2D21 A;  4ELP A;  2P0S A;  5H8N B;  4ESW A;  4JB7 A;  2B65 A;  3VFJ A;  4F29 A;  3CG3 A;  4C0R A;  2F5X A;  1FQE A;  2H5Y A;  1RYO A;  5FTH A;  3B6T A;  3RTF B;  2ONS A;  4C1T A;  4GQO A;  3OD7 A;  4R6K A;  3H4Z A;  2ZXT A;  2Q88 A;  1OQG A;  3MJN A;  3OO6 A;  2AL4 A;  1JVY A;  1R9Q A;  3FJM A;  2OCU A;  3F11 A;  1LB8 A;  5K2X A;  4DIG A;  3QIM A;  3R26 A;  3MVY A;  1QUI A;  3CI8 A;  2H98 A;  1Q1K A;  5L9O A;  3FIR A;  3O2A A;  3IB2 A;  1FQD A;  3OEM A;  3SEX A;  2A5S A;  5I2N B;  3PU5 A;  3T9X B;  3T66 A;  4U4X A;  2UVH A;  3G3I A;  4ND9 A;  1MH4 A;  1S7Y A;  2GHA A;  1FCK A;  4ISU A;  1A99 A;  3R6U A;  5H8H B;  3LC8 A;  2O51 A;  3MZB A;  5TPA B;  4JBZ A;  2Y7W A;  4X9T A;  4KYS A;  4KYE A;  1MQH A;  3RNN A;  1BKA A;  3L6G A;  4WXJ A;  2YJP A;  1SYI A;  3IOW A;  3Q25 A;  5BWJ A;  1RYX A;  2YLN A;  2F7C A;  1FQA A;  3IX1 A;  2F7B A;  2V93 A;  3TTL A;  3VVF A;  3L6H A;  3FD3 A;  4DE8 A;  3TOD A;  4R75 A;  4XXU A;  4NTL A;  4BDQ A;  2IEE A;  1N7X A;  5CMB A;  5FHO A;  3VVD A;  4RXL A;  2W7Y A;  1DPP A;  2XX8 A;  3CR9 A; 
#chains in the Genus database with same CATH topology
 3H03 A;  4PBH A;  3ROJ A;  3TQL A;  1P1N A;  1PDA A;  4LON B;  3T9H B;  4F18 A;  3C4M A;  2DP8 A;  1SW1 A;  1JNF A;  1MM7 A;  2DYX A;  2V3U A;  1BLF A;  4N4U A;  2XWK A;  1KWH A;  3UOR A;  2NUV A;  1B3G A;  1MY4 A;  3NOH A;  3LBS A;  4NF8 A;  5DTB A;  3IOT A;  2Q8J A;  4MNC A;  5CRY A;  1N3W A;  2XWO A;  1I6A A;  2P3V A;  4LZ5 A;  4ZEC A;  5KCJ A;  3N26 A;  2XX9 A;  3SDF A;  4H45 A;  1RKM A;  1MXU A;  1MXZ A;  1LBZ A;  1TT1 A;  5KDT A;  4WEP A;  3SEW A;  3HHG A;  1FW0 A;  5DYH A;  1LFH A;  3E4R A;  4EXK A;  2OWS A;  4GL8 A;  3OMB A;  1SPI A;  1XOC A;  4OMB A;  2FYI A;  1JVX A;  4HW8 A;  3GLB A;  1P1U A;  4Z0I A;  3A3U A;  1J1N A;  3T96 B;  2CZI A;  5FBP A;  3U94 A;  4R2B A;  5ICQ A;  1YYZ A;  4GWY A;  4WKM A;  4KR5 A;  2DVC A;  1GR2 A;  2XXU A;  1MPC A;  4GWW A;  1QW0 A;  1IME A;  4LVQ A;  1FTK A;  4IB2 A;  1NV5 A;  1QKA A;  4UA8 A;  3BBR A;  4YKK A;  2ZYK A;  1B52 A;  2A5T A;  2XA5 A;  4G4P A;  1DSN A;  4EDP A;  2RC8 A;  3TYH A;  1ELJ A;  2XXW A;  4EF1 A;  1DMB A;  3MVZ A;  4GX6 A;  2O1M A;  2Y7K A;  4QFK A;  2VD2 A;  5AA2 D;  4ZE8 A;  4I62 A;  4R9G A;  1S50 A;  3O66 A;  4F1U A;  3DLN A;  2O7U A;  3ILT B;  4NAP A;  4GXA A;  1FBC A;  4LZ8 A;  3UIF A;  5CI5 A;  1OIB A;  5DEX A;  1DCU A;  1N7W A;  1T0K A;  4IGR A;  3W15 C;  3HCQ A;  3IR1 A;  3KFM A;  2WKY A;  2DS9 A;  3IO4 A;  2XD2 A;  3OEN A;  1B1X A;  5I59 A;  2UVI A;  3I3V A;  3TQW A;  4P9K A;  4U21 A;  4FBP A;  2XXH A;  3JZJ A;  4H46 A;  4OET A;  3IAZ A;  1LCF A;  1PBP A;  3VXB A;  3IB1 A;  4NF4 A;  1NL5 A;  4GBW A;  1QUL A;  3H6V A;  4EUO A;  4NN3 A;  2FA7 A;  4OVR A;  3E3K A;  1IMC A;  4GWU A;  1SQY A;  4ZZE A;  5ELV A;  1FBG A;  1IXI A;  5H8N A;  2PMS A;  2O84 X;  3FV2 A;  2WYK A;  2V3T A;  4OVP A;  4P8B A;  4GWO A;  4IO2 A;  1B0L A;  4OEV A;  3MAM A;  1PB9 A;  3CVG A;  4F39 A;  3S2V A;  1LFG A;  5M2V A;  1H44 A;  4O94 A;  2DDK A;  2XXR A;  3CFZ A;  2XWI A;  3CHG A;  4MEV A;  3T1B A;  2Q89 A;  3ODB A;  3Q29 A;  5KCJ B;  4R6H A;  2QS2 A;  3GYY A;  1FBH A;  1N04 A;  1JW1 A;  2BJJ X;  1JW5 A;  4O7I A;  3V5A A;  3DP4 A;  4X1B A;  5KDT B;  1IXH A;  4QSC A;  2Z22 A;  3IFC A;  1AH5 A;  2VP1 A;  4BDN A;  1S9T A;  4QBA A;  4PC9 A;  1B7H A;  4OVQ A;  4GOT A;  4BDL A;  2IA4 A;  1SI0 A;  1O63 A;  1MH3 A;  5JK4 A;  5I2N A;  1ZIU A;  3LR1 A;  2O68 A;  3C35 A;  3W9W A;  3PUY E;  5TU0 A;  2B3B A;  4HCW A;  1UIV A;  4EQB A;  4NX1 A;  5DW8 A;  1K9Z A;  3ZSF A;  1JQF A;  2FBP A;  2AYS A;  2VD3 A;  3B6W A;  4OAN A;  1JEU A;  3MP1 A;  4PAK A;  3JV9 A;  4EXL A;  3THI A;  1FBE A;  4JSD A;  3SES A;  3RN8 A;  4JXI A;  2GRV A;  4ZEK A;  4IO5 A;  1XS5 A;  4AS5 A;  2AL5 A;  2HXR A;  4PP0 A;  1B0H A;  2YPN A;  2B3F A;  4PQJ A;  4P47 A;  3KOS A;  2REG A;  1R6Z A;  4GLI A;  3SEU A;  3KN3 A;  1FJ9 A;  5IZZ A;  4QSD A;  2HXW A;  1MXW A;  3RT6 B;  4GXS B;  2CZH A;  4OES A;  1B58 A;  2OWZ A;  4LA9 A;  4OEU A;  4MAG A;  3CSG A;  5H8Q B;  1M5D A;  1MQD A;  3H6W A;  4N8Y A;  3VVE A;  4KCC A;  3G3K A;  4AB5 A;  3OO7 A;  5ET5 A;  5LTC A;  3K2D A;  4IO7 A;  1M5C A;  2B4L A;  4ZZA A;  1GVC A;  3SZP A;  2DE2 A;  5EHS A;  4NF4 B;  1B6H A;  2WYP A;  3K6V A;  3ONM A;  4GVO A;  5EQ8 A;  2R71 A;  1ZBM A;  4GL0 A;  4OFO A;  4LN5 A;  1IEJ A;  4PET A;  1EU8 A;  3HN0 A;  4YKJ A;  1FBD A;  2WBD A;  4OHN A;  1MY2 A;  3MWB A;  4PAI A;  2OX3 A;  4BLA A;  1R9L A;  3O97 A;  4P0I A;  3O6G A;  3FVN A;  3MVW A;  4OVT A;  1B2H A;  2PFY A;  3RUM A;  4N6D A;  1NV7 A;  2I4C A;  5KZT A;  4ZDM A;  3K1P A;  4YKP A;  5I58 B;  3O29 A;  2WBB A;  4KQP A;  4RY1 A;  4HE2 A;  3H7M A;  3SKP A;  1UTH B;  1EZP A;  3K1N A;  3MST A;  3U92 A;  1LCT A;  3HPI A;  4MX6 A;  4L17 A;  4N6K A;  2HHM A;  1A40 A;  1Z7M E;  1IXC A;  3RLF E;  5L9M A;  1FPL A;  1B4Z A;  4YAH X;  1OVB A;  5CM6 A;  1P1Q A;  2RKM A;  1MPB A;  5HBC A;  4HTG A;  1MDP 1;  3FUZ A;  2I4B A;  4ELO A;  3IOV A;  1OVT A;  4AS4 A;  1N84 A;  1CNQ A;  3G3F A;  3QSL A;  4ZEF A;  4QFL A;  5HPQ A;  1D4N A;  5H8S A;  3MBP A;  1B3L A;  4ELQ A;  2OZZ A;  4R2F A;  3EHT A;  1YPN A;  3MPL A;  1EH3 A;  1LST A;  2F36 A;  3OSQ A;  2FNC A;  4U22 A;  3A09 A;  1FPK A;  3IOR A;  4UAB A;  1SYH A;  3TPA A;  4MIJ A;  3ZS6 A;  1H3D A;  3UP9 A;  2HZL A;  3BKI B;  4KXP A;  3PTY A;  3QUF A;  3IL1 B;  3IOU A;  1NKX A;  1VSO A;  2Y7P A;  2X26 A;  2NVU B;  4YB7 A;  2Z8E A;  3T93 B;  2FHY A;  3HO7 A;  1ZMG A;  2V4C A;  1DOT A;  1MQI A;  5ITP A;  2HEU A;  3D4C A;  4E0W A;  2FIE A;  4H65 A;  4ONY A;  1PB8 A;  4Q8R A;  2ZZV A;  4PFU A;  2H4I A;  4GBV A;  4FED A;  1B1H A;  1MS7 A;  3KOT A;  3P7I A;  3PMW A;  4BDO A;  2HPG A;  1HSJ A;  4FOR A;  2RC9 A;  3DP8 A;  4GIZ A;  3U93 A;  5EYF A;  1B4H A;  3KJ7 A;  3PUX E;  4BDR A;  3UK4 A;  3QUJ A;  4G77 A;  2Z8D A;  1VR5 A;  2XXI A;  3BFT A;  4YZZ A;  1IMD A;  2ZNT A;  3Q26 A;  2RC7 A;  1LAG E;  3VXC A;  5AA4 B;  4G8N A;  4F22 A;  4G2Z A;  4LZ7 A;  3TTN A;  4TQU Q;  4JVI A;  5CMK A;  2XXP A;  3EHU A;  2OLB A;  3B7D A;  5EQ7 A;  3W9V A;  1NUW A;  1B3H A;  4I40 A;  4F3S A;  1WDN A;  3T9U A;  1FPD A;  2Q74 A;  2QPQ A;  2KLF A;  4ZEI A;  3C32 A;  1M5B A;  4HXV A;  3WAE A;  1AMF A;  1AIV A;  1LFI A;  5F1Q A;  3TTR A;  3KC1 A;  1Q35 A;  4I8C A;  4ECF A;  2XHD A;  5IKB A;  5FTI A;  3U1O A;  3EPE A;  1M5F A;  4YIC A;  1FQB A;  2D5W A;  4GRK A;  3MUQ A;  2DXR A;  2H99 A;  3FVG A;  3A3C A;  3GXA A;  5CBR A;  3O9P A;  1MM6 A;  4N6P A;  3WAF A;  3TDJ A;  3IO6 A;  4PFT A;  3LSF B;  1B40 A;  3TEP A;  3EKI A;  2ZZX A;  1KA0 A;  1TWY A;  3K1M A;  4M4G A;  2Z23 A;  2XD3 A;  4OVS A;  4EF2 A;  3FAT A;  1RDY A;  4QSE A;  1NV3 A;  3SEV A;  1B51 A;  4PBQ A;  2Q2C A;  1IMA A;  3KC0 A;  2DVZ A;  1D3K A;  2I3W A;  3PUZ E;  3A29 A;  5IM2 A;  2H25 A;  4U1O A;  2WX9 A;  1K9Y A;  2I0B A;  2QVV A;  1WOD A;  4P11 A;  4H8J A;  2P1S A;  3OXN A;  4IO4 A;  1POY 1;  4OEN A;  4NWD A;  1UTB A;  4RPN A;  5ITO A;  2QS3 A;  3TFL A;  3M8U A;  1OLA A;  2Y5K A;  4I1D A;  5H8Q A;  3IJO B;  4ZS9 A;  4POX A;  4X1D A;  3IFA A;  4XFE A;  1SDX A;  4M1V A;  4NGU A;  1MY0 A;  4DDD A;  3E79 A;  2DWI A;  4MJO A;  1N76 A;  2QL3 A;  4ZEB A;  4C1U A;  1LAH E;  3PPO A;  2QRY A;  3K6W A;  1QKB A;  2RIN A;  2X7Q A;  1OMP A;  4G68 C;  3RPW A;  2F6G A;  1Y9U A;  1B05 A;  4AQ4 A;  3TKD A;  2ZYO A;  1Y1Z A;  1FTA A;  4I3Y A;  1SD3 A;  3KG2 A;  1L5T A;  4GD5 A;  4I3E A;  1LBV A;  4YMB A;  1FQC A;  2PT2 A;  1A8F A;  3MP6 A;  3RYD A;  5IAI A;  5AA3 A;  2R6G E;  4F19 A;  5I5P A;  3UA8 A;  1H43 A;  2DWH A;  4XIG Q;  3PD8 A;  1RDZ A;  5I57 A;  1B7U A;  1FPE A;  1B3E A;  4R9F A;  5I58 A;  3BIH A;  3LUZ A;  5DVF A;  3M3K A;  1FPG A;  4IY5 A;  3HFU A;  5AE4 A;  1UTH A;  2DE4 A;  3IK6 B;  4R73 A;  2HQ0 A;  3S9E A;  1HSL A;  3U8Q A;  1VE4 A;  1Y3Q A;  5AA2 B;  2PBW A;  4NF6 A;  5H8F B;  3TTK A;  4TLM B;  3PPQ A;  2XXQ A;  1WVJ A;  1FQF A;  1RDX A;  4IO6 A;  3TMG A;  1FPI A;  2GQ1 A;  2VT5 A;  4FEC A;  2XWV A;  3GBA A;  2RF1 A;  1G0I A;  1LBB A;  3FVO A;  1D9V A;  4FAJ A;  4NQ8 A;  4HS7 A;  3GBB A;  3HV1 A;  4H6D A;  3FXQ A;  1EYJ A;  5CC2 A;  3CRB A;  1XVY A;  1CE2 A;  2ESN A;  1BIY A;  2P2A A;  3SEY A;  1URS A;  5I2K A;  1EYK A;  4THI A;  3ZKK A;  3R7X A;  2GFE A;  4GX3 A;  4YKI A;  1Z7N E;  1NV2 A;  3FBP A;  4Z7E A;  3K0V A;  2CEX A;  2O69 A;  3O6I A;  2ONR A;  4FE8 A;  3M3L A;  3S9L C;  4GX4 A;  4PFW A;  1HSE A;  1I69 A;  1B9J A;  1UIU A;  3K4U A;  2OK2 A;  2ZNU A;  5DT6 A;  3RQT A;  4NF0 A;  5EHM A;  3FXU A;  2RCA A;  1F9B A;  1IUD A;  4KI0 E;  3DP6 A;  1MRP A;  4MCO A;  2O7I A;  1OQH A;  3C36 A;  3KBZ A;  3G3H A;  3MC2 A;  4YB6 A;  1MG1 A;  3VE1 B;  3V89 B;  5JEI A;  4EQ7 A;  4MF3 A;  4PFR A;  4R72 A;  1UTB B;  4UAC A;  4N15 A;  4JWY A;  3FJG A;  5BUU A;  5I7I A;  4PCD A;  1B3F A;  1AL3 A;  4K3F A;  4N91 A;  3PMX A;  4AB6 A;  1SVX B;  5CMM A;  1Q9D A;  3H06 B;  3KJT A;  3UN6 A;  1NUY A;  1QVS A;  1SW5 A;  2Y84 A;  2F3D A;  3DM0 A;  3D4G A;  3EHS A;  3KN7 A;  2F3B A;  2X7P A;  1PC3 A;  3C34 A;  2ABH A;  4KPT A;  2WEF A;  4G61 A;  5ET8 A;  4O3B A;  3K02 A;  2CEY A;  4O7M A;  1LBY A;  5AA4 A;  4MH5 A;  2I6E A;  4PFY A;  2DSF A;  1LEV A;  3BFU A;  4PE3 A;  2OJT A;  1MXV A;  1MQG A;  2CZK A;  3PPP A;  3N5L A;  1A55 A;  3T0J A;  3VDF A;  3EQ1 A;  4DXC A;  1ANF A;  5EYG A;  5L9S A;  4MLQ A;  3OEK A;  3KN8 A;  4X48 A;  4NF5 A;  3N6U A;  4OQO A;  1FPB A;  4FIM A;  4OFJ A;  1Y4T A;  5A5X A;  1SBP A;  4JVD A;  2DXY A;  4FJP A;  4LQ2 A;  1NH7 A;  4R6Y A;  3K6U A;  4OTE A;  1JP4 A;  2HZK A;  3N94 A;  2GHB A;  2E1S A;  4N13 A;  4PFB A;  3T22 A;  4LUB A;  3S4U A;  5EQ9 A;  5IGA A;  5I57 B;  4QF9 A;  2XXX A;  1YAE A;  2VPN A;  2I48 A;  4JDF A;  2FVZ A;  4R74 A;  1H45 A;  3U72 A;  3LSX A;  4XKN A;  1A8E A;  1USY H;  3U65 A;  3RGY A;  3TUS A;  2NOO A;  4OVJ A;  4F31 B;  1A7L A;  4NF6 B;  1LGB C;  2Q2A A;  1Y3N A;  1NV1 A;  4ZED A;  2REJ A;  5IZ1 A;  4NE4 A;  3SER A;  1QUJ A;  4GWZ A;  4MLV A;  1NNK A;  2HAU A;  2QMW A;  3FJ7 A;  3KGC A;  4TLL B;  1POT A;  4NHB A;  1VFE A;  1IXG A;  3TZA A;  5L8D A;  3E13 X;  3V83 A;  4WED A;  4NWC A;  1FPF A;  3K6X A;  2UXA A;  3FZV A;  3VLU A;  4H0W A;  3UGW A;  3PV0 E;  1XVX A;  1NV0 A;  4NG7 A;  3QAX A;  1A54 A;  3FXR A;  5I2K B;  1NV6 A;  5FHN A;  1Y20 A;  4H67 A;  1LBC A;  1IIT A;  1R1N A;  3CIJ A;  1US5 A;  3MPK A;  5ET7 A;  5DVI A;  5ICT A;  2G93 A;  2ONK E;  1PB7 A;  3CFL A;  4PGN A;  4XTC Q;  3C33 A;  3PD9 A;  4HCY A;  4DI3 D;  3V8X B;  2JJK A;  3C9H A;  5AA1 A;  1GV8 A;  2D3I A;  3JYR A;  1DTZ A;  4F3G A;  1XT8 A;  1YXI A;  1MY3 A;  4PDD A;  4XKP A;  1BTJ A;  4LAT A;  1SW2 A;  4H1X A;  4Q0C A;  2LAO A;  1LBW A;  4N81 A;  1YZ0 A;  1MQJ A;  4KD5 A;  1EYI A;  1NFT A;  4PF6 A;  1B7Z A;  2P3N A;  3LUY A;  2V25 A;  4O3C A;  4PFI A;  2V3Q A;  4G68 B;  4OWD A;  4F1Y A;  1N0T A;  4H5G A;  4QRZ A;  2ZZW A;  3MQ9 A;  4RK2 A;  1URG A;  1MXX A;  1I6Q A;  5ISU A;  1O7T A;  3S9M C;  2UVJ A;  4N8G A;  2F6P A;  4YMA A;  3CSB A;  2QSX A;  2ZNS A;  4TOZ A;  3I5O A;  3PPR A;  1SW4 A;  3C31 A;  4I9D A;  2B4M A;  1BP5 A;  1LAX A;  1PBQ A;  4LQ5 A;  4O3A A;  2VHA A;  4IR8 A;  1IMF A;  2BJI A;  4QFO A;  1QJM A;  4P0G A;  1NNP A;  4BDM A;  2DWA A;  3FXB A;  2I49 A;  2DOJ A;  3KZG A;  1YCJ A;  3EF7 A;  2QFL A;  2QS4 A;  2I0C A;  3PGF A;  2MKZ A;  5AA2 A;  3SET A;  4NF5 B;  4P3L A;  5H8F A;  4ELR A;  5A5X B;  4E0X A;  1G0H A;  4PTK A;  4RPO A;  1XC1 A;  2G29 A;  2F35 A;  4XEQ A;  1US4 A;  4QHQ A;  2UYE A;  3AXF A;  5JTY A;  1II5 A;  3MZ9 A;  4FEB A;  1B46 A;  2HAV A;  2F34 A;  3HST A;  2NXO A;  5TP9 A;  3B6Q A;  2OWT A;  1CB6 A;  4YU0 A;  4P1E A;  4IO3 A;  1OLC A;  1FSA A;  4H8I A;  1NNF A;  4FAT A;  4OZ9 A;  2H9B A;  5LOM A;  1I6B A;  2ALU A;  1SI1 A;  1ZTY A;  3N6T A;  4PDH A;  4EQ9 A;  2XXY A;  5J1D A;  4OXV A;  4RA1 A;  3EN3 A;  1MY1 A;  3MZ1 A;  1AWB A;  3MP8 A;  3QXM A;  4MHF A;  4YB5 A;  2V84 A;  1B5I A;  1NI9 A;  1VFD A;  4DXU A;  1B32 A;  1TFD A;  1ZLQ A;  3PPN A;  2ANJ A;  3VV5 A;  3OEL A;  1DTG A;  3FV1 A;  1QUK A;  4XKR A;  2OBG A;  1LB9 A;  5F7V A;  5I56 A;  2CZL A;  3E9X A;  4JWX A;  2QMX A;  4NED A;  2PVU A;  2NWJ A;  4DI4 B;  3RY3 A;  1JW4 A;  3RT8 A;  4RNS A;  4F3P A;  2XXT A;  4O8M A;  4RK9 A;  3MW0 A;  3QYT A;  3VLW A;  3IJX B;  4OFL A;  1INP A;  1FPJ A;  3O28 A;  4F3B A;  1YTV A;  3IB0 A;  2XX7 A;  2PX1 A;  4DCX A;  4GWS A;  5ET6 A;  3QMF A;  3OO9 A;  1NUZ A;  4H5F A;  1LBX A;  1AOV A;  3TCG A;  4GWX A;  4IGT A;  3G7W A;  4U4S A;  2PT1 A;  2DWJ A;  1EZ9 A;  5T3J A;  2GH9 A;  1USY E;  4MBP A;  4KCD A;  3T9V A;  1P1O A;  3RPL A;  3G3G A;  4OA4 A;  5K2Y A;  1MPD A;  5A5L A;  5LDZ A;  2ZYN A;  4QXD A;  4P56 A;  1D9Y A;  1N3X A;  2L5V A;  2VGQ A;  2Y7R A;  3M3F A;  4N17 A;  3FGS A;  3KSX A;  3K01 A;  1FTL A;  3O6H A;  2F7A A;  1FTJ A;  1UQW A;  5DVJ A;  3VLV A;  4XKQ A;  1IQ7 A;  1O64 A;  3E78 A;  1FTM A;  1LLS A;  1VDW A;  3HHF A;  2UYF A;  1QGX A;  2R9J A;  4F2Q A;  2CMO A;  1BK4 A;  3TAJ A;  2RCB A;  4DCY A;  3OOA A;  3TTM A;  4GF8 A;  2DE3 A;  5F24 A;  1ZKB A;  2Q8M A;  1D9Q A;  5B7D A;  4X8R A;  3MYU A;  4LP2 B;  4JSO A;  1MXY A;  1XHY A;  4OYV A;  1LAF E;  2Y7I A;  4NF8 B;  5FHM A;  3RTW B;  4U1Z A;  3ILU B;  1FTO A;  1B5H A;  5JTY B;  3BIG A;  4QFN A;  5B70 A;  5ESY A;  2HCA A;  2I3V A;  1P99 A;  3S9N C;  2Q9T A;  2O6A A;  1ZU0 A;  4Q30 B;  3QK6 A;  5TP9 B;  3DEL B;  2PFZ A;  5CMC A;  3H6T A;  4F1V A;  4JWO A;  3CFX A;  1Y1M A;  5CBS A;  1PEB A;  1B5J A;  4U2R A;  4U23 A;  4QFP A;  3ZKL A;  3LSL A;  4IY6 A;  1Y4C A;  3KSJ A;  4ZE9 A;  4N07 A;  4HE0 A;  1DPE A;  3B50 A;  2ZYM A;  1NMU A;  1Y3P A;  1IZ1 A;  2M8C A;  1KA1 A;  2HFB A;  1P1W A;  1FBF A;  4G8H A;  3PMV A;  5HM4 B;  3FAS A;  3CG1 A;  2ZMB A;  1GTK A;  4Q5T A;  3H3G A;  3KEI A;  4RYA A;  3PUW E;  5H8H A;  3FVK A;  2A5T B;  5IZ3 A;  1GGG A;  5TPA A;  1NNT A;  2F8D A;  4KYD A;  1JEV A;  2VOZ A;  3PUV E;  3TCH A;  3MVX A;  3H6U A;  5I56 B;  3D1R A;  3K00 A;  1ATG A;  4G68 A;  4KFQ A;  3TEL A;  4GFR A;  4G8M A;  2F78 A;  4PAF A;  2F97 A;  1KZ8 A;  2Y5L A;  2XXK A;  3G3J A;  1JET A;  1TXF A;  3ECR A;  4DLD A;  4OER A;  5DEX B;  1FJ6 A;  1EZO A;  3OSR A;  2THI A;  4RJZ A;  2QJE A;  2PYY A;  4F2O A;  4MFI A;  2KR0 A;  1ZJL A;  1IIW A;  3LV0 A;  1TFA A;  2E0S A;  3TCF A;  2UVG A;  1H76 A;  5EQA A;  2DQV A;  5EYH A;  4PE5 B;  5I59 B;  3OO8 A;  3LSW A;  3Q27 A;  1URD A;  4ESX A;  5I84 A;  2PCR A;  1NH8 A;  2O1L A;  1DBZ A;  3RPL B;  4DZ1 A;  3I6V A;  4POW A;  3GZG A;  3Q28 A;  2QVR A;  2AIX A;  1M5E A;  4MNI A;  2I58 A;  1MDQ A;  3USD A;  4NMY A;  2XXV A;  3KBR A;  4KHZ E;  2QS1 A;  4DXB A;  1DK4 A;  1NV4 A;  2Z8F A;  2D21 A;  4ELP A;  3ISP A;  2VPO A;  2P0S A;  5H8N B;  4ESW A;  4JB7 A;  2B65 A;  3VFJ A;  4F29 A;  3CG3 A;  4C0R A;  2F5X A;  1FQE A;  2FIX A;  2H5Y A;  1RYO A;  1FBP A;  5FTH A;  3B6T A;  4MMP A;  3RTF B;  2ONS A;  4C1T A;  4GQO A;  3OD7 A;  4R6K A;  3H4Z A;  4XF5 A;  2ZXT A;  2Q88 A;  1OQG A;  3MJN A;  3OO6 A;  2AL4 A;  1JVY A;  1R9Q A;  3FJM A;  2QVU A;  2OCU A;  4X04 A;  2KQZ A;  2R8T A;  4JVC A;  3F11 A;  4PF8 A;  1LB8 A;  5K2X A;  4DIG A;  3QIM A;  3R26 A;  3MVY A;  1FRP A;  1QUI A;  3CI8 A;  2H98 A;  1Q1K A;  5L9O A;  3FIR A;  3O2A A;  3IB2 A;  1FQD A;  3OEM A;  3SEX A;  2A5S A;  5I2N B;  3PU5 A;  3T9X B;  3T66 A;  4U4X A;  4HE1 A;  2UVH A;  3G3I A;  4ND9 A;  1MH4 A;  1S7Y A;  2GHA A;  1FCK A;  4ISU A;  5I3S A;  1IMB A;  1A99 A;  3R6U A;  5H8H B;  1NUX A;  3LC8 A;  5IZ3 B;  2O51 A;  3MZB A;  5TPA B;  3B8B A;  5J16 A;  4JBZ A;  4MNP A;  2Y7W A;  4X9T A;  4KYS A;  4KYE A;  1MQH A;  3RNN A;  1BKA A;  1XI6 A;  3L6G A;  4WXJ A;  2YJP A;  1SYI A;  3IOW A;  3Q25 A;  4P1L A;  5BWJ A;  1RYX A;  2YLN A;  2F7C A;  1FQA A;  3IX1 A;  2F7B A;  2V93 A;  3TTL A;  3VVF A;  3L6H A;  3FD3 A;  4DE8 A;  3TOD A;  4R75 A;  4XXU A;  4NTL A;  4BDQ A;  2IEE A;  1N7X A;  5CMB A;  5FHO A;  3VVD A;  4RXL A;  2W7Y A;  1DPP A;  2XX8 A;  3CR9 A;  4PGP A; 
#chains in the Genus database with same CATH homology
 3H03 A;  3TQL A;  1P1N A;  1PDA A;  4LON B;  3T9H B;  4F18 A;  3C4M A;  2DP8 A;  1SW1 A;  1JNF A;  1MM7 A;  2DYX A;  2V3U A;  1BLF A;  1KWH A;  3UOR A;  2NUV A;  1B3G A;  1MY4 A;  3LBS A;  4NF8 A;  5DTB A;  3IOT A;  2Q8J A;  5CRY A;  1N3W A;  1I6A A;  4LZ5 A;  4ZEC A;  5KCJ A;  3N26 A;  2XX9 A;  3SDF A;  1RKM A;  1MXU A;  1MXZ A;  1TT1 A;  5KDT A;  4WEP A;  3SEW A;  3HHG A;  1FW0 A;  5DYH A;  1LFH A;  3E4R A;  4EXK A;  2OWS A;  4GL8 A;  3OMB A;  1XOC A;  4OMB A;  2FYI A;  1JVX A;  4HW8 A;  3GLB A;  1P1U A;  4Z0I A;  3A3U A;  1J1N A;  3T96 B;  3U94 A;  4R2B A;  5ICQ A;  4WKM A;  4KR5 A;  2DVC A;  1GR2 A;  2XXU A;  1MPC A;  1QW0 A;  4LVQ A;  1FTK A;  4IB2 A;  1QKA A;  4UA8 A;  3BBR A;  4YKK A;  2ZYK A;  1B52 A;  2A5T A;  4G4P A;  1DSN A;  4EDP A;  2RC8 A;  3TYH A;  1ELJ A;  2XXW A;  4EF1 A;  1DMB A;  3MVZ A;  2O1M A;  2Y7K A;  4QFK A;  2VD2 A;  5AA2 D;  4ZE8 A;  4I62 A;  4R9G A;  1S50 A;  3O66 A;  4F1U A;  3DLN A;  2O7U A;  3ILT B;  4GXA A;  4LZ8 A;  3UIF A;  5CI5 A;  1OIB A;  5DEX A;  1N7W A;  1T0K A;  4IGR A;  3W15 C;  3HCQ A;  3IR1 A;  3KFM A;  2WKY A;  2DS9 A;  3IO4 A;  2XD2 A;  3OEN A;  1B1X A;  5I59 A;  2UVI A;  3I3V A;  3TQW A;  4U21 A;  2XXH A;  3JZJ A;  4OET A;  3IAZ A;  1LCF A;  3VXB A;  1PBP A;  3IB1 A;  4NF4 A;  1NL5 A;  1QUL A;  3H6V A;  4EUO A;  2FA7 A;  3E3K A;  1SQY A;  4ZZE A;  5ELV A;  1IXI A;  5H8N A;  2PMS A;  2O84 X;  3FV2 A;  2V3T A;  4GWO A;  4IO2 A;  1B0L A;  4OEV A;  3MAM A;  1PB9 A;  3CVG A;  4F39 A;  3S2V A;  1LFG A;  5M2V A;  1H44 A;  2XXR A;  3CFZ A;  2Q89 A;  3ODB A;  3Q29 A;  5KCJ B;  4R6H A;  2QS2 A;  1N04 A;  1JW1 A;  2BJJ X;  1JW5 A;  3V5A A;  3DP4 A;  4X1B A;  5KDT B;  1IXH A;  4QSC A;  2Z22 A;  1AH5 A;  2VP1 A;  4BDN A;  1S9T A;  1B7H A;  4GOT A;  4BDL A;  2IA4 A;  1SI0 A;  1O63 A;  1MH3 A;  5JK4 A;  5I2N A;  1ZIU A;  3LR1 A;  3W9W A;  2O68 A;  3C35 A;  3PUY E;  5TU0 A;  2B3B A;  4HCW A;  1UIV A;  4EQB A;  3ZSF A;  1JQF A;  2AYS A;  2VD3 A;  3B6W A;  1JEU A;  3MP1 A;  3JV9 A;  4EXL A;  3THI A;  4JSD A;  3SES A;  3RN8 A;  4JXI A;  2GRV A;  4ZEK A;  4IO5 A;  1XS5 A;  2AL5 A;  4PP0 A;  1B0H A;  2YPN A;  2B3F A;  4PQJ A;  3KOS A;  2REG A;  1R6Z A;  4GLI A;  3SEU A;  3KN3 A;  4QSD A;  2HXW A;  1MXW A;  3RT6 B;  4GXS B;  4OES A;  1B58 A;  4LA9 A;  4OEU A;  3CSG A;  5H8Q B;  1M5D A;  3VVE A;  1MQD A;  3H6W A;  4KCC A;  3G3K A;  4AB5 A;  3OO7 A;  3K2D A;  4IO7 A;  1M5C A;  4ZZA A;  1GVC A;  2DE2 A;  5EHS A;  4NF4 B;  1B6H A;  3K6V A;  3ONM A;  4GVO A;  2R71 A;  1ZBM A;  4GL0 A;  4OFO A;  1IEJ A;  4PET A;  1EU8 A;  3HN0 A;  4YKJ A;  4OHN A;  1MY2 A;  3MWB A;  4BLA A;  1R9L A;  3O97 A;  4P0I A;  3O6G A;  3FVN A;  3MVW A;  1B2H A;  3RUM A;  2I4C A;  5KZT A;  4ZDM A;  3K1P A;  4YKP A;  5I58 B;  3O29 A;  4KQP A;  4RY1 A;  3H7M A;  3SKP A;  1UTH B;  1EZP A;  3K1N A;  3U92 A;  1LCT A;  3HPI A;  4L17 A;  1A40 A;  1Z7M E;  1IXC A;  3RLF E;  5L9M A;  1B4Z A;  4YAH X;  1OVB A;  5CM6 A;  1P1Q A;  2RKM A;  1MPB A;  5HBC A;  4HTG A;  1MDP 1;  3FUZ A;  2I4B A;  4ELO A;  3IOV A;  1OVT A;  1N84 A;  3G3F A;  3QSL A;  4ZEF A;  4QFL A;  5HPQ A;  1D4N A;  5H8S A;  3MBP A;  1B3L A;  4ELQ A;  2OZZ A;  4R2F A;  3EHT A;  1YPN A;  3MPL A;  1EH3 A;  1LST A;  2F36 A;  3OSQ A;  2FNC A;  4U22 A;  3A09 A;  3IOR A;  1SYH A;  3TPA A;  3ZS6 A;  1H3D A;  3UP9 A;  2HZL A;  3BKI B;  3QUF A;  3IL1 B;  3IOU A;  1NKX A;  1VSO A;  2Y7P A;  2X26 A;  2NVU B;  4YB7 A;  2Z8E A;  3T93 B;  3HO7 A;  1ZMG A;  1DOT A;  1MQI A;  5ITP A;  2HEU A;  3D4C A;  4E0W A;  4H65 A;  4ONY A;  1PB8 A;  4Q8R A;  4PFU A;  2H4I A;  4FED A;  1B1H A;  1MS7 A;  3KOT A;  3P7I A;  3PMW A;  4BDO A;  1HSJ A;  4FOR A;  2RC9 A;  3DP8 A;  4GIZ A;  3U93 A;  5EYF A;  1B4H A;  3KJ7 A;  3PUX E;  4BDR A;  3UK4 A;  3QUJ A;  4G77 A;  2Z8D A;  1VR5 A;  2XXI A;  3BFT A;  4YZZ A;  2ZNT A;  3Q26 A;  2RC7 A;  1LAG E;  3VXC A;  5AA4 B;  4G8N A;  4F22 A;  4G2Z A;  4LZ7 A;  3TTN A;  4TQU Q;  5CMK A;  2XXP A;  3EHU A;  2OLB A;  3B7D A;  3W9V A;  1B3H A;  4F3S A;  1WDN A;  3T9U A;  2QPQ A;  2KLF A;  4ZEI A;  3C32 A;  1M5B A;  3WAE A;  1AMF A;  1AIV A;  1LFI A;  5F1Q A;  3TTR A;  1Q35 A;  4I8C A;  4ECF A;  2XHD A;  5IKB A;  5FTI A;  3U1O A;  3EPE A;  1M5F A;  4YIC A;  1FQB A;  2D5W A;  4GRK A;  3MUQ A;  2DXR A;  2H99 A;  3FVG A;  3A3C A;  3GXA A;  5CBR A;  3O9P A;  1MM6 A;  4N6P A;  3WAF A;  3TDJ A;  3IO6 A;  4PFT A;  3LSF B;  1B40 A;  3TEP A;  1TWY A;  3K1M A;  4M4G A;  2Z23 A;  2XD3 A;  4EF2 A;  3FAT A;  4QSE A;  3SEV A;  1B51 A;  2Q2C A;  2DVZ A;  1D3K A;  2I3W A;  3PUZ E;  2H25 A;  4U1O A;  2I0B A;  1WOD A;  4P11 A;  4H8J A;  2P1S A;  3OXN A;  4IO4 A;  1POY 1;  4OEN A;  4NWD A;  1UTB A;  4RPN A;  5ITO A;  2QS3 A;  3TFL A;  3M8U A;  1OLA A;  4I1D A;  5H8Q A;  3IJO B;  4ZS9 A;  4POX A;  4X1D A;  1SDX A;  4M1V A;  1MY0 A;  4DDD A;  2DWI A;  1N76 A;  2QL3 A;  4ZEB A;  4C1U A;  1LAH E;  3PPO A;  2QRY A;  3K6W A;  1QKB A;  2RIN A;  2X7Q A;  1OMP A;  4G68 C;  3RPW A;  2F6G A;  1Y9U A;  1B05 A;  4AQ4 A;  3TKD A;  2ZYO A;  1Y1Z A;  1SD3 A;  3KG2 A;  1L5T A;  4GD5 A;  4YMB A;  1FQC A;  2PT2 A;  1A8F A;  3MP6 A;  5IAI A;  5AA3 A;  2R6G E;  4F19 A;  3UA8 A;  1H43 A;  2DWH A;  4XIG Q;  3PD8 A;  5I57 A;  1B7U A;  5I58 A;  1B3E A;  4R9F A;  5DVF A;  3M3K A;  4IY5 A;  5AE4 A;  1UTH A;  2DE4 A;  3IK6 B;  4R73 A;  2HQ0 A;  3S9E A;  1HSL A;  3U8Q A;  1VE4 A;  1Y3Q A;  5AA2 B;  2PBW A;  4NF6 A;  5H8F B;  3TTK A;  4TLM B;  3PPQ A;  2XXQ A;  1WVJ A;  1FQF A;  4IO6 A;  3TMG A;  4FEC A;  3GBA A;  2RF1 A;  1LBB A;  3FVO A;  1D9V A;  4FAJ A;  4HS7 A;  3GBB A;  3HV1 A;  4H6D A;  3FXQ A;  5CC2 A;  3CRB A;  1XVY A;  1CE2 A;  2ESN A;  1BIY A;  2P2A A;  3SEY A;  1URS A;  5I2K A;  4THI A;  3ZKK A;  3R7X A;  2GFE A;  4YKI A;  1Z7N E;  4Z7E A;  3K0V A;  2O69 A;  3O6I A;  2ONR A;  4FE8 A;  3M3L A;  3S9L C;  4PFW A;  1HSE A;  1I69 A;  1B9J A;  1UIU A;  3K4U A;  2OK2 A;  2ZNU A;  5DT6 A;  3RQT A;  5EHM A;  3FXU A;  2RCA A;  1F9B A;  1IUD A;  4KI0 E;  3DP6 A;  1MRP A;  2O7I A;  1OQH A;  3C36 A;  3G3H A;  3MC2 A;  4YB6 A;  1MG1 A;  3VE1 B;  3V89 B;  5JEI A;  4EQ7 A;  4MF3 A;  4R72 A;  1UTB B;  4UAC A;  4JWY A;  3FJG A;  5BUU A;  1B3F A;  1AL3 A;  4K3F A;  3PMX A;  4AB6 A;  1SVX B;  5CMM A;  3H06 B;  3UN6 A;  3KJT A;  1QVS A;  1SW5 A;  2Y84 A;  3DM0 A;  3D4G A;  3EHS A;  3KN7 A;  2X7P A;  1PC3 A;  3C34 A;  2ABH A;  4KPT A;  4O3B A;  3K02 A;  5AA4 A;  4MH5 A;  2I6E A;  4PFY A;  2DSF A;  3BFU A;  2OJT A;  1MXV A;  1MQG A;  3PPP A;  3N5L A;  1A55 A;  3VDF A;  3EQ1 A;  4DXC A;  1ANF A;  5L9S A;  4MLQ A;  3OEK A;  3KN8 A;  4X48 A;  4NF5 A;  3N6U A;  4OQO A;  4FIM A;  4OFJ A;  1Y4T A;  5A5X A;  1SBP A;  2DXY A;  4FJP A;  4LQ2 A;  1NH7 A;  4R6Y A;  3K6U A;  4OTE A;  2HZK A;  3N94 A;  2GHB A;  2E1S A;  4N13 A;  3T22 A;  4LUB A;  3S4U A;  5I57 B;  4QF9 A;  2XXX A;  1YAE A;  2I48 A;  4JDF A;  4R74 A;  1H45 A;  3U72 A;  3LSX A;  4XKN A;  1A8E A;  1USY H;  3RGY A;  3TUS A;  2NOO A;  4OVJ A;  4F31 B;  1A7L A;  4NF6 B;  1LGB C;  2Q2A A;  1Y3N A;  4ZED A;  2REJ A;  4NE4 A;  3SER A;  1QUJ A;  4MLV A;  1NNK A;  2HAU A;  2QMW A;  3FJ7 A;  3KGC A;  4TLL B;  1POT A;  1VFE A;  1IXG A;  3TZA A;  5L8D A;  3E13 X;  3V83 A;  4WED A;  4NWC A;  3K6X A;  2UXA A;  3FZV A;  3VLU A;  4H0W A;  3UGW A;  3PV0 E;  1XVX A;  3QAX A;  1A54 A;  3FXR A;  5I2K B;  5FHN A;  1Y20 A;  4H67 A;  1LBC A;  1IIT A;  1R1N A;  3CIJ A;  1US5 A;  3MPK A;  5DVI A;  5ICT A;  2G93 A;  2ONK E;  1PB7 A;  3CFL A;  4XTC Q;  3C33 A;  3PD9 A;  4HCY A;  3V8X B;  3C9H A;  5AA1 A;  1GV8 A;  2D3I A;  3JYR A;  1DTZ A;  4F3G A;  1XT8 A;  1MY3 A;  4XKP A;  1BTJ A;  4LAT A;  1SW2 A;  4H1X A;  4Q0C A;  2LAO A;  1MQJ A;  4KD5 A;  1NFT A;  1B7Z A;  3LUY A;  2V25 A;  4O3C A;  2V3Q A;  4G68 B;  4OWD A;  4F1Y A;  1N0T A;  4H5G A;  4QRZ A;  3MQ9 A;  4RK2 A;  1URG A;  1MXX A;  1I6Q A;  5ISU A;  1O7T A;  3S9M C;  2UVJ A;  2F6P A;  4YMA A;  3CSB A;  2QSX A;  2ZNS A;  4TOZ A;  3I5O A;  3PPR A;  1SW4 A;  3C31 A;  4I9D A;  1BP5 A;  1LAX A;  1PBQ A;  4LQ5 A;  4O3A A;  2VHA A;  4QFO A;  1QJM A;  4P0G A;  1NNP A;  4BDM A;  2DWA A;  2I49 A;  2DOJ A;  3KZG A;  1YCJ A;  3EF7 A;  2QS4 A;  2I0C A;  3PGF A;  5AA2 A;  3SET A;  4NF5 B;  5H8F A;  4ELR A;  5A5X B;  4E0X A;  4RPO A;  1XC1 A;  2G29 A;  2F35 A;  1US4 A;  4QHQ A;  2UYE A;  3AXF A;  5JTY A;  1II5 A;  3MZ9 A;  4FEB A;  1B46 A;  2HAV A;  2F34 A;  3HST A;  2NXO A;  5TP9 A;  3B6Q A;  2OWT A;  1CB6 A;  4YU0 A;  4IO3 A;  1OLC A;  4H8I A;  1NNF A;  4FAT A;  4OZ9 A;  2H9B A;  5LOM A;  1I6B A;  2ALU A;  1SI1 A;  1ZTY A;  3N6T A;  4EQ9 A;  2XXY A;  5J1D A;  4OXV A;  4RA1 A;  3EN3 A;  1MY1 A;  3MZ1 A;  3MP8 A;  3QXM A;  4YB5 A;  2V84 A;  1B5I A;  1VFD A;  4DXU A;  1B32 A;  1TFD A;  1ZLQ A;  3PPN A;  2ANJ A;  3VV5 A;  3OEL A;  1DTG A;  3FV1 A;  1QUK A;  4XKR A;  2OBG A;  1LB9 A;  5F7V A;  5I56 A;  2CZL A;  3E9X A;  4JWX A;  2QMX A;  4NED A;  2PVU A;  2NWJ A;  3RY3 A;  1JW4 A;  3RT8 A;  4RNS A;  4F3P A;  2XXT A;  4RK9 A;  3MW0 A;  3QYT A;  3VLW A;  3IJX B;  4OFL A;  3O28 A;  4F3B A;  1YTV A;  3IB0 A;  2XX7 A;  2PX1 A;  4DCX A;  3OO9 A;  4H5F A;  1AOV A;  3TCG A;  4IGT A;  3G7W A;  4U4S A;  2PT1 A;  2DWJ A;  1EZ9 A;  2GH9 A;  1USY E;  4MBP A;  4KCD A;  3T9V A;  1P1O A;  3G3G A;  5K2Y A;  1MPD A;  2ZYN A;  1D9Y A;  1N3X A;  2VGQ A;  2Y7R A;  3M3F A;  3FGS A;  3KSX A;  3K01 A;  1FTL A;  3O6H A;  2F7A A;  1FTJ A;  1UQW A;  5DVJ A;  3VLV A;  4XKQ A;  1IQ7 A;  1O64 A;  1FTM A;  1LLS A;  3HHF A;  2UYF A;  2R9J A;  4F2Q A;  2CMO A;  3TAJ A;  2RCB A;  4DCY A;  3OOA A;  3TTM A;  4GF8 A;  2DE3 A;  1ZKB A;  5B7D A;  4LP2 B;  4JSO A;  1MXY A;  1XHY A;  4OYV A;  1LAF E;  2Y7I A;  4NF8 B;  5FHM A;  3RTW B;  4U1Z A;  3ILU B;  1FTO A;  1B5H A;  5JTY B;  4QFN A;  5B70 A;  2HCA A;  2I3V A;  1P99 A;  3S9N C;  2Q9T A;  2O6A A;  1ZU0 A;  4Q30 B;  3QK6 A;  5TP9 B;  3DEL B;  5CMC A;  3H6T A;  4F1V A;  4JWO A;  3CFX A;  1Y1M A;  5CBS A;  1PEB A;  1B5J A;  4U2R A;  4U23 A;  4QFP A;  3ZKL A;  3LSL A;  4IY6 A;  1Y4C A;  3KSJ A;  4ZE9 A;  4N07 A;  1DPE A;  2ZYM A;  1NMU A;  1Y3P A;  1IZ1 A;  2M8C A;  2HFB A;  1P1W A;  4G8H A;  3PMV A;  5HM4 B;  3FAS A;  3CG1 A;  2ZMB A;  1GTK A;  4Q5T A;  3H3G A;  3KEI A;  4RYA A;  3PUW E;  5H8H A;  3FVK A;  2A5T B;  1GGG A;  5TPA A;  1NNT A;  2F8D A;  4KYD A;  1JEV A;  2VOZ A;  3PUV E;  3TCH A;  3MVX A;  3H6U A;  5I56 B;  3K00 A;  1ATG A;  4G68 A;  4KFQ A;  3TEL A;  4GFR A;  4G8M A;  2F78 A;  2F97 A;  3G3J A;  1JET A;  1TXF A;  3ECR A;  4DLD A;  4OER A;  5DEX B;  1EZO A;  3OSR A;  2THI A;  4RJZ A;  2QJE A;  2PYY A;  4F2O A;  4MFI A;  1ZJL A;  1IIW A;  1TFA A;  2E0S A;  3TCF A;  2UVG A;  1H76 A;  2DQV A;  4PE5 B;  5I59 B;  3OO8 A;  3LSW A;  3Q27 A;  1URD A;  4ESX A;  5I84 A;  1NH8 A;  2O1L A;  4DZ1 A;  3I6V A;  4POW A;  3GZG A;  3Q28 A;  2AIX A;  1M5E A;  2I58 A;  1MDQ A;  3USD A;  4NMY A;  2XXV A;  3KBR A;  4KHZ E;  2QS1 A;  4DXB A;  2Z8F A;  2D21 A;  4ELP A;  2P0S A;  5H8N B;  4ESW A;  4JB7 A;  2B65 A;  3VFJ A;  4F29 A;  3CG3 A;  4C0R A;  2F5X A;  1FQE A;  2H5Y A;  1RYO A;  5FTH A;  3B6T A;  3RTF B;  2ONS A;  4C1T A;  4GQO A;  3OD7 A;  4R6K A;  3H4Z A;  2ZXT A;  2Q88 A;  1OQG A;  3MJN A;  3OO6 A;  2AL4 A;  1JVY A;  1R9Q A;  3FJM A;  2OCU A;  3F11 A;  1LB8 A;  5K2X A;  4DIG A;  3QIM A;  3R26 A;  3MVY A;  1QUI A;  3CI8 A;  2H98 A;  1Q1K A;  5L9O A;  3FIR A;  3O2A A;  3IB2 A;  1FQD A;  3OEM A;  3SEX A;  2A5S A;  5I2N B;  3PU5 A;  3T9X B;  3T66 A;  4U4X A;  2UVH A;  3G3I A;  4ND9 A;  1MH4 A;  1S7Y A;  2GHA A;  1FCK A;  4ISU A;  1A99 A;  3R6U A;  5H8H B;  3LC8 A;  2O51 A;  3MZB A;  5TPA B;  4JBZ A;  2Y7W A;  4X9T A;  4KYS A;  4KYE A;  1MQH A;  3RNN A;  1BKA A;  3L6G A;  4WXJ A;  2YJP A;  1SYI A;  3IOW A;  3Q25 A;  5BWJ A;  1RYX A;  2YLN A;  2F7C A;  1FQA A;  3IX1 A;  2F7B A;  2V93 A;  3TTL A;  3VVF A;  3L6H A;  3FD3 A;  4DE8 A;  3TOD A;  4R75 A;  4XXU A;  4NTL A;  4BDQ A;  2IEE A;  1N7X A;  5CMB A;  5FHO A;  3VVD A;  4RXL A;  2W7Y A;  1DPP A;  2XX8 A;  3CR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...