1QW0A

Crystal structure of haemophilus influenzae n175l mutant holo ferric ion-binding protein a
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
308
structure length
308
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKLSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-utilization periplasmic protein
publication title Presence of ferric hydroxide clusters in mutants of Haemophilus influenzae ferric ion-binding protein A
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Metal binding protein
total genus 109
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2003-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qw0A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qw0A01
2ANJA 1FW0A 1URGA 3LBSA 4RNSA 3T9VA 5AA4B 3PPOA 2DXRA 4YB7A 3MZ1A 1MY4A 4KI0E 3D4GA 3IOVA 4QF9A 4IY5A 3U1OA 1I6BA 1GV8A 3C33A 3GXAA 4WEPA 4C0RA 3E3KA 3O28A 4O3AA 4ZDMA 2DE3A 4YB5A 1NMUA 4E0XA 1PBPA 4MFIA 3U72A 5H8NB 3H6WA 2XX8A 4QFPA 2ABHA 5F1QA 2WKYA 2E1SA 3E13X 5CMCA 3FVKA 1FQDA 4X48A 3Q25A 4HCWA 4PETA 2DVCA 3PMWA 2OLBA 5AA2A 4ESWA 4JWOA 3SETA 3H06B 3RN8A 1H45A 3K1NA 4U4SA 2H5YA 1RYXA 4Q5TA 1NNFA 4X1BA 5I2NA 3TQLA 2ZNSA 4ONYA 2V84A 3VXCA 1PDAA 2Z23A 5I59B 4P0GA 4EUOA 3B7DA 3A3CA 1UIUA 2PMSA 3FJMA 3I5OA 1BLFA 1GGGA 1BIYA 1DSNA 2GH9A 1Y3NA 3C4MA 1QW0A 4IO4A 1QJMA 2D5WA 3OD7A 2KLFA 2F7BA 4H6DA 4G8MA 1N7XA 3S4UA 3RTWB 5L9OA 4BDRA 4RPOA 1LAFE 3TZAA 4X1DA 3MPKA 1QVSA 4GXSB 2NXOA 3MP8A 1VFEA 1MH3A 3EN3A 4DXBA 2ONKE 3FV1A 3UGWA 4F29A 4I1DA 4DCXA 1A8FA 1BKAA 1LAHE 3K4UA 5CRYA 3Q26A 4QFOA 1LCTA 4DCYA 2XXYA 3RQTA 4NF5A 2DWJA 4H1XA 2REJA 1B1XA 4U23A 3FD3A 5JK4A 3G3FA 2CZLA 2FYIA 4ZEDA 3VV5A 4G68B 1B32A 3K2DA 3OO8A 2ALUA 3QIMA 2RF1A 1LB8A 1OVBA 3MVXA 3MBPA 3C9HA 1H3DA 3BFTA 4LQ2A 1SD3A 4R9FA 1AH5A 1M5DA 5ELVA 2H25A 1OIBA 4NWCA 3IL1B 3R6UA 4KD5A 2PX1A 2YJPA 3MZ9A 4OEVA 1FQFA 3GBBA 5K2XA 4I9DA 1MDP1 3K6VA 1B5HA 5KZTA 4FORA 4F1VA 2I4BA 5IAIA 2RC8A 4KHZE 4KFQA 3LSFB 3VLVA 1ATGA 3B6WA 4R6KA 3MQ9A 4R74A 1MM6A 2XXXA 4F3BA 1N7WA 2XXUA 4FEDA 4R9GA 1TFDA 1MXUA 4UA8A 1FQBA 2GFEA 2V3UA 1UTHA 4RY1A 1HSLA 1XVYA 2NOOA 3CRBA 5I2KB 4OMBA 3PUWE 3ZKKA 1J1NA 2PT1A 4RYAA 4R73A 4IGTA 2XXWA 1JETA 2I0BA 4NEDA 1B7HA 5KCJA 1CE2A 3THIA 1WDNA 4OVJA 5A5XB 4EXKA 1MXXA 4U22A 1XHYA 3RT6B 3PPPA 3MWBA 5I58B 3HHFA 1B9JA 4FJPA 1FQEA 4H67A 1MPDA 2Y7RA 1MDQA 2UYFA 1S7YA 4NF8A 5TP9B 3PMXA 4GF8A 3DP4A 5ICQA 1MXYA 2M8CA 3ILUB 4U21A 5B70A 1EU8A 3H03A 1VSOA 1YTVA 4JSOA 1A99A 5I57A 3FXRA 3PUZE 3KOTA 1LLSA 3ZKLA 3A3UA 3VVFA 3TDJA 1LAXA 1FTJA 3TMGA 3OEMA 3RLFE 5KDTA 3OSQA 3M3KA 2B3BA 3N6UA 2A5TB 4OFJA 3PUYE 5CMBA 1A55A 3G3KA 1Y1MA 5H8HA 4DZ1A 3U8QA 2VD3A 1QULA 2D21A 3LR1A 3O97A 1M5BA 1KWHA 4ZECA 3FVGA 3KZGA 4Q30B 1B46A 3PD8A 3E9XA 1SQYA 4UACA 2B3FA 2HXWA 3OSRA 1YPNA 2XXTA 3SKPA 3EPEA 4U1ZA 1AOVA 4F2OA 4R72A 1MQDA 3HHGA 3KGCA 1TXFA 1P1UA 3ZSFA 5AA4A 1FQAA 1ZU0A 1DOTA 1OLAA 3PPNA 3B6TA 2QMXA 3SEXA 2HCAA 2QMWA 2A5SA 2XXQA 2QS4A 1Q1KA 4OFOA 1I6AA 2ZYMA 3F11A 2VOZA 2OWSA 1B7ZA 3QUFA 4LVQA 5H8NA 3WAFA 3OOAA 4ZEBA 1AMFA 1JEVA 5K2YA 3IK6B 3OMBA 1B3EA 2XX9A 5DT6A 4R6YA 4OTEA 1I69A 2X26A 3CG1A 3K6WA 1ZMGA 1D3KA 3TTNA 3T93B 4R75A 4EQBA 1B6HA 1H43A 4BDOA 5HM4B 5I56B 1NKXA 3SEWA 3IB2A 2OK2A 2Z8EA 1SI0A 3RGYA 5DVFA 5FHOA 3VLWA 3SEUA 2UXAA 5AA2D 5B7DA 1GR2A 1I6QA 5I59A 3RPWA 3IJOB 3V5AA 3O6IA 1P1WA 5HBCA 4NF4B 4RXLA 3OO9A 2UVJA 1EH3A 4ZE9A 3FGSA 3HSTA 1D9YA 3CSBA 4ZEIA 1FTLA 2UVHA 4POWA 4XXUA 1MXZA 1B4ZA 2O68A 2ONSA 3VE1B 2O7IA 2DQVA 5TU0A 4QSDA 4X9TA 4YAHX 1ZIUA 1Y1ZA 4ESXA 5ICTA 3CIJA 2NUVA 4DLDA 3H3GA 4DIGA 1R9QA 4AB6A 3RTFB 4DDDA 1R6ZA 3T96B 4DXCA 4KYEA 1JNFA 2V3TA 1LFHA 1XT8A 3VVEA 2QJEA 1US4A 4IB2A 2P2AA 3TKDA 3K02A 2DYXA 3IAZA 5DVIA 3PPQA 2IA4A 3HN0A 1LAGE 5CBSA 5AA1A 4RK2A 2F7CA 4YZZA 3UN6A 1PC3A 4EF2A 4F3PA 1VFDA 3D4CA 4KQPA 2UVGA 4LA9A 4G68A 5CBRA 1MXVA 2R9JA 2HEUA 1SI1A 2O1LA 4OHNA 3S9NC 4MBPA 4EF1A 1IZ1A 3KN8A 1B2HA 4IO3A 5CC2A 4JSDA 1NFTA 2OWTA 2DE4A 4IO5A 3K6UA 4H8IA 1B40A 4IO7A 4ZEFA 2AYSA 3SDFA 3VVDA 2ONRA 3FXUA 1D4NA 2DP8A 2ZNTA 4ND9A 4BDLA 4FEBA 4HW8A 2G93A 2Q88A 2X7QA 5CMMA 3PUXE 4AQ4A 5JEIA 1POY1 1B52A 5J1DA 2RCAA 1QUIA 3DELB 4MH5A 1OMPA 3G3IA 5DYHA 3N94A 1B51A 1VE4A 1FTKA 4KR5A 2ZXTA 1Y4TA 2F6GA 1B0HA 2YLNA 5L8DA 1POTA 1JVXA 4OEUA 4XTCQ 5DTBA 4OZ9A 2XXPA 5I2KA 3RT8A 3MVZA 3FJGA 5L9MA 4GRKA 1XOCA 1ZTYA 5H8SA 4ZE8A 1LFIA 5H8FB 2Z22A 1H44A 4QFKA 1XC1A 4F2QA 3DP8A 1USYH 3FXQA 3R7XA 3LUYA 3MW0A 2HFBA 2QSXA 5A5XA 1ANFA 2RINA 1F9BA 2VGQA 2F34A 4ECFA 3IR1A 1IXHA 4OFLA 2PYYA 5I58A 2F78A 5BUUA 4PQJA 1MQJA 3U93A 3KN7A 1N84A 2G29A 4QSCA 5TP9A 1H76A 4FE8A 4I62A 3RY3A 4GWOA 2OJTA 4ZEKA 4HS7A 2RC7A 5FTHA 4TLMB 1LBBA 3PGFA 1LFGA 3OELA 2F6PA 5CI5A 3CFXA 2H4IA 4YKKA 2YPNA 3ZS6A 4OESA 1DTZA 3QUJA 4AB5A 1B05A 2I3WA 3UA8A 3FVOA 1OVTA 1NH8A 1SYIA 1Q35A 2QPQA 1YAEA 3HPIA 1URDA 2OBGA 2A5TA 1WODA 4IO6A 2FA7A 4WXJA 4NMYA 2X7PA 3EHSA 2I48A 3RUMA 4GXAA 2VP1A 2PVUA 4M1VA 3USDA 1NNKA 3UORA 4ELQA 3U94A 1UTBB 4FECA 1LCFA 4C1TA 1DMBA 3P7IA 1MQIA 4O3CA 1M5CA 3K1MA 1M5FA 1B3FA 3T9XB 4Z0IA 5FHMA 3O66A 2DWAA 2I3VA 4ELPA 2W7YA 3TCGA 5IKBA 2H9BA 3V8XB 1O64A 4MF3A 1HSJA 2ZMBA 2Q9TA 4U4XA 4KYDA 4H0WA 3N26A 3KSJA 1B3HA 4C1UA 2LAOA 3IOUA 4KCCA 4NF6B 3ECRA 5AE4A 4H65A 2F35A 1UQWA 4F31B 3UIFA 5FHNA 3W15C 3S9LC 1SVXB 4XKPA 3KBRA 3KEIA 3UK4A 2F8DA 3O9PA 3EHTA 3PMVA 4OXVA 3GZGA 2HAUA 3TTLA 3I3VA 2ESNA 5I56A 3MP1A 1A40A 1JEUA 1B5JA 4QFLA 1IEJA 4LQ5A 3IOWA 3GLBA 4PP0A 1Y20A 5TPAB 4PFTA 1Z7ME 1JVYA 5F7VA 3ILTB 1QUJA 3G3HA 3T66A 1TWYA 4JWYA 4DE8A 3MJNA 4GVOA 4NF4A 2DVZA 4H8JA 1MY2A 4E0WA 3V83A 3PUVE 2F5XA 4ELOA 4GLIA 2XXRA 1N0TA 4U2RA 2ZYKA 4G4PA 1SW4A 4WEDA 5EYFA 3S9MC 3TCHA 2O7UA 3H7MA 2DWHA 1PEBA 2P0SA 3KSXA 2F36A 3TTRA 2XXVA 2QS2A 2F7AA 4LUBA 4OWDA 3HO7A 2HZLA 4YICA 3H6TA 2RCBA 5EHSA 2DS9A 4YMAA 4RPNA 1SBPA 2Y84A 4OETA 3IX1A 5H8QB 1MM7A 3EQ1A 4G77A 3VDFA 3T22A 4EDPA 5I84A 3FZVA 1A54A 3B6QA 2VHAA 4GD5A 4F3GA 3EHUA 4EQ9A 3GBAA 3SERA 5L9SA 2Y7WA 1Y4CA 3QK6A 3C36A 3SESA 1JW1A 2PT2A 4GIZA 1TT1A 2F97A 4BDNA 3DM0A 2XX7A 1XVXA 1O63A 1MY3A 4H5GA 2Z8FA 3MC2A 1FCKA 2V3QA 4Q0CA 3FV2A 1II5A 2I58A 1ZKBA 4NE4A 1EZOA 4LATA 3T9HB 4O3BA 1DTGA 3RNNA 4K3FA 3TAJA 4ZS9A 4U1OA 4JDFA 3JZJA 4G2ZA 2DSFA 5JTYB 2XD2A 1R1NA 4N07A 4Z7EA 4P0IA 4MLQA 1SDXA 3HV1A 3H6UA 4XKQA 3OXNA 4PFWA 4JXIA 1N04A 2BJJX 1ZJLA 3ONMA 4TOZA 1LB9A 3OEKA 2PBWA 3PV0E 3TQWA 3IOTA 1LBCA 1LGBC 3PD9A 1MG1A 3I6VA 3M8UA 3H6VA 4YMBA 3LSLA 4PE5B 1P99A 1JW4A 3A09A 5AA3A 4DXUA 3Q27A 3G3JA 3QYTA 4LP2B 4XKRA 3FATA 2E0SA 4M4GA 1IIWA 2AIXA 1MXWA 2AL4A 5EHMA 3FIRA 1WVJA 3FASA 1FQCA 4R2FA 3TYHA 2XXHA 5DEXB 3L6HA 3OO7A 2R71A 4THIA 2HAVA 2Q2AA 3UP9A 5H8FA 1QKAA 1SW1A 1DPEA 3N6TA 3QAXA 4LZ8A 4Q8RA 1YCJA 2XHDA 5ITOA 5M2VA 1OQGA 3K0VA 3L6GA 2Y7KA 3TODA 2QL3A 1ZBMA 2Q8JA 1AL3A 3BKIB 4LZ7A 1PB8A 2V93A 2Y7PA 1A7LA 1MY1A 3TEPA 1EZPA 1B1HA 1S50A 2ZYOA 3R26A 3HCQA 5CM6A 3K01A 3K1PA 4NTLA 1DPPA 1LSTA 2UVIA 2GHAA 4L17A 4F19A 3EF7A 2I4CA 1ZLQA 4HTGA 3SEYA 4BLAA 4KCDA 3MP6A 3K6XA 3SEVA 3WAEA 1B5IA 2OCUA 3CVGA 3H4ZA 3IO4A 3PU5A 3Q29A 3TUSA 3BBRA 5AA2B 1QKBA 4R2BA 1B58A 1BTJA 1SW5A 4GFRA 4LZ5A 1N3WA 3MVYA 3TTKA 1NH7A 4MLVA 3LSXA 4G8NA 2GHBA 2O69A 3C35A 5I2NB 4FAJA 3O29A 4GQOA 4XKNA 2THIA 4OYVA 3TTMA 4N13A 1SYHA 1P1NA 3TPAA 1GTKA 1R9LA 3QXMA 2R6GE 2DXYA 3OENA 1UTBA 3E4RA 4PFYA 3JV9A 1P1OA 3DP6A 4QFNA 5BWJA 2O1MA 3QSLA 1M5EA 4IO2A 4F22A 3O6GA 3CI8A 1ELJA 1EZ9A 4NWDA 1VR5A 1NL5A 3S2VA 4F18A 1AIVA 1URSA 4BDMA 2H99A 3MVWA 4PFUA 3FJ7A 4RJZA 4QRZA 2ZNUA 2Q89A 4NF5B 3IJXB 4POXA 4YKIA 4JWXA 3TELA 4ELRA 3IB1A 4NF6A 1IXIA 1MPBA 1B4HA 4R6HA 2O84X 4BDQA 1P1QA 3MZBA 1UIVA 4RA1A 1RKMA 3MUQA 3CSGA 2DOJA 3KJ7A 2XXIA 4IY6A 1MQHA 4G8HA 4EXLA 1IQ7A 2O6AA 3TFLA 4QHQA 1Y3PA 1N3XA 1USYE 2Q2CA 1D9VA 1QUKA 1PB9A 5TPAA 1MY0A 3M3FA 4I8CA 1JW5A 5FTIA 1US5A 2D3IA 3C32A 4F3SA 2XD3A 1O7TA 2DWIA 5CMKA 1IUDA 4RK9A 1Z7NE 4YU0A 1PBQA 3W9WA 3IB0A 4QSEA 3VXBA 3PPRA 4YKJA 1B3GA 4JB7A 2QRYA 4OERA 3LC8A 4KPTA 1OLCA 3IO6A 3BFUA 3K00A 3C31A 1PB7A 2RKMA 1UTHB 1L5TA 2GRVA 3VLUA 4YB6A 2Z8DA 3MAMA 3CFZA 1FTOA 4H5FA 5H8QA 3ODBA 3LSWA 2RC9A 3OO6A 4GL8A 2VD2A 3S9EA 3G3GA 2H98A 2ZYNA 1IXGA 2P1SA 3CFLA 2FNCA 2I6EA 1MRPA 4XIGQ 5KCJB 2NVUB 4F1UA 3O6HA 5DVJA 2B65A 1B3LA 1B0LA 3FVNA 1TFAA 3V89B 2O51A 2UYEA 3VFJA 1NNTA 1SW2A 2DE2A 4GL0A 2CMOA 3JYRA 3AXFA 4NF8B 2HQ0A 1IITA 1GVCA 3FUZA 4G68C 1MS7A 3KOSA 1CB6A 3T9UA 3G7WA 1FTMA 4ISUA 2HZKA 3KN3A 3KJTA 1MPCA 5I57B 1MQGA 1NNPA 4LONB 5JTYA 1OQHA 4FIMA 4OENA 1B7UA 5LOMA 1JQFA 4KYSA 4JBZA 1A8EA 1BP5A 3MPLA 2I49A 2REGA 5KDTB 2NWJA 3KFMA 1RYOA 4N6PA 4HCYA 4F1YA 4OQOA 1Y9UA 2OZZA 4P11A 1MH4A 1N76A 3Q28A 3W9VA 1HSEA 3CG3A 4TQUQ 4F39A 4FATA 1XS5A 5ISUA 1S9TA 2I0CA 4GOTA 5H8HB 2Y7IA 2QS3A 2IEEA 3CR9A 3U92A 5HPQA 3M3LA 3TCFA 2AL5A 3DLNA 4WKMA 4YKPA 3KG2A 1IXCA 4ZZEA 3IORA 4IGRA 5ITPA 3C34A 4EQ7A 2V25A 3N5LA 1T0KA 4ZZAA 3O2AA 5DEXA 1Y3QA 4TLLB 2QS1A
chains in the Genus database with same CATH superfamily
2ANJA 1FW0A 1URGA 3LBSA 4RNSA 3T9VA 2ZZVA 1LBVA 5AA4B 3PPOA 1NUXA 2DXRA 4PCDA 4YB7A 3MZ1A 1MY4A 4KI0E 3D4GA 1RDYA 5LTCA 3IOVA 4QF9A 5ET7A 4IY5A 2PCRA 3U1OA 1I6BA 2V4CA 4O8MA 1GV8A 3C33A 3GXAA 4MX6A 4WEPA 4C0RA 3E3KA 4GX4A 3O28A 4PDHA 4O3AA 4ZDMA 2XWIA 1IMCA 2DE3A 4YB5A 1NMUA 4E0XA 1PBPA 4MFIA 3U72A 5H8NB 3H6WA 2XX8A 4QFPA 2ABHA 5F1QA 2WKYA 2E1SA 3E13X 5CMCA 4MAGA 3FVKA 2F3DA 1FQDA 4X48A 3Q25A 4HCWA 4PETA 2DVCA 3PMWA 2FIXA 3PTYA 2OLBA 2XWOA 5AA2A 4ESWA 4P56A 2FVZA 4JWOA 4NF0A 3SETA 3H06B 3RN8A 1H45A 3K1NA 4U4SA 2H5YA 1NI9A 1RYXA 4Q5TA 3IFCA 1NNFA 4X1BA 5I2NA 3TQLA 2ZNSA 4ONYA 2V84A 3VXCA 1PDAA 2Z23A 1FJ9A 5I59B 4P0GA 4EUOA 3B7DA 3A3CA 1UIUA 2PMSA 3FJMA 3I5OA 1BLFA 1GGGA 1BIYA 1DSNA 2GH9A 1Y3NA 3C4MA 1QW0A 4IO4A 1QJMA 2D5WA 3OD7A 2KLFA 2F7BA 4H6DA 4G8MA 4GBVA 1N7XA 4PGNA 3B50A 3S4UA 3RTWB 5L9OA 4BDRA 2WBBA 4RPOA 1LAFE 3TZAA 2JJKA 3KBZA 4X1DA 3MPKA 1KA1A 1QVSA 1FPGA 2QVUA 4GXSB 2NXOA 1FBFA 3E78A 3MP8A 1VFEA 1MH3A 3EN3A 1FPJA 2P3VA 4DXBA 2ONKE 3BIHA 2QFLA 3FV1A 3UGWA 4F29A 4I1DA 4DCXA 1A8FA 1BKAA 1LAHE 3K4UA 5CRYA 4QXDA 3Q26A 4QFOA 5EYGA 1LCTA 4OVRA 4DCYA 4OVPA 2XXYA 3RQTA 4NF5A 2DWJA 4H1XA 1NV4A 2REJA 1B1XA 4U23A 3FD3A 5JK4A 4H45A 3G3FA 4GBWA 2CZLA 2KQZA 2FYIA 4ZEDA 3VV5A 4G68B 1B32A 3K2DA 3OO8A 2ALUA 3QIMA 2RF1A 2B4MA 4MHFA 1LB8A 1OVBA 3MVXA 4HXVA 1K9YA 3MBPA 3C9HA 1H3DA 3BFTA 1LEVA 4LQ2A 1SD3A 4R9FA 1AH5A 1M5DA 5EQ8A 1EYKA 5ELVA 2H25A 1OIBA 2WEFA 4NWCA 3IL1B 3R6UA 4KD5A 2PX1A 2YJPA 4PAFA 3MZ9A 5LDZA 4OEVA 1FQFA 3GBBA 1NV7A 5K2XA 4I9DA 1MDP1 3K6VA 1B5HA 5KZTA 5T3JA 4FORA 4F1VA 2I4BA 2OWZA 1D9QA 5IAIA 2RC8A 4KHZE 4KFQA 3LSFB 3VLVA 1FRPA 1ATGA 3B6WA 4R6KA 3MQ9A 4R74A 1MM6A 2XXXA 4F3BA 3B8BA 1N7WA 1NV1A 2XXUA 4FEDA 4R9GA 1TFDA 1MXUA 4UA8A 1FQBA 1RDZA 2GFEA 2FIEA 2V3UA 1UTHA 4RY1A 1HSLA 1XVYA 2NOOA 3CRBA 4P47A 5I2KB 4OMBA 3PUWE 3LUZA 3ZKKA 1J1NA 2L5VA 2PT1A 4RYAA 4PF6A 4R73A 4IGTA 5ET5A 2XXWA 1JETA 2I0BA 4HE2A 4NEDA 1B7HA 5KCJA 5IZ3A 1CE2A 3THIA 1WDNA 4OVJA 5A5XB 4EXKA 1MXXA 4U22A 1XHYA 3RT6B 3PPPA 3MWBA 5I58B 3HHFA 1B9JA 4FJPA 1FQEA 4MNCA 4H67A 1MPDA 2Y7RA 1MDQA 2UYFA 1S7YA 4NF8A 5TP9B 3PMXA 4GF8A 3DP4A 5ICQA 1MXYA 2M8CA 3ILUB 4U21A 5B70A 1EU8A 3H03A 5ESYA 2ZZWA 1NV3A 1VSOA 1YTVA 4JSOA 1A99A 4P9KA 5I57A 3FXRA 3PUZE 3KOTA 1LLSA 3ZKLA 3A3UA 3VVFA 3TDJA 1LAXA 1FTJA 3TMGA 3OEMA 3RLFE 5KDTA 3OSQA 3M3KA 2B3BA 3N6UA 2A5TB 4OFJA 3PUYE 5CMBA 1A55A 1LBWA 3G3KA 1Y1MA 1FBPA 5H8HA 4DZ1A 3U8QA 2VD3A 1QULA 2D21A 3LR1A 3O97A 2QVVA 1M5BA 1KWHA 4ZECA 1NUWA 3FVGA 3KZGA 3SZPA 4Q30B 1B46A 3PD8A 3E9XA 1DK4A 1SQYA 4UACA 2B3FA 2HXWA 3OSRA 4MIJA 1YPNA 2XXTA 3SKPA 3EPEA 1K9ZA 4U1ZA 1AOVA 4F2OA 4R72A 1YYZA 1MQDA 3HHGA 3KGCA 1TXFA 2QVRA 1P1UA 1RDXA 3ROJA 3ZSFA 5AA4A 3FXBA 1FQAA 1ZU0A 1Q9DA 2HHMA 1DOTA 3LV0A 1OLAA 3PPNA 2HPGA 3B6TA 2QMXA 3SEXA 2HCAA 2QMWA 2A5SA 2XXQA 2QS4A 4PFRA 1Q1KA 4OFOA 1I6AA 2ZYMA 3F11A 2VOZA 2OWSA 1B7ZA 3QUFA 1FPIA 4LVQA 1SPIA 1NUYA 5H8NA 3WAFA 1FSAA 3OOAA 4ZEBA 1AMFA 1JEVA 5K2YA 3IK6B 3OMBA 1B3EA 2XX9A 5DT6A 4NN3A 4R6YA 4OTEA 4N4UA 1I69A 2X26A 3CG1A 3K6WA 4PAIA 1ZMGA 1FPFA 1D3KA 3TTNA 3T93B 4R75A 4EQBA 1B6HA 1H43A 4P1EA 3T1BA 4BDOA 4IR8A 5HM4B 1LBYA 4I3EA 5I56B 1NKXA 3SEWA 3IB2A 2OK2A 2Z8EA 1SI0A 4NQ8A 4PC9A 3RGYA 4I3YA 5DVFA 5FHOA 3VLWA 3SEUA 2UXAA 5AA2D 5B7DA 1GR2A 1I6QA 5I59A 3RPWA 3IJOB 3V5AA 5IM2A 3O6IA 1P1WA 1FBGA 5HBCA 4NF4B 4RXLA 3OO9A 2UVJA 1EH3A 4ZE9A 3T0JA 3FGSA 2VPNA 4HE0A 3HSTA 1D9YA 3CSBA 4OVTA 4ZEIA 1FTLA 2UVHA 4POWA 4XXUA 1MXZA 4I40A 1B4ZA 2O68A 2ONSA 3VE1B 2O7IA 2DQVA 5TU0A 4QSDA 4X9TA 1CNQA 4YAHX 2PFZA 1ZIUA 1Y1ZA 4ESXA 5ICTA 3CHGA 3CIJA 2NUVA 4DLDA 3H3GA 4DIGA 1R9QA 4AB6A 3RTFB 4DDDA 1R6ZA 3T96B 1G0HA 4DXCA 4KYEA 4MMPA 5J16A 1JNFA 4GWYA 2V3TA 1LFHA 1XT8A 3VVEA 2QJEA 1US4A 1NV6A 4IB2A 2P2AA 3TKDA 3K02A 2DYXA 3IAZA 5DVIA 3PPQA 2IA4A 3HN0A 1LAGE 4N8GA 5CBSA 5AA1A 4RK2A 2F7CA 4YZZA 3UN6A 1PC3A 4EF2A 4PFBA 4F3PA 1YXIA 1VFDA 4N91A 4P8BA 3D4CA 4KQPA 2UVGA 2XXKA 4LA9A 4G68A 5CBRA 5EQ7A 1MXVA 2R9JA 2HEUA 1SI1A 2O1LA 4OHNA 3S9NC 2DDKA 4MBPA 4EF1A 1IZ1A 3KN8A 4GX6A 1B2HA 4IO3A 5CC2A 4JSDA 1NFTA 2OWTA 2DE4A 2Y5LA 4IO5A 3GYYA 3K6UA 4H8IA 2BJIA 1B40A 4IO7A 3EKIA 4ZEFA 2AYSA 3SDFA 3VVDA 2ONRA 3FXUA 1D4NA 4H46A 2CZHA 2DP8A 2ZNTA 1VDWA 4ND9A 4BDLA 4O7MA 4FEBA 4HW8A 2G93A 2Q88A 2X7QA 5CMMA 3PUXE 4AQ4A 5JEIA 1POY1 4G61A 1B52A 4GWWA 5J1DA 2RCAA 1QUIA 3DELB 4MH5A 1EYIA 1OMPA 5IGAA 3G3IA 5DYHA 3N94A 1B51A 1VE4A 1FTKA 4KR5A 2ZXTA 3RPLB 4PFIA 4PDDA 2PFYA 1Y4TA 2F6GA 1B0HA 2YLNA 5L8DA 1POTA 1JVXA 4OEUA 4XTCQ 5DTBA 4OZ9A 2XXPA 5I2KA 3RT8A 3MVZA 3FJGA 5L9MA 4GRKA 1BK4A 1XOCA 1ZTYA 5H8SA 4ZE8A 1LFIA 5H8FB 2Z22A 1H44A 3RYDA 4QFKA 1XC1A 4F2QA 3DP8A 1USYH 3FXQA 3R7XA 3LUYA 3MW0A 2HFBA 2QSXA 5A5XA 2CEXA 1ANFA 2RINA 4GWXA 1F9BA 2VGQA 2F34A 4ECFA 3IR1A 1IXHA 4OFLA 2PYYA 5I58A 3BIGA 2F78A 5BUUA 4PQJA 1MQJA 3U93A 3KN7A 1N84A 2G29A 2HXRA 4QSCA 5TP9A 1H76A 4FE8A 4I62A 3RY3A 4GWOA 2OJTA 4ZEKA 4HS7A 1FBDA 2RC7A 1FJ6A 4TLMB 5FTHA 1LBBA 3PGFA 1LFGA 3OELA 2F6PA 5CI5A 3CFXA 2H4IA 4YKKA 4N81A 2YPNA 3IFAA 3ZS6A 4OESA 1DTZA 3QUJA 4AB5A 1B05A 2I3WA 3UA8A 3FVOA 1OVTA 1FPDA 1NH8A 1SYIA 1Q35A 4N17A 2QPQA 1YAEA 4XEQA 3HPIA 1URDA 1IMDA 2OBGA 2A5TA 1WODA 4IO6A 2FA7A 2WYPA 4WXJA 4NMYA 2X7PA 3EHSA 2I48A 3RUMA 4GXAA 5IZ1A 2VP1A 4NG7A 2PVUA 4M1VA 5F24A 4OVSA 3USDA 5A5LA 1NNKA 3UORA 4ELQA 3U94A 1UTBB 4FECA 4GWZA 1NV5A 1LCFA 4C1TA 1FPLA 1DMBA 3P7IA 1MQIA 4O3CA 1M5CA 3K1MA 1M5FA 1B3FA 4X04A 3T9XB 4Z0IA 5FHMA 3O66A 2DWAA 2I3VA 4ELPA 2W7YA 3TCGA 5IKBA 1NV0A 2H9BA 2VPOA 3V8XB 1O64A 4MF3A 1HSJA 2ZMBA 1FPEA 2Q9TA 4U4XA 4KYDA 4H0WA 3N26A 3KSJA 1B3HA 4C1UA 4MNIA 2LAOA 1EYJA 3IOUA 4KCCA 4NF6B 3ECRA 3NOHA 5AE4A 4P1LA 4H65A 2F35A 1UQWA 4F31B 3UIFA 5FHNA 3W15C 4JVIA 3S9LC 1SVXB 4XKPA 3KBRA 4OA4A 3KEIA 3UK4A 2F8DA 3O9PA 3EHTA 3PMVA 4OXVA 3GZGA 2HAUA 3TTLA 3I3VA 2ESNA 5I56A 3MP1A 1A40A 5FBPA 1JEUA 1B5JA 4DI4B 1QGXA 4QFLA 1IEJA 4LQ5A 3IOWA 3GLBA 4PP0A 1Y20A 5TPAB 4PFTA 1Z7ME 1JVYA 5F7VA 3ILTB 1QUJA 4AS4A 2WX9A 1FBCA 3G3HA 3T66A 1TWYA 4XF5A 4JWYA 4DE8A 3MJNA 4NHBA 2Q8MA 4GVOA 4NF4A 2B4LA 2DVZA 4H8JA 1MY2A 4E0WA 3V83A 3PUVE 2F5XA 4ELOA 4GLIA 2XXRA 1N0TA 4U2RA 2ZYKA 4FBPA 5I5PA 4G4PA 1SW4A 4WEDA 5EYFA 4N6KA 3S9MC 3TCHA 2O7UA 2Q74A 3H7MA 2DWHA 1FBHA 1PEBA 2P0SA 3FBPA 3KSXA 2F36A 3TTRA 5ET8A 1NV2A 2XXVA 2QS2A 2F7AA 4LUBA 2GQ1A 4OWDA 1YZ0A 2MKZA 3HO7A 2HZLA 2Y5KA 4YICA 3H6TA 2RCBA 5EHSA 2DS9A 4PGPA 2KR0A 4YMAA 4RPNA 4AS5A 1SBPA 2Y84A 4OETA 3IX1A 1FTAA 1MM7A 5H8QB 3EQ1A 4G77A 3VDFA 3T22A 4EDPA 5I84A 4OVQA 3FZVA 1A54A 4N15A 3B6QA 2VHAA 4GD5A 4F3GA 3EHUA 4EQ9A 3GBAA 3SERA 5L9SA 2Y7WA 2XWVA 1Y4CA 3QK6A 3C36A 3SESA 5I3SA 3A29A 1JW1A 2PT2A 4GIZA 1TT1A 2F97A 4BDNA 3E79A 3DM0A 4MNPA 2XX7A 1XVXA 1O63A 1MY3A 1FBEA 4H5GA 2Z8FA 3MC2A 1FCKA 2V3QA 4Q0CA 3FV2A 1II5A 2I58A 1ZKBA 4NE4A 1EZOA 4MEVA 4DI3D 4LATA 3T9HB 4O3BA 1DTGA 4KXPA 3RNNA 4K3FA 3TAJA 4ZS9A 4U1OA 4JDFA 3JZJA 4G2ZA 4MCOA 2DSFA 5JTYB 3QMFA 2XD2A 4PBHA 1R1NA 4N07A 4Z7EA 4P0IA 4MLQA 1SDXA 3HV1A 3D1RA 3H6UA 4XKQA 1JP4A 3MYUA 3OXNA 4PFWA 4JXIA 1N04A 2BJJX 1ZJLA 3ONMA 4TOZA 1LB9A 4NX1A 3OEKA 2PBWA 3PV0E 3TQWA 4GWSA 3IOTA 1LBCA 1LGBC 3PD9A 1MG1A 3I6VA 3M8UA 2OX3A 4O7IA 3H6VA 3RPLA 4YMBA 2F3BA 3LSLA 1IMFA 4PE5B 1P99A 1JW4A 3A09A 4DXUA 3Q27A 3G3JA 5AA3A 3QYTA 4LP2B 3FATA 4M4GA 2E0SA 4XKRA 1AWBA 1IIWA 2AIXA 1MXWA 4NGUA 2AL4A 5EHMA 3FIRA 1WVJA 3FASA 1FQCA 4R2FA 3TYHA 1IMEA 2XXHA 5DEXB 1DBZA 3L6HA 4N6DA 3OO7A 2R71A 4THIA 2HAVA 2Q2AA 3UP9A 5H8FA 1QKAA 1SW1A 1DPEA 3N6TA 3QAXA 4LZ8A 4Q8RA 1YCJA 2XHDA 5ITOA 4PBQA 2FHYA 4GX3A 5M2VA 1OQGA 3KC0A 4PAKA 3K0VA 3L6GA 2Y7KA 3TODA 2QL3A 1ZBMA 2Q8JA 1AL3A 3BKIB 4LZ7A 1PB8A 2V93A 2Y7PA 1A7LA 1MY1A 3TEPA 1EZPA 1B1HA 4GWUA 1S50A 2ZYOA 3R26A 3HCQA 5CM6A 3K01A 4PTKA 3K1PA 4NTLA 1DPPA 1LSTA 2UVIA 3ISPA 1INPA 2GHAA 4L17A 4F19A 3EF7A 2I4CA 1LBZA 1ZLQA 4HTGA 1LBXA 3SEYA 4BLAA 4KCDA 3MP6A 3K6XA 3SEVA 3WAEA 1B5IA 2OCUA 3CVGA 3H4ZA 3IO4A 3PU5A 3Q29A 3TUSA 3BBRA 2CZKA 5AA2B 5EYHA 1QKBA 4R2BA 1B58A 1BTJA 1SW5A 4GFRA 4LZ5A 1N3WA 3MVYA 3TTKA 1NH7A 4MLVA 3LSXA 4G8NA 4X8RA 2GHBA 2O69A 3C35A 5I2NB 4FAJA 3O29A 4GQOA 4XKNA 2THIA 5IZZA 4LN5A 4OYVA 3TTMA 4HE1A 4N13A 4UABA 1SYHA 1P1NA 3TPAA 1GTKA 1R9LA 3QXMA 2R6GE 2DXYA 3OENA 2FBPA 1UTBA 3KC1A 3E4RA 4PFYA 3JV9A 1P1OA 3DP6A 4QFNA 5BWJA 2O1MA 3QSLA 1M5EA 4IO2A 4F22A 3O6GA 3CI8A 1ELJA 1EZ9A 4NWDA 1VR5A 1KZ8A 4JVDA 1NL5A 3S2VA 4F18A 2XA5A 1AIVA 1URSA 4BDMA 2H99A 3MVWA 4PFUA 3FJ7A 4RJZA 4QRZA 2ZNUA 2Q89A 4MJOA 4NF5B 3IJXB 4POXA 4YKIA 4JWXA 1IMBA 3TELA 4ELRA 3IB1A 4NF6A 1IXIA 1MPBA 4O94A 1B4HA 4R6HA 2XWKA 2O84X 4BDQA 1P1QA 3MZBA 1UIVA 4RA1A 1RKMA 3MUQA 3CSGA 2DOJA 3KJ7A 4PE3A 2WYKA 2XXIA 4IY6A 1MQHA 4G8HA 4EXLA 1IQ7A 2O6AA 3TFLA 4QHQA 1Y3PA 1N3XA 1USYE 2Q2CA 1D9VA 2P3NA 1QUKA 4XFEA 1PB9A 5TPAA 1MY0A 3M3FA 1DCUA 4I8CA 1JW5A 5FTIA 1US5A 2D3IA 3C32A 4F3SA 2XD3A 1O7TA 2DWIA 5CMKA 5DW8A 1IUDA 4RK9A 1Z7NE 4YU0A 1PBQA 3W9WA 3IB0A 4QSEA 3VXBA 3PPRA 4YKJA 1B3GA 4JB7A 1FPKA 2QRYA 4OERA 3LC8A 4KPTA 1OLCA 3IO6A 3BFUA 3K00A 1G0IA 3C31A 1PB7A 2RKMA 2R8TA 1UTHB 4NAPA 1L5TA 2GRVA 3VLUA 4YB6A 2Z8DA 3MAMA 3CFZA 1FTOA 4H5FA 5H8QA 3ODBA 3LSWA 2RC9A 3OO6A 4GL8A 2VD2A 3S9EA 3G3GA 2H98A 2ZYNA 1IXGA 2P1SA 3CFLA 1FPBA 2FNCA 2I6EA 1MRPA 4XIGQ 5KCJB 2NVUB 4F1UA 3O6HA 5IZ3B 5DVJA 2B65A 1B3LA 1B0LA 3FVNA 1TFAA 1NUZA 3V89B 2O51A 2UYEA 3VFJA 5EQAA 1NNTA 3U65A 1SW2A 2DE2A 4GL0A 5I7IA 2CMOA 3JYRA 3AXFA 4NF8B 2HQ0A 1IITA 1GVCA 3FUZA 4G68C 5ET6A 1MS7A 5EQ9A 1KA0A 3KOSA 3HFUA 4OANA 1CB6A 3T9UA 3G7WA 1FTMA 4ISUA 2HZKA 3KN3A 4P3LA 3KJTA 1MPCA 5I57B 1MQGA 1NNPA 4LONB 5JTYA 1OQHA 4FIMA 4OENA 1B7UA 5LOMA 1JQFA 4KYSA 4JBZA 1A8EA 1BP5A 3MPLA 2I49A 2REGA 5KDTB 2NWJA 3KFMA 1RYOA 4N6PA 2VT5A 4HCYA 4F1YA 4OQOA 1Y9UA 2OZZA 4P11A 1MH4A 1N76A 2CEYA 3Q28A 3W9VA 1HSEA 4TQUQ 3CG3A 4F39A 4FATA 1XS5A 5ISUA 1S9TA 2I0CA 4GOTA 5H8HB 4PF8A 2Y7IA 1XI6A 2QS3A 2IEEA 3CR9A 3U92A 5HPQA 3M3LA 3TCFA 2AL5A 3DLNA 4WKMA 4YKPA 3KG2A 1IXCA 3MSTA 4N8YA 2ZZXA 4ZZEA 3IORA 4IGRA 5ITPA 4JVCA 3C34A 4EQ7A 2WBDA 2V25A 3N5LA 1T0KA 4ZZAA 3O2AA 1IMAA 5DEXA 1Y3QA 4QBAA 4TLLB 2CZIA 2QS1A
chains in the Genus database with same CATH topology
2ANJA 1FW0A 1URGA 3LBSA 4RNSA 3T9VA 5AA4B 3PPOA 2DXRA 4YB7A 3MZ1A 1MY4A 4KI0E 3D4GA 3IOVA 4QF9A 4IY5A 3U1OA 1I6BA 1GV8A 3C33A 3GXAA 4WEPA 4C0RA 3E3KA 3O28A 4O3AA 4ZDMA 2DE3A 4YB5A 1NMUA 4E0XA 1PBPA 4MFIA 3U72A 5H8NB 3H6WA 2XX8A 4QFPA 2ABHA 5F1QA 2WKYA 2E1SA 3E13X 5CMCA 3FVKA 1FQDA 4X48A 3Q25A 4HCWA 4PETA 2DVCA 3PMWA 2OLBA 5AA2A 4ESWA 4JWOA 3SETA 3H06B 3RN8A 1H45A 3K1NA 4U4SA 2H5YA 1RYXA 4Q5TA 1NNFA 4X1BA 5I2NA 3TQLA 2ZNSA 4ONYA 2V84A 3VXCA 1PDAA 2Z23A 5I59B 4P0GA 4EUOA 3B7DA 3A3CA 1UIUA 2PMSA 3FJMA 3I5OA 1BLFA 1GGGA 1BIYA 1DSNA 2GH9A 1Y3NA 3C4MA 1QW0A 4IO4A 1QJMA 2D5WA 3OD7A 2KLFA 2F7BA 4H6DA 4G8MA 1N7XA 3S4UA 3RTWB 5L9OA 4BDRA 4RPOA 1LAFE 3TZAA 4X1DA 3MPKA 1QVSA 4GXSB 2NXOA 3MP8A 1VFEA 1MH3A 3EN3A 4DXBA 2ONKE 3FV1A 3UGWA 4F29A 4I1DA 4DCXA 1A8FA 1BKAA 1LAHE 3K4UA 5CRYA 3Q26A 4QFOA 1LCTA 4DCYA 2XXYA 3RQTA 4NF5A 2DWJA 4H1XA 2REJA 1B1XA 4U23A 3FD3A 5JK4A 3G3FA 2CZLA 2FYIA 4ZEDA 3VV5A 4G68B 1B32A 3K2DA 3OO8A 2ALUA 3QIMA 2RF1A 1LB8A 1OVBA 3MVXA 3MBPA 3C9HA 1H3DA 3BFTA 4LQ2A 1SD3A 4R9FA 1AH5A 1M5DA 5ELVA 2H25A 1OIBA 4NWCA 3IL1B 3R6UA 4KD5A 2PX1A 2YJPA 3MZ9A 4OEVA 1FQFA 3GBBA 5K2XA 4I9DA 1MDP1 3K6VA 1B5HA 5KZTA 4FORA 4F1VA 2I4BA 5IAIA 2RC8A 4KHZE 4KFQA 3LSFB 3VLVA 1ATGA 3B6WA 4R6KA 3MQ9A 4R74A 1MM6A 2XXXA 4F3BA 1N7WA 2XXUA 4FEDA 4R9GA 1TFDA 1MXUA 4UA8A 1FQBA 2GFEA 2V3UA 1UTHA 4RY1A 1HSLA 1XVYA 2NOOA 3CRBA 5I2KB 4OMBA 3PUWE 3ZKKA 1J1NA 2PT1A 4RYAA 4R73A 4IGTA 2XXWA 1JETA 2I0BA 4NEDA 1B7HA 5KCJA 1CE2A 3THIA 1WDNA 4OVJA 5A5XB 4EXKA 1MXXA 4U22A 1XHYA 3RT6B 3PPPA 3MWBA 5I58B 3HHFA 1B9JA 4FJPA 1FQEA 4H67A 1MPDA 2Y7RA 1MDQA 2UYFA 1S7YA 4NF8A 5TP9B 3PMXA 4GF8A 3DP4A 5ICQA 1MXYA 2M8CA 3ILUB 4U21A 5B70A 1EU8A 3H03A 1VSOA 1YTVA 4JSOA 1A99A 5I57A 3FXRA 3PUZE 3KOTA 1LLSA 3ZKLA 3A3UA 3VVFA 3TDJA 1LAXA 1FTJA 3TMGA 3OEMA 3RLFE 5KDTA 3OSQA 3M3KA 2B3BA 3N6UA 2A5TB 4OFJA 3PUYE 5CMBA 1A55A 3G3KA 1Y1MA 5H8HA 4DZ1A 3U8QA 2VD3A 1QULA 2D21A 3LR1A 3O97A 1M5BA 1KWHA 4ZECA 3FVGA 3KZGA 4Q30B 1B46A 3PD8A 3E9XA 1SQYA 4UACA 2B3FA 2HXWA 3OSRA 1YPNA 2XXTA 3SKPA 3EPEA 4U1ZA 1AOVA 4F2OA 4R72A 1MQDA 3HHGA 3KGCA 1TXFA 1P1UA 3ZSFA 5AA4A 1FQAA 1ZU0A 1DOTA 1OLAA 3PPNA 3B6TA 2QMXA 3SEXA 2HCAA 2QMWA 2A5SA 2XXQA 2QS4A 1Q1KA 4OFOA 1I6AA 2ZYMA 3F11A 2VOZA 2OWSA 1B7ZA 3QUFA 4LVQA 5H8NA 3WAFA 3OOAA 4ZEBA 1AMFA 1JEVA 5K2YA 3IK6B 3OMBA 1B3EA 2XX9A 5DT6A 4R6YA 4OTEA 1I69A 2X26A 3CG1A 3K6WA 1ZMGA 1D3KA 3TTNA 3T93B 4R75A 4EQBA 1B6HA 1H43A 4BDOA 5HM4B 5I56B 1NKXA 3SEWA 3IB2A 2OK2A 2Z8EA 1SI0A 3RGYA 5DVFA 5FHOA 3VLWA 3SEUA 2UXAA 5AA2D 5B7DA 1GR2A 1I6QA 5I59A 3RPWA 3IJOB 3V5AA 3O6IA 1P1WA 5HBCA 4NF4B 4RXLA 3OO9A 2UVJA 1EH3A 4ZE9A 3FGSA 3HSTA 1D9YA 3CSBA 4ZEIA 1FTLA 2UVHA 4POWA 4XXUA 1MXZA 1B4ZA 2O68A 2ONSA 3VE1B 2O7IA 2DQVA 5TU0A 4QSDA 4X9TA 4YAHX 1ZIUA 1Y1ZA 4ESXA 5ICTA 3CIJA 2NUVA 4DLDA 3H3GA 4DIGA 1R9QA 4AB6A 3RTFB 4DDDA 1R6ZA 3T96B 4DXCA 4KYEA 1JNFA 2V3TA 1LFHA 1XT8A 3VVEA 2QJEA 1US4A 4IB2A 2P2AA 3TKDA 3K02A 2DYXA 3IAZA 5DVIA 3PPQA 2IA4A 3HN0A 1LAGE 5CBSA 5AA1A 4RK2A 2F7CA 4YZZA 3UN6A 1PC3A 4EF2A 4F3PA 1VFDA 3D4CA 4KQPA 2UVGA 4LA9A 4G68A 5CBRA 1MXVA 2R9JA 2HEUA 1SI1A 2O1LA 4OHNA 3S9NC 4MBPA 4EF1A 1IZ1A 3KN8A 1B2HA 4IO3A 5CC2A 4JSDA 1NFTA 2OWTA 2DE4A 4IO5A 3K6UA 4H8IA 1B40A 4IO7A 4ZEFA 2AYSA 3SDFA 3VVDA 2ONRA 3FXUA 1D4NA 2DP8A 2ZNTA 4ND9A 4BDLA 4FEBA 4HW8A 2G93A 2Q88A 2X7QA 5CMMA 3PUXE 4AQ4A 5JEIA 1POY1 1B52A 5J1DA 2RCAA 1QUIA 3DELB 4MH5A 1OMPA 3G3IA 5DYHA 3N94A 1B51A 1VE4A 1FTKA 4KR5A 2ZXTA 1Y4TA 2F6GA 1B0HA 2YLNA 5L8DA 1POTA 1JVXA 4OEUA 4XTCQ 5DTBA 4OZ9A 2XXPA 5I2KA 3RT8A 3MVZA 3FJGA 5L9MA 4GRKA 1XOCA 1ZTYA 5H8SA 4ZE8A 1LFIA 5H8FB 2Z22A 1H44A 4QFKA 1XC1A 4F2QA 3DP8A 1USYH 3FXQA 3R7XA 3LUYA 3MW0A 2HFBA 2QSXA 5A5XA 1ANFA 2RINA 1F9BA 2VGQA 2F34A 4ECFA 3IR1A 1IXHA 4OFLA 2PYYA 5I58A 2F78A 5BUUA 4PQJA 1MQJA 3U93A 3KN7A 1N84A 2G29A 4QSCA 5TP9A 1H76A 4FE8A 4I62A 3RY3A 4GWOA 2OJTA 4ZEKA 4HS7A 2RC7A 5FTHA 4TLMB 1LBBA 3PGFA 1LFGA 3OELA 2F6PA 5CI5A 3CFXA 2H4IA 4YKKA 2YPNA 3ZS6A 4OESA 1DTZA 3QUJA 4AB5A 1B05A 2I3WA 3UA8A 3FVOA 1OVTA 1NH8A 1SYIA 1Q35A 2QPQA 1YAEA 3HPIA 1URDA 2OBGA 2A5TA 1WODA 4IO6A 2FA7A 4WXJA 4NMYA 2X7PA 3EHSA 2I48A 3RUMA 4GXAA 2VP1A 2PVUA 4M1VA 3USDA 1NNKA 3UORA 4ELQA 3U94A 1UTBB 4FECA 1LCFA 4C1TA 1DMBA 3P7IA 1MQIA 4O3CA 1M5CA 3K1MA 1M5FA 1B3FA 3T9XB 4Z0IA 5FHMA 3O66A 2DWAA 2I3VA 4ELPA 2W7YA 3TCGA 5IKBA 2H9BA 3V8XB 1O64A 4MF3A 1HSJA 2ZMBA 2Q9TA 4U4XA 4KYDA 4H0WA 3N26A 3KSJA 1B3HA 4C1UA 2LAOA 3IOUA 4KCCA 4NF6B 3ECRA 5AE4A 4H65A 2F35A 1UQWA 4F31B 3UIFA 5FHNA 3W15C 3S9LC 1SVXB 4XKPA 3KBRA 3KEIA 3UK4A 2F8DA 3O9PA 3EHTA 3PMVA 4OXVA 3GZGA 2HAUA 3TTLA 3I3VA 2ESNA 5I56A 3MP1A 1A40A 1JEUA 1B5JA 4QFLA 1IEJA 4LQ5A 3IOWA 3GLBA 4PP0A 1Y20A 5TPAB 4PFTA 1Z7ME 1JVYA 5F7VA 3ILTB 1QUJA 3G3HA 3T66A 1TWYA 4JWYA 4DE8A 3MJNA 4GVOA 4NF4A 2DVZA 4H8JA 1MY2A 4E0WA 3V83A 3PUVE 2F5XA 4ELOA 4GLIA 2XXRA 1N0TA 4U2RA 2ZYKA 4G4PA 1SW4A 4WEDA 5EYFA 3S9MC 3TCHA 2O7UA 3H7MA 2DWHA 1PEBA 2P0SA 3KSXA 2F36A 3TTRA 2XXVA 2QS2A 2F7AA 4LUBA 4OWDA 3HO7A 2HZLA 4YICA 3H6TA 2RCBA 5EHSA 2DS9A 4YMAA 4RPNA 1SBPA 2Y84A 4OETA 3IX1A 5H8QB 1MM7A 3EQ1A 4G77A 3VDFA 3T22A 4EDPA 5I84A 3FZVA 1A54A 3B6QA 2VHAA 4GD5A 4F3GA 3EHUA 4EQ9A 3GBAA 3SERA 5L9SA 2Y7WA 1Y4CA 3QK6A 3C36A 3SESA 1JW1A 2PT2A 4GIZA 1TT1A 2F97A 4BDNA 3DM0A 2XX7A 1XVXA 1O63A 1MY3A 4H5GA 2Z8FA 3MC2A 1FCKA 2V3QA 4Q0CA 3FV2A 1II5A 2I58A 1ZKBA 4NE4A 1EZOA 4LATA 3T9HB 4O3BA 1DTGA 3RNNA 4K3FA 3TAJA 4ZS9A 4U1OA 4JDFA 3JZJA 4G2ZA 2DSFA 5JTYB 2XD2A 1R1NA 4N07A 4Z7EA 4P0IA 4MLQA 1SDXA 3HV1A 3H6UA 4XKQA 3OXNA 4PFWA 4JXIA 1N04A 2BJJX 1ZJLA 3ONMA 4TOZA 1LB9A 3OEKA 2PBWA 3PV0E 3TQWA 3IOTA 1LBCA 1LGBC 3PD9A 1MG1A 3I6VA 3M8UA 3H6VA 4YMBA 3LSLA 4PE5B 1P99A 1JW4A 3A09A 5AA3A 4DXUA 3Q27A 3G3JA 3QYTA 4LP2B 4XKRA 3FATA 2E0SA 4M4GA 1IIWA 2AIXA 1MXWA 2AL4A 5EHMA 3FIRA 1WVJA 3FASA 1FQCA 4R2FA 3TYHA 2XXHA 5DEXB 3L6HA 3OO7A 2R71A 4THIA 2HAVA 2Q2AA 3UP9A 5H8FA 1QKAA 1SW1A 1DPEA 3N6TA 3QAXA 4LZ8A 4Q8RA 1YCJA 2XHDA 5ITOA 5M2VA 1OQGA 3K0VA 3L6GA 2Y7KA 3TODA 2QL3A 1ZBMA 2Q8JA 1AL3A 3BKIB 4LZ7A 1PB8A 2V93A 2Y7PA 1A7LA 1MY1A 3TEPA 1EZPA 1B1HA 1S50A 2ZYOA 3R26A 3HCQA 5CM6A 3K01A 3K1PA 4NTLA 1DPPA 1LSTA 2UVIA 2GHAA 4L17A 4F19A 3EF7A 2I4CA 1ZLQA 4HTGA 3SEYA 4BLAA 4KCDA 3MP6A 3K6XA 3SEVA 3WAEA 1B5IA 2OCUA 3CVGA 3H4ZA 3IO4A 3PU5A 3Q29A 3TUSA 3BBRA 5AA2B 1QKBA 4R2BA 1B58A 1BTJA 1SW5A 4GFRA 4LZ5A 1N3WA 3MVYA 3TTKA 1NH7A 4MLVA 3LSXA 4G8NA 2GHBA 2O69A 3C35A 5I2NB 4FAJA 3O29A 4GQOA 4XKNA 2THIA 4OYVA 3TTMA 4N13A 1SYHA 1P1NA 3TPAA 1GTKA 1R9LA 3QXMA 2R6GE 2DXYA 3OENA 1UTBA 3E4RA 4PFYA 3JV9A 1P1OA 3DP6A 4QFNA 5BWJA 2O1MA 3QSLA 1M5EA 4IO2A 4F22A 3O6GA 3CI8A 1ELJA 1EZ9A 4NWDA 1VR5A 1NL5A 3S2VA 4F18A 1AIVA 1URSA 4BDMA 2H99A 3MVWA 4PFUA 3FJ7A 4RJZA 4QRZA 2ZNUA 2Q89A 4NF5B 3IJXB 4POXA 4YKIA 4JWXA 3TELA 4ELRA 3IB1A 4NF6A 1IXIA 1MPBA 1B4HA 4R6HA 2O84X 4BDQA 1P1QA 3MZBA 1UIVA 4RA1A 1RKMA 3MUQA 3CSGA 2DOJA 3KJ7A 2XXIA 4IY6A 1MQHA 4G8HA 4EXLA 1IQ7A 2O6AA 3TFLA 4QHQA 1Y3PA 1N3XA 1USYE 2Q2CA 1D9VA 1QUKA 1PB9A 5TPAA 1MY0A 3M3FA 4I8CA 1JW5A 5FTIA 1US5A 2D3IA 3C32A 4F3SA 2XD3A 1O7TA 2DWIA 5CMKA 1IUDA 4RK9A 1Z7NE 4YU0A 1PBQA 3W9WA 3IB0A 4QSEA 3VXBA 3PPRA 4YKJA 1B3GA 4JB7A 2QRYA 4OERA 3LC8A 4KPTA 1OLCA 3IO6A 3BFUA 3K00A 3C31A 1PB7A 2RKMA 1UTHB 1L5TA 2GRVA 3VLUA 4YB6A 2Z8DA 3MAMA 3CFZA 1FTOA 4H5FA 5H8QA 3ODBA 3LSWA 2RC9A 3OO6A 4GL8A 2VD2A 3S9EA 3G3GA 2H98A 2ZYNA 1IXGA 2P1SA 3CFLA 2FNCA 2I6EA 1MRPA 4XIGQ 5KCJB 2NVUB 4F1UA 3O6HA 5DVJA 2B65A 1B3LA 1B0LA 3FVNA 1TFAA 3V89B 2O51A 2UYEA 3VFJA 1NNTA 1SW2A 2DE2A 4GL0A 2CMOA 3JYRA 3AXFA 4NF8B 2HQ0A 1IITA 1GVCA 3FUZA 4G68C 1MS7A 3KOSA 1CB6A 3T9UA 3G7WA 1FTMA 4ISUA 2HZKA 3KN3A 3KJTA 1MPCA 5I57B 1MQGA 1NNPA 4LONB 5JTYA 1OQHA 4FIMA 4OENA 1B7UA 5LOMA 1JQFA 4KYSA 4JBZA 1A8EA 1BP5A 3MPLA 2I49A 2REGA 5KDTB 2NWJA 3KFMA 1RYOA 4N6PA 4HCYA 4F1YA 4OQOA 1Y9UA 2OZZA 4P11A 1MH4A 1N76A 3Q28A 3W9VA 1HSEA 3CG3A 4TQUQ 4F39A 4FATA 1XS5A 5ISUA 1S9TA 2I0CA 4GOTA 5H8HB 2Y7IA 2QS3A 2IEEA 3CR9A 3U92A 5HPQA 3M3LA 3TCFA 2AL5A 3DLNA 4WKMA 4YKPA 3KG2A 1IXCA 4ZZEA 3IORA 4IGRA 5ITPA 3C34A 4EQ7A 2V25A 3N5LA 1T0KA 4ZZAA 3O2AA 5DEXA 1Y3QA 4TLLB 2QS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ANJ A;  1FW0 A;  1URG A;  3LBS A;  4RNS A;  3T9V A;  5AA4 B;  3PPO A;  2DXR A;  4YB7 A;  3MZ1 A;  1MY4 A;  4KI0 E;  3D4G A;  3IOV A;  4QF9 A;  4IY5 A;  3U1O A;  1I6B A;  1GV8 A;  3C33 A;  3GXA A;  4WEP A;  4C0R A;  3E3K A;  3O28 A;  4O3A A;  4ZDM A;  2DE3 A;  4YB5 A;  1NMU A;  4E0X A;  1PBP A;  4MFI A;  3U72 A;  5H8N B;  3H6W A;  2XX8 A;  4QFP A;  2ABH A;  5F1Q A;  2WKY A;  2E1S A;  3E13 X;  5CMC A;  3FVK A;  1FQD A;  4X48 A;  3Q25 A;  4HCW A;  4PET A;  2DVC A;  3PMW A;  2OLB A;  5AA2 A;  4ESW A;  4JWO A;  3SET A;  3H06 B;  3RN8 A;  1H45 A;  3K1N A;  4U4S A;  2H5Y A;  1RYX A;  4Q5T A;  1NNF A;  4X1B A;  5I2N A;  3TQL A;  2ZNS A;  4ONY A;  2V84 A;  3VXC A;  1PDA A;  2Z23 A;  5I59 B;  4P0G A;  4EUO A;  3B7D A;  3A3C A;  1UIU A;  2PMS A;  3FJM A;  3I5O A;  1BLF A;  1GGG A;  1BIY A;  1DSN A;  2GH9 A;  1Y3N A;  3C4M A;  1QW0 A;  4IO4 A;  1QJM A;  2D5W A;  3OD7 A;  2KLF A;  2F7B A;  4H6D A;  4G8M A;  1N7X A;  3S4U A;  3RTW B;  5L9O A;  4BDR A;  4RPO A;  1LAF E;  3TZA A;  4X1D A;  3MPK A;  1QVS A;  4GXS B;  2NXO A;  3MP8 A;  1VFE A;  1MH3 A;  3EN3 A;  4DXB A;  2ONK E;  3FV1 A;  3UGW A;  4F29 A;  4I1D A;  4DCX A;  1A8F A;  1BKA A;  1LAH E;  3K4U A;  5CRY A;  3Q26 A;  4QFO A;  1LCT A;  4DCY A;  2XXY A;  3RQT A;  4NF5 A;  2DWJ A;  4H1X A;  2REJ A;  1B1X A;  4U23 A;  3FD3 A;  5JK4 A;  3G3F A;  2CZL A;  2FYI A;  4ZED A;  3VV5 A;  4G68 B;  1B32 A;  3K2D A;  3OO8 A;  2ALU A;  3QIM A;  2RF1 A;  1LB8 A;  1OVB A;  3MVX A;  3MBP A;  3C9H A;  1H3D A;  3BFT A;  4LQ2 A;  1SD3 A;  4R9F A;  1AH5 A;  1M5D A;  5ELV A;  2H25 A;  1OIB A;  4NWC A;  3IL1 B;  3R6U A;  4KD5 A;  2PX1 A;  2YJP A;  3MZ9 A;  4OEV A;  1FQF A;  3GBB A;  5K2X A;  4I9D A;  1MDP 1;  3K6V A;  1B5H A;  5KZT A;  4FOR A;  4F1V A;  2I4B A;  5IAI A;  2RC8 A;  4KHZ E;  4KFQ A;  3LSF B;  3VLV A;  1ATG A;  3B6W A;  4R6K A;  3MQ9 A;  4R74 A;  1MM6 A;  2XXX A;  4F3B A;  1N7W A;  2XXU A;  4FED A;  4R9G A;  1TFD A;  1MXU A;  4UA8 A;  1FQB A;  2GFE A;  2V3U A;  1UTH A;  4RY1 A;  1HSL A;  1XVY A;  2NOO A;  3CRB A;  5I2K B;  4OMB A;  3PUW E;  3ZKK A;  1J1N A;  2PT1 A;  4RYA A;  4R73 A;  4IGT A;  2XXW A;  1JET A;  2I0B A;  4NED A;  1B7H A;  5KCJ A;  1CE2 A;  3THI A;  1WDN A;  4OVJ A;  5A5X B;  4EXK A;  1MXX A;  4U22 A;  1XHY A;  3RT6 B;  3PPP A;  3MWB A;  5I58 B;  3HHF A;  1B9J A;  4FJP A;  1FQE A;  4H67 A;  1MPD A;  2Y7R A;  1MDQ A;  2UYF A;  1S7Y A;  4NF8 A;  5TP9 B;  3PMX A;  4GF8 A;  3DP4 A;  5ICQ A;  1MXY A;  2M8C A;  3ILU B;  4U21 A;  5B70 A;  1EU8 A;  3H03 A;  1VSO A;  1YTV A;  4JSO A;  1A99 A;  5I57 A;  3FXR A;  3PUZ E;  3KOT A;  1LLS A;  3ZKL A;  3A3U A;  3VVF A;  3TDJ A;  1LAX A;  1FTJ A;  3TMG A;  3OEM A;  3RLF E;  5KDT A;  3OSQ A;  3M3K A;  2B3B A;  3N6U A;  2A5T B;  4OFJ A;  3PUY E;  5CMB A;  1A55 A;  3G3K A;  1Y1M A;  5H8H A;  4DZ1 A;  3U8Q A;  2VD3 A;  1QUL A;  2D21 A;  3LR1 A;  3O97 A;  1M5B A;  1KWH A;  4ZEC A;  3FVG A;  3KZG A;  4Q30 B;  1B46 A;  3PD8 A;  3E9X A;  1SQY A;  4UAC A;  2B3F A;  2HXW A;  3OSR A;  1YPN A;  2XXT A;  3SKP A;  3EPE A;  4U1Z A;  1AOV A;  4F2O A;  4R72 A;  1MQD A;  3HHG A;  3KGC A;  1TXF A;  1P1U A;  3ZSF A;  5AA4 A;  1FQA A;  1ZU0 A;  1DOT A;  1OLA A;  3PPN A;  3B6T A;  2QMX A;  3SEX A;  2HCA A;  2QMW A;  2A5S A;  2XXQ A;  2QS4 A;  1Q1K A;  4OFO A;  1I6A A;  2ZYM A;  3F11 A;  2VOZ A;  2OWS A;  1B7Z A;  3QUF A;  4LVQ A;  5H8N A;  3WAF A;  3OOA A;  4ZEB A;  1AMF A;  1JEV A;  5K2Y A;  3IK6 B;  3OMB A;  1B3E A;  2XX9 A;  5DT6 A;  4R6Y A;  4OTE A;  1I69 A;  2X26 A;  3CG1 A;  3K6W A;  1ZMG A;  1D3K A;  3TTN A;  3T93 B;  4R75 A;  4EQB A;  1B6H A;  1H43 A;  4BDO A;  5HM4 B;  5I56 B;  1NKX A;  3SEW A;  3IB2 A;  2OK2 A;  2Z8E A;  1SI0 A;  3RGY A;  5DVF A;  5FHO A;  3VLW A;  3SEU A;  2UXA A;  5AA2 D;  5B7D A;  1GR2 A;  1I6Q A;  5I59 A;  3RPW A;  3IJO B;  3V5A A;  3O6I A;  1P1W A;  5HBC A;  4NF4 B;  4RXL A;  3OO9 A;  2UVJ A;  1EH3 A;  4ZE9 A;  3FGS A;  3HST A;  1D9Y A;  3CSB A;  4ZEI A;  1FTL A;  2UVH A;  4POW A;  4XXU A;  1MXZ A;  1B4Z A;  2O68 A;  2ONS A;  3VE1 B;  2O7I A;  2DQV A;  5TU0 A;  4QSD A;  4X9T A;  4YAH X;  1ZIU A;  1Y1Z A;  4ESX A;  5ICT A;  3CIJ A;  2NUV A;  4DLD A;  3H3G A;  4DIG A;  1R9Q A;  4AB6 A;  3RTF B;  4DDD A;  1R6Z A;  3T96 B;  4DXC A;  4KYE A;  1JNF A;  2V3T A;  1LFH A;  1XT8 A;  3VVE A;  2QJE A;  1US4 A;  4IB2 A;  2P2A A;  3TKD A;  3K02 A;  2DYX A;  3IAZ A;  5DVI A;  3PPQ A;  2IA4 A;  3HN0 A;  1LAG E;  5CBS A;  5AA1 A;  4RK2 A;  2F7C A;  4YZZ A;  3UN6 A;  1PC3 A;  4EF2 A;  4F3P A;  1VFD A;  3D4C A;  4KQP A;  2UVG A;  4LA9 A;  4G68 A;  5CBR A;  1MXV A;  2R9J A;  2HEU A;  1SI1 A;  2O1L A;  4OHN A;  3S9N C;  4MBP A;  4EF1 A;  1IZ1 A;  3KN8 A;  1B2H A;  4IO3 A;  5CC2 A;  4JSD A;  1NFT A;  2OWT A;  2DE4 A;  4IO5 A;  3K6U A;  4H8I A;  1B40 A;  4IO7 A;  4ZEF A;  2AYS A;  3SDF A;  3VVD A;  2ONR A;  3FXU A;  1D4N A;  2DP8 A;  2ZNT A;  4ND9 A;  4BDL A;  4FEB A;  4HW8 A;  2G93 A;  2Q88 A;  2X7Q A;  5CMM A;  3PUX E;  4AQ4 A;  5JEI A;  1POY 1;  1B52 A;  5J1D A;  2RCA A;  1QUI A;  3DEL B;  4MH5 A;  1OMP A;  3G3I A;  5DYH A;  3N94 A;  1B51 A;  1VE4 A;  1FTK A;  4KR5 A;  2ZXT A;  1Y4T A;  2F6G A;  1B0H A;  2YLN A;  5L8D A;  1POT A;  1JVX A;  4OEU A;  4XTC Q;  5DTB A;  4OZ9 A;  2XXP A;  5I2K A;  3RT8 A;  3MVZ A;  3FJG A;  5L9M A;  4GRK A;  1XOC A;  1ZTY A;  5H8S A;  4ZE8 A;  1LFI A;  5H8F B;  2Z22 A;  1H44 A;  4QFK A;  1XC1 A;  4F2Q A;  3DP8 A;  1USY H;  3FXQ A;  3R7X A;  3LUY A;  3MW0 A;  2HFB A;  2QSX A;  5A5X A;  1ANF A;  2RIN A;  1F9B A;  2VGQ A;  2F34 A;  4ECF A;  3IR1 A;  1IXH A;  4OFL A;  2PYY A;  5I58 A;  2F78 A;  5BUU A;  4PQJ A;  1MQJ A;  3U93 A;  3KN7 A;  1N84 A;  2G29 A;  4QSC A;  5TP9 A;  1H76 A;  4FE8 A;  4I62 A;  3RY3 A;  4GWO A;  2OJT A;  4ZEK A;  4HS7 A;  2RC7 A;  5FTH A;  4TLM B;  1LBB A;  3PGF A;  1LFG A;  3OEL A;  2F6P A;  5CI5 A;  3CFX A;  2H4I A;  4YKK A;  2YPN A;  3ZS6 A;  4OES A;  1DTZ A;  3QUJ A;  4AB5 A;  1B05 A;  2I3W A;  3UA8 A;  3FVO A;  1OVT A;  1NH8 A;  1SYI A;  1Q35 A;  2QPQ A;  1YAE A;  3HPI A;  1URD A;  2OBG A;  2A5T A;  1WOD A;  4IO6 A;  2FA7 A;  4WXJ A;  4NMY A;  2X7P A;  3EHS A;  2I48 A;  3RUM A;  4GXA A;  2VP1 A;  2PVU A;  4M1V A;  3USD A;  1NNK A;  3UOR A;  4ELQ A;  3U94 A;  1UTB B;  4FEC A;  1LCF A;  4C1T A;  1DMB A;  3P7I A;  1MQI A;  4O3C A;  1M5C A;  3K1M A;  1M5F A;  1B3F A;  3T9X B;  4Z0I A;  5FHM A;  3O66 A;  2DWA A;  2I3V A;  4ELP A;  2W7Y A;  3TCG A;  5IKB A;  2H9B A;  3V8X B;  1O64 A;  4MF3 A;  1HSJ A;  2ZMB A;  2Q9T A;  4U4X A;  4KYD A;  4H0W A;  3N26 A;  3KSJ A;  1B3H A;  4C1U A;  2LAO A;  3IOU A;  4KCC A;  4NF6 B;  3ECR A;  5AE4 A;  4H65 A;  2F35 A;  1UQW A;  4F31 B;  3UIF A;  5FHN A;  3W15 C;  3S9L C;  1SVX B;  4XKP A;  3KBR A;  3KEI A;  3UK4 A;  2F8D A;  3O9P A;  3EHT A;  3PMV A;  4OXV A;  3GZG A;  2HAU A;  3TTL A;  3I3V A;  2ESN A;  5I56 A;  3MP1 A;  1A40 A;  1JEU A;  1B5J A;  4QFL A;  1IEJ A;  4LQ5 A;  3IOW A;  3GLB A;  4PP0 A;  1Y20 A;  5TPA B;  4PFT A;  1Z7M E;  1JVY A;  5F7V A;  3ILT B;  1QUJ A;  3G3H A;  3T66 A;  1TWY A;  4JWY A;  4DE8 A;  3MJN A;  4GVO A;  4NF4 A;  2DVZ A;  4H8J A;  1MY2 A;  4E0W A;  3V83 A;  3PUV E;  2F5X A;  4ELO A;  4GLI A;  2XXR A;  1N0T A;  4U2R A;  2ZYK A;  4G4P A;  1SW4 A;  4WED A;  5EYF A;  3S9M C;  3TCH A;  2O7U A;  3H7M A;  2DWH A;  1PEB A;  2P0S A;  3KSX A;  2F36 A;  3TTR A;  2XXV A;  2QS2 A;  2F7A A;  4LUB A;  4OWD A;  3HO7 A;  2HZL A;  4YIC A;  3H6T A;  2RCB A;  5EHS A;  2DS9 A;  4YMA A;  4RPN A;  1SBP A;  2Y84 A;  4OET A;  3IX1 A;  5H8Q B;  1MM7 A;  3EQ1 A;  4G77 A;  3VDF A;  3T22 A;  4EDP A;  5I84 A;  3FZV A;  1A54 A;  3B6Q A;  2VHA A;  4GD5 A;  4F3G A;  3EHU A;  4EQ9 A;  3GBA A;  3SER A;  5L9S A;  2Y7W A;  1Y4C A;  3QK6 A;  3C36 A;  3SES A;  1JW1 A;  2PT2 A;  4GIZ A;  1TT1 A;  2F97 A;  4BDN A;  3DM0 A;  2XX7 A;  1XVX A;  1O63 A;  1MY3 A;  4H5G A;  2Z8F A;  3MC2 A;  1FCK A;  2V3Q A;  4Q0C A;  3FV2 A;  1II5 A;  2I58 A;  1ZKB A;  4NE4 A;  1EZO A;  4LAT A;  3T9H B;  4O3B A;  1DTG A;  3RNN A;  4K3F A;  3TAJ A;  4ZS9 A;  4U1O A;  4JDF A;  3JZJ A;  4G2Z A;  2DSF A;  5JTY B;  2XD2 A;  1R1N A;  4N07 A;  4Z7E A;  4P0I A;  4MLQ A;  1SDX A;  3HV1 A;  3H6U A;  4XKQ A;  3OXN A;  4PFW A;  4JXI A;  1N04 A;  2BJJ X;  1ZJL A;  3ONM A;  4TOZ A;  1LB9 A;  3OEK A;  2PBW A;  3PV0 E;  3TQW A;  3IOT A;  1LBC A;  1LGB C;  3PD9 A;  1MG1 A;  3I6V A;  3M8U A;  3H6V A;  4YMB A;  3LSL A;  4PE5 B;  1P99 A;  1JW4 A;  3A09 A;  5AA3 A;  4DXU A;  3Q27 A;  3G3J A;  3QYT A;  4LP2 B;  4XKR A;  3FAT A;  2E0S A;  4M4G A;  1IIW A;  2AIX A;  1MXW A;  2AL4 A;  5EHM A;  3FIR A;  1WVJ A;  3FAS A;  1FQC A;  4R2F A;  3TYH A;  2XXH A;  5DEX B;  3L6H A;  3OO7 A;  2R71 A;  4THI A;  2HAV A;  2Q2A A;  3UP9 A;  5H8F A;  1QKA A;  1SW1 A;  1DPE A;  3N6T A;  3QAX A;  4LZ8 A;  4Q8R A;  1YCJ A;  2XHD A;  5ITO A;  5M2V A;  1OQG A;  3K0V A;  3L6G A;  2Y7K A;  3TOD A;  2QL3 A;  1ZBM A;  2Q8J A;  1AL3 A;  3BKI B;  4LZ7 A;  1PB8 A;  2V93 A;  2Y7P A;  1A7L A;  1MY1 A;  3TEP A;  1EZP A;  1B1H A;  1S50 A;  2ZYO A;  3R26 A;  3HCQ A;  5CM6 A;  3K01 A;  3K1P A;  4NTL A;  1DPP A;  1LST A;  2UVI A;  2GHA A;  4L17 A;  4F19 A;  3EF7 A;  2I4C A;  1ZLQ A;  4HTG A;  3SEY A;  4BLA A;  4KCD A;  3MP6 A;  3K6X A;  3SEV A;  3WAE A;  1B5I A;  2OCU A;  3CVG A;  3H4Z A;  3IO4 A;  3PU5 A;  3Q29 A;  3TUS A;  3BBR A;  5AA2 B;  1QKB A;  4R2B A;  1B58 A;  1BTJ A;  1SW5 A;  4GFR A;  4LZ5 A;  1N3W A;  3MVY A;  3TTK A;  1NH7 A;  4MLV A;  3LSX A;  4G8N A;  2GHB A;  2O69 A;  3C35 A;  5I2N B;  4FAJ A;  3O29 A;  4GQO A;  4XKN A;  2THI A;  4OYV A;  3TTM A;  4N13 A;  1SYH A;  1P1N A;  3TPA A;  1GTK A;  1R9L A;  3QXM A;  2R6G E;  2DXY A;  3OEN A;  1UTB A;  3E4R A;  4PFY A;  3JV9 A;  1P1O A;  3DP6 A;  4QFN A;  5BWJ A;  2O1M A;  3QSL A;  1M5E A;  4IO2 A;  4F22 A;  3O6G A;  3CI8 A;  1ELJ A;  1EZ9 A;  4NWD A;  1VR5 A;  1NL5 A;  3S2V A;  4F18 A;  1AIV A;  1URS A;  4BDM A;  2H99 A;  3MVW A;  4PFU A;  3FJ7 A;  4RJZ A;  4QRZ A;  2ZNU A;  2Q89 A;  4NF5 B;  3IJX B;  4POX A;  4YKI A;  4JWX A;  3TEL A;  4ELR A;  3IB1 A;  4NF6 A;  1IXI A;  1MPB A;  1B4H A;  4R6H A;  2O84 X;  4BDQ A;  1P1Q A;  3MZB A;  1UIV A;  4RA1 A;  1RKM A;  3MUQ A;  3CSG A;  2DOJ A;  3KJ7 A;  2XXI A;  4IY6 A;  1MQH A;  4G8H A;  4EXL A;  1IQ7 A;  2O6A A;  3TFL A;  4QHQ A;  1Y3P A;  1N3X A;  1USY E;  2Q2C A;  1D9V A;  1QUK A;  1PB9 A;  5TPA A;  1MY0 A;  3M3F A;  4I8C A;  1JW5 A;  5FTI A;  1US5 A;  2D3I A;  3C32 A;  4F3S A;  2XD3 A;  1O7T A;  2DWI A;  5CMK A;  1IUD A;  4RK9 A;  1Z7N E;  4YU0 A;  1PBQ A;  3W9W A;  3IB0 A;  4QSE A;  3VXB A;  3PPR A;  4YKJ A;  1B3G A;  4JB7 A;  2QRY A;  4OER A;  3LC8 A;  4KPT A;  1OLC A;  3IO6 A;  3BFU A;  3K00 A;  3C31 A;  1PB7 A;  2RKM A;  1UTH B;  1L5T A;  2GRV A;  3VLU A;  4YB6 A;  2Z8D A;  3MAM A;  3CFZ A;  1FTO A;  4H5F A;  5H8Q A;  3ODB A;  3LSW A;  2RC9 A;  3OO6 A;  4GL8 A;  2VD2 A;  3S9E A;  3G3G A;  2H98 A;  2ZYN A;  1IXG A;  2P1S A;  3CFL A;  2FNC A;  2I6E A;  1MRP A;  4XIG Q;  5KCJ B;  2NVU B;  4F1U A;  3O6H A;  5DVJ A;  2B65 A;  1B3L A;  1B0L A;  3FVN A;  1TFA A;  3V89 B;  2O51 A;  2UYE A;  3VFJ A;  1NNT A;  1SW2 A;  2DE2 A;  4GL0 A;  2CMO A;  3JYR A;  3AXF A;  4NF8 B;  2HQ0 A;  1IIT A;  1GVC A;  3FUZ A;  4G68 C;  1MS7 A;  3KOS A;  1CB6 A;  3T9U A;  3G7W A;  1FTM A;  4ISU A;  2HZK A;  3KN3 A;  3KJT A;  1MPC A;  5I57 B;  1MQG A;  1NNP A;  4LON B;  5JTY A;  1OQH A;  4FIM A;  4OEN A;  1B7U A;  5LOM A;  1JQF A;  4KYS A;  4JBZ A;  1A8E A;  1BP5 A;  3MPL A;  2I49 A;  2REG A;  5KDT B;  2NWJ A;  3KFM A;  1RYO A;  4N6P A;  4HCY A;  4F1Y A;  4OQO A;  1Y9U A;  2OZZ A;  4P11 A;  1MH4 A;  1N76 A;  3Q28 A;  3W9V A;  1HSE A;  3CG3 A;  4TQU Q;  4F39 A;  4FAT A;  1XS5 A;  5ISU A;  1S9T A;  2I0C A;  4GOT A;  5H8H B;  2Y7I A;  2QS3 A;  2IEE A;  3CR9 A;  3U92 A;  5HPQ A;  3M3L A;  3TCF A;  2AL5 A;  3DLN A;  4WKM A;  4YKP A;  3KG2 A;  1IXC A;  4ZZE A;  3IOR A;  4IGR A;  5ITP A;  3C34 A;  4EQ7 A;  2V25 A;  3N5L A;  1T0K A;  4ZZA A;  3O2A A;  5DEX A;  1Y3Q A;  4TLL B;  2QS1 A; 
#chains in the Genus database with same CATH topology
 2ANJ A;  1FW0 A;  1URG A;  3LBS A;  4RNS A;  3T9V A;  2ZZV A;  1LBV A;  5AA4 B;  3PPO A;  1NUX A;  2DXR A;  4PCD A;  4YB7 A;  3MZ1 A;  1MY4 A;  4KI0 E;  3D4G A;  1RDY A;  5LTC A;  3IOV A;  4QF9 A;  5ET7 A;  4IY5 A;  2PCR A;  3U1O A;  1I6B A;  2V4C A;  4O8M A;  1GV8 A;  3C33 A;  3GXA A;  4MX6 A;  4WEP A;  4C0R A;  3E3K A;  4GX4 A;  3O28 A;  4PDH A;  4O3A A;  4ZDM A;  2XWI A;  1IMC A;  2DE3 A;  4YB5 A;  1NMU A;  4E0X A;  1PBP A;  4MFI A;  3U72 A;  5H8N B;  3H6W A;  2XX8 A;  4QFP A;  2ABH A;  5F1Q A;  2WKY A;  2E1S A;  3E13 X;  5CMC A;  4MAG A;  3FVK A;  2F3D A;  1FQD A;  4X48 A;  3Q25 A;  4HCW A;  4PET A;  2DVC A;  3PMW A;  2FIX A;  3PTY A;  2OLB A;  2XWO A;  5AA2 A;  4ESW A;  4P56 A;  2FVZ A;  4JWO A;  4NF0 A;  3SET A;  3H06 B;  3RN8 A;  1H45 A;  3K1N A;  4U4S A;  2H5Y A;  1NI9 A;  1RYX A;  4Q5T A;  3IFC A;  1NNF A;  4X1B A;  5I2N A;  3TQL A;  2ZNS A;  4ONY A;  2V84 A;  3VXC A;  1PDA A;  2Z23 A;  1FJ9 A;  5I59 B;  4P0G A;  4EUO A;  3B7D A;  3A3C A;  1UIU A;  2PMS A;  3FJM A;  3I5O A;  1BLF A;  1GGG A;  1BIY A;  1DSN A;  2GH9 A;  1Y3N A;  3C4M A;  1QW0 A;  4IO4 A;  1QJM A;  2D5W A;  3OD7 A;  2KLF A;  2F7B A;  4H6D A;  4G8M A;  4GBV A;  1N7X A;  4PGN A;  3B50 A;  3S4U A;  3RTW B;  5L9O A;  4BDR A;  2WBB A;  4RPO A;  1LAF E;  3TZA A;  2JJK A;  3KBZ A;  4X1D A;  3MPK A;  1KA1 A;  1QVS A;  1FPG A;  2QVU A;  4GXS B;  2NXO A;  1FBF A;  3E78 A;  3MP8 A;  1VFE A;  1MH3 A;  3EN3 A;  1FPJ A;  2P3V A;  4DXB A;  2ONK E;  3BIH A;  2QFL A;  3FV1 A;  3UGW A;  4F29 A;  4I1D A;  4DCX A;  1A8F A;  1BKA A;  1LAH E;  3K4U A;  5CRY A;  4QXD A;  3Q26 A;  4QFO A;  5EYG A;  1LCT A;  4OVR A;  4DCY A;  4OVP A;  2XXY A;  3RQT A;  4NF5 A;  2DWJ A;  4H1X A;  1NV4 A;  2REJ A;  1B1X A;  4U23 A;  3FD3 A;  5JK4 A;  4H45 A;  3G3F A;  4GBW A;  2CZL A;  2KQZ A;  2FYI A;  4ZED A;  3VV5 A;  4G68 B;  1B32 A;  3K2D A;  3OO8 A;  2ALU A;  3QIM A;  2RF1 A;  2B4M A;  4MHF A;  1LB8 A;  1OVB A;  3MVX A;  4HXV A;  1K9Y A;  3MBP A;  3C9H A;  1H3D A;  3BFT A;  1LEV A;  4LQ2 A;  1SD3 A;  4R9F A;  1AH5 A;  1M5D A;  5EQ8 A;  1EYK A;  5ELV A;  2H25 A;  1OIB A;  2WEF A;  4NWC A;  3IL1 B;  3R6U A;  4KD5 A;  2PX1 A;  2YJP A;  4PAF A;  3MZ9 A;  5LDZ A;  4OEV A;  1FQF A;  3GBB A;  1NV7 A;  5K2X A;  4I9D A;  1MDP 1;  3K6V A;  1B5H A;  5KZT A;  5T3J A;  4FOR A;  4F1V A;  2I4B A;  2OWZ A;  1D9Q A;  5IAI A;  2RC8 A;  4KHZ E;  4KFQ A;  3LSF B;  3VLV A;  1FRP A;  1ATG A;  3B6W A;  4R6K A;  3MQ9 A;  4R74 A;  1MM6 A;  2XXX A;  4F3B A;  3B8B A;  1N7W A;  1NV1 A;  2XXU A;  4FED A;  4R9G A;  1TFD A;  1MXU A;  4UA8 A;  1FQB A;  1RDZ A;  2GFE A;  2FIE A;  2V3U A;  1UTH A;  4RY1 A;  1HSL A;  1XVY A;  2NOO A;  3CRB A;  4P47 A;  5I2K B;  4OMB A;  3PUW E;  3LUZ A;  3ZKK A;  1J1N A;  2L5V A;  2PT1 A;  4RYA A;  4PF6 A;  4R73 A;  4IGT A;  5ET5 A;  2XXW A;  1JET A;  2I0B A;  4HE2 A;  4NED A;  1B7H A;  5KCJ A;  5IZ3 A;  1CE2 A;  3THI A;  1WDN A;  4OVJ A;  5A5X B;  4EXK A;  1MXX A;  4U22 A;  1XHY A;  3RT6 B;  3PPP A;  3MWB A;  5I58 B;  3HHF A;  1B9J A;  4FJP A;  1FQE A;  4MNC A;  4H67 A;  1MPD A;  2Y7R A;  1MDQ A;  2UYF A;  1S7Y A;  4NF8 A;  5TP9 B;  3PMX A;  4GF8 A;  3DP4 A;  5ICQ A;  1MXY A;  2M8C A;  3ILU B;  4U21 A;  5B70 A;  1EU8 A;  3H03 A;  5ESY A;  2ZZW A;  1NV3 A;  1VSO A;  1YTV A;  4JSO A;  1A99 A;  4P9K A;  5I57 A;  3FXR A;  3PUZ E;  3KOT A;  1LLS A;  3ZKL A;  3A3U A;  3VVF A;  3TDJ A;  1LAX A;  1FTJ A;  3TMG A;  3OEM A;  3RLF E;  5KDT A;  3OSQ A;  3M3K A;  2B3B A;  3N6U A;  2A5T B;  4OFJ A;  3PUY E;  5CMB A;  1A55 A;  1LBW A;  3G3K A;  1Y1M A;  1FBP A;  5H8H A;  4DZ1 A;  3U8Q A;  2VD3 A;  1QUL A;  2D21 A;  3LR1 A;  3O97 A;  2QVV A;  1M5B A;  1KWH A;  4ZEC A;  1NUW A;  3FVG A;  3KZG A;  3SZP A;  4Q30 B;  1B46 A;  3PD8 A;  3E9X A;  1DK4 A;  1SQY A;  4UAC A;  2B3F A;  2HXW A;  3OSR A;  4MIJ A;  1YPN A;  2XXT A;  3SKP A;  3EPE A;  1K9Z A;  4U1Z A;  1AOV A;  4F2O A;  4R72 A;  1YYZ A;  1MQD A;  3HHG A;  3KGC A;  1TXF A;  2QVR A;  1P1U A;  1RDX A;  3ROJ A;  3ZSF A;  5AA4 A;  3FXB A;  1FQA A;  1ZU0 A;  1Q9D A;  2HHM A;  1DOT A;  3LV0 A;  1OLA A;  3PPN A;  2HPG A;  3B6T A;  2QMX A;  3SEX A;  2HCA A;  2QMW A;  2A5S A;  2XXQ A;  2QS4 A;  4PFR A;  1Q1K A;  4OFO A;  1I6A A;  2ZYM A;  3F11 A;  2VOZ A;  2OWS A;  1B7Z A;  3QUF A;  1FPI A;  4LVQ A;  1SPI A;  1NUY A;  5H8N A;  3WAF A;  1FSA A;  3OOA A;  4ZEB A;  1AMF A;  1JEV A;  5K2Y A;  3IK6 B;  3OMB A;  1B3E A;  2XX9 A;  5DT6 A;  4NN3 A;  4R6Y A;  4OTE A;  4N4U A;  1I69 A;  2X26 A;  3CG1 A;  3K6W A;  4PAI A;  1ZMG A;  1FPF A;  1D3K A;  3TTN A;  3T93 B;  4R75 A;  4EQB A;  1B6H A;  1H43 A;  4P1E A;  3T1B A;  4BDO A;  4IR8 A;  5HM4 B;  1LBY A;  4I3E A;  5I56 B;  1NKX A;  3SEW A;  3IB2 A;  2OK2 A;  2Z8E A;  1SI0 A;  4NQ8 A;  4PC9 A;  3RGY A;  4I3Y A;  5DVF A;  5FHO A;  3VLW A;  3SEU A;  2UXA A;  5AA2 D;  5B7D A;  1GR2 A;  1I6Q A;  5I59 A;  3RPW A;  3IJO B;  3V5A A;  5IM2 A;  3O6I A;  1P1W A;  1FBG A;  5HBC A;  4NF4 B;  4RXL A;  3OO9 A;  2UVJ A;  1EH3 A;  4ZE9 A;  3T0J A;  3FGS A;  2VPN A;  4HE0 A;  3HST A;  1D9Y A;  3CSB A;  4OVT A;  4ZEI A;  1FTL A;  2UVH A;  4POW A;  4XXU A;  1MXZ A;  4I40 A;  1B4Z A;  2O68 A;  2ONS A;  3VE1 B;  2O7I A;  2DQV A;  5TU0 A;  4QSD A;  4X9T A;  1CNQ A;  4YAH X;  2PFZ A;  1ZIU A;  1Y1Z A;  4ESX A;  5ICT A;  3CHG A;  3CIJ A;  2NUV A;  4DLD A;  3H3G A;  4DIG A;  1R9Q A;  4AB6 A;  3RTF B;  4DDD A;  1R6Z A;  3T96 B;  1G0H A;  4DXC A;  4KYE A;  4MMP A;  5J16 A;  1JNF A;  4GWY A;  2V3T A;  1LFH A;  1XT8 A;  3VVE A;  2QJE A;  1US4 A;  1NV6 A;  4IB2 A;  2P2A A;  3TKD A;  3K02 A;  2DYX A;  3IAZ A;  5DVI A;  3PPQ A;  2IA4 A;  3HN0 A;  1LAG E;  4N8G A;  5CBS A;  5AA1 A;  4RK2 A;  2F7C A;  4YZZ A;  3UN6 A;  1PC3 A;  4EF2 A;  4PFB A;  4F3P A;  1YXI A;  1VFD A;  4N91 A;  4P8B A;  3D4C A;  4KQP A;  2UVG A;  2XXK A;  4LA9 A;  4G68 A;  5CBR A;  5EQ7 A;  1MXV A;  2R9J A;  2HEU A;  1SI1 A;  2O1L A;  4OHN A;  3S9N C;  2DDK A;  4MBP A;  4EF1 A;  1IZ1 A;  3KN8 A;  4GX6 A;  1B2H A;  4IO3 A;  5CC2 A;  4JSD A;  1NFT A;  2OWT A;  2DE4 A;  2Y5L A;  4IO5 A;  3GYY A;  3K6U A;  4H8I A;  2BJI A;  1B40 A;  4IO7 A;  3EKI A;  4ZEF A;  2AYS A;  3SDF A;  3VVD A;  2ONR A;  3FXU A;  1D4N A;  4H46 A;  2CZH A;  2DP8 A;  2ZNT A;  1VDW A;  4ND9 A;  4BDL A;  4O7M A;  4FEB A;  4HW8 A;  2G93 A;  2Q88 A;  2X7Q A;  5CMM A;  3PUX E;  4AQ4 A;  5JEI A;  1POY 1;  4G61 A;  1B52 A;  4GWW A;  5J1D A;  2RCA A;  1QUI A;  3DEL B;  4MH5 A;  1EYI A;  1OMP A;  5IGA A;  3G3I A;  5DYH A;  3N94 A;  1B51 A;  1VE4 A;  1FTK A;  4KR5 A;  2ZXT A;  3RPL B;  4PFI A;  4PDD A;  2PFY A;  1Y4T A;  2F6G A;  1B0H A;  2YLN A;  5L8D A;  1POT A;  1JVX A;  4OEU A;  4XTC Q;  5DTB A;  4OZ9 A;  2XXP A;  5I2K A;  3RT8 A;  3MVZ A;  3FJG A;  5L9M A;  4GRK A;  1BK4 A;  1XOC A;  1ZTY A;  5H8S A;  4ZE8 A;  1LFI A;  5H8F B;  2Z22 A;  1H44 A;  3RYD A;  4QFK A;  1XC1 A;  4F2Q A;  3DP8 A;  1USY H;  3FXQ A;  3R7X A;  3LUY A;  3MW0 A;  2HFB A;  2QSX A;  5A5X A;  2CEX A;  1ANF A;  2RIN A;  4GWX A;  1F9B A;  2VGQ A;  2F34 A;  4ECF A;  3IR1 A;  1IXH A;  4OFL A;  2PYY A;  5I58 A;  3BIG A;  2F78 A;  5BUU A;  4PQJ A;  1MQJ A;  3U93 A;  3KN7 A;  1N84 A;  2G29 A;  2HXR A;  4QSC A;  5TP9 A;  1H76 A;  4FE8 A;  4I62 A;  3RY3 A;  4GWO A;  2OJT A;  4ZEK A;  4HS7 A;  1FBD A;  2RC7 A;  1FJ6 A;  4TLM B;  5FTH A;  1LBB A;  3PGF A;  1LFG A;  3OEL A;  2F6P A;  5CI5 A;  3CFX A;  2H4I A;  4YKK A;  4N81 A;  2YPN A;  3IFA A;  3ZS6 A;  4OES A;  1DTZ A;  3QUJ A;  4AB5 A;  1B05 A;  2I3W A;  3UA8 A;  3FVO A;  1OVT A;  1FPD A;  1NH8 A;  1SYI A;  1Q35 A;  4N17 A;  2QPQ A;  1YAE A;  4XEQ A;  3HPI A;  1URD A;  1IMD A;  2OBG A;  2A5T A;  1WOD A;  4IO6 A;  2FA7 A;  2WYP A;  4WXJ A;  4NMY A;  2X7P A;  3EHS A;  2I48 A;  3RUM A;  4GXA A;  5IZ1 A;  2VP1 A;  4NG7 A;  2PVU A;  4M1V A;  5F24 A;  4OVS A;  3USD A;  5A5L A;  1NNK A;  3UOR A;  4ELQ A;  3U94 A;  1UTB B;  4FEC A;  4GWZ A;  1NV5 A;  1LCF A;  4C1T A;  1FPL A;  1DMB A;  3P7I A;  1MQI A;  4O3C A;  1M5C A;  3K1M A;  1M5F A;  1B3F A;  4X04 A;  3T9X B;  4Z0I A;  5FHM A;  3O66 A;  2DWA A;  2I3V A;  4ELP A;  2W7Y A;  3TCG A;  5IKB A;  1NV0 A;  2H9B A;  2VPO A;  3V8X B;  1O64 A;  4MF3 A;  1HSJ A;  2ZMB A;  1FPE A;  2Q9T A;  4U4X A;  4KYD A;  4H0W A;  3N26 A;  3KSJ A;  1B3H A;  4C1U A;  4MNI A;  2LAO A;  1EYJ A;  3IOU A;  4KCC A;  4NF6 B;  3ECR A;  3NOH A;  5AE4 A;  4P1L A;  4H65 A;  2F35 A;  1UQW A;  4F31 B;  3UIF A;  5FHN A;  3W15 C;  4JVI A;  3S9L C;  1SVX B;  4XKP A;  3KBR A;  4OA4 A;  3KEI A;  3UK4 A;  2F8D A;  3O9P A;  3EHT A;  3PMV A;  4OXV A;  3GZG A;  2HAU A;  3TTL A;  3I3V A;  2ESN A;  5I56 A;  3MP1 A;  1A40 A;  5FBP A;  1JEU A;  1B5J A;  4DI4 B;  1QGX A;  4QFL A;  1IEJ A;  4LQ5 A;  3IOW A;  3GLB A;  4PP0 A;  1Y20 A;  5TPA B;  4PFT A;  1Z7M E;  1JVY A;  5F7V A;  3ILT B;  1QUJ A;  4AS4 A;  2WX9 A;  1FBC A;  3G3H A;  3T66 A;  1TWY A;  4XF5 A;  4JWY A;  4DE8 A;  3MJN A;  4NHB A;  2Q8M A;  4GVO A;  4NF4 A;  2B4L A;  2DVZ A;  4H8J A;  1MY2 A;  4E0W A;  3V83 A;  3PUV E;  2F5X A;  4ELO A;  4GLI A;  2XXR A;  1N0T A;  4U2R A;  2ZYK A;  4FBP A;  5I5P A;  4G4P A;  1SW4 A;  4WED A;  5EYF A;  4N6K A;  3S9M C;  3TCH A;  2O7U A;  2Q74 A;  3H7M A;  2DWH A;  1FBH A;  1PEB A;  2P0S A;  3FBP A;  3KSX A;  2F36 A;  3TTR A;  5ET8 A;  1NV2 A;  2XXV A;  2QS2 A;  2F7A A;  4LUB A;  2GQ1 A;  4OWD A;  1YZ0 A;  2MKZ A;  3HO7 A;  2HZL A;  2Y5K A;  4YIC A;  3H6T A;  2RCB A;  5EHS A;  2DS9 A;  4PGP A;  2KR0 A;  4YMA A;  4RPN A;  4AS5 A;  1SBP A;  2Y84 A;  4OET A;  3IX1 A;  1FTA A;  1MM7 A;  5H8Q B;  3EQ1 A;  4G77 A;  3VDF A;  3T22 A;  4EDP A;  5I84 A;  4OVQ A;  3FZV A;  1A54 A;  4N15 A;  3B6Q A;  2VHA A;  4GD5 A;  4F3G A;  3EHU A;  4EQ9 A;  3GBA A;  3SER A;  5L9S A;  2Y7W A;  2XWV A;  1Y4C A;  3QK6 A;  3C36 A;  3SES A;  5I3S A;  3A29 A;  1JW1 A;  2PT2 A;  4GIZ A;  1TT1 A;  2F97 A;  4BDN A;  3E79 A;  3DM0 A;  4MNP A;  2XX7 A;  1XVX A;  1O63 A;  1MY3 A;  1FBE A;  4H5G A;  2Z8F A;  3MC2 A;  1FCK A;  2V3Q A;  4Q0C A;  3FV2 A;  1II5 A;  2I58 A;  1ZKB A;  4NE4 A;  1EZO A;  4MEV A;  4DI3 D;  4LAT A;  3T9H B;  4O3B A;  1DTG A;  4KXP A;  3RNN A;  4K3F A;  3TAJ A;  4ZS9 A;  4U1O A;  4JDF A;  3JZJ A;  4G2Z A;  4MCO A;  2DSF A;  5JTY B;  3QMF A;  2XD2 A;  4PBH A;  1R1N A;  4N07 A;  4Z7E A;  4P0I A;  4MLQ A;  1SDX A;  3HV1 A;  3D1R A;  3H6U A;  4XKQ A;  1JP4 A;  3MYU A;  3OXN A;  4PFW A;  4JXI A;  1N04 A;  2BJJ X;  1ZJL A;  3ONM A;  4TOZ A;  1LB9 A;  4NX1 A;  3OEK A;  2PBW A;  3PV0 E;  3TQW A;  4GWS A;  3IOT A;  1LBC A;  1LGB C;  3PD9 A;  1MG1 A;  3I6V A;  3M8U A;  2OX3 A;  4O7I A;  3H6V A;  3RPL A;  4YMB A;  2F3B A;  3LSL A;  1IMF A;  4PE5 B;  1P99 A;  1JW4 A;  3A09 A;  4DXU A;  3Q27 A;  3G3J A;  5AA3 A;  3QYT A;  4LP2 B;  3FAT A;  4M4G A;  2E0S A;  4XKR A;  1AWB A;  1IIW A;  2AIX A;  1MXW A;  4NGU A;  2AL4 A;  5EHM A;  3FIR A;  1WVJ A;  3FAS A;  1FQC A;  4R2F A;  3TYH A;  1IME A;  2XXH A;  5DEX B;  1DBZ A;  3L6H A;  4N6D A;  3OO7 A;  2R71 A;  4THI A;  2HAV A;  2Q2A A;  3UP9 A;  5H8F A;  1QKA A;  1SW1 A;  1DPE A;  3N6T A;  3QAX A;  4LZ8 A;  4Q8R A;  1YCJ A;  2XHD A;  5ITO A;  4PBQ A;  2FHY A;  4GX3 A;  5M2V A;  1OQG A;  3KC0 A;  4PAK A;  3K0V A;  3L6G A;  2Y7K A;  3TOD A;  2QL3 A;  1ZBM A;  2Q8J A;  1AL3 A;  3BKI B;  4LZ7 A;  1PB8 A;  2V93 A;  2Y7P A;  1A7L A;  1MY1 A;  3TEP A;  1EZP A;  1B1H A;  4GWU A;  1S50 A;  2ZYO A;  3R26 A;  3HCQ A;  5CM6 A;  3K01 A;  4PTK A;  3K1P A;  4NTL A;  1DPP A;  1LST A;  2UVI A;  3ISP A;  1INP A;  2GHA A;  4L17 A;  4F19 A;  3EF7 A;  2I4C A;  1LBZ A;  1ZLQ A;  4HTG A;  1LBX A;  3SEY A;  4BLA A;  4KCD A;  3MP6 A;  3K6X A;  3SEV A;  3WAE A;  1B5I A;  2OCU A;  3CVG A;  3H4Z A;  3IO4 A;  3PU5 A;  3Q29 A;  3TUS A;  3BBR A;  2CZK A;  5AA2 B;  5EYH A;  1QKB A;  4R2B A;  1B58 A;  1BTJ A;  1SW5 A;  4GFR A;  4LZ5 A;  1N3W A;  3MVY A;  3TTK A;  1NH7 A;  4MLV A;  3LSX A;  4G8N A;  4X8R A;  2GHB A;  2O69 A;  3C35 A;  5I2N B;  4FAJ A;  3O29 A;  4GQO A;  4XKN A;  2THI A;  5IZZ A;  4LN5 A;  4OYV A;  3TTM A;  4HE1 A;  4N13 A;  4UAB A;  1SYH A;  1P1N A;  3TPA A;  1GTK A;  1R9L A;  3QXM A;  2R6G E;  2DXY A;  3OEN A;  2FBP A;  1UTB A;  3KC1 A;  3E4R A;  4PFY A;  3JV9 A;  1P1O A;  3DP6 A;  4QFN A;  5BWJ A;  2O1M A;  3QSL A;  1M5E A;  4IO2 A;  4F22 A;  3O6G A;  3CI8 A;  1ELJ A;  1EZ9 A;  4NWD A;  1VR5 A;  1KZ8 A;  4JVD A;  1NL5 A;  3S2V A;  4F18 A;  2XA5 A;  1AIV A;  1URS A;  4BDM A;  2H99 A;  3MVW A;  4PFU A;  3FJ7 A;  4RJZ A;  4QRZ A;  2ZNU A;  2Q89 A;  4MJO A;  4NF5 B;  3IJX B;  4POX A;  4YKI A;  4JWX A;  1IMB A;  3TEL A;  4ELR A;  3IB1 A;  4NF6 A;  1IXI A;  1MPB A;  4O94 A;  1B4H A;  4R6H A;  2XWK A;  2O84 X;  4BDQ A;  1P1Q A;  3MZB A;  1UIV A;  4RA1 A;  1RKM A;  3MUQ A;  3CSG A;  2DOJ A;  3KJ7 A;  4PE3 A;  2WYK A;  2XXI A;  4IY6 A;  1MQH A;  4G8H A;  4EXL A;  1IQ7 A;  2O6A A;  3TFL A;  4QHQ A;  1Y3P A;  1N3X A;  1USY E;  2Q2C A;  1D9V A;  2P3N A;  1QUK A;  4XFE A;  1PB9 A;  5TPA A;  1MY0 A;  3M3F A;  1DCU A;  4I8C A;  1JW5 A;  5FTI A;  1US5 A;  2D3I A;  3C32 A;  4F3S A;  2XD3 A;  1O7T A;  2DWI A;  5CMK A;  5DW8 A;  1IUD A;  4RK9 A;  1Z7N E;  4YU0 A;  1PBQ A;  3W9W A;  3IB0 A;  4QSE A;  3VXB A;  3PPR A;  4YKJ A;  1B3G A;  4JB7 A;  1FPK A;  2QRY A;  4OER A;  3LC8 A;  4KPT A;  1OLC A;  3IO6 A;  3BFU A;  3K00 A;  1G0I A;  3C31 A;  1PB7 A;  2RKM A;  2R8T A;  1UTH B;  4NAP A;  1L5T A;  2GRV A;  3VLU A;  4YB6 A;  2Z8D A;  3MAM A;  3CFZ A;  1FTO A;  4H5F A;  5H8Q A;  3ODB A;  3LSW A;  2RC9 A;  3OO6 A;  4GL8 A;  2VD2 A;  3S9E A;  3G3G A;  2H98 A;  2ZYN A;  1IXG A;  2P1S A;  3CFL A;  1FPB A;  2FNC A;  2I6E A;  1MRP A;  4XIG Q;  5KCJ B;  2NVU B;  4F1U A;  3O6H A;  5IZ3 B;  5DVJ A;  2B65 A;  1B3L A;  1B0L A;  3FVN A;  1TFA A;  1NUZ A;  3V89 B;  2O51 A;  2UYE A;  3VFJ A;  5EQA A;  1NNT A;  3U65 A;  1SW2 A;  2DE2 A;  4GL0 A;  5I7I A;  2CMO A;  3JYR A;  3AXF A;  4NF8 B;  2HQ0 A;  1IIT A;  1GVC A;  3FUZ A;  4G68 C;  5ET6 A;  1MS7 A;  5EQ9 A;  1KA0 A;  3KOS A;  3HFU A;  4OAN A;  1CB6 A;  3T9U A;  3G7W A;  1FTM A;  4ISU A;  2HZK A;  3KN3 A;  4P3L A;  3KJT A;  1MPC A;  5I57 B;  1MQG A;  1NNP A;  4LON B;  5JTY A;  1OQH A;  4FIM A;  4OEN A;  1B7U A;  5LOM A;  1JQF A;  4KYS A;  4JBZ A;  1A8E A;  1BP5 A;  3MPL A;  2I49 A;  2REG A;  5KDT B;  2NWJ A;  3KFM A;  1RYO A;  4N6P A;  2VT5 A;  4HCY A;  4F1Y A;  4OQO A;  1Y9U A;  2OZZ A;  4P11 A;  1MH4 A;  1N76 A;  2CEY A;  3Q28 A;  3W9V A;  1HSE A;  4TQU Q;  3CG3 A;  4F39 A;  4FAT A;  1XS5 A;  5ISU A;  1S9T A;  2I0C A;  4GOT A;  5H8H B;  4PF8 A;  2Y7I A;  1XI6 A;  2QS3 A;  2IEE A;  3CR9 A;  3U92 A;  5HPQ A;  3M3L A;  3TCF A;  2AL5 A;  3DLN A;  4WKM A;  4YKP A;  3KG2 A;  1IXC A;  3MST A;  4N8Y A;  2ZZX A;  4ZZE A;  3IOR A;  4IGR A;  5ITP A;  4JVC A;  3C34 A;  4EQ7 A;  2WBD A;  2V25 A;  3N5L A;  1T0K A;  4ZZA A;  3O2A A;  1IMA A;  5DEX A;  1Y3Q A;  4QBA A;  4TLL B;  2CZI A;  2QS1 A; 
#chains in the Genus database with same CATH homology
 2ANJ A;  1FW0 A;  1URG A;  3LBS A;  4RNS A;  3T9V A;  5AA4 B;  3PPO A;  2DXR A;  4YB7 A;  3MZ1 A;  1MY4 A;  4KI0 E;  3D4G A;  3IOV A;  4QF9 A;  4IY5 A;  3U1O A;  1I6B A;  1GV8 A;  3C33 A;  3GXA A;  4WEP A;  4C0R A;  3E3K A;  3O28 A;  4O3A A;  4ZDM A;  2DE3 A;  4YB5 A;  1NMU A;  4E0X A;  1PBP A;  4MFI A;  3U72 A;  5H8N B;  3H6W A;  2XX8 A;  4QFP A;  2ABH A;  5F1Q A;  2WKY A;  2E1S A;  3E13 X;  5CMC A;  3FVK A;  1FQD A;  4X48 A;  3Q25 A;  4HCW A;  4PET A;  2DVC A;  3PMW A;  2OLB A;  5AA2 A;  4ESW A;  4JWO A;  3SET A;  3H06 B;  3RN8 A;  1H45 A;  3K1N A;  4U4S A;  2H5Y A;  1RYX A;  4Q5T A;  1NNF A;  4X1B A;  5I2N A;  3TQL A;  2ZNS A;  4ONY A;  2V84 A;  3VXC A;  1PDA A;  2Z23 A;  5I59 B;  4P0G A;  4EUO A;  3B7D A;  3A3C A;  1UIU A;  2PMS A;  3FJM A;  3I5O A;  1BLF A;  1GGG A;  1BIY A;  1DSN A;  2GH9 A;  1Y3N A;  3C4M A;  1QW0 A;  4IO4 A;  1QJM A;  2D5W A;  3OD7 A;  2KLF A;  2F7B A;  4H6D A;  4G8M A;  1N7X A;  3S4U A;  3RTW B;  5L9O A;  4BDR A;  4RPO A;  1LAF E;  3TZA A;  4X1D A;  3MPK A;  1QVS A;  4GXS B;  2NXO A;  3MP8 A;  1VFE A;  1MH3 A;  3EN3 A;  4DXB A;  2ONK E;  3FV1 A;  3UGW A;  4F29 A;  4I1D A;  4DCX A;  1A8F A;  1BKA A;  1LAH E;  3K4U A;  5CRY A;  3Q26 A;  4QFO A;  1LCT A;  4DCY A;  2XXY A;  3RQT A;  4NF5 A;  2DWJ A;  4H1X A;  2REJ A;  1B1X A;  4U23 A;  3FD3 A;  5JK4 A;  3G3F A;  2CZL A;  2FYI A;  4ZED A;  3VV5 A;  4G68 B;  1B32 A;  3K2D A;  3OO8 A;  2ALU A;  3QIM A;  2RF1 A;  1LB8 A;  1OVB A;  3MVX A;  3MBP A;  3C9H A;  1H3D A;  3BFT A;  4LQ2 A;  1SD3 A;  4R9F A;  1AH5 A;  1M5D A;  5ELV A;  2H25 A;  1OIB A;  4NWC A;  3IL1 B;  3R6U A;  4KD5 A;  2PX1 A;  2YJP A;  3MZ9 A;  4OEV A;  1FQF A;  3GBB A;  5K2X A;  4I9D A;  1MDP 1;  3K6V A;  1B5H A;  5KZT A;  4FOR A;  4F1V A;  2I4B A;  5IAI A;  2RC8 A;  4KHZ E;  4KFQ A;  3LSF B;  3VLV A;  1ATG A;  3B6W A;  4R6K A;  3MQ9 A;  4R74 A;  1MM6 A;  2XXX A;  4F3B A;  1N7W A;  2XXU A;  4FED A;  4R9G A;  1TFD A;  1MXU A;  4UA8 A;  1FQB A;  2GFE A;  2V3U A;  1UTH A;  4RY1 A;  1HSL A;  1XVY A;  2NOO A;  3CRB A;  5I2K B;  4OMB A;  3PUW E;  3ZKK A;  1J1N A;  2PT1 A;  4RYA A;  4R73 A;  4IGT A;  2XXW A;  1JET A;  2I0B A;  4NED A;  1B7H A;  5KCJ A;  1CE2 A;  3THI A;  1WDN A;  4OVJ A;  5A5X B;  4EXK A;  1MXX A;  4U22 A;  1XHY A;  3RT6 B;  3PPP A;  3MWB A;  5I58 B;  3HHF A;  1B9J A;  4FJP A;  1FQE A;  4H67 A;  1MPD A;  2Y7R A;  1MDQ A;  2UYF A;  1S7Y A;  4NF8 A;  5TP9 B;  3PMX A;  4GF8 A;  3DP4 A;  5ICQ A;  1MXY A;  2M8C A;  3ILU B;  4U21 A;  5B70 A;  1EU8 A;  3H03 A;  1VSO A;  1YTV A;  4JSO A;  1A99 A;  5I57 A;  3FXR A;  3PUZ E;  3KOT A;  1LLS A;  3ZKL A;  3A3U A;  3VVF A;  3TDJ A;  1LAX A;  1FTJ A;  3TMG A;  3OEM A;  3RLF E;  5KDT A;  3OSQ A;  3M3K A;  2B3B A;  3N6U A;  2A5T B;  4OFJ A;  3PUY E;  5CMB A;  1A55 A;  3G3K A;  1Y1M A;  5H8H A;  4DZ1 A;  3U8Q A;  2VD3 A;  1QUL A;  2D21 A;  3LR1 A;  3O97 A;  1M5B A;  1KWH A;  4ZEC A;  3FVG A;  3KZG A;  4Q30 B;  1B46 A;  3PD8 A;  3E9X A;  1SQY A;  4UAC A;  2B3F A;  2HXW A;  3OSR A;  1YPN A;  2XXT A;  3SKP A;  3EPE A;  4U1Z A;  1AOV A;  4F2O A;  4R72 A;  1MQD A;  3HHG A;  3KGC A;  1TXF A;  1P1U A;  3ZSF A;  5AA4 A;  1FQA A;  1ZU0 A;  1DOT A;  1OLA A;  3PPN A;  3B6T A;  2QMX A;  3SEX A;  2HCA A;  2QMW A;  2A5S A;  2XXQ A;  2QS4 A;  1Q1K A;  4OFO A;  1I6A A;  2ZYM A;  3F11 A;  2VOZ A;  2OWS A;  1B7Z A;  3QUF A;  4LVQ A;  5H8N A;  3WAF A;  3OOA A;  4ZEB A;  1AMF A;  1JEV A;  5K2Y A;  3IK6 B;  3OMB A;  1B3E A;  2XX9 A;  5DT6 A;  4R6Y A;  4OTE A;  1I69 A;  2X26 A;  3CG1 A;  3K6W A;  1ZMG A;  1D3K A;  3TTN A;  3T93 B;  4R75 A;  4EQB A;  1B6H A;  1H43 A;  4BDO A;  5HM4 B;  5I56 B;  1NKX A;  3SEW A;  3IB2 A;  2OK2 A;  2Z8E A;  1SI0 A;  3RGY A;  5DVF A;  5FHO A;  3VLW A;  3SEU A;  2UXA A;  5AA2 D;  5B7D A;  1GR2 A;  1I6Q A;  5I59 A;  3RPW A;  3IJO B;  3V5A A;  3O6I A;  1P1W A;  5HBC A;  4NF4 B;  4RXL A;  3OO9 A;  2UVJ A;  1EH3 A;  4ZE9 A;  3FGS A;  3HST A;  1D9Y A;  3CSB A;  4ZEI A;  1FTL A;  2UVH A;  4POW A;  4XXU A;  1MXZ A;  1B4Z A;  2O68 A;  2ONS A;  3VE1 B;  2O7I A;  2DQV A;  5TU0 A;  4QSD A;  4X9T A;  4YAH X;  1ZIU A;  1Y1Z A;  4ESX A;  5ICT A;  3CIJ A;  2NUV A;  4DLD A;  3H3G A;  4DIG A;  1R9Q A;  4AB6 A;  3RTF B;  4DDD A;  1R6Z A;  3T96 B;  4DXC A;  4KYE A;  1JNF A;  2V3T A;  1LFH A;  1XT8 A;  3VVE A;  2QJE A;  1US4 A;  4IB2 A;  2P2A A;  3TKD A;  3K02 A;  2DYX A;  3IAZ A;  5DVI A;  3PPQ A;  2IA4 A;  3HN0 A;  1LAG E;  5CBS A;  5AA1 A;  4RK2 A;  2F7C A;  4YZZ A;  3UN6 A;  1PC3 A;  4EF2 A;  4F3P A;  1VFD A;  3D4C A;  4KQP A;  2UVG A;  4LA9 A;  4G68 A;  5CBR A;  1MXV A;  2R9J A;  2HEU A;  1SI1 A;  2O1L A;  4OHN A;  3S9N C;  4MBP A;  4EF1 A;  1IZ1 A;  3KN8 A;  1B2H A;  4IO3 A;  5CC2 A;  4JSD A;  1NFT A;  2OWT A;  2DE4 A;  4IO5 A;  3K6U A;  4H8I A;  1B40 A;  4IO7 A;  4ZEF A;  2AYS A;  3SDF A;  3VVD A;  2ONR A;  3FXU A;  1D4N A;  2DP8 A;  2ZNT A;  4ND9 A;  4BDL A;  4FEB A;  4HW8 A;  2G93 A;  2Q88 A;  2X7Q A;  5CMM A;  3PUX E;  4AQ4 A;  5JEI A;  1POY 1;  1B52 A;  5J1D A;  2RCA A;  1QUI A;  3DEL B;  4MH5 A;  1OMP A;  3G3I A;  5DYH A;  3N94 A;  1B51 A;  1VE4 A;  1FTK A;  4KR5 A;  2ZXT A;  1Y4T A;  2F6G A;  1B0H A;  2YLN A;  5L8D A;  1POT A;  1JVX A;  4OEU A;  4XTC Q;  5DTB A;  4OZ9 A;  2XXP A;  5I2K A;  3RT8 A;  3MVZ A;  3FJG A;  5L9M A;  4GRK A;  1XOC A;  1ZTY A;  5H8S A;  4ZE8 A;  1LFI A;  5H8F B;  2Z22 A;  1H44 A;  4QFK A;  1XC1 A;  4F2Q A;  3DP8 A;  1USY H;  3FXQ A;  3R7X A;  3LUY A;  3MW0 A;  2HFB A;  2QSX A;  5A5X A;  1ANF A;  2RIN A;  1F9B A;  2VGQ A;  2F34 A;  4ECF A;  3IR1 A;  1IXH A;  4OFL A;  2PYY A;  5I58 A;  2F78 A;  5BUU A;  4PQJ A;  1MQJ A;  3U93 A;  3KN7 A;  1N84 A;  2G29 A;  4QSC A;  5TP9 A;  1H76 A;  4FE8 A;  4I62 A;  3RY3 A;  4GWO A;  2OJT A;  4ZEK A;  4HS7 A;  2RC7 A;  5FTH A;  4TLM B;  1LBB A;  3PGF A;  1LFG A;  3OEL A;  2F6P A;  5CI5 A;  3CFX A;  2H4I A;  4YKK A;  2YPN A;  3ZS6 A;  4OES A;  1DTZ A;  3QUJ A;  4AB5 A;  1B05 A;  2I3W A;  3UA8 A;  3FVO A;  1OVT A;  1NH8 A;  1SYI A;  1Q35 A;  2QPQ A;  1YAE A;  3HPI A;  1URD A;  2OBG A;  2A5T A;  1WOD A;  4IO6 A;  2FA7 A;  4WXJ A;  4NMY A;  2X7P A;  3EHS A;  2I48 A;  3RUM A;  4GXA A;  2VP1 A;  2PVU A;  4M1V A;  3USD A;  1NNK A;  3UOR A;  4ELQ A;  3U94 A;  1UTB B;  4FEC A;  1LCF A;  4C1T A;  1DMB A;  3P7I A;  1MQI A;  4O3C A;  1M5C A;  3K1M A;  1M5F A;  1B3F A;  3T9X B;  4Z0I A;  5FHM A;  3O66 A;  2DWA A;  2I3V A;  4ELP A;  2W7Y A;  3TCG A;  5IKB A;  2H9B A;  3V8X B;  1O64 A;  4MF3 A;  1HSJ A;  2ZMB A;  2Q9T A;  4U4X A;  4KYD A;  4H0W A;  3N26 A;  3KSJ A;  1B3H A;  4C1U A;  2LAO A;  3IOU A;  4KCC A;  4NF6 B;  3ECR A;  5AE4 A;  4H65 A;  2F35 A;  1UQW A;  4F31 B;  3UIF A;  5FHN A;  3W15 C;  3S9L C;  1SVX B;  4XKP A;  3KBR A;  3KEI A;  3UK4 A;  2F8D A;  3O9P A;  3EHT A;  3PMV A;  4OXV A;  3GZG A;  2HAU A;  3TTL A;  3I3V A;  2ESN A;  5I56 A;  3MP1 A;  1A40 A;  1JEU A;  1B5J A;  4QFL A;  1IEJ A;  4LQ5 A;  3IOW A;  3GLB A;  4PP0 A;  1Y20 A;  5TPA B;  4PFT A;  1Z7M E;  1JVY A;  5F7V A;  3ILT B;  1QUJ A;  3G3H A;  3T66 A;  1TWY A;  4JWY A;  4DE8 A;  3MJN A;  4GVO A;  4NF4 A;  2DVZ A;  4H8J A;  1MY2 A;  4E0W A;  3V83 A;  3PUV E;  2F5X A;  4ELO A;  4GLI A;  2XXR A;  1N0T A;  4U2R A;  2ZYK A;  4G4P A;  1SW4 A;  4WED A;  5EYF A;  3S9M C;  3TCH A;  2O7U A;  3H7M A;  2DWH A;  1PEB A;  2P0S A;  3KSX A;  2F36 A;  3TTR A;  2XXV A;  2QS2 A;  2F7A A;  4LUB A;  4OWD A;  3HO7 A;  2HZL A;  4YIC A;  3H6T A;  2RCB A;  5EHS A;  2DS9 A;  4YMA A;  4RPN A;  1SBP A;  2Y84 A;  4OET A;  3IX1 A;  5H8Q B;  1MM7 A;  3EQ1 A;  4G77 A;  3VDF A;  3T22 A;  4EDP A;  5I84 A;  3FZV A;  1A54 A;  3B6Q A;  2VHA A;  4GD5 A;  4F3G A;  3EHU A;  4EQ9 A;  3GBA A;  3SER A;  5L9S A;  2Y7W A;  1Y4C A;  3QK6 A;  3C36 A;  3SES A;  1JW1 A;  2PT2 A;  4GIZ A;  1TT1 A;  2F97 A;  4BDN A;  3DM0 A;  2XX7 A;  1XVX A;  1O63 A;  1MY3 A;  4H5G A;  2Z8F A;  3MC2 A;  1FCK A;  2V3Q A;  4Q0C A;  3FV2 A;  1II5 A;  2I58 A;  1ZKB A;  4NE4 A;  1EZO A;  4LAT A;  3T9H B;  4O3B A;  1DTG A;  3RNN A;  4K3F A;  3TAJ A;  4ZS9 A;  4U1O A;  4JDF A;  3JZJ A;  4G2Z A;  2DSF A;  5JTY B;  2XD2 A;  1R1N A;  4N07 A;  4Z7E A;  4P0I A;  4MLQ A;  1SDX A;  3HV1 A;  3H6U A;  4XKQ A;  3OXN A;  4PFW A;  4JXI A;  1N04 A;  2BJJ X;  1ZJL A;  3ONM A;  4TOZ A;  1LB9 A;  3OEK A;  2PBW A;  3PV0 E;  3TQW A;  3IOT A;  1LBC A;  1LGB C;  3PD9 A;  1MG1 A;  3I6V A;  3M8U A;  3H6V A;  4YMB A;  3LSL A;  4PE5 B;  1P99 A;  1JW4 A;  3A09 A;  5AA3 A;  4DXU A;  3Q27 A;  3G3J A;  3QYT A;  4LP2 B;  4XKR A;  3FAT A;  2E0S A;  4M4G A;  1IIW A;  2AIX A;  1MXW A;  2AL4 A;  5EHM A;  3FIR A;  1WVJ A;  3FAS A;  1FQC A;  4R2F A;  3TYH A;  2XXH A;  5DEX B;  3L6H A;  3OO7 A;  2R71 A;  4THI A;  2HAV A;  2Q2A A;  3UP9 A;  5H8F A;  1QKA A;  1SW1 A;  1DPE A;  3N6T A;  3QAX A;  4LZ8 A;  4Q8R A;  1YCJ A;  2XHD A;  5ITO A;  5M2V A;  1OQG A;  3K0V A;  3L6G A;  2Y7K A;  3TOD A;  2QL3 A;  1ZBM A;  2Q8J A;  1AL3 A;  3BKI B;  4LZ7 A;  1PB8 A;  2V93 A;  2Y7P A;  1A7L A;  1MY1 A;  3TEP A;  1EZP A;  1B1H A;  1S50 A;  2ZYO A;  3R26 A;  3HCQ A;  5CM6 A;  3K01 A;  3K1P A;  4NTL A;  1DPP A;  1LST A;  2UVI A;  2GHA A;  4L17 A;  4F19 A;  3EF7 A;  2I4C A;  1ZLQ A;  4HTG A;  3SEY A;  4BLA A;  4KCD A;  3MP6 A;  3K6X A;  3SEV A;  3WAE A;  1B5I A;  2OCU A;  3CVG A;  3H4Z A;  3IO4 A;  3PU5 A;  3Q29 A;  3TUS A;  3BBR A;  5AA2 B;  1QKB A;  4R2B A;  1B58 A;  1BTJ A;  1SW5 A;  4GFR A;  4LZ5 A;  1N3W A;  3MVY A;  3TTK A;  1NH7 A;  4MLV A;  3LSX A;  4G8N A;  2GHB A;  2O69 A;  3C35 A;  5I2N B;  4FAJ A;  3O29 A;  4GQO A;  4XKN A;  2THI A;  4OYV A;  3TTM A;  4N13 A;  1SYH A;  1P1N A;  3TPA A;  1GTK A;  1R9L A;  3QXM A;  2R6G E;  2DXY A;  3OEN A;  1UTB A;  3E4R A;  4PFY A;  3JV9 A;  1P1O A;  3DP6 A;  4QFN A;  5BWJ A;  2O1M A;  3QSL A;  1M5E A;  4IO2 A;  4F22 A;  3O6G A;  3CI8 A;  1ELJ A;  1EZ9 A;  4NWD A;  1VR5 A;  1NL5 A;  3S2V A;  4F18 A;  1AIV A;  1URS A;  4BDM A;  2H99 A;  3MVW A;  4PFU A;  3FJ7 A;  4RJZ A;  4QRZ A;  2ZNU A;  2Q89 A;  4NF5 B;  3IJX B;  4POX A;  4YKI A;  4JWX A;  3TEL A;  4ELR A;  3IB1 A;  4NF6 A;  1IXI A;  1MPB A;  1B4H A;  4R6H A;  2O84 X;  4BDQ A;  1P1Q A;  3MZB A;  1UIV A;  4RA1 A;  1RKM A;  3MUQ A;  3CSG A;  2DOJ A;  3KJ7 A;  2XXI A;  4IY6 A;  1MQH A;  4G8H A;  4EXL A;  1IQ7 A;  2O6A A;  3TFL A;  4QHQ A;  1Y3P A;  1N3X A;  1USY E;  2Q2C A;  1D9V A;  1QUK A;  1PB9 A;  5TPA A;  1MY0 A;  3M3F A;  4I8C A;  1JW5 A;  5FTI A;  1US5 A;  2D3I A;  3C32 A;  4F3S A;  2XD3 A;  1O7T A;  2DWI A;  5CMK A;  1IUD A;  4RK9 A;  1Z7N E;  4YU0 A;  1PBQ A;  3W9W A;  3IB0 A;  4QSE A;  3VXB A;  3PPR A;  4YKJ A;  1B3G A;  4JB7 A;  2QRY A;  4OER A;  3LC8 A;  4KPT A;  1OLC A;  3IO6 A;  3BFU A;  3K00 A;  3C31 A;  1PB7 A;  2RKM A;  1UTH B;  1L5T A;  2GRV A;  3VLU A;  4YB6 A;  2Z8D A;  3MAM A;  3CFZ A;  1FTO A;  4H5F A;  5H8Q A;  3ODB A;  3LSW A;  2RC9 A;  3OO6 A;  4GL8 A;  2VD2 A;  3S9E A;  3G3G A;  2H98 A;  2ZYN A;  1IXG A;  2P1S A;  3CFL A;  2FNC A;  2I6E A;  1MRP A;  4XIG Q;  5KCJ B;  2NVU B;  4F1U A;  3O6H A;  5DVJ A;  2B65 A;  1B3L A;  1B0L A;  3FVN A;  1TFA A;  3V89 B;  2O51 A;  2UYE A;  3VFJ A;  1NNT A;  1SW2 A;  2DE2 A;  4GL0 A;  2CMO A;  3JYR A;  3AXF A;  4NF8 B;  2HQ0 A;  1IIT A;  1GVC A;  3FUZ A;  4G68 C;  1MS7 A;  3KOS A;  1CB6 A;  3T9U A;  3G7W A;  1FTM A;  4ISU A;  2HZK A;  3KN3 A;  3KJT A;  1MPC A;  5I57 B;  1MQG A;  1NNP A;  4LON B;  5JTY A;  1OQH A;  4FIM A;  4OEN A;  1B7U A;  5LOM A;  1JQF A;  4KYS A;  4JBZ A;  1A8E A;  1BP5 A;  3MPL A;  2I49 A;  2REG A;  5KDT B;  2NWJ A;  3KFM A;  1RYO A;  4N6P A;  4HCY A;  4F1Y A;  4OQO A;  1Y9U A;  2OZZ A;  4P11 A;  1MH4 A;  1N76 A;  3Q28 A;  3W9V A;  1HSE A;  3CG3 A;  4TQU Q;  4F39 A;  4FAT A;  1XS5 A;  5ISU A;  1S9T A;  2I0C A;  4GOT A;  5H8H B;  2Y7I A;  2QS3 A;  2IEE A;  3CR9 A;  3U92 A;  5HPQ A;  3M3L A;  3TCF A;  2AL5 A;  3DLN A;  4WKM A;  4YKP A;  3KG2 A;  1IXC A;  4ZZE A;  3IOR A;  4IGR A;  5ITP A;  3C34 A;  4EQ7 A;  2V25 A;  3N5L A;  1T0K A;  4ZZA A;  3O2A A;  5DEX A;  1Y3Q A;  4TLL B;  2QS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...