1QWDA

Crystal structure of a bacterial lipocalin, the blc gene product from e. coli
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
167
structure length
167
Chain Sequence
b'HLESTSLYKKSSSTPPRGVTVVNNFDAKRYLGTWYEIARFDHRFERGLEKVTATYSLRDDGGLNVINKGYNPDRGMWQQSEGKAYFTGAPTRAALKVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISDEVKQEMLAVATREGFDVSKFIWVQQPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane lipoprotein blc
publication title The crystal structure of the Escherichia coli lipocalin Blc suggests a possible role in phospholipid binding
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid binding protein
total genus 43
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08212 Lipocalin_2 Lipocalin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1qwdA00
2W2BA 4Y0RA 4YBPA 1EUOA 2QO4A 2Q9SA 3PH5A 1ERBA 4OS0A 3UEVA 3VG4A 4A8ZA 5HTDA 4MVKA 1IFCA 1NP1A 1QY2A 1X8PA 3BY0A 3U0DA 3VG6A 3CBCA 2FWVA 2QO6A 4R0BA 5LJBA 4HPDA 1ZNGA 4HPAA 2EU7X 3ZQ3A 2MO5A 5HZ6A 3NX2A 2RCQA 4UU2A 3U03A 4Y0QA 1ICNA 2JN3A 1HMTA 2POAA 2HYSA 4QZUA 2PY1A 3I17A 1KQWA 1KT7A 1E02A 3APWA 1FE3A 1L6MA 1DZPA 2G79A 3PECA 5L8OA 3FMZA 5F7GA 3RZYA 2KT4B 1E5PA 5DG4A 1O8VA 2WQ9A 3B2JA 3FENA 3BX8A 3AKMA 1VYGA 3KFFA 4NNSA 4WFUA 2CZUA 1TOWA 1JYJA 1T0VA 4EEJA 3ELZA 3BSZE 5CE4A 1D2UA 5LJKA 2XSTA 1GKAB 4ODDA 4XMDA 5FENA 3WJEA 5F1EA 3UEXA 1FENA 1NGLA 4N7DA 4OS8A 3WJBA 4QGWA 1R0UA 3FLLA 4GE1A 4YMYA 5HTEA 1X8NA 2QM9A 4ZHDA 1OBQA 1ALBA 4XMCA 2AKQA 5DPQA 2QO5A 4ALOA 4DQ4A 4YFQA 3P6DA 2L67A 3STMX 3B2IA 4ORSA 3EYCA 4ORYA 4GRJA 4EFGA 4A60A 4YBUA 1FTPA 2L9CA 1LIEA 1N0SA 3C78X 3FA9A 3L4RA 1OBPA 5HZ9A 1OPBA 1A18A 3BDRA 3FEKA 5HZ5A 1HMSA 2HMBA 4TJZA 5LKFA 3FR2A 3P6FA 1I4UA 2JOZA 3P6HA 4TLJA 1ZNEA 5HCEC 5B29A 1HMRA 2WEWA 5EDCA 1EIOA 1E00A 4GNYA 5HZ8A 1BSOA 2GTFX 3BX7A 4YDAA 5BVQA 5H9KA 5HA1A 1KT5A 1IIUA 3CQNA 2FS7A 1LFOA 3BU1A 3EBWA 2ALLX 5H9AA 3STKA 4YFRA 4ZHGA 2AH7X 1ACDA 1G74A 2FT9A 1KT6A 1RLBE 3FW5A 2NNDA 1BM5A 5LJHA 3B2HA 3GAQA 3JSQA 2RD7C 2A2UA 5K06A 3B2KA 3MVFA 3CMPA 3APXA 2OFMX 1XKIA 5F6ZA 4QYPA 1EPAA 4N7CA 4OMWA 1T8VA 2OVEA 4RUUA 1MVGA 1CBRA 1Z24A 1G7NA 1LPJA 4I3BA 3PEDA 2LKKA 2AMMX 4YDBA 1GXAA 3FIQA 5F58A 1A2DA 2ASNX 3NADA 1EQDA 2RCTA 4GNWA 3WJDA 2G78A 1BWYA 1UREA 2LFOA 3P6CA 4IMNA 4WFVA 2F73A 3K3LA 2FR3A 2R74A 3O2YA 1BBPA 5C0NA 3BU9A 1X89A 3B2LA 3VG3A 2K23A 1EIIA 4LZUA 3G7XA 2P8GA 2ACPX 3F9DA 4ZH9A 5KHPA 1LF7A 4Y0PA 4NLIA 2K62A 3TGAA 4MVLA 3DTQA 2W2FA 3FEPA 3SAOA 4ZFXA 3KFHA 1FEMA 1S44A 5HA0A 1ADLA 2A3FX 1DV9A 3PP6A 1A3YA 1GX8A 4IB8A 2RQ0A 1XCAA 1BRPA 2AT6X 5D45A 1FDQA 2WEXA 2FS6A 2O62A 3WJGA 1X8QA 5KICA 2WWPA 2HZQA 4UU3A 1PBOA 3D97A 4HFOA 1KZXA 2FLJA 1SY0A 1X8OA 2L68A 3IFBA 5D48A 1X8UA 1I04A 2G7BA 4ZCBA 2BLGA 3WVMA 1JJJA 3BS2A 1AQBA 3U9PC 4IAWA 4TKBA 4ALBA 1JV4A 1BEBA 2MM3A 3BRNA 1SY1A 1SXXA 3FA6A 5LJEA 3TGCA 3D95A 1SXYA 2A0AA 3NPOA 5EPQA 2AT8X 1TW4A 3VG2A 5EEDA 5HBSA 3EM0A 2W2AA 1GX9A 1ZNKA 4QYNA 1MDCA 1PEEA 1VYFA 2WQAE 1X71A 4MVIA 4XMEA 1KXOA 1QY0A 4NYQA 2CZTA 4TQ2A 3VG5A 4YKMA 5EDBA 2Q2PA 4AZPA 4A1HA 3STNA 5IO7A 1GT5A 1B8EA 1QFVA 4I9RA 5L8NA 2AT3X 4BQUA 4Y0SA 4YCEA 3OJYC 1NP4A 3KFIA 1O1VA 4IB9A 4YH0A 1JZUA 3HWFA 4ZHCA 2JU7A 1CBSA 5LJCA 1JJXA 1U18A 4NNTA 5D47A 5IO5A 2AT0X 5B27A 4WBKA 4K19A 1YWAA 3HWGA 3FA7A 1HN2A 3AKNA 1D3SA 4I9SA 4GKCA 1QQSA 3NQ9A 4ZHFA 1YP6A 5LJGA 1JBHA 2FRSA 2Q4NA 1IW2A 4DQ3A 3HWDA 2LB6A 5D4AA 5H9LA 3P6EA 1MX7A 2NNEA 4YFPA 1MX8A 2OVDA 1OEKA 3CWKA 3CQRA 1TOUA 1GKAA 1QABE 4HPCA 3T1DA 1SXWA 2HZRA 3ZUIA 2Q39A 5BVTA 2KTDA 3ELXA 4AW8A 1DF3A 2Q2MA 3KZAA 3HK1A 4ARHA 4M6SA 4QGVA 1DZJA 4AZMA 2FTBA 4RUNA 2FR2A 1DC9A 4TKHA 4AZNA 1AELA 1HBQA 4LKPA 3VG7A 5IO6A 4AYHA 2DM5A 3D96A 2R56A 4TNNA 1SY3A 4OMXA 4HPBA 2NP1A 4A1YA 1KGLA 1BRQA 1CRBA 1DZMA 4BOEA 1YWDA 4QGXA 1QG5A 1S7DA 3TF6A 3EBKA 1YP7A 4ORUA 5L8IA 2JU3A 2X45A 3FR4A 3HWEA 1G85A 4YGGA 2CM9A 5HCCC 2AT5X 3F8AA 4XMHA 2OZQA 2R73A 1EXSA 1HQPA 1YWBA 4NLJA 2LBAA 1E06A 1YUPA 2ANSA 3CBSA 3UEUA 3P6GA 3WJFA 1ICMA 2AL0X 2GJ5A 1GGLA 1SA8A 3FR5A 3WBGA 3CR6A 3S26A 1LIFA 1QWDA 4PSQA 2LBVA 1B0OA 4AZQA 1UZ2X 4NP1A 4ORRA 1LIDA 4ORWA 1LKEA 4YGZA 5F6BA 3EMMA 1BJ7A 2XKLA 1OEEA 4CK4A 4IB7A 4AZRA 2L5PA 3O22A 4IMOA 1IKEA 1SXUA 3Q6LA 2X46A 4YGHA 3O19A 3PH6A 1G5WA 3MBTA 1U17A 2HNXA 1YWCA 5AQ6A 2A13A 3I0AA 3NP1A 3WXQA 1CJ5A 4IBAA 5EEEA 2WR6A 1KZWA 2RA6A 4ES7A 1S2PA 3NR3A 2WSJA 5HCDC 1O1UA 3PPTA 4D6AA 1B4MA 4XMFA 1GT1A 1VPRA 4M7MA 4D6BA 1TXLA 5BVSA 1JYDA 3JS1A 4GETA 1RBPA 1KT4A 4KIIA 2OFRX 1EALA 3KQ0A 2GC9A 2MJIA 3BLGA 1IKJA 4XMGA 5HZQA 4IB6A 1ERXA 1EPBA 1GT4A 1ZNLA 2YG2A 1I06A 1KT3A 1ML7A 1IFBA 1ZRYA 2ACOA 3ZUOA 2A2GA 1CBIA 1ZNHA 2CM4A 3APVA 4IAXA 4QAEA 3C77X 1I05A 5HWZA 3FA8A 4YKOA 1A57A 4YCHA 1OPAA 4QZTA 3C76X 5H9NA 4BVMA 1BLRA 1LNMA 3UEWA 5JR8A 4ZH6A 4EXZA 2JU8A 1LIBA 1PM1X 4LZVA 4OS3A 1FELA 5EZ2A 1KOIA 1PMPA 1EW3A 2CBSA 4I3CA 1DFVA 3IA8A 3NX1A 4ZJ0A 1GT3A 1BSYA 3FELA 1MUPA 4ZHHA 1U0XA 4NYRA 2CBRA 2HLVA 5LKEA 2IFBA 1P6PA 2NNQA 1GM6A 4EDEA 1DZKA 4GH7A 1T68X 1SY2A 3TGBA 2E4JA 5HAEA 1KQXA 1ZNDA 1AB0A 3WJCA 2QOSC 4I3DA 2WUTA 1QY1A 1QFTA 5LJDA 3KFGA 5KIDA 1AVGI 1B56A 4ZGUA 1BSQA 5FAZA 1H91A 4AZOA 3NQ3A 4TKJA 5H8TA 1LICA 3TZSA 1CBQA 1OBUA 4ORXA 2OVAA 3DSZA 4ZR2A 1TVQA 1YIVA 5D8JA 1HBPA 5FFHA 4LKTA 3APUA 1OEJA 3FW4A 3QKGA 4O9SA 3RSWA 2N93A
chains in the Genus database with same CATH superfamily
4MVEA 4CSBA 1SLEB 2W2BA 2CAMA 4GJVA 2RTQB 4Y0RA 4YBPA 3VHHA 1EUOA 2QO4A 2Q9SA 3RY1A 3PH5A 1ERBA 4OS0A 3UEVA 3VG4A 4A8ZA 5HTDA 4U8UN 4MVKA 1IFCA 1K3BA 1SWNA 1NP1A 1QY2A 1SREA 1X8PA 3BY0A 5HZQA 2ZAGA 1N4JA 4BX5A 3U0DA 1PBYA 3VG6A 1UYNX 2OL7A 3CBCA 2FWVA 2QO6A 1VWFB 2JMBA 4R0BA 4HPDA 1JMZA 2RTBB 1ZNGA 5LJBA 4HPAA 2EU7X 3ZQ3A 2N93A 4L1NA 1Y55X 2MO5A 5HZ6A 4MEEA 3VU1A 3NX2A 4KC8A 2RCQA 1HQQA 4UU2A 3U03A 4Y0QA 1ICNA 2JN3A 1HMTA 2POAA 2Z4IA 2HYSA 5AJBA 4QZUA 2PY1A 3I17A 3ZW1B 1KQWA 1KT7A 1LELA 1RSUB 1E02A 3APWA 1FE3A 1L6MA 1DZPA 1NDJA 2G79A 2X8TA 3FMZA 3PECA 4O4SA 5F7GA 4Z28A 3RZYA 2KT4B 1E5PA 1VWNB 1SRGA 2IZJA 2OY1O 5DG4A 1Y9TA 1O8VA 2WQ9A 4CPIA 2IZIA 1VWLB 3B2JA 3FENA 1KL5A 2RTIB 3BX8A 1LUQA 3AKMA 2GTLO 3Q34A 1GX3A 1VYGA 3KFFA 4KC7A 2Z4HA 1VWJB 2C1SA 4NNSA 2CZUA 1TOWA 1LCWA 4PJ2A 4WFUA 1JYJA 1T0VA 4EEJA 2HKDA 3ELZA 3BSZE 5CE4A 1D2UA 5LJKA 2XSTA 1FJ1E 1GKAB 1NQMA 4BX6A 3OD9A 4ODDA 1VYOA 4XMGA 4FBRA 4I60A 4XMDA 4Y59A 3WJEA 5FENA 5F1EA 3UEXA 1FENA 1NGLA 4N7DA 4OS8A 3WJBA 1SLFB 1R0UA 4QGWA 3FDCA 4OELA 4YVBA 3FLLA 1VWCB 2IZFB 4GE1A 2IZBA 3WZPA 4ON1A 4YMYA 4O4OA 5HTEA 1SWUA 1X8NA 2JGSA 2QM9A 4ZHDA 5CHKA 1OBQA 1ALBA 4XMCA 2AKQA 3MM0A 5DPQA 4COTA 1MOYA 4GU8A 3SLJA 2QO5A 4ALOA 4DQ4A 5JD2A 4YFQA 2FHLA 2L67A 3P6DA 1JIWI 3STMX 1VWHB 3WYQA 3B2IA 4GD9A 4ORSA 3EYCA 1VWEB 2VFCA 4ORYA 4GRJA 4EFGA 2RTLA 2X8FA 4A60A 4YBUA 1FTPA 2BHVA 1LIEA 2L9CA 1N0SA 3C78X 3FA9A 3L4RA 1OBPA 5HZ9A 1OPBA 1A18A 3BDRA 4QQ1A 3FEKA 4CV7A 5HZ5A 3VHMA 1HMSA 2X8SA 2HMBA 4TJZA 2A5CA 3FR2A 2IZLB 3P6FA 5LKFA 1I4UA 2JOZA 3P6HA 4GDZA 1ZNEA 4TLJA 1N43A 2I5ZO 2GH7A 5HCEC 5B29A 1HMRA 2F01A 2OFBA 2WEWA 3FYFA 5EDCA 1EIOA 1E00A 2RTAA 4GNYA 5HZ8A 1BSOA 3PDFA 2GTFX 3BX7A 4YDAA 5BVQA 5H9KA 3WZNA 5HA1A 1JMXA 1KT5A 1IIUA 2RTGB 2FS7A 1LFOA 2RTKA 3BU1A 2ALLX 3CQNA 3D9WA 3EBWA 2FHNX 3STKA 4YFRA 2AH7X 4ZHGA 1ACDA 1G74A 2FT9A 3SZHA 1KT6A 4NV8A 1RLBE 3EW2A 2BS5A 2NNDA 3FW5A 5FQ7E 1BM5A 1NQNA 3B2HA 3GAQA 5CSEA 3JSQA 5LJHA 2RD7C 2A2UA 5K06A 3WOVA 1LDQA 3B2KA 1HY2A 2QMIA 3CMPA 3APXA 3MVFA 2OFMX 1XKIA 5F6ZA 4QYPA 1EPAA 2OYBO 4N7CA 4OMWA 5CYBA 1T8VA 1HXLA 2OVEA 4RUUA 3SLOA 3RBYA 1LDOA 1MVGA 1Y53X 1CBRA 3RDQA 3ZW2A 2RTDB 1Z24A 3D4RA 1G7NA 1LPJA 4I3BA 3PEDA 2LKKA 1VWMB 2AMMX 2KD2A 2Y32A 3EW1A 1GXAA 4FQBB 3FIQA 4YDBA 5F58A 1A2DA 2ASNX 3NADA 4GGRA 2OY5O 1EQDA 2RCTA 3ZW0A 5IXGA 1SLGB 1LCVA 4GNWA 1SWFA 2G78A 3WJDA 1BWYA 4OKAA 1UREA 2LFOA 3P6CA 4IMNA 4WFVA 2F73A 3K3LA 1VWQB 1UYOX 2FR3A 2R74A 3O2YA 1BBPA 1WUBA 3CKFA 4O4XA 1VWPB 5FQ6E 2A5BA 2RTJA 1X89A 3B2LA 3BU9A 5C0NA 2MHDA 3VG3A 2K23A 1EIIA 4LZUA 3G7XA 2P8GA 2ACPX 2GTLN 3F9DA 4LQZA 4ZH9A 1LF7A 3RE5A 5KHPA 4Y0PA 4NLIA 4BX7B 2K62A 3TGAA 4MVLA 3DTQA 2W2FA 2WPUA 3FEPA 4U8UM 3SAOA 3AEHA 4C5PA 4ZFXA 3KFHA 1FEMA 4O4UA 1S44A 5HA0A 1ADLA 3RDSA 2A3FX 1DV9A 3PP6A 1STRB 1A3YA 1GX8A 4IB8A 3X00A 1SRFA 2RQ0A 1SWOA 4I6SA 1VWKB 5K67A 2BT9A 1XCAA 1BRPA 2IZGB 1SWTA 2AT6X 5D45A 1FDQA 2WEXA 2FS6A 2O62A 3WJGA 1X8QA 2QCBA 5KICA 2OL6O 2WWPA 4MIRA 2HZQA 1SWPA 4UU3A 1VWGB 1PBOA 3D97A 4HFOA 1KZXA 2RTEB 1W4TA 2RTHB 2FLJA 4GGTA 1SY0A 2Y3EA 1HXZA 1X8OA 2L68A 3IFBA 5D48A 1X8UA 1I04A 2G7BA 4ZCBA 3S60A 4GUZA 2BLGA 3T2XA 3T2WA 3WVMA 1JJJA 3BS2A 1AQBA 3U9PC 2Y3FA 4IAWA 4GK9A 3SZIA 3LHNA 1W6FA 4TKBA 4ALBA 1JV4A 3KVNA 4CPHA 1BEBA 2MM3A 3BRNA 5L8OA 1SY1A 1SXXA 3FA6A 3UAQA 5LJEA 3TGCA 1RAVA 3D95A 2IZHB 1SXYA 2OVSA 2VDFA 1SWAA 2A0AA 3NPOA 5EPQA 2FKJA 3PQSA 2AT8X 3VPJE 2UYWA 4JO6A 1TW4A 3V8UA 4DNEA 3VG2A 4Z6JA 5EEDA 1W5RA 3OE3A 5HBSA 3HTYA 2RTOB 3EM0A 4O3ZA 2W2AA 1GX9A 1ZNKA 4GGZA 4QYNA 1MDCA 1PEEA 3RKGA 5B10O 2G8CO 1VYFA 3AUMO 2WQAE 1X71A 4MVIA 1VWOB 4XMEA 1KXOA 1Y0GA 1QY0A 4NYQA 1WBIA 2CZTA 5B11O 4TQ2A 3VG5A 3F6ZB 2C4IA 1PTSA 2FGSA 4YKMA 5EDBA 1SWDA 4Y5DA 1IJ8A 2Q2PA 4AZPA 2G5LA 4A1HA 3STNA 5IO7A 1GT5A 1MEPA 2YMSA 1B8EA 2RTPB 3LV4A 1QFVA 2ZSCA 4I9RA 5L8NA 2AT3X 4BQUA 2FKGA 4Y0SA 3OJYC 4YCEA 1NP4A 3KFIA 2AF5A 1O1VA 1RXHA 4IB9A 4YH0A 1JZUA 3HWFA 2OY8A 4ZHCA 2JU7A 4BX5B 1VWAB 5L3YA 1CBSA 5LJCA 1JJXA 1U18A 5B5GA 4NNTA 5IRAA 5D47A 3SLTA 5IO5A 2AT0X 5B27A 4ML7B 3OBLA 4WBKA 4K19A 1YWAA 3HWGA 3FA7A 3ZW1A 1HN2A 4GZVA 3AKNA 1D3SA 4I9SA 4GKCA 1QQSA 3NQ9A 4O3WA 1JJUA 1SWKA 1SWSA 1SWHA 1I78A 1VWIB 1YP6A 5LJGA 4ZHFA 1JBHA 2FRSA 2Q4NA 1IW2A 4DQ3A 3CKGA 3HWDA 2LB6A 5D4AA 5H9LA 5B2AO 2X55A 3P6EA 1MX7A 2NNEA 2ZAIA 4GDAA 2A8GA 4I95A 4YFPA 4MISA 1MX8A 2OVDA 1OEKA 3CWKA 1NBXA 3N91A 3CQRA 1N9MA 1TOUA 4FGIB 1GKAA 1QABE 4HPCA 3T1DA 1SXWA 3ZUIA 2Q39A 3LTWA 3NBXX 5BVTA 2KTDA 3ELXA 4BGFA 4AW8A 1RSTB 4NW4A 4KT5A 2Q2MA 1AVDA 1DF3A 3RE6A 2IZAA 3KZAA 4BX6B 3HK1A 4ARHA 4M6SA 4QGVA 1SRHA 1SWEA 1DZJA 4AZMA 2FTBA 2MF6A 2FR2A 1SWBA 4RUNA 3ZZVA 1DC9A 4TKHA 4AZNA 1AELA 1HBQA 1SWCA 4LKPA 5AJCA 3VG7A 3ZI8A 4AYHA 3HOLA 5IO6A 2DM5A 3D96A 2R56A 2F09A 2GTLM 2LA7A 4TNNA 1SY3A 1STSB 2BSZA 4INNA 4IRWA 4O3XB 4OMXA 5F2BA 3WYPA 3S5VA 5FQ8E 3T6LA 1SRIA 3WZOA 4HPBA 2NP1A 4A1YA 5IRUA 4CPEA 1BRQA 1CRBA 1DZMA 2OL8O 4BOEA 3E3CA 1YWDA 1KGLA 4QGXA 2BS6A 2IZDB 3EC5A 3VHIA 1QG5A 1S7DA 3TF6A 3EBKA 3HOEA 5B5FA 3QQ2A 1SWJA 1YP7A 4ORUA 5L8IA 1JQPA 2JU3A 2IZEB 4U3QA 4Z2PA 3RDXA 2X45A 3FR4A 3HWEA 1G85A 3P02A 4YGGA 2CM9A 5HCCC 2AT5X 3F8AA 4XMHA 4L3RA 2OZQA 3RY2A 2IZKA 2R73A 1EXSA 1HQPA 1N9YA 1YWBA 4DCBA 4NLJA 4B55A 2LBAA 4CDFA 1E06A 1YUPA 2ANSA 3CBSA 4HWMA 3UEUA 3P6GA 3WJFA 2AVIA 1ICMA 2AL0X 2GJ5A 4KCAA 2M4LA 3RDMA 4O49A 2QOMA 1GGLA 3HPEA 1I9HA 1RXKA 1SA8A 3WZQA 4QRLA 2RTRB 4EQAC 3FR5A 2IZCB 3WBGA 3CR6A 3S26A 1LIFA 1QWDA 4PSQA 2LBVA 2C1QA 3MG5A 1B0OA 4AZQA 1UZ2X 1VWRB 4NP1A 4ORRA 1LIDA 4ORWA 1DF8A 1LKEA 3RDUA 4YGZA 5F6BA 4BCSA 3EMMA 3NQKA 1BJ7A 1Y52X 4JHQA 2XKLA 1EI5A 1OEEA 3RDOA 4CK4A 4IB7A 5B3MO 3SOTA 4AZRA 2L5PA 3O22A 4IMOA 1IKEA 1SXUA 3Q6LA 2X46A 2OF8A 4YGHA 4U8UO 3ZWEA 2X56A 3VGWA 3O19A 3H3IA 3PH6A 4O3YA 1G5WA 3MBTA 1U17A 2HNXA 4ZGFA 1YWCA 5AQ6A 2A13A 3I0AA 3NP1A 4QNIA 4NV7A 3WXQA 3ZW0B 5BYPA 1CJ5A 4IBAA 5EEEA 2WR6A 1KZWA 2RA6A 4ES7A 1S2PA 3NR3A 2MWHA 2WSJA 3RWXA 5HCDC 1SRJA 1O1UA 3PPTA 4D6AA 4OEMA 4XMFA 4Z2OA 1GT1A 1B4MA 1VPRA 4M7MA 4D6BA 4CDEA 4ID2A 1TXLA 4IABA 3GE2A 4WHIA 4BX7A 4BJ8A 5BVSA 1JYDA 3JS1A 4GETA 1RBPA 1KT4A 1AVEA 2RN4A 3MX7A 4KIIA 2VFBA 2OFRX 2KTSA 1EALA 3KQ0A 2GC9A 2MJIA 3BLGA 1E2TA 1IKJA 1Y9LA 2X34A 1MK5A 2RTFB 4IB6A 1ERXA 2JW1A 1EPBA 1GT4A 1ZNLA 2YG2A 1I06A 1KT3A 1ML7A 1MM9A 1VWDB 1IFBA 1ZRYA 2ACOA 2PI3O 2A2GA 2RTCB 1CBIA 1ZNHA 3ZUOA 2CM4A 3APVA 3SZJA 1STPA 3T6FA 4CDCA 1K24A 4U46A 4IAXA 3JQOA 1SWQA 2BC3A 2OFAA 4QAEA 3C77X 1I05A 5HWZA 3FA8A 4YKOA 4CPFA 1A57A 1KL4A 4YCHA 1OPAA 4QZTA 3P24A 3C76X 1SWRA 2RTNB 2X32A 5H9NA 4BVMA 1BLRA 1LNMA 3UEWA 5JR8A 2OF9A 4ZH6A 4EXZA 2JU8A 1LIBA 1KFFA 1PM1X 4LZVA 1FELA 4GJSA 4OS3A 4U9CA 1KOIA 1KL3A 1PMPA 1EW3A 1VWBB 2CBSA 1DFVA 2KW1A 3IA8A 3NX1A 4I3CA 4ZJ0A 1GT3A 1BSYA 3FELA 2DJFA 1SLDB 3S5XA 1MUPA 4ZHHA 1U0XA 4NYRA 2CBRA 5AEOA 3VE1A 2HLVA 5LKEA 2IFBA 1P6PA 2NNQA 1GM6A 1SMPI 4EDEA 4Z27A 1DZKA 4CDDA 4GH7A 1T68X 1SY2A 2OY7A 3PK2A 3TGBA 2E4JA 5HAEA 1KQXA 4FBVA 4CPHB 1ZNDA 1SWLA 1AB0A 3WJCA 2QOSC 4JNJA 4I3DA 1SWGA 1QY1A 2WUTA 1LCZA 1N7YA 1QFTA 5LJDA 4BBOA 3FIDA 3KFGA 4JGLA 5KIDA 2UZ2A 3VE2A 5IRWA 4EKVA 5H9AA 1AVGI 5K68A 1B56A 4ZGUA 5EZ2A 1BSQA 1NC9A 5FAZA 1H91A 3PQUA 3NQ3A 4TKJA 5H8TA 4AZOA 1LICA 4FBOA 1CBQA 3TZSA 1OBUA 1OSPO 4ORXA 2OVAA 3DSZA 4KH8A 2I5VO 1TVQA 1YIVA 5D8JA 1HBPA 2RTMA 4LKTA 4ZR2A 5FFHA 2X4MA 3APUA 4Z2VA 1OEJA 1RXJA 3FW4A 3QKGA 4O9SA 3RSWA 2HZRA 2DJGA
chains in the Genus database with same CATH topology
4MVEA 4CSBA 2W2BA 4Y0RA 4YBPA 1EUOA 2QO4A 2Q9SA 3PH5A 1ERBA 4OS0A 3UEVA 3VG4A 4A8ZA 5HTDA 4U8UN 4MVKA 1IFCA 1NP1A 1QY2A 1X8PA 3BY0A 2ZAGA 3U0DA 3VG6A 3CBCA 2FWVA 2QO6A 2JMBA 4R0BA 5LJBA 4HPDA 1ZNGA 4HPAA 2EU7X 3ZQ3A 4L1NA 2MO5A 5HZ6A 3VU1A 3NX2A 4KC8A 2RCQA 4UU2A 3U03A 4Y0QA 1ICNA 2JN3A 1HMTA 2POAA 2Z4IA 2HYSA 5AJBA 4QZUA 2PY1A 3I17A 3ZW1B 1KQWA 1KT7A 1E02A 3APWA 1FE3A 1L6MA 1DZPA 2G79A 2X8TA 3PECA 3FMZA 4O4SA 5F7GA 5L8OA 3RZYA 2KT4B 1E5PA 5DG4A 1Y9TA 1O8VA 2WQ9A 3B2JA 3FENA 3BX8A 3AKMA 2GTLO 1VYGA 3KFFA 4KC7A 2Z4HA 4NNSA 4PJ2A 4WFUA 2CZUA 1TOWA 1JYJA 1T0VA 4EEJA 3ELZA 3BSZE 5CE4A 1D2UA 5LJKA 2XSTA 1GKAB 3OD9A 4ODDA 4FBRA 4XMDA 5FENA 3WJEA 5F1EA 3UEXA 1FENA 1NGLA 4N7DA 4OS8A 3WJBA 4QGWA 1R0UA 3FLLA 4GE1A 4YMYA 4ON1A 4O4OA 5HTEA 1X8NA 2QM9A 4ZHDA 1OBQA 1ALBA 4XMCA 2AKQA 5DPQA 4COTA 4GU8A 2QO5A 4ALOA 4DQ4A 4YFQA 3P6DA 2L67A 3STMX 1JIWI 3B2IA 4ORSA 3EYCA 4ORYA 4GRJA 4EFGA 2X8FA 4A60A 4YBUA 1FTPA 2BHVA 1LIEA 2L9CA 1N0SA 3C78X 3FA9A 3L4RA 1OBPA 5HZ9A 1OPBA 1A18A 3BDRA 4QQ1A 3FEKA 4CV7A 5HZ5A 1HMSA 2X8SA 2HMBA 4TJZA 5LKFA 3FR2A 3P6FA 1I4UA 2JOZA 3P6HA 4GDZA 1ZNEA 4TLJA 5HCEC 5B29A 1HMRA 2WEWA 3FYFA 5EDCA 1EIOA 1E00A 4GNYA 5HZ8A 1BSOA 2GTFX 3BX7A 4YDAA 5BVQA 5H9KA 5HA1A 1KT5A 1IIUA 3CQNA 2FS7A 1LFOA 3BU1A 3EBWA 2ALLX 5H9AA 3STKA 4YFRA 4ZHGA 2AH7X 1ACDA 1G74A 2FT9A 1KT6A 1RLBE 2BS5A 2NNDA 3FW5A 5FQ7E 1BM5A 5LJHA 3B2HA 3GAQA 3JSQA 2RD7C 2A2UA 5K06A 3WOVA 3B2KA 2QMIA 3MVFA 3CMPA 3APXA 2OFMX 1XKIA 5F6ZA 4QYPA 1EPAA 4N7CA 4OMWA 5CYBA 1T8VA 2OVEA 4RUUA 3RBYA 1MVGA 1CBRA 3ZW2A 1Z24A 3D4RA 1G7NA 1LPJA 4I3BA 3PEDA 2LKKA 2AMMX 2KD2A 4YDBA 1GXAA 4FQBB 3FIQA 5F58A 1A2DA 2ASNX 3NADA 1EQDA 2RCTA 3ZW0A 4GNWA 3WJDA 2G78A 1BWYA 1UREA 2LFOA 3P6CA 4IMNA 4WFVA 2F73A 3K3LA 2FR3A 2R74A 3O2YA 1BBPA 4O4XA 5C0NA 5FQ6E 3BU9A 1X89A 3B2LA 2MHDA 3VG3A 2K23A 1EIIA 4LZUA 3G7XA 2P8GA 2ACPX 2GTLN 3F9DA 4LQZA 4ZH9A 1LF7A 5KHPA 4Y0PA 4NLIA 2K62A 3TGAA 4MVLA 3DTQA 2W2FA 3FEPA 4U8UM 3SAOA 4ZFXA 3KFHA 1FEMA 4O4UA 1S44A 5HA0A 1ADLA 2A3FX 1DV9A 3PP6A 1A3YA 1GX8A 4IB8A 2RQ0A 4I6SA 2BT9A 1XCAA 1BRPA 2AT6X 5D45A 1FDQA 2WEXA 2FS6A 2O62A 3WJGA 1X8QA 5KICA 2WWPA 4MIRA 2HZQA 4UU3A 1PBOA 3D97A 4HFOA 1KZXA 2FLJA 1SY0A 1X8OA 2L68A 3IFBA 5D48A 1X8UA 1I04A 2G7BA 4ZCBA 3S60A 2BLGA 3WVMA 1JJJA 3BS2A 1AQBA 3U9PC 4IAWA 4GK9A 3LHNA 4TKBA 4ALBA 1JV4A 1BEBA 2MM3A 3BRNA 1SY1A 1SXXA 3FA6A 3UAQA 5LJEA 3TGCA 3D95A 1SXYA 2OVSA 2A0AA 3NPOA 5EPQA 3PQSA 2AT8X 3VPJE 1TW4A 3V8UA 3VG2A 5EEDA 5HBSA 3OE3A 3HTYA 3EM0A 4O3ZA 2W2AA 1GX9A 1ZNKA 4QYNA 1MDCA 1PEEA 3RKGA 1VYFA 2WQAE 1X71A 4MVIA 4XMEA 1KXOA 1QY0A 4NYQA 2CZTA 4TQ2A 3VG5A 3F6ZB 4YKMA 5EDBA 2Q2PA 4AZPA 4A1HA 3STNA 5IO7A 1GT5A 2YMSA 1B8EA 3LV4A 1QFVA 4I9RA 5L8NA 2AT3X 4BQUA 4Y0SA 4YCEA 3OJYC 1NP4A 3KFIA 1O1VA 4IB9A 4YH0A 1JZUA 3HWFA 4ZHCA 2JU7A 1CBSA 5LJCA 1JJXA 1U18A 4NNTA 5D47A 5IO5A 2AT0X 5B27A 4ML7B 3OBLA 4WBKA 4K19A 1YWAA 3HWGA 3FA7A 3ZW1A 1HN2A 4GZVA 3AKNA 1D3SA 4I9SA 4GKCA 1QQSA 3NQ9A 4O3WA 4ZHFA 1YP6A 5LJGA 1JBHA 2FRSA 2Q4NA 1IW2A 4DQ3A 3HWDA 2LB6A 5D4AA 5H9LA 3P6EA 1MX7A 2NNEA 2ZAIA 4YFPA 4I95A 4MISA 1MX8A 2OVDA 1OEKA 3CWKA 3N91A 3CQRA 1TOUA 4FGIB 1GKAA 1QABE 4HPCA 3T1DA 1SXWA 2HZRA 3ZUIA 2Q39A 3NBXX 5BVTA 2KTDA 3ELXA 4AW8A 4NW4A 4KT5A 2Q2MA 1DF3A 3KZAA 3HK1A 4ARHA 4M6SA 4QGVA 1DZJA 4AZMA 2FTBA 4RUNA 2FR2A 3ZZVA 1DC9A 4TKHA 4AZNA 1AELA 1HBQA 4LKPA 5AJCA 3VG7A 3ZI8A 4AYHA 5IO6A 3HOLA 2DM5A 3D96A 2R56A 2F09A 2GTLM 2LA7A 4TNNA 1SY3A 4INNA 4O3XB 4OMXA 3S5VA 5FQ8E 4HPBA 2NP1A 4A1YA 1KGLA 1BRQA 1CRBA 1DZMA 4BOEA 3E3CA 1YWDA 4QGXA 2BS6A 1QG5A 1S7DA 3TF6A 3EBKA 3HOEA 1YP7A 4ORUA 5L8IA 2JU3A 4U3QA 2X45A 3FR4A 3HWEA 1G85A 3P02A 4YGGA 2CM9A 5HCCC 2AT5X 3F8AA 4XMHA 4L3RA 2OZQA 2R73A 1EXSA 1HQPA 1YWBA 4NLJA 2LBAA 1E06A 1YUPA 2ANSA 3CBSA 4HWMA 3UEUA 3P6GA 3WJFA 1ICMA 2AL0X 2GJ5A 4KCAA 2M4LA 4O49A 1GGLA 1SA8A 4QRLA 4EQAC 3FR5A 3WBGA 3CR6A 3S26A 1LIFA 1QWDA 4PSQA 2LBVA 1B0OA 4AZQA 1UZ2X 4NP1A 4ORRA 1LIDA 4ORWA 1LKEA 4YGZA 5F6BA 3EMMA 3NQKA 1BJ7A 2XKLA 1EI5A 1OEEA 4CK4A 4IB7A 3SOTA 4AZRA 2L5PA 3O22A 4IMOA 1IKEA 1SXUA 3Q6LA 2X46A 4YGHA 4U8UO 3ZWEA 3O19A 3H3IA 3PH6A 4O3YA 1G5WA 3MBTA 1U17A 2HNXA 4ZGFA 1YWCA 5AQ6A 2A13A 3I0AA 3NP1A 4QNIA 3WXQA 3ZW0B 5BYPA 1CJ5A 4IBAA 5EEEA 2WR6A 1KZWA 2RA6A 4ES7A 1S2PA 3NR3A 2MWHA 2WSJA 3RWXA 5HCDC 1O1UA 3PPTA 4D6AA 1B4MA 4XMFA 1GT1A 1VPRA 4M7MA 4D6BA 4ID2A 1TXLA 4IABA 3GE2A 4WHIA 5BVSA 1JYDA 3JS1A 4GETA 1RBPA 1KT4A 2RN4A 3MX7A 4KIIA 2OFRX 2KTSA 1EALA 3KQ0A 2GC9A 2MJIA 3BLGA 1IKJA 1Y9LA 4XMGA 5HZQA 4IB6A 1ERXA 2JW1A 1EPBA 1GT4A 1ZNLA 2YG2A 1I06A 1KT3A 1ML7A 1IFBA 1ZRYA 2ACOA 3ZUOA 2A2GA 1CBIA 1ZNHA 2CM4A 3APVA 4IAXA 3JQOA 4QAEA 3C77X 1I05A 5HWZA 3FA8A 4YKOA 1A57A 4YCHA 1OPAA 4QZTA 3P24A 3C76X 5H9NA 4BVMA 1BLRA 1LNMA 3UEWA 5JR8A 4ZH6A 4EXZA 2JU8A 1LIBA 1PM1X 4LZVA 4OS3A 1FELA 5EZ2A 4U9CA 1KOIA 1PMPA 1EW3A 2CBSA 4I3CA 1DFVA 2KW1A 3IA8A 3NX1A 4ZJ0A 1GT3A 1BSYA 3FELA 3S5XA 1MUPA 4ZHHA 1U0XA 4NYRA 2CBRA 5AEOA 3VE1A 2HLVA 5LKEA 2IFBA 1P6PA 2NNQA 1GM6A 1SMPI 4EDEA 1DZKA 4GH7A 1T68X 1SY2A 3TGBA 2E4JA 5HAEA 1KQXA 4FBVA 1ZNDA 1AB0A 3WJCA 2QOSC 4I3DA 2WUTA 1QY1A 1QFTA 5LJDA 3KFGA 4JGLA 5KIDA 3VE2A 1AVGI 1B56A 4ZGUA 1BSQA 5FAZA 1H91A 3PQUA 3NQ3A 4TKJA 5H8TA 4AZOA 1LICA 4FBOA 1CBQA 3TZSA 1OBUA 4ORXA 2OVAA 3DSZA 4KH8A 4ZR2A 1TVQA 1YIVA 5D8JA 1HBPA 5FFHA 4LKTA 3APUA 1OEJA 3FW4A 3QKGA 4O9SA 3RSWA 2N93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2B A;  4Y0R A;  4YBP A;  1EUO A;  2QO4 A;  2Q9S A;  3PH5 A;  1ERB A;  4OS0 A;  3UEV A;  3VG4 A;  4A8Z A;  5HTD A;  4MVK A;  1IFC A;  1NP1 A;  1QY2 A;  1X8P A;  3BY0 A;  3U0D A;  3VG6 A;  3CBC A;  2FWV A;  2QO6 A;  4R0B A;  5LJB A;  4HPD A;  1ZNG A;  4HPA A;  2EU7 X;  3ZQ3 A;  2MO5 A;  5HZ6 A;  3NX2 A;  2RCQ A;  4UU2 A;  3U03 A;  4Y0Q A;  1ICN A;  2JN3 A;  1HMT A;  2POA A;  2HYS A;  4QZU A;  2PY1 A;  3I17 A;  1KQW A;  1KT7 A;  1E02 A;  3APW A;  1FE3 A;  1L6M A;  1DZP A;  2G79 A;  3PEC A;  5L8O A;  3FMZ A;  5F7G A;  3RZY A;  2KT4 B;  1E5P A;  5DG4 A;  1O8V A;  2WQ9 A;  3B2J A;  3FEN A;  3BX8 A;  3AKM A;  1VYG A;  3KFF A;  4NNS A;  4WFU A;  2CZU A;  1TOW A;  1JYJ A;  1T0V A;  4EEJ A;  3ELZ A;  3BSZ E;  5CE4 A;  1D2U A;  5LJK A;  2XST A;  1GKA B;  4ODD A;  4XMD A;  5FEN A;  3WJE A;  5F1E A;  3UEX A;  1FEN A;  1NGL A;  4N7D A;  4OS8 A;  3WJB A;  4QGW A;  1R0U A;  3FLL A;  4GE1 A;  4YMY A;  5HTE A;  1X8N A;  2QM9 A;  4ZHD A;  1OBQ A;  1ALB A;  4XMC A;  2AKQ A;  5DPQ A;  2QO5 A;  4ALO A;  4DQ4 A;  4YFQ A;  3P6D A;  2L67 A;  3STM X;  3B2I A;  4ORS A;  3EYC A;  4ORY A;  4GRJ A;  4EFG A;  4A60 A;  4YBU A;  1FTP A;  2L9C A;  1LIE A;  1N0S A;  3C78 X;  3FA9 A;  3L4R A;  1OBP A;  5HZ9 A;  1OPB A;  1A18 A;  3BDR A;  3FEK A;  5HZ5 A;  1HMS A;  2HMB A;  4TJZ A;  5LKF A;  3FR2 A;  3P6F A;  1I4U A;  2JOZ A;  3P6H A;  4TLJ A;  1ZNE A;  5HCE C;  5B29 A;  1HMR A;  2WEW A;  5EDC A;  1EIO A;  1E00 A;  4GNY A;  5HZ8 A;  1BSO A;  2GTF X;  3BX7 A;  4YDA A;  5BVQ A;  5H9K A;  5HA1 A;  1KT5 A;  1IIU A;  3CQN A;  2FS7 A;  1LFO A;  3BU1 A;  3EBW A;  2ALL X;  5H9A A;  3STK A;  4YFR A;  4ZHG A;  2AH7 X;  1ACD A;  1G74 A;  2FT9 A;  1KT6 A;  1RLB E;  3FW5 A;  2NND A;  1BM5 A;  5LJH A;  3B2H A;  3GAQ A;  3JSQ A;  2RD7 C;  2A2U A;  5K06 A;  3B2K A;  3MVF A;  3CMP A;  3APX A;  2OFM X;  1XKI A;  5F6Z A;  4QYP A;  1EPA A;  4N7C A;  4OMW A;  1T8V A;  2OVE A;  4RUU A;  1MVG A;  1CBR A;  1Z24 A;  1G7N A;  1LPJ A;  4I3B A;  3PED A;  2LKK A;  2AMM X;  4YDB A;  1GXA A;  3FIQ A;  5F58 A;  1A2D A;  2ASN X;  3NAD A;  1EQD A;  2RCT A;  4GNW A;  3WJD A;  2G78 A;  1BWY A;  1URE A;  2LFO A;  3P6C A;  4IMN A;  4WFV A;  2F73 A;  3K3L A;  2FR3 A;  2R74 A;  3O2Y A;  1BBP A;  5C0N A;  3BU9 A;  1X89 A;  3B2L A;  3VG3 A;  2K23 A;  1EII A;  4LZU A;  3G7X A;  2P8G A;  2ACP X;  3F9D A;  4ZH9 A;  5KHP A;  1LF7 A;  4Y0P A;  4NLI A;  2K62 A;  3TGA A;  4MVL A;  3DTQ A;  2W2F A;  3FEP A;  3SAO A;  4ZFX A;  3KFH A;  1FEM A;  1S44 A;  5HA0 A;  1ADL A;  2A3F X;  1DV9 A;  3PP6 A;  1A3Y A;  1GX8 A;  4IB8 A;  2RQ0 A;  1XCA A;  1BRP A;  2AT6 X;  5D45 A;  1FDQ A;  2WEX A;  2FS6 A;  2O62 A;  3WJG A;  1X8Q A;  5KIC A;  2WWP A;  2HZQ A;  4UU3 A;  1PBO A;  3D97 A;  4HFO A;  1KZX A;  2FLJ A;  1SY0 A;  1X8O A;  2L68 A;  3IFB A;  5D48 A;  1X8U A;  1I04 A;  2G7B A;  4ZCB A;  2BLG A;  3WVM A;  1JJJ A;  3BS2 A;  1AQB A;  3U9P C;  4IAW A;  4TKB A;  4ALB A;  1JV4 A;  1BEB A;  2MM3 A;  3BRN A;  1SY1 A;  1SXX A;  3FA6 A;  5LJE A;  3TGC A;  3D95 A;  1SXY A;  2A0A A;  3NPO A;  5EPQ A;  2AT8 X;  1TW4 A;  3VG2 A;  5EED A;  5HBS A;  3EM0 A;  2W2A A;  1GX9 A;  1ZNK A;  4QYN A;  1MDC A;  1PEE A;  1VYF A;  2WQA E;  1X71 A;  4MVI A;  4XME A;  1KXO A;  1QY0 A;  4NYQ A;  2CZT A;  4TQ2 A;  3VG5 A;  4YKM A;  5EDB A;  2Q2P A;  4AZP A;  4A1H A;  3STN A;  5IO7 A;  1GT5 A;  1B8E A;  1QFV A;  4I9R A;  5L8N A;  2AT3 X;  4BQU A;  4Y0S A;  4YCE A;  3OJY C;  1NP4 A;  3KFI A;  1O1V A;  4IB9 A;  4YH0 A;  1JZU A;  3HWF A;  4ZHC A;  2JU7 A;  1CBS A;  5LJC A;  1JJX A;  1U18 A;  4NNT A;  5D47 A;  5IO5 A;  2AT0 X;  5B27 A;  4WBK A;  4K19 A;  1YWA A;  3HWG A;  3FA7 A;  1HN2 A;  3AKN A;  1D3S A;  4I9S A;  4GKC A;  1QQS A;  3NQ9 A;  4ZHF A;  1YP6 A;  5LJG A;  1JBH A;  2FRS A;  2Q4N A;  1IW2 A;  4DQ3 A;  3HWD A;  2LB6 A;  5D4A A;  5H9L A;  3P6E A;  1MX7 A;  2NNE A;  4YFP A;  1MX8 A;  2OVD A;  1OEK A;  3CWK A;  3CQR A;  1TOU A;  1GKA A;  1QAB E;  4HPC A;  3T1D A;  1SXW A;  2HZR A;  3ZUI A;  2Q39 A;  5BVT A;  2KTD A;  3ELX A;  4AW8 A;  1DF3 A;  2Q2M A;  3KZA A;  3HK1 A;  4ARH A;  4M6S A;  4QGV A;  1DZJ A;  4AZM A;  2FTB A;  4RUN A;  2FR2 A;  1DC9 A;  4TKH A;  4AZN A;  1AEL A;  1HBQ A;  4LKP A;  3VG7 A;  5IO6 A;  4AYH A;  2DM5 A;  3D96 A;  2R56 A;  4TNN A;  1SY3 A;  4OMX A;  4HPB A;  2NP1 A;  4A1Y A;  1KGL A;  1BRQ A;  1CRB A;  1DZM A;  4BOE A;  1YWD A;  4QGX A;  1QG5 A;  1S7D A;  3TF6 A;  3EBK A;  1YP7 A;  4ORU A;  5L8I A;  2JU3 A;  2X45 A;  3FR4 A;  3HWE A;  1G85 A;  4YGG A;  2CM9 A;  5HCC C;  2AT5 X;  3F8A A;  4XMH A;  2OZQ A;  2R73 A;  1EXS A;  1HQP A;  1YWB A;  4NLJ A;  2LBA A;  1E06 A;  1YUP A;  2ANS A;  3CBS A;  3UEU A;  3P6G A;  3WJF A;  1ICM A;  2AL0 X;  2GJ5 A;  1GGL A;  1SA8 A;  3FR5 A;  3WBG A;  3CR6 A;  3S26 A;  1LIF A;  1QWD A;  4PSQ A;  2LBV A;  1B0O A;  4AZQ A;  1UZ2 X;  4NP1 A;  4ORR A;  1LID A;  4ORW A;  1LKE A;  4YGZ A;  5F6B A;  3EMM A;  1BJ7 A;  2XKL A;  1OEE A;  4CK4 A;  4IB7 A;  4AZR A;  2L5P A;  3O22 A;  4IMO A;  1IKE A;  1SXU A;  3Q6L A;  2X46 A;  4YGH A;  3O19 A;  3PH6 A;  1G5W A;  3MBT A;  1U17 A;  2HNX A;  1YWC A;  5AQ6 A;  2A13 A;  3I0A A;  3NP1 A;  3WXQ A;  1CJ5 A;  4IBA A;  5EEE A;  2WR6 A;  1KZW A;  2RA6 A;  4ES7 A;  1S2P A;  3NR3 A;  2WSJ A;  5HCD C;  1O1U A;  3PPT A;  4D6A A;  1B4M A;  4XMF A;  1GT1 A;  1VPR A;  4M7M A;  4D6B A;  1TXL A;  5BVS A;  1JYD A;  3JS1 A;  4GET A;  1RBP A;  1KT4 A;  4KII A;  2OFR X;  1EAL A;  3KQ0 A;  2GC9 A;  2MJI A;  3BLG A;  1IKJ A;  4XMG A;  5HZQ A;  4IB6 A;  1ERX A;  1EPB A;  1GT4 A;  1ZNL A;  2YG2 A;  1I06 A;  1KT3 A;  1ML7 A;  1IFB A;  1ZRY A;  2ACO A;  3ZUO A;  2A2G A;  1CBI A;  1ZNH A;  2CM4 A;  3APV A;  4IAX A;  4QAE A;  3C77 X;  1I05 A;  5HWZ A;  3FA8 A;  4YKO A;  1A57 A;  4YCH A;  1OPA A;  4QZT A;  3C76 X;  5H9N A;  4BVM A;  1BLR A;  1LNM A;  3UEW A;  5JR8 A;  4ZH6 A;  4EXZ A;  2JU8 A;  1LIB A;  1PM1 X;  4LZV A;  4OS3 A;  1FEL A;  5EZ2 A;  1KOI A;  1PMP A;  1EW3 A;  2CBS A;  4I3C A;  1DFV A;  3IA8 A;  3NX1 A;  4ZJ0 A;  1GT3 A;  1BSY A;  3FEL A;  1MUP A;  4ZHH A;  1U0X A;  4NYR A;  2CBR A;  2HLV A;  5LKE A;  2IFB A;  1P6P A;  2NNQ A;  1GM6 A;  4EDE A;  1DZK A;  4GH7 A;  1T68 X;  1SY2 A;  3TGB A;  2E4J A;  5HAE A;  1KQX A;  1ZND A;  1AB0 A;  3WJC A;  2QOS C;  4I3D A;  2WUT A;  1QY1 A;  1QFT A;  5LJD A;  3KFG A;  5KID A;  1AVG I;  1B56 A;  4ZGU A;  1BSQ A;  5FAZ A;  1H91 A;  4AZO A;  3NQ3 A;  4TKJ A;  5H8T A;  1LIC A;  3TZS A;  1CBQ A;  1OBU A;  4ORX A;  2OVA A;  3DSZ A;  4ZR2 A;  1TVQ A;  1YIV A;  5D8J A;  1HBP A;  5FFH A;  4LKT A;  3APU A;  1OEJ A;  3FW4 A;  3QKG A;  4O9S A;  3RSW A;  2N93 A; 
#chains in the Genus database with same CATH topology
 4MVE A;  4CSB A;  1SLE B;  2W2B A;  2CAM A;  4GJV A;  2RTQ B;  4Y0R A;  4YBP A;  3VHH A;  1EUO A;  2QO4 A;  2Q9S A;  3RY1 A;  3PH5 A;  1ERB A;  4OS0 A;  3UEV A;  3VG4 A;  4A8Z A;  5HTD A;  4U8U N;  4MVK A;  1IFC A;  1K3B A;  1SWN A;  1NP1 A;  1QY2 A;  1SRE A;  1X8P A;  3BY0 A;  5HZQ A;  2ZAG A;  1N4J A;  4BX5 A;  3U0D A;  1PBY A;  3VG6 A;  1UYN X;  2OL7 A;  3CBC A;  2FWV A;  2QO6 A;  1VWF B;  2JMB A;  4R0B A;  4HPD A;  1JMZ A;  2RTB B;  1ZNG A;  5LJB A;  4HPA A;  2EU7 X;  3ZQ3 A;  2N93 A;  4L1N A;  1Y55 X;  2MO5 A;  5HZ6 A;  4MEE A;  3VU1 A;  3NX2 A;  4KC8 A;  2RCQ A;  1HQQ A;  4UU2 A;  3U03 A;  4Y0Q A;  1ICN A;  2JN3 A;  1HMT A;  2POA A;  2Z4I A;  2HYS A;  5AJB A;  4QZU A;  2PY1 A;  3I17 A;  3ZW1 B;  1KQW A;  1KT7 A;  1LEL A;  1RSU B;  1E02 A;  3APW A;  1FE3 A;  1L6M A;  1DZP A;  1NDJ A;  2G79 A;  2X8T A;  3FMZ A;  3PEC A;  4O4S A;  5F7G A;  4Z28 A;  3RZY A;  2KT4 B;  1E5P A;  1VWN B;  1SRG A;  2IZJ A;  2OY1 O;  5DG4 A;  1Y9T A;  1O8V A;  2WQ9 A;  4CPI A;  2IZI A;  1VWL B;  3B2J A;  3FEN A;  1KL5 A;  2RTI B;  3BX8 A;  1LUQ A;  3AKM A;  2GTL O;  3Q34 A;  1GX3 A;  1VYG A;  3KFF A;  4KC7 A;  2Z4H A;  1VWJ B;  2C1S A;  4NNS A;  2CZU A;  1TOW A;  1LCW A;  4PJ2 A;  4WFU A;  1JYJ A;  1T0V A;  4EEJ A;  2HKD A;  3ELZ A;  3BSZ E;  5CE4 A;  1D2U A;  5LJK A;  2XST A;  1FJ1 E;  1GKA B;  1NQM A;  4BX6 A;  3OD9 A;  4ODD A;  1VYO A;  4XMG A;  4FBR A;  4I60 A;  4XMD A;  4Y59 A;  3WJE A;  5FEN A;  5F1E A;  3UEX A;  1FEN A;  1NGL A;  4N7D A;  4OS8 A;  3WJB A;  1SLF B;  1R0U A;  4QGW A;  3FDC A;  4OEL A;  4YVB A;  3FLL A;  1VWC B;  2IZF B;  4GE1 A;  2IZB A;  3WZP A;  4ON1 A;  4YMY A;  4O4O A;  5HTE A;  1SWU A;  1X8N A;  2JGS A;  2QM9 A;  4ZHD A;  5CHK A;  1OBQ A;  1ALB A;  4XMC A;  2AKQ A;  3MM0 A;  5DPQ A;  4COT A;  1MOY A;  4GU8 A;  3SLJ A;  2QO5 A;  4ALO A;  4DQ4 A;  5JD2 A;  4YFQ A;  2FHL A;  2L67 A;  3P6D A;  1JIW I;  3STM X;  1VWH B;  3WYQ A;  3B2I A;  4GD9 A;  4ORS A;  3EYC A;  1VWE B;  2VFC A;  4ORY A;  4GRJ A;  4EFG A;  2RTL A;  2X8F A;  4A60 A;  4YBU A;  1FTP A;  2BHV A;  1LIE A;  2L9C A;  1N0S A;  3C78 X;  3FA9 A;  3L4R A;  1OBP A;  5HZ9 A;  1OPB A;  1A18 A;  3BDR A;  4QQ1 A;  3FEK A;  4CV7 A;  5HZ5 A;  3VHM A;  1HMS A;  2X8S A;  2HMB A;  4TJZ A;  2A5C A;  3FR2 A;  2IZL B;  3P6F A;  5LKF A;  1I4U A;  2JOZ A;  3P6H A;  4GDZ A;  1ZNE A;  4TLJ A;  1N43 A;  2I5Z O;  2GH7 A;  5HCE C;  5B29 A;  1HMR A;  2F01 A;  2OFB A;  2WEW A;  3FYF A;  5EDC A;  1EIO A;  1E00 A;  2RTA A;  4GNY A;  5HZ8 A;  1BSO A;  3PDF A;  2GTF X;  3BX7 A;  4YDA A;  5BVQ A;  5H9K A;  3WZN A;  5HA1 A;  1JMX A;  1KT5 A;  1IIU A;  2RTG B;  2FS7 A;  1LFO A;  2RTK A;  3BU1 A;  2ALL X;  3CQN A;  3D9W A;  3EBW A;  2FHN X;  3STK A;  4YFR A;  2AH7 X;  4ZHG A;  1ACD A;  1G74 A;  2FT9 A;  3SZH A;  1KT6 A;  4NV8 A;  1RLB E;  3EW2 A;  2BS5 A;  2NND A;  3FW5 A;  5FQ7 E;  1BM5 A;  1NQN A;  3B2H A;  3GAQ A;  5CSE A;  3JSQ A;  5LJH A;  2RD7 C;  2A2U A;  5K06 A;  3WOV A;  1LDQ A;  3B2K A;  1HY2 A;  2QMI A;  3CMP A;  3APX A;  3MVF A;  2OFM X;  1XKI A;  5F6Z A;  4QYP A;  1EPA A;  2OYB O;  4N7C A;  4OMW A;  5CYB A;  1T8V A;  1HXL A;  2OVE A;  4RUU A;  3SLO A;  3RBY A;  1LDO A;  1MVG A;  1Y53 X;  1CBR A;  3RDQ A;  3ZW2 A;  2RTD B;  1Z24 A;  3D4R A;  1G7N A;  1LPJ A;  4I3B A;  3PED A;  2LKK A;  1VWM B;  2AMM X;  2KD2 A;  2Y32 A;  3EW1 A;  1GXA A;  4FQB B;  3FIQ A;  4YDB A;  5F58 A;  1A2D A;  2ASN X;  3NAD A;  4GGR A;  2OY5 O;  1EQD A;  2RCT A;  3ZW0 A;  5IXG A;  1SLG B;  1LCV A;  4GNW A;  1SWF A;  2G78 A;  3WJD A;  1BWY A;  4OKA A;  1URE A;  2LFO A;  3P6C A;  4IMN A;  4WFV A;  2F73 A;  3K3L A;  1VWQ B;  1UYO X;  2FR3 A;  2R74 A;  3O2Y A;  1BBP A;  1WUB A;  3CKF A;  4O4X A;  1VWP B;  5FQ6 E;  2A5B A;  2RTJ A;  1X89 A;  3B2L A;  3BU9 A;  5C0N A;  2MHD A;  3VG3 A;  2K23 A;  1EII A;  4LZU A;  3G7X A;  2P8G A;  2ACP X;  2GTL N;  3F9D A;  4LQZ A;  4ZH9 A;  1LF7 A;  3RE5 A;  5KHP A;  4Y0P A;  4NLI A;  4BX7 B;  2K62 A;  3TGA A;  4MVL A;  3DTQ A;  2W2F A;  2WPU A;  3FEP A;  4U8U M;  3SAO A;  3AEH A;  4C5P A;  4ZFX A;  3KFH A;  1FEM A;  4O4U A;  1S44 A;  5HA0 A;  1ADL A;  3RDS A;  2A3F X;  1DV9 A;  3PP6 A;  1STR B;  1A3Y A;  1GX8 A;  4IB8 A;  3X00 A;  1SRF A;  2RQ0 A;  1SWO A;  4I6S A;  1VWK B;  5K67 A;  2BT9 A;  1XCA A;  1BRP A;  2IZG B;  1SWT A;  2AT6 X;  5D45 A;  1FDQ A;  2WEX A;  2FS6 A;  2O62 A;  3WJG A;  1X8Q A;  2QCB A;  5KIC A;  2OL6 O;  2WWP A;  4MIR A;  2HZQ A;  1SWP A;  4UU3 A;  1VWG B;  1PBO A;  3D97 A;  4HFO A;  1KZX A;  2RTE B;  1W4T A;  2RTH B;  2FLJ A;  4GGT A;  1SY0 A;  2Y3E A;  1HXZ A;  1X8O A;  2L68 A;  3IFB A;  5D48 A;  1X8U A;  1I04 A;  2G7B A;  4ZCB A;  3S60 A;  4GUZ A;  2BLG A;  3T2X A;  3T2W A;  3WVM A;  1JJJ A;  3BS2 A;  1AQB A;  3U9P C;  2Y3F A;  4IAW A;  4GK9 A;  3SZI A;  3LHN A;  1W6F A;  4TKB A;  4ALB A;  1JV4 A;  3KVN A;  4CPH A;  1BEB A;  2MM3 A;  3BRN A;  5L8O A;  1SY1 A;  1SXX A;  3FA6 A;  3UAQ A;  5LJE A;  3TGC A;  1RAV A;  3D95 A;  2IZH B;  1SXY A;  2OVS A;  2VDF A;  1SWA A;  2A0A A;  3NPO A;  5EPQ A;  2FKJ A;  3PQS A;  2AT8 X;  3VPJ E;  2UYW A;  4JO6 A;  1TW4 A;  3V8U A;  4DNE A;  3VG2 A;  4Z6J A;  5EED A;  1W5R A;  3OE3 A;  5HBS A;  3HTY A;  2RTO B;  3EM0 A;  4O3Z A;  2W2A A;  1GX9 A;  1ZNK A;  4GGZ A;  4QYN A;  1MDC A;  1PEE A;  3RKG A;  5B10 O;  2G8C O;  1VYF A;  3AUM O;  2WQA E;  1X71 A;  4MVI A;  1VWO B;  4XME A;  1KXO A;  1Y0G A;  1QY0 A;  4NYQ A;  1WBI A;  2CZT A;  5B11 O;  4TQ2 A;  3VG5 A;  3F6Z B;  2C4I A;  1PTS A;  2FGS A;  4YKM A;  5EDB A;  1SWD A;  4Y5D A;  1IJ8 A;  2Q2P A;  4AZP A;  2G5L A;  4A1H A;  3STN A;  5IO7 A;  1GT5 A;  1MEP A;  2YMS A;  1B8E A;  2RTP B;  3LV4 A;  1QFV A;  2ZSC A;  4I9R A;  5L8N A;  2AT3 X;  4BQU A;  2FKG A;  4Y0S A;  3OJY C;  4YCE A;  1NP4 A;  3KFI A;  2AF5 A;  1O1V A;  1RXH A;  4IB9 A;  4YH0 A;  1JZU A;  3HWF A;  2OY8 A;  4ZHC A;  2JU7 A;  4BX5 B;  1VWA B;  5L3Y A;  1CBS A;  5LJC A;  1JJX A;  1U18 A;  5B5G A;  4NNT A;  5IRA A;  5D47 A;  3SLT A;  5IO5 A;  2AT0 X;  5B27 A;  4ML7 B;  3OBL A;  4WBK A;  4K19 A;  1YWA A;  3HWG A;  3FA7 A;  3ZW1 A;  1HN2 A;  4GZV A;  3AKN A;  1D3S A;  4I9S A;  4GKC A;  1QQS A;  3NQ9 A;  4O3W A;  1JJU A;  1SWK A;  1SWS A;  1SWH A;  1I78 A;  1VWI B;  1YP6 A;  5LJG A;  4ZHF A;  1JBH A;  2FRS A;  2Q4N A;  1IW2 A;  4DQ3 A;  3CKG A;  3HWD A;  2LB6 A;  5D4A A;  5H9L A;  5B2A O;  2X55 A;  3P6E A;  1MX7 A;  2NNE A;  2ZAI A;  4GDA A;  2A8G A;  4I95 A;  4YFP A;  4MIS A;  1MX8 A;  2OVD A;  1OEK A;  3CWK A;  1NBX A;  3N91 A;  3CQR A;  1N9M A;  1TOU A;  4FGI B;  1GKA A;  1QAB E;  4HPC A;  3T1D A;  1SXW A;  3ZUI A;  2Q39 A;  3LTW A;  3NBX X;  5BVT A;  2KTD A;  3ELX A;  4BGF A;  4AW8 A;  1RST B;  4NW4 A;  4KT5 A;  2Q2M A;  1AVD A;  1DF3 A;  3RE6 A;  2IZA A;  3KZA A;  4BX6 B;  3HK1 A;  4ARH A;  4M6S A;  4QGV A;  1SRH A;  1SWE A;  1DZJ A;  4AZM A;  2FTB A;  2MF6 A;  2FR2 A;  1SWB A;  4RUN A;  3ZZV A;  1DC9 A;  4TKH A;  4AZN A;  1AEL A;  1HBQ A;  1SWC A;  4LKP A;  5AJC A;  3VG7 A;  3ZI8 A;  4AYH A;  3HOL A;  5IO6 A;  2DM5 A;  3D96 A;  2R56 A;  2F09 A;  2GTL M;  2LA7 A;  4TNN A;  1SY3 A;  1STS B;  2BSZ A;  4INN A;  4IRW A;  4O3X B;  4OMX A;  5F2B A;  3WYP A;  3S5V A;  5FQ8 E;  3T6L A;  1SRI A;  3WZO A;  4HPB A;  2NP1 A;  4A1Y A;  5IRU A;  4CPE A;  1BRQ A;  1CRB A;  1DZM A;  2OL8 O;  4BOE A;  3E3C A;  1YWD A;  1KGL A;  4QGX A;  2BS6 A;  2IZD B;  3EC5 A;  3VHI A;  1QG5 A;  1S7D A;  3TF6 A;  3EBK A;  3HOE A;  5B5F A;  3QQ2 A;  1SWJ A;  1YP7 A;  4ORU A;  5L8I A;  1JQP A;  2JU3 A;  2IZE B;  4U3Q A;  4Z2P A;  3RDX A;  2X45 A;  3FR4 A;  3HWE A;  1G85 A;  3P02 A;  4YGG A;  2CM9 A;  5HCC C;  2AT5 X;  3F8A A;  4XMH A;  4L3R A;  2OZQ A;  3RY2 A;  2IZK A;  2R73 A;  1EXS A;  1HQP A;  1N9Y A;  1YWB A;  4DCB A;  4NLJ A;  4B55 A;  2LBA A;  4CDF A;  1E06 A;  1YUP A;  2ANS A;  3CBS A;  4HWM A;  3UEU A;  3P6G A;  3WJF A;  2AVI A;  1ICM A;  2AL0 X;  2GJ5 A;  4KCA A;  2M4L A;  3RDM A;  4O49 A;  2QOM A;  1GGL A;  3HPE A;  1I9H A;  1RXK A;  1SA8 A;  3WZQ A;  4QRL A;  2RTR B;  4EQA C;  3FR5 A;  2IZC B;  3WBG A;  3CR6 A;  3S26 A;  1LIF A;  1QWD A;  4PSQ A;  2LBV A;  2C1Q A;  3MG5 A;  1B0O A;  4AZQ A;  1UZ2 X;  1VWR B;  4NP1 A;  4ORR A;  1LID A;  4ORW A;  1DF8 A;  1LKE A;  3RDU A;  4YGZ A;  5F6B A;  4BCS A;  3EMM A;  3NQK A;  1BJ7 A;  1Y52 X;  4JHQ A;  2XKL A;  1EI5 A;  1OEE A;  3RDO A;  4CK4 A;  4IB7 A;  5B3M O;  3SOT A;  4AZR A;  2L5P A;  3O22 A;  4IMO A;  1IKE A;  1SXU A;  3Q6L A;  2X46 A;  2OF8 A;  4YGH A;  4U8U O;  3ZWE A;  2X56 A;  3VGW A;  3O19 A;  3H3I A;  3PH6 A;  4O3Y A;  1G5W A;  3MBT A;  1U17 A;  2HNX A;  4ZGF A;  1YWC A;  5AQ6 A;  2A13 A;  3I0A A;  3NP1 A;  4QNI A;  4NV7 A;  3WXQ A;  3ZW0 B;  5BYP A;  1CJ5 A;  4IBA A;  5EEE A;  2WR6 A;  1KZW A;  2RA6 A;  4ES7 A;  1S2P A;  3NR3 A;  2MWH A;  2WSJ A;  3RWX A;  5HCD C;  1SRJ A;  1O1U A;  3PPT A;  4D6A A;  4OEM A;  4XMF A;  4Z2O A;  1GT1 A;  1B4M A;  1VPR A;  4M7M A;  4D6B A;  4CDE A;  4ID2 A;  1TXL A;  4IAB A;  3GE2 A;  4WHI A;  4BX7 A;  4BJ8 A;  5BVS A;  1JYD A;  3JS1 A;  4GET A;  1RBP A;  1KT4 A;  1AVE A;  2RN4 A;  3MX7 A;  4KII A;  2VFB A;  2OFR X;  2KTS A;  1EAL A;  3KQ0 A;  2GC9 A;  2MJI A;  3BLG A;  1E2T A;  1IKJ A;  1Y9L A;  2X34 A;  1MK5 A;  2RTF B;  4IB6 A;  1ERX A;  2JW1 A;  1EPB A;  1GT4 A;  1ZNL A;  2YG2 A;  1I06 A;  1KT3 A;  1ML7 A;  1MM9 A;  1VWD B;  1IFB A;  1ZRY A;  2ACO A;  2PI3 O;  2A2G A;  2RTC B;  1CBI A;  1ZNH A;  3ZUO A;  2CM4 A;  3APV A;  3SZJ A;  1STP A;  3T6F A;  4CDC A;  1K24 A;  4U46 A;  4IAX A;  3JQO A;  1SWQ A;  2BC3 A;  2OFA A;  4QAE A;  3C77 X;  1I05 A;  5HWZ A;  3FA8 A;  4YKO A;  4CPF A;  1A57 A;  1KL4 A;  4YCH A;  1OPA A;  4QZT A;  3P24 A;  3C76 X;  1SWR A;  2RTN B;  2X32 A;  5H9N A;  4BVM A;  1BLR A;  1LNM A;  3UEW A;  5JR8 A;  2OF9 A;  4ZH6 A;  4EXZ A;  2JU8 A;  1LIB A;  1KFF A;  1PM1 X;  4LZV A;  1FEL A;  4GJS A;  4OS3 A;  4U9C A;  1KOI A;  1KL3 A;  1PMP A;  1EW3 A;  1VWB B;  2CBS A;  1DFV A;  2KW1 A;  3IA8 A;  3NX1 A;  4I3C A;  4ZJ0 A;  1GT3 A;  1BSY A;  3FEL A;  2DJF A;  1SLD B;  3S5X A;  1MUP A;  4ZHH A;  1U0X A;  4NYR A;  2CBR A;  5AEO A;  3VE1 A;  2HLV A;  5LKE A;  2IFB A;  1P6P A;  2NNQ A;  1GM6 A;  1SMP I;  4EDE A;  4Z27 A;  1DZK A;  4CDD A;  4GH7 A;  1T68 X;  1SY2 A;  2OY7 A;  3PK2 A;  3TGB A;  2E4J A;  5HAE A;  1KQX A;  4FBV A;  4CPH B;  1ZND A;  1SWL A;  1AB0 A;  3WJC A;  2QOS C;  4JNJ A;  4I3D A;  1SWG A;  1QY1 A;  2WUT A;  1LCZ A;  1N7Y A;  1QFT A;  5LJD A;  4BBO A;  3FID A;  3KFG A;  4JGL A;  5KID A;  2UZ2 A;  3VE2 A;  5IRW A;  4EKV A;  5H9A A;  1AVG I;  5K68 A;  1B56 A;  4ZGU A;  5EZ2 A;  1BSQ A;  1NC9 A;  5FAZ A;  1H91 A;  3PQU A;  3NQ3 A;  4TKJ A;  5H8T A;  4AZO A;  1LIC A;  4FBO A;  1CBQ A;  3TZS A;  1OBU A;  1OSP O;  4ORX A;  2OVA A;  3DSZ A;  4KH8 A;  2I5V O;  1TVQ A;  1YIV A;  5D8J A;  1HBP A;  2RTM A;  4LKT A;  4ZR2 A;  5FFH A;  2X4M A;  3APU A;  4Z2V A;  1OEJ A;  1RXJ A;  3FW4 A;  3QKG A;  4O9S A;  3RSW A;  2HZR A;  2DJG A; 
#chains in the Genus database with same CATH homology
 4MVE A;  4CSB A;  2W2B A;  4Y0R A;  4YBP A;  1EUO A;  2QO4 A;  2Q9S A;  3PH5 A;  1ERB A;  4OS0 A;  3UEV A;  3VG4 A;  4A8Z A;  5HTD A;  4U8U N;  4MVK A;  1IFC A;  1NP1 A;  1QY2 A;  1X8P A;  3BY0 A;  2ZAG A;  3U0D A;  3VG6 A;  3CBC A;  2FWV A;  2QO6 A;  2JMB A;  4R0B A;  5LJB A;  4HPD A;  1ZNG A;  4HPA A;  2EU7 X;  3ZQ3 A;  4L1N A;  2MO5 A;  5HZ6 A;  3VU1 A;  3NX2 A;  4KC8 A;  2RCQ A;  4UU2 A;  3U03 A;  4Y0Q A;  1ICN A;  2JN3 A;  1HMT A;  2POA A;  2Z4I A;  2HYS A;  5AJB A;  4QZU A;  2PY1 A;  3I17 A;  3ZW1 B;  1KQW A;  1KT7 A;  1E02 A;  3APW A;  1FE3 A;  1L6M A;  1DZP A;  2G79 A;  2X8T A;  3PEC A;  3FMZ A;  4O4S A;  5F7G A;  5L8O A;  3RZY A;  2KT4 B;  1E5P A;  5DG4 A;  1Y9T A;  1O8V A;  2WQ9 A;  3B2J A;  3FEN A;  3BX8 A;  3AKM A;  2GTL O;  1VYG A;  3KFF A;  4KC7 A;  2Z4H A;  4NNS A;  4PJ2 A;  4WFU A;  2CZU A;  1TOW A;  1JYJ A;  1T0V A;  4EEJ A;  3ELZ A;  3BSZ E;  5CE4 A;  1D2U A;  5LJK A;  2XST A;  1GKA B;  3OD9 A;  4ODD A;  4FBR A;  4XMD A;  5FEN A;  3WJE A;  5F1E A;  3UEX A;  1FEN A;  1NGL A;  4N7D A;  4OS8 A;  3WJB A;  4QGW A;  1R0U A;  3FLL A;  4GE1 A;  4YMY A;  4ON1 A;  4O4O A;  5HTE A;  1X8N A;  2QM9 A;  4ZHD A;  1OBQ A;  1ALB A;  4XMC A;  2AKQ A;  5DPQ A;  4COT A;  4GU8 A;  2QO5 A;  4ALO A;  4DQ4 A;  4YFQ A;  3P6D A;  2L67 A;  3STM X;  1JIW I;  3B2I A;  4ORS A;  3EYC A;  4ORY A;  4GRJ A;  4EFG A;  2X8F A;  4A60 A;  4YBU A;  1FTP A;  2BHV A;  1LIE A;  2L9C A;  1N0S A;  3C78 X;  3FA9 A;  3L4R A;  1OBP A;  5HZ9 A;  1OPB A;  1A18 A;  3BDR A;  4QQ1 A;  3FEK A;  4CV7 A;  5HZ5 A;  1HMS A;  2X8S A;  2HMB A;  4TJZ A;  5LKF A;  3FR2 A;  3P6F A;  1I4U A;  2JOZ A;  3P6H A;  4GDZ A;  1ZNE A;  4TLJ A;  5HCE C;  5B29 A;  1HMR A;  2WEW A;  3FYF A;  5EDC A;  1EIO A;  1E00 A;  4GNY A;  5HZ8 A;  1BSO A;  2GTF X;  3BX7 A;  4YDA A;  5BVQ A;  5H9K A;  5HA1 A;  1KT5 A;  1IIU A;  3CQN A;  2FS7 A;  1LFO A;  3BU1 A;  3EBW A;  2ALL X;  5H9A A;  3STK A;  4YFR A;  4ZHG A;  2AH7 X;  1ACD A;  1G74 A;  2FT9 A;  1KT6 A;  1RLB E;  2BS5 A;  2NND A;  3FW5 A;  5FQ7 E;  1BM5 A;  5LJH A;  3B2H A;  3GAQ A;  3JSQ A;  2RD7 C;  2A2U A;  5K06 A;  3WOV A;  3B2K A;  2QMI A;  3MVF A;  3CMP A;  3APX A;  2OFM X;  1XKI A;  5F6Z A;  4QYP A;  1EPA A;  4N7C A;  4OMW A;  5CYB A;  1T8V A;  2OVE A;  4RUU A;  3RBY A;  1MVG A;  1CBR A;  3ZW2 A;  1Z24 A;  3D4R A;  1G7N A;  1LPJ A;  4I3B A;  3PED A;  2LKK A;  2AMM X;  2KD2 A;  4YDB A;  1GXA A;  4FQB B;  3FIQ A;  5F58 A;  1A2D A;  2ASN X;  3NAD A;  1EQD A;  2RCT A;  3ZW0 A;  4GNW A;  3WJD A;  2G78 A;  1BWY A;  1URE A;  2LFO A;  3P6C A;  4IMN A;  4WFV A;  2F73 A;  3K3L A;  2FR3 A;  2R74 A;  3O2Y A;  1BBP A;  4O4X A;  5C0N A;  5FQ6 E;  3BU9 A;  1X89 A;  3B2L A;  2MHD A;  3VG3 A;  2K23 A;  1EII A;  4LZU A;  3G7X A;  2P8G A;  2ACP X;  2GTL N;  3F9D A;  4LQZ A;  4ZH9 A;  1LF7 A;  5KHP A;  4Y0P A;  4NLI A;  2K62 A;  3TGA A;  4MVL A;  3DTQ A;  2W2F A;  3FEP A;  4U8U M;  3SAO A;  4ZFX A;  3KFH A;  1FEM A;  4O4U A;  1S44 A;  5HA0 A;  1ADL A;  2A3F X;  1DV9 A;  3PP6 A;  1A3Y A;  1GX8 A;  4IB8 A;  2RQ0 A;  4I6S A;  2BT9 A;  1XCA A;  1BRP A;  2AT6 X;  5D45 A;  1FDQ A;  2WEX A;  2FS6 A;  2O62 A;  3WJG A;  1X8Q A;  5KIC A;  2WWP A;  4MIR A;  2HZQ A;  4UU3 A;  1PBO A;  3D97 A;  4HFO A;  1KZX A;  2FLJ A;  1SY0 A;  1X8O A;  2L68 A;  3IFB A;  5D48 A;  1X8U A;  1I04 A;  2G7B A;  4ZCB A;  3S60 A;  2BLG A;  3WVM A;  1JJJ A;  3BS2 A;  1AQB A;  3U9P C;  4IAW A;  4GK9 A;  3LHN A;  4TKB A;  4ALB A;  1JV4 A;  1BEB A;  2MM3 A;  3BRN A;  1SY1 A;  1SXX A;  3FA6 A;  3UAQ A;  5LJE A;  3TGC A;  3D95 A;  1SXY A;  2OVS A;  2A0A A;  3NPO A;  5EPQ A;  3PQS A;  2AT8 X;  3VPJ E;  1TW4 A;  3V8U A;  3VG2 A;  5EED A;  5HBS A;  3OE3 A;  3HTY A;  3EM0 A;  4O3Z A;  2W2A A;  1GX9 A;  1ZNK A;  4QYN A;  1MDC A;  1PEE A;  3RKG A;  1VYF A;  2WQA E;  1X71 A;  4MVI A;  4XME A;  1KXO A;  1QY0 A;  4NYQ A;  2CZT A;  4TQ2 A;  3VG5 A;  3F6Z B;  4YKM A;  5EDB A;  2Q2P A;  4AZP A;  4A1H A;  3STN A;  5IO7 A;  1GT5 A;  2YMS A;  1B8E A;  3LV4 A;  1QFV A;  4I9R A;  5L8N A;  2AT3 X;  4BQU A;  4Y0S A;  4YCE A;  3OJY C;  1NP4 A;  3KFI A;  1O1V A;  4IB9 A;  4YH0 A;  1JZU A;  3HWF A;  4ZHC A;  2JU7 A;  1CBS A;  5LJC A;  1JJX A;  1U18 A;  4NNT A;  5D47 A;  5IO5 A;  2AT0 X;  5B27 A;  4ML7 B;  3OBL A;  4WBK A;  4K19 A;  1YWA A;  3HWG A;  3FA7 A;  3ZW1 A;  1HN2 A;  4GZV A;  3AKN A;  1D3S A;  4I9S A;  4GKC A;  1QQS A;  3NQ9 A;  4O3W A;  4ZHF A;  1YP6 A;  5LJG A;  1JBH A;  2FRS A;  2Q4N A;  1IW2 A;  4DQ3 A;  3HWD A;  2LB6 A;  5D4A A;  5H9L A;  3P6E A;  1MX7 A;  2NNE A;  2ZAI A;  4YFP A;  4I95 A;  4MIS A;  1MX8 A;  2OVD A;  1OEK A;  3CWK A;  3N91 A;  3CQR A;  1TOU A;  4FGI B;  1GKA A;  1QAB E;  4HPC A;  3T1D A;  1SXW A;  2HZR A;  3ZUI A;  2Q39 A;  3NBX X;  5BVT A;  2KTD A;  3ELX A;  4AW8 A;  4NW4 A;  4KT5 A;  2Q2M A;  1DF3 A;  3KZA A;  3HK1 A;  4ARH A;  4M6S A;  4QGV A;  1DZJ A;  4AZM A;  2FTB A;  4RUN A;  2FR2 A;  3ZZV A;  1DC9 A;  4TKH A;  4AZN A;  1AEL A;  1HBQ A;  4LKP A;  5AJC A;  3VG7 A;  3ZI8 A;  4AYH A;  5IO6 A;  3HOL A;  2DM5 A;  3D96 A;  2R56 A;  2F09 A;  2GTL M;  2LA7 A;  4TNN A;  1SY3 A;  4INN A;  4O3X B;  4OMX A;  3S5V A;  5FQ8 E;  4HPB A;  2NP1 A;  4A1Y A;  1KGL A;  1BRQ A;  1CRB A;  1DZM A;  4BOE A;  3E3C A;  1YWD A;  4QGX A;  2BS6 A;  1QG5 A;  1S7D A;  3TF6 A;  3EBK A;  3HOE A;  1YP7 A;  4ORU A;  5L8I A;  2JU3 A;  4U3Q A;  2X45 A;  3FR4 A;  3HWE A;  1G85 A;  3P02 A;  4YGG A;  2CM9 A;  5HCC C;  2AT5 X;  3F8A A;  4XMH A;  4L3R A;  2OZQ A;  2R73 A;  1EXS A;  1HQP A;  1YWB A;  4NLJ A;  2LBA A;  1E06 A;  1YUP A;  2ANS A;  3CBS A;  4HWM A;  3UEU A;  3P6G A;  3WJF A;  1ICM A;  2AL0 X;  2GJ5 A;  4KCA A;  2M4L A;  4O49 A;  1GGL A;  1SA8 A;  4QRL A;  4EQA C;  3FR5 A;  3WBG A;  3CR6 A;  3S26 A;  1LIF A;  1QWD A;  4PSQ A;  2LBV A;  1B0O A;  4AZQ A;  1UZ2 X;  4NP1 A;  4ORR A;  1LID A;  4ORW A;  1LKE A;  4YGZ A;  5F6B A;  3EMM A;  3NQK A;  1BJ7 A;  2XKL A;  1EI5 A;  1OEE A;  4CK4 A;  4IB7 A;  3SOT A;  4AZR A;  2L5P A;  3O22 A;  4IMO A;  1IKE A;  1SXU A;  3Q6L A;  2X46 A;  4YGH A;  4U8U O;  3ZWE A;  3O19 A;  3H3I A;  3PH6 A;  4O3Y A;  1G5W A;  3MBT A;  1U17 A;  2HNX A;  4ZGF A;  1YWC A;  5AQ6 A;  2A13 A;  3I0A A;  3NP1 A;  4QNI A;  3WXQ A;  3ZW0 B;  5BYP A;  1CJ5 A;  4IBA A;  5EEE A;  2WR6 A;  1KZW A;  2RA6 A;  4ES7 A;  1S2P A;  3NR3 A;  2MWH A;  2WSJ A;  3RWX A;  5HCD C;  1O1U A;  3PPT A;  4D6A A;  1B4M A;  4XMF A;  1GT1 A;  1VPR A;  4M7M A;  4D6B A;  4ID2 A;  1TXL A;  4IAB A;  3GE2 A;  4WHI A;  5BVS A;  1JYD A;  3JS1 A;  4GET A;  1RBP A;  1KT4 A;  2RN4 A;  3MX7 A;  4KII A;  2OFR X;  2KTS A;  1EAL A;  3KQ0 A;  2GC9 A;  2MJI A;  3BLG A;  1IKJ A;  1Y9L A;  4XMG A;  5HZQ A;  4IB6 A;  1ERX A;  2JW1 A;  1EPB A;  1GT4 A;  1ZNL A;  2YG2 A;  1I06 A;  1KT3 A;  1ML7 A;  1IFB A;  1ZRY A;  2ACO A;  3ZUO A;  2A2G A;  1CBI A;  1ZNH A;  2CM4 A;  3APV A;  4IAX A;  3JQO A;  4QAE A;  3C77 X;  1I05 A;  5HWZ A;  3FA8 A;  4YKO A;  1A57 A;  4YCH A;  1OPA A;  4QZT A;  3P24 A;  3C76 X;  5H9N A;  4BVM A;  1BLR A;  1LNM A;  3UEW A;  5JR8 A;  4ZH6 A;  4EXZ A;  2JU8 A;  1LIB A;  1PM1 X;  4LZV A;  4OS3 A;  1FEL A;  5EZ2 A;  4U9C A;  1KOI A;  1PMP A;  1EW3 A;  2CBS A;  4I3C A;  1DFV A;  2KW1 A;  3IA8 A;  3NX1 A;  4ZJ0 A;  1GT3 A;  1BSY A;  3FEL A;  3S5X A;  1MUP A;  4ZHH A;  1U0X A;  4NYR A;  2CBR A;  5AEO A;  3VE1 A;  2HLV A;  5LKE A;  2IFB A;  1P6P A;  2NNQ A;  1GM6 A;  1SMP I;  4EDE A;  1DZK A;  4GH7 A;  1T68 X;  1SY2 A;  3TGB A;  2E4J A;  5HAE A;  1KQX A;  4FBV A;  1ZND A;  1AB0 A;  3WJC A;  2QOS C;  4I3D A;  2WUT A;  1QY1 A;  1QFT A;  5LJD A;  3KFG A;  4JGL A;  5KID A;  3VE2 A;  1AVG I;  1B56 A;  4ZGU A;  1BSQ A;  5FAZ A;  1H91 A;  3PQU A;  3NQ3 A;  4TKJ A;  5H8T A;  4AZO A;  1LIC A;  4FBO A;  1CBQ A;  3TZS A;  1OBU A;  4ORX A;  2OVA A;  3DSZ A;  4KH8 A;  4ZR2 A;  1TVQ A;  1YIV A;  5D8J A;  1HBP A;  5FFH A;  4LKT A;  3APU A;  1OEJ A;  3FW4 A;  3QKG A;  4O9S A;  3RSW A;  2N93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...