1QWFA

C-src sh3 domain complexed with ligand vsl12
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE TRANSFORMING PROTEIN SRC
publication title Specific interactions outside the proline-rich core of two classes of Src homology 3 ligands.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Complex (signal transduction/peptide)
total genus 8
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1qwfA00
2NWMA 2DL7A 1JQQA 1UGVA 3TSWA 1AVZC 2DL3A 4GLMA 2JT4A 2CREA 1NM7A 2FRYA 1M30A 2EPDA 5L23A 2D1XA 2O9VA 4F16A 4HVWA 2JM8A 3EG1A 2DE0X 2CT4A 2FEIA 4J9EA 1WFWA 2A37A 2CH4W 2KT1A 1NEGA 4HCKA 4R0KA 5EC7A 2EGAA 2RQTA 1M8MA 4J9IA 2ED0A 4FSSA 4LNPA 1S1NA 3VS2A 2O31A 3SHWA 1VA7A 1QKWA 4Z88A 2OI3A 4JJCA 1Z9QA 2FG0A 2JS0A 1Y57A 1X69A 1WX6A 3GBQA 1MUZA 1ZSGA 1AZGB 1UDLA 3EG0A 2LQWA 2ROTA 2J05A 1TUDA 2DVJA 1RI9A 1T3SA 4AG1C 1GL5A 2K7AA 1UJYA 2DL5A 3VS5A 1K4US 2KYMA 2DLPA 1AWOA 1JXMA 4F17A 1WXUA 4RTTA 1H92A 2I0NA 4AFSC 2CUDA 1RUWA 2V1RA 1N5ZA 3PVQA 1AWJA 1TG0A 3R6NA 3O5ZA 5GJWB 2HEQA 2RN8A 4RTXA 2C0OA 4ORZA 2RQVA 1QWEA 2DYBA 4J9CA 1PHTA 1WDXA 2CDTA 2G6FX 1WLPB 4E6RA 1ZX6A 1EFNA 2HCKA 2K9GA 1RLPC 1M3CA 1V1CA 2OAWA 2VKNA 1M27C 2EYZA 2JTEA 5HCKA 1T0JA 2K2MA 2CT3A 2GNCA 2YUPA 2SRCA 1WI7A 5IXBA 3TVTA 3I9QA 2J06A 4JJDA 2FPFA 4OMQA 3VRYA 2D8HA 3NHNA 1GFCA 3JV3A 4CC7A 2EGEA 2KRSA 1YWOA 2LX7A 4OMNA 2SEMA 2EQIA 1PKTA 2O2OA 1E6GA 2K3BA 3UF4A 2C0IA 2B86A 2DA9A 2KXCA 1H8KA 2A36A 4CC3A 4DEYA 1I1JA 1HJDA 1JXOA 1K76A 1KIKA 2AZVA 2GTOA 2BZYA 4WCIA 1JEGA 2LJ0A 2LJ1A 4AFQC 4J9GA 2VWFA 1GRIA 1B3QA 1UECA 2C0TA 2E5KA 1GCQC 4J9HA 1GCPA 3M0UA 5I11A 2RQWA 2DRKA 2FPDA 3SEMA 1SHFA 2X3XD 1UHFA 2KNBB 3I5SA 2EW3A 1A0NB 1U3OA 1CKAA 1W6XA 2H8HA 1FYNA 2LZ6B 2MCNA 2EBPA 2YSQA 1ABOA 3VS6A 1UFFA 2O88A 2KT8A 1T3LA 1X27A 3REBB 3UATA 5ECAA 2MIOA 4D8DA 1BB9A 1BBZA 2DF6A 5I22A 2FO0A 4GBQA 2W0ZA 1SRMA 2O9SA 1AZEA 2DNUA 2JS2A 1TUCA 1YP5A 4J9DA 3M0TA 2FRWA 1K0XA 2YUNA 1GCQA 1J3TA 2DRMA 2J7IA 4OMLA 1ZBJA 4CC4B 1Z9ZA 1AEYA 1I0CA 2GGRA 1IO6A 2AKLA 3VS7A 1AD5A 1PRMC 3H0FA 2EYXA 2LJ3A 1QKXA 3LH5A 4QT7A 1YNZA 1WXBA 2LCSA 4AFUC 2LQNA 2CSIA 1VYUA 2D0NA 1WA7A 3QWYA 2EKHA 2L0AA 2GQIA 3EG2A 5IH2A 2EGCA 2PTKA 3EGUA 4F14A 1AWWA 3VRZA 1K0SA 1OEBA 5FWCA 2V1QA 5IHNA 2KXDA 1U5SA 3I5RA 2JMAA 2GBQA 2DL4A 3H41A 4HVUA 4ZNXA 3CQTA 4JZ4A 1JU5C 3EG3A 2DBMA 1PWTA 3FJ5A 1W1FA 2F2WA 1SRLA 4IIOA 2KBTA 2BZXA 1QCFA 1KFZA 4Y92A 3VS3A 3A98A 1QLYA 2RQUA 3M0PA 1XOVA 2J6OA 2KR3A 3KFVA 4LUDA 2DBKA 2YUOA 1ABQA 1WXTA 4JPBW 2BTTA 4KRTA 4X1VA 3TSZA 1ARKA 2KGTA 2YT6A 5GJVB 1X43A 2F2VA 1K9AA 3UA7A 2F2XA 2KRNA 4OMPA 1UE9A 2KYBA 1LCKA 2JM9A 3UA6A 5IHKA 5IHIA 1OV3A 1UJ0A 1NEBA 2LMJA 4A63B 1FMKA 4RUGA 1NLOC 1MV0B 1GBRA 1YN8A 5IXFA 1E6HA 1QWFA 4JZ3A 2EYYA 2FPEA 4RTUA 1NYFA 2HDAA 2A28A 2YDLA 2JW4A 3M0QA 1UTIA 4K11A 1ZLMA 1G2BA 1OPKA 3PE0A 2K79A 2LP5A 1I07A 2W10A 4M4ZA 2JXBA 1OOTA 2EYWA 3NGPA 4RTWA 2CUBA 1UUEA 1PRLC 1KJWA 3H0HA 1K1ZA 1X6GA 1CKBA 2XMFA 3M0SA 2RF0A 1BU1A 1KSWA 2MOXA 3PVLA 1AOJA 3EHQA 4LE9A 2EVRA 2K6DA 4D8KA 4RTZA 2J6KA 1M3BA 2RMOA 4J9BA 1JO8A 2ED1A 1UHCA 2AKKA 2DX1A 1YCSB 4ESRA 1M3AA 1RLQC 4Z89A 2AK5A 2KE9A 1GBQA 2IIMA 1W70A 1U06A 5FWBA 2L3SA 2CSQA 1X2QA 4HVVA 1ZUUA 3M0RA 2ABLA 1BK2A 2KRMA 2NUZA 1X6BA 2CH4A 2L2PA 1CSKA 1OPLA 2DMOA 1NYGA 1NG2A 1UG1A 2X3WD 2ECZA 2P4RA 3RNJA 2A08A 2M51A 3QWXX 1GFDA 4LN2A 4AG2C 2DM1A 2RNAA 5FW9A 3VS1A 2L3QA 1NLPC 1VYVA 1ZUKA 2BZ8A 1T0HA 1H3HA 1YWPA 4JJBA 2JMCA 1ZUYA 2QDLA 3H0IA 3ULRB 4RTYA 2KROA 1SPKA 1MV3A 3VS0A 1SHGA 4OMMA 3C0CA 1B07A 2PNIA 1SEMA 2RPNA 2DJQA 2OJ2A 4HXJA 4CC2A 3U23A 2D8JA 2YUQA 4RTVA 1WIEA 4J9FA 2LNHB 2DL8A 1HSQA 2RQRA 1VYTA 1X2KA 2AZSA 3ZL7C 2DILA 2HSPA 1HD3A 2VVKA 2ROLA 3THKA 1PNJA 4IIMA 4EIKA 2HBWA 2ESWA 1E7OA 2GTJA 3EHRA 3NMZC 4DEXA 3IQLA 4OMOA 2PZ1A 2KEAA 4AFZC 2J6FA 1G83A 3I35A 1PKSA 4LUEA 3RBBB 4Z8AA 3REAB 1AWXA 1WYXA 3NPFA 2ENMA 2L3PA 3VS4A 2M0YA 1SSHA 1Y0MA
chains in the Genus database with same CATH superfamily
3QO3A 2JJ9A 4GLMA 2F5KA 3OW2P 2FRYA 3A8GB 5L23A 2D1XA 4C92G 4F16A 2JM8A 3S6WA 3JCMQ 2YXYA 3OSSC 3CD6T 2CH4W 4R0KA 4PL6A 2HZYA 2RQTA 1M8MA 4M78B 1Q86U 3VS2A 3LWHA 4Z88A 2LX9A 2OI3A 1KD1U 1Z9QA 1WX6A 1VQ5Q 2YLCA 1MUZA 4M78A 3M57A 3MP1A 2QTXA 1AZGB 1Q7YR 2BIVA 2LQWA 2J05A 2HQEA 2Z0WA 5CAIA 1KC8R 8AT1B 4MZPA 1UJYA 2DLPA 2NUTB 1VQ6Q 1AWOA 2QDYB 3OW2A 1WXUA 4XTVA 2XK0A 4FT4A 5EG2A 3META 2LQKA 4O6JA 2KDSA 4V2SA 5GAMh 2Y4YA 1TG0A 2PVDB 3CC7T 3KBGA 2NUTA 6AT1B 2NLUA 4RTXA 2MK5A 2FB7A 1PHTA 2CDTA 5CKFA 1WLPB 1FXXA 2DJZA 2XDBA 3TEEA 4LD6A 4FSXA 1ZA1B 3A8OB 2OAWA 1ZA2B 1OULA 3A1PA 4IUUA 1M27C 1WPYA 2E4HA 2JTEA 2YRDA 1T0JA 2H3JA 4KUDK 2YUPA 4Y91A 4HT9A 2K4YA 1WI7A 3CCQT 2C06A 2OTLT 4FL6A 4OMQA 3NHNA 1S72A 5I2SA 3PTAA 2LX7A 1YJNA 3M9QA 3E2UA 3HP9A 4N4IA 4E7KA 1YCYA 5DY9A 3UF4A 1G5VA 2HKQB 2L8DA 1D1CA 1WHHA 4DEYA 2A36A 4OB0B 2M0OA 3JCMV 4CC3A 3ASKA 4MDWA 5CR2A 1JXOA 1K76A 2GTOA 2BZYA 2KVQG 3I56A 4BY6B 3CD6Q 2C0TA 3VU3C 1JJ2P 4M7AC 2RQWA 4M7DC 2X3XD 1VQLQ 2QQAA 3I5SA 1IZ6A 4EPCA 1WJSA 1U3OA 2P0PA 4PJOC 2V8JA 1KHCA 4C5GA 2H8HA 1TH7A 3GOXA 2CZ0B 2R57A 4QQ6A 2YSQA 1ABOA 1D09B 4GY5A 4QKUA 3V7CA 4X9DA 1T3LA 5GAOn 5ECAA 5GAMj 3L2VA 4M77G 1PG5B 1BB9A 1PCXA 5GAN3 1YHQA 4LDVA 2E12A 4J8OA 2FO0A 3M54A 5J26A 3S3OA 4E7HA 1M5Q1 4R55A 2W0ZA 1SRMA 2O9SA 3CCST 1IREB 5AYFA 1MHNA 2F1LA 2FRWA 1M1FA 3AT1B 3PNWC 2DRMA 3CBOA 1QP2A 1KQ2A 1JJ2A 2ATCB 1I0CA 2DXUA 1YJ9Q 1AD5A 2EYXA 1QKXA 1VIEA 4FYVB 4QT7A 3PFSA 3HRTA 4C8QC 2D0NA 1WA7A 2DETA 2EKHA 2L0AA 2GQIA 1QCNA 4N4HA 4HCBA 2EGCA 2E10A 2JTFA 2M16A 3D7SB 1RI0A 1AWWA 1MMDA 4FYXB 1YI2A 2KXDA 2O4XB 3CCMA 4RMOA 2VGNA 3FB9A 1M2OA 2GCXA 2DL4A 2LNVA 3G71Q 3CQTA 3EG3A 3BW1A 2F69A 3CCET 1PWTA 2XD0A 1W1FA 1R0CB 2F2WA 5GAOp 2O4XA 1D3BA 1P92A 1QCFA 5CCAA 1QCOA 4M77F 3A98A 3QZ9B 4B9XA 3OYLA 5GANe 4A4KA 2KR3A 3OW2S 1YJNT 2YUOA 4C92C 2BTTA 1VQ8A 1NPPA 4PJMA 3TSZA 1ARKA 3G4ST 1ACMB 1TWBA 2F2VA 3G7ZA 2QGFB 4P5NA 2F2XA 3OS0A 2ZPGB 4OMPA 4XTWA 5IHIA 1OV3A 2LMJA 4FYWB 1W2BP 2XI9A 4A63B 3OBWA 1YBYA 3JSCA 2FZGB 3G6EA 5CIUA 1GBRA 1E6HA 2EYYA 2FPEA 3QBYA 2DTHA 3E19A 4DOVA 1VQOT 4M77B 3M0QA 2LVMA 3GLXA 2DD4A 2K79A 2LP5A 2AHJB 1M90R 3QHSA 1OOTA 2EYWA 2CUBA 5GAMd 2EQKA 4M77A 1UUEA 4MDXA 3H0HA 3N5BB 2QQ9A 3M0SA 2LRQA 1BCOA 3L2QA 1BU1A 2E5QA 2WSEE 2MOXA 4LE9A 4XQ3A 2EVRA 1UGPB 2K6DA 1BIBA 4KGZB 1W2BA 5IT9E 4FYYB 1M3BA 3JCMW 3I55A 3NTKA 3WXMB 4EDUA 1SSFA 1M3AA 4L59A 2D0QB 2LCCA 3OA6A 4FT2A 1G8XA 3CMEQ 4PJJA 2IIMA 2RJEA 4XU0A 1FX7A 1VQKT 3QUIA 5FWBA 2K5LA 5GAN5 2CSQA 1ZSZC 4N0AA 5CO7A 2RHYA 3M0RA 2ABLA 4FCYA 1TTHB 3CBPA 4J5YA 1YITA 1BK2A 1WHJA 1YI2T 1WJQA 2NUZA 4BE1A 1C0MA 1N8RC 1OPLA 2DMOA 1NYGA 1WHGA 1S72Q 3RNJA 2A08A 3CCVQ 4LN2A 4J6XA 2EKOA 2RNAA 3SD4A 1VQ5A 5FU7C 2VB6A 1JJ2S 1ZUKA 1T0HA 2KSSA 3L2UA 1MMNA 3I56Q 4JJBA 3OMGA 2JMCA 1ZUYA 4RTYA 2XICA 1V29B 4FW2A 3WVEB 4XTZA 2KAFA 3OYBA 1Q82R 1X75C 1PC0A 3CC4A 1B7TA 4TVRA 2MMPA 1OI1A 4MMLA 2I2LA 4BB7A 3J7AF 2HSPA 1HD3A 2E1HA 2EYQA 2RHZA 3MO8A 2E6NA 1IHVA 3ME9A 2LQ8A 5CKBA 1YHQQ 2V8IA 4PJNA 1RABB 4E7SA 4OMOA 2DEUA 3H6ZA 4LD9K 4M75C 1NJIR 3HSBA 1VQ9T 3RBBB 3CCJT 3HHTB 3L2ZA 2L3PA 2M0YA 1SSHA 1Y0MA 1RAHB 3M4YA 3RKYA 1BI2A 2MWPA 2X4JA 3BDLA 4JLIA 1UGVA 3TSWA 1AVZC 2DL3A 3T9NA 2JT4A 4ZGEB 3QIIA 1LOJA 4C0DC 3RESA 5LJ3g 1AHJB 4NOYA 4JS5A 1KHIA 4LDUA 5GAN4 2A0FB 4HCKA 5EC7A 4PLIA 3CCMQ 4J9IA 2E3HA 1EIFA 4LNPA 4J6WA 1VA7A 2JZ2A 1VQLA 1PSFA 1X69A 3X28B 1IB8A 4KBMB 5KCHA 4IUVA 3GBQA 1OU9A 2VXFA 1ZSGA 2FHDA 3QJ6A 2CP3A 5GAOq 4M7DG 2XHCA 2DVJA 1GL5A 2K7AA 1M1KC 4XAXB 2KYMA 1JXMA 3MHXA 4F17A 4PJOG 1H92A 1VQ8Q 1RUWA 1W2BS 5KYWB 4OB3B 5A0GA 2OX7A 1VQ5T 3PVQA 2HEQA 3CEYA 1D1BA 4J9CA 2HBPA 3V7SA 5LJ3d 5KYWA 2G6FX 1N8RU 1VQ6T 1YJ9A 1LVKA 3MEUA 4KGVB 3G6EQ 1UB4A 1VIFA 2QK0A 1M3CA 2G3RA 3SFMA 2DIGA 3E1SA 2K2MA 2CT3A 2GNCA 1EZZB 4C0FA 2IG0A 4Q5WA 1DJ7B 3PT9A 2QYZA 5FU6C 3VRYA 5DM7R 2L89A 4CC7A 2EGEA 4C8QG 4OMNA 2SEMA 3MCAB 1PKTA 4QQDA 1VQPA 2VGMA 1WQ7A 3HL8A 3NTHA 3M53A 3QDFA 9ATCB 4B9WA 4A54A 2K5FA 2KXCA 4M7DF 4M7AF 1RAEB 2RJCA 1HJDA 3OYJA 2AZVA 5KYNA 2LJ0A 4AFQC 4J9GA 3I55Q 3JRZA 3EAEA 2XDPA 3CCUA 2E5KA 2EJ9A 2DXBA 3OMCA 2FPDA 3P8BB 1R77A 1UHFA 2KNBB 3X26B 4KT0E 5GAN8 4NL2A 1FYNA 1RADB 5KYUB 5CQYA 1YITQ 1UFFA 1X27A 3REBB 3UATA 4D8DA 3GNGA 1K9MR 5KYUA 1VQLT 5I22A 2EAYA 4GBQA 4M7AB 1HYOA 4M7DB 2JS2A 1YP5A 5KYXB 2YUNA 4PJOB 4OB1B 1J3TA 3MEWA 3OY9A 2J7IA 4M7AA 4M7DA 4OMLA 3OQ5A 1ZBJA 3V8LA 2MYSA 4PFPA 2COWA 1AEYA 2GGRA 3VS7A 4WTOB 4M77E 2CP7A 4RCBA 3V7RA 4DBQA 5AT1B 3MJXA 3O8VA 3PIPA 1MNEA 4DQ2A 4EMGA 1OZ3A 2RA2A 1Q81C 1K8AC 3EG2A 5IH2A 3OSVA 2PTKA 3R6OA 3CC4Q 1FMVA 1Q86R 1K0SA 1OEBA 3OS2A 1KD1R 3A8HB 1YJ9T 3I5RA 4O5VA 3QKJA 1M1KU 2GBQA 3RDVA 3CMEA 4IKFA 4HVUA 1IGUA 4C92F 2R58A 1KG1A 2YWWA 1TUGB 1SRLA 5J39A 2DFUA 4IIOA 2KBTA 4DOWA 2BUDA 2CP6A 1IXDA 2GFAA 1ZQ1A 3VS3A 5GANj 1VQ4Q 1QLYA 1XOVA 3KFVA 4J7IA 1WXTA 3G71T 3RERA 1C6VX 1KQ1A 1ZHIA 4KRTA 1RAAB 3URGA 3CCVA 5LJ3f 2KGTA 2YT6A 1YIJA 3OYIA 2KMTA 5LJ5e 1UE9A 1LCKA 2JM9A 5HKCA 5IHKA 5KH6A 1UJ0A 4ANJA 1X6OA 4M77D 1LNXA 1MV0B 3M4GA 4C92B 5IXFA 2ZPBB 1RAFB 3JCMJ 4JZ3A 1NYFA 2HDAA 2YDLA 4E7LA 2QQSA 3OYNA 2JW4A 3VUBA 3HPWA 4ELZC 4C92A 1ZLMA 2R5MA 5GMKm 3PE0A 2COYA 2JXBA 4M78C 2RD1A 1X6GA 2ZPIB 1CKBA 2XMFA 2QA4A 3LYIA 1NBEB 5CKHA 2HMAA 5GANg 3TCJA 4XTYA 3RMSA 1M2VB 4FM4B 2DX1A 4ZTJA 1YCSB 2CGHA 5IN1A 2VASA 2E65A 1RLQC 4F7UG 2CP0A 3A8MB 4ZN1A 4E47A 2KE9A 4ATOA 1GBQA 1AT1B 4DBFA 1W70A 4M75G 3BDUA 2M1HA 2DKGA 2L3RA 4HVVA 1ZUUA 4QQGA 5C0MA 3VV0A 2QI2A 1K73C 1X6BA 1BI3A 2L2PA 4A4FA 1CSKA 3VUZA 2FVUA 1BCMA 2COZA 3CMET 2QASA 2X3WD 3HRUA 5DLQE 2P4RA 4GLKA 3QJYA 1VQPQ 3QWXX 4AG2C 1Q81U 5GAOl 1K8AU 1SKUB 1ZSZB 3FRNA 1VYVA 1WHMA 2NUPB 4II1A 1XTDA 2CKKA 4B6MA 5GANd 4BACA 4ZTFA 5KE2A 1S72T 4FU6A 2QDLA 3CCUQ 3ULRB 1MGQA 3CCVT 3F70A 1YIJT 1MV3A 2B8AA 2PUOB 2QAZA 4OMMA 1MMAA 3FIFA 5HK0A 1SEMA 4HXJA 2LTOA 3ER0A 2HQXA 4ELYC 3I56T 2DEQA 5LL6S 4C0GA 1HSQA 1VYTA 1M8VA 2RJDA 5D6WA 1I5LA 1NE8A 2X35A 2EJFA 5DLOA 3THKA 1PNJA 4IIMA 2LT1A 4EIKA 3OYFA 2E64A 5LJ3h 1E7OA 3NMZC 4E7ZA 2CZ7B 1WHLA 2RHUA 1Y7XA 5KCOA 1G83A 4DA4A 3I35A 2DERA 2X4YA 2E3IA 1PKSA 4LUEA 3REAB 3FDRA 3UT1A 1AWXA 2QQRA 3CCRA 3EH1A 2JVVA 1YHQT 4JLGA 4ZN3A 1JQQA 2XDDA 3CC2A 2ZPEB 3AHUA 5D6XA 3LGFA 5CQXA 1SF9A 2ZGWA 2QEXQ 2CREA 3GP8A 1M30A 4F7UB 2O9VA 2V8KA 2DD5A 2DTIA 3RKWA 2DE0X 5HK3A 4M75B 4FIBA 2CT4A 1JRIA 2DZCA 2FEIA 5D6YA 2A37A 1TXQA 2KT1A 2EGAA 4F7UA 1QVFA 2O31A 1QKWA 3V8JA 3S3MA 3CPFA 3OYCA 2JS0A 1Y57A 2OAUA 4MZTA 2VC8A 2DXCA 4C0DB 5KYYB 1UDLA 3EG0A 2VUBA 2EQUA 4IURA 1Y71A 1TUDA 3PMTA 8ATCB 1RI9A 3CCMT 1T3SA 4A4EA 2EFIA 4AG1C 2DL5A 3VS5A 1K4US 3EFRA 5KYYA 3JCMb 2YRVA 4AFSC 2JN0A 2V1RA 4PJLA 4JRQA 1YIJQ 3QDRB 3O5ZA 5GJWB 3RUXA 2PU9B 1VQ7A 2RN8A 2RQVA 1B34B 1K73U 2DYBA 4M7AE 4M7DE 4E6RA 5LJ3j 2BE9B 1ZX6A 1VQ8T 1EFNA 4PJOE 3KXTA 3LH0A 2K9GA 3MEVA 4BDZA 1B34A 3C95A 5GAN6 1RL2A 1V1CA 4EMKC 1VUBA 4BI8B 3FLGA 1VQNQ 3JB9J 3DB4A 2SRCA 4OB2B 5IXBA 3TREA 4JJDA 2D8HA 1TU0B 2OTJA 2KI7A 2FL7A 1YWOA 3G6ET 2DTOA 5GAOm 1QMCA 1VOMA 1C1AA 1D0ZA 2DIQA 4OGEA 2EIFA 3PGGA 4MMKA 5GANf 2C0IA 1PM3A 3MKDA 2QA4Q 3UDCA 1KK7A 1Q95G 3TQ7P 2B86A 2X4XA 3LW5E 5CK9A 1KIKA 4WCIA 1JEGA 1VQ4A 2LJ1A 3DLMA 1MNDA 3HKSA 2CP5A 2VWFA 1GRIA 1QW1A 4VUBA 1UECA 4C8QE 4C5EA 1GCQC 4J9HA 3L42A 5GAN2 4C5IA 5I11A 1Q7YC 2DRKA 2ZCFB 1SHFA 3JCMg 3SB2A 1KC8C 1CKAA 4XTUA 2KQWA 4HA8A 4M7AD 4M7DD 2YLBA 2MCNA 3I55T 1UGRB 2O88A 2JUFA 3EGXB 1N9RA 3CPWP 4PJOD 3Q1JA 4J83A 1D0YA 2VYTA 3CMAQ 2DPPB 4YTLA 4A53A 4JDSA 3EGXA 4PFOA 1TUCA 5L8RE 1I5OB 1I8FA 1TS9A 3M0TA 4C92E 1K0XA 1YITT 4EMHA 2Y90A 1Z9ZA 2CZ6B 3JB9G 1IO6A 2AKLA 2PVOB 2RI5A 1PRMC 5A0DA 2LJ3A 1YJWA 2XIDA 4JS4A 1FWZA 1YNZA 2LCSA 4AFUC 5FLXE 2LQNA 1GXIE 1QVPA 4M78G 1X01A 4FW1A 3CPWA 3VRZA 3MP8A 5FWCA 2V1QA 5IHNA 2GQVA 4C8QD 3JCMe 2JNGA 1QVFS 3HFOA 1G3YA 3LWIA 3H9NA 4ZNXA 1WJRA 2QTVA 4JZ4A 2DBMA 3SWNC 3FJ5A 4XU2A 3M56A 3OYHA 2HL5C 3CC4T 4CI0C 2MI6A 4R56A 1KFZA 4Y92A 2RQUA 3M0PA 3C94A 1ABQA 1IGQA 4JPBW 3CCLQ 3OYYA 3CCRQ 4C5HA 4X1VA 1VQMQ 3CC2Q 2X9HA 4C92D 1K9AA 1N8RR 2KYBA 1VQ4T 3UA6A 1NEBA 3VKIA 2DO3A 2OTLA 4PJOF 1FMKA 3X20B 1NLOC 2K3YA 2RK1A 2WSCE 4KGXB 1YN8A 1UGSB 1IRXA 1QWFA 5GANh 1O75A 2CYZB 4IUTA 2A28A 2LC4A 3ZBDA 2PVGB 1HXDA 4XK8E 3E9FA 3HTRA 1OQKA 2RI2A 3MEAA 3QYHB 4E7IA 3OYKA 1PRLC 4OMFB 3P8HA 1KJWA 3OBYA 1Q7YU 4D6WA 1JB0E 2LCLA 1KC8U 4D8KA 2J6KA 2RMOA 4J9BA 4C8QF 2ED1A 1VQ7Q 1UHCA 2E6ZA 3EG9B 1SG5A 2RI3A 4PK4A 4ESRA 5GMKe 3GNFB 5KYXA 3GF5A 1H641 1YJWT 5LJ5g 2H3EB 4PJOA 2ZAEA 3EG9A 2L3SA 3KUFA 2QEXA 3CCSA 3TU4K 1JBMA 2WSFE 4QVDA 1RACB 3J81E 2KRMA 1KQSA 2XKOC 4E7JA 2CH4A 4DBRA 2OTJQ 5FRMA 1NG2A 1UG1A 4F7UE 2ECZA 4XU1A 4OP0A 2GF7A 2M51A 4M75E 4JRPA 1GFDA 3L1AA 1UEBA 2X51A 1U1SA 3EFSA 4HCCA 4XU3A 5FW9A 3VS1A 3INZA 4C8QB 1V76A 2QXFA 1NLPC 2BZ8A 4MZMA 1RAIB 3JCMX 2F5TX 3ZFJA 4BE2A 2DYIA 4LDWA 4RCCA 3H0IA 4C8QA 3SDZA 3JCMf 1VQPT 3BFMA 1XQHA 3CCEA 1M90C 3CPWS 5LJ5d 1FMWA 5KE3A 3RMQA 1M1KR 2DJQA 2OJ2A 4CC2A 3U23A 2YUQA 4RTVA 1WIEA 3C4SA 4J9FA 5J3BA 2LNHB 2DL8A 3CCUT 1YFNA 4DBHA 4F04B 1EX4A 4LDXA 2HBWA 2ESWA 4L5GA 4JRIA 2GTJA 2P84A 3DLLA 3G4SA 1PD0A 5I21A 1WQWA 2PZ1A 3M59A 4AFZC 4OGCA 1OX9A 2J6FA 1VQNA 2PUKB 2E70A 5FROA 4Z8AA 2CP2A 3NPFA 4E2FB 2ENMA 2RO0A 4PLLA 3VS4A 4M75D 2BE7D 2D9TA 2A3LA 2NWMA 2DL7A 4HCZA 1YJWQ 1QQJA 4LXCA 1RAGB 1NM7A 2EPDA 3LGLA 1VQOA 1M1GA 4HVWA 3EG1A 2P0KA 3EGDB 3M58A 4J9EA 1PSEA 1WFWA 4LDYA 3RR6A 2IVWA 1NEGA 2RH2A 3UPUA 2ED0A 4FSSA 1QP3A 1S1NA 2WACA 2RM4A 3SHWA 3EGDA 4HKEA 1O9SA 2QEXT 1M2VA 4JJCA 2FG0A 3BE3A 2K2VA 4OF1A 3OB9A 1ZBXA 2P0QA 3CC7Q 4AT1B 2ROTA 5GMKi 1H3ZA 3P8DA 3A8LB 1Q82C 4IUQA 1BI0A 3PMIA 3M5AA 5C6SA 2ZZDA 3CBMA 4RTTA 3CMAA 2I0NA 1VQKA 2CUDA 3DKMA 3QZ5B 2EWNA 1N5ZA 4J6YA 4KULA 5I2MA 1AWJA 2DVEA 3R6NA 1XNIA 1OU8A 2C0OA 4ORZA 5CKEA 3LLRA 1QWEA 3DB3A 4BD3A 1WDXA 3CCQQ 1D3BB 2K5IA 4PKCC 2OTLQ 3EFOB 2BKDN 2K3XA 2PQWA 5IAYA 1ZSZA 1NJIC 2HCKA 2NUPA 5M9OA 1WZOA 1RLPC 7AT1B 4IUPA 2RHIA 2O01E 2VKNA 3EFOA 2EYZA 5HCKA 3JB9H 1KQSS 5GAMg 4BY6C 5FU7B 3TVTA 4F7UF 3I9QA 3JCMc 3GPLA 2J06A 2FPFA 2XG8D 3VYGA 1R0BG 3C12A 1Q81R 5GAOr 4M75F 1GFCA 3JV3A 1BI1A 2DZ9A 4BI3A 2KRSA 1K8AR 3JCMh 2EQIA 1IHWA 2O2OA 2AT1B 1E6GA 2K3BA 4WF2A 1OZ2A 2HSEB 2EQMA 1WHKA 1WNLA 1M90U 2DA9A 4EMKB 2EQJA 1QVFP 1H8KA 1VQNT 1I1JA 1G3WA 1N27A 2ZPHB 1QVGP 5LJ5f 3RIRA 2RHXA 2MF2A 4EMKA 1B3QA 3CCLA 5A2QE 4PFZA 4A4HA 1GCPA 3M0UA 2QA4T 1VQMA 3SEMA 3OYMA 4A4GA 2EW3A 1M9SA 1A0NB 3V8KA 2R5AA 4Y28E 3CCSQ 1D1AA 1MMGA 1W6XA 1BYMA 1R8OB 2VXEA 2LZ6B 4JRKA 2KK4A 2XU8A 3CXCP 2EBPA 1VQ9A 3VS6A 1WGSA 4OVAA 3CCJA 2KT8A 2RK2A 3JCMP 1XJWB 2MIOA 5A0LA 4QVCA 1BBZA 5GAMe 3FC3A 2DF6A 2FZCB 4M75A 2JTMA 1AZEA 1QVGA 2ZPFB 2DNUA 4J9DA 2M9UA 2E41A 4RKUE 1G3TA 1GCQA 2HL3A 1N9SA 1F1BB 1LJOA 3JAME 4CC4B 2NYSA 2MWOA 4QW2A 1NZ9A 1I81A 1TOVA 3H0FA 3CMAT 4UC4A 2L5QA 3LH5A 1HK9A 1WXBA 3OYGA 2CSIA 1OX8A 1VYUA 4KUIA 3CCEQ 3QWYA 3CXCA 4NS5A 1Y96B 2YRCA 3EGUA 4F14A 4BI4A 3NTIA 2DAQA 1U5SA 2K57A 3FJPA 1Q82U 5D7UA 4CRIA 1Y96A 3PIOA 2JMAA 1YJNQ 3H41A 5GMKh 1JU5C 2FZKB 3ZEHA 2DXTA 3G4SQ 2QGGA 3J80E 3L2RA 5HY6A 3GIBA 2BZXA 4M78E 3EH2A 1PD1A 2J6OA 4N4GA 4LUDA 2DBKA 1VQ6A 2HNIA 3UWNA 2AIRB 1NJIU 3X25B 1K73R 5GJVB 1X43A 4M77C 3SWNB 2P4TA 2DK3A 2FYKA 3UA7A 2HQHA 2KRNA 3E9GA 2LDMA 2RJFA 1VQOQ 1K9MC 3OYEA 4X34A 3CCLT 3SWNA 4RUGA 3CCRT 2HAXA 1W4SA 2MAMA 5FU6B 1VQMT 4NL3A 3CC2T 1UGQB 4RTUA 3OYDA 4ME7A 1TSFA 3S3NA 1I4K1 4KH1B 1UTIA 2IPOB 4K11A 1G2BA 2QQBA 1OPKA 3JB9D 1I07A 2V26A 4N0AC 2W10A 5LJ5h 4M4ZA 2QG9B 4RG8A 3NGPA 3M55A 4RTWA 3JB9I 1K1ZA 2MPXC 1Q86C 1NPRA 2RF0A 1KSWA 1M4ZA 2A7YA 1KD1C 1VQKQ 3PVLA 1AOJA 3EHQA 3QPHA 3QXEB 4M78D 4KH0B 2CZ1B 4RTZA 1JO8A 1OYXA 3RKXA 2AKKA 5GMKj 1YI2Q 3CD6A 2X4WA 2M02A 4J7FA 3MPUB 4PNOA 1LPLA 4Z89A 2AK5A 4BE0A 4JJNK 1U06A 3H8ZA 2RB6A 1X2QA 2GFUA 5GAMf 2EJGA 1VQ7T 3JCMd 3VJPA 4RG2A 2HD0A 4M7AG 1BIAA 2VV5A 4HT8A 4ZGDB 1U8RA 1N6AA 5GAN7 1QVGS 1G3SA 3LX7A 2DM1A 3HRSA 2JOYA 2L3QA 4XTXA 3OS1A 3CC7A 4X9CA 4BDYA 2OTJT 1H3HA 1YWPA 5LJ3e 2LT4A 2D6FA 3BY7A 2KROA 3A5ZB 3CXCS 4L6V5 3VYHB 1SPKA 4Z02A 3FEOA 3QSUA 3VS0A 1SHGA 3C0CA 1B07A 3L2WA 5LJ5j 2PNIA 5CVIA 2RPNA 4BUGA 1D0XA 2YHTA 3JB9F 3G1JA 2D8JA 4C0ZA 3CCQA 1VQ9Q 2RQRA 1X2KA 2AZSA 3CCJQ 3ZL7C 2DILA 2VVKA 3MP6A 2ROLA 3G71A 5GMKl 3WVDB 2CS7A 4M78F 4DEXA 3EHRA 2KY9A 3IQLA 4JUVA 4QVZA 2KEAA 1BKBA 2Y4XA 3X24B 4ZGJB 1U1TA 4AMCA 3OS5A 5FRNA 2HKNA 1K9MU 3NFCA 3QG1A 1Y07A 5CKDA 3HFNA 3OYAA 1WYXA 3QYGB 1KQSP
chains in the Genus database with same CATH topology
2NWMA 2DL7A 1JQQA 1UGVA 3TSWA 1AVZC 2DL3A 4GLMA 2JT4A 2CREA 1NM7A 2FRYA 1M30A 2EPDA 5L23A 2D1XA 2O9VA 4F16A 4HVWA 2JM8A 3EG1A 2DE0X 2CT4A 2FEIA 4J9EA 1WFWA 2A37A 2CH4W 2KT1A 1NEGA 4HCKA 4R0KA 5EC7A 2EGAA 2RQTA 1M8MA 4J9IA 2ED0A 4FSSA 4LNPA 1S1NA 3VS2A 2O31A 3SHWA 1VA7A 1QKWA 4Z88A 2OI3A 4JJCA 1Z9QA 2FG0A 2JS0A 1Y57A 1X69A 1WX6A 3GBQA 1MUZA 1ZSGA 1AZGB 1UDLA 3EG0A 2LQWA 2ROTA 2J05A 1TUDA 2DVJA 1RI9A 1T3SA 4AG1C 1GL5A 2K7AA 1UJYA 2DL5A 3VS5A 1K4US 2KYMA 2DLPA 1AWOA 1JXMA 4F17A 1WXUA 4RTTA 1H92A 2I0NA 4AFSC 2CUDA 1RUWA 2V1RA 1N5ZA 3PVQA 1AWJA 1TG0A 3R6NA 3O5ZA 5GJWB 2HEQA 2RN8A 4RTXA 2C0OA 4ORZA 2RQVA 1QWEA 2DYBA 4J9CA 1PHTA 1WDXA 2CDTA 2G6FX 1WLPB 4E6RA 1ZX6A 1EFNA 2HCKA 2K9GA 1RLPC 1M3CA 1V1CA 2OAWA 2VKNA 1M27C 2EYZA 2JTEA 5HCKA 1T0JA 2K2MA 2CT3A 2GNCA 2YUPA 2SRCA 1WI7A 5IXBA 3TVTA 3I9QA 2J06A 4JJDA 2FPFA 4OMQA 3VRYA 2D8HA 3NHNA 1GFCA 3JV3A 4CC7A 2EGEA 2KRSA 1YWOA 2LX7A 4OMNA 2SEMA 2EQIA 1PKTA 2O2OA 1E6GA 2K3BA 3UF4A 2C0IA 2B86A 2DA9A 2KXCA 1H8KA 2A36A 4CC3A 4DEYA 1I1JA 1HJDA 1JXOA 1K76A 1KIKA 2AZVA 2GTOA 2BZYA 4WCIA 1JEGA 2LJ0A 2LJ1A 4AFQC 4J9GA 2VWFA 1GRIA 1B3QA 1UECA 2C0TA 2E5KA 1GCQC 4J9HA 1GCPA 3M0UA 5I11A 2RQWA 2DRKA 2FPDA 3SEMA 1SHFA 2X3XD 1UHFA 2KNBB 3I5SA 2EW3A 1A0NB 1U3OA 1CKAA 1W6XA 2H8HA 1FYNA 2LZ6B 2MCNA 2EBPA 2YSQA 1ABOA 3VS6A 1UFFA 2O88A 2KT8A 1T3LA 1X27A 3REBB 3UATA 5ECAA 2MIOA 4D8DA 1BB9A 1BBZA 2DF6A 5I22A 2FO0A 4GBQA 2W0ZA 1SRMA 2O9SA 1AZEA 2DNUA 2JS2A 1TUCA 1YP5A 4J9DA 3M0TA 2FRWA 1K0XA 2YUNA 1GCQA 1J3TA 2DRMA 2J7IA 4OMLA 1ZBJA 4CC4B 1Z9ZA 1AEYA 1I0CA 2GGRA 1IO6A 2AKLA 3VS7A 1AD5A 1PRMC 3H0FA 2EYXA 2LJ3A 1QKXA 3LH5A 4QT7A 1YNZA 1WXBA 2LCSA 4AFUC 2LQNA 2CSIA 1VYUA 2D0NA 1WA7A 3QWYA 2EKHA 2L0AA 2GQIA 3EG2A 5IH2A 2EGCA 2PTKA 3EGUA 4F14A 1AWWA 3VRZA 1K0SA 1OEBA 5FWCA 2V1QA 5IHNA 2KXDA 1U5SA 3I5RA 2JMAA 2GBQA 2DL4A 3H41A 4HVUA 4ZNXA 3CQTA 4JZ4A 1JU5C 3EG3A 2DBMA 1PWTA 3FJ5A 1W1FA 2F2WA 1SRLA 4IIOA 2KBTA 2BZXA 1QCFA 1KFZA 4Y92A 3VS3A 3A98A 1QLYA 2RQUA 3M0PA 1XOVA 2J6OA 2KR3A 3KFVA 4LUDA 2DBKA 2YUOA 1ABQA 1WXTA 4JPBW 2BTTA 4KRTA 4X1VA 3TSZA 1ARKA 2KGTA 2YT6A 5GJVB 1X43A 2F2VA 1K9AA 3UA7A 2F2XA 2KRNA 4OMPA 1UE9A 2KYBA 1LCKA 2JM9A 3UA6A 5IHKA 5IHIA 1OV3A 1UJ0A 1NEBA 2LMJA 4A63B 1FMKA 4RUGA 1NLOC 1MV0B 1GBRA 1YN8A 5IXFA 1E6HA 1QWFA 4JZ3A 2EYYA 2FPEA 4RTUA 1NYFA 2HDAA 2A28A 2YDLA 2JW4A 3M0QA 1UTIA 4K11A 1ZLMA 1G2BA 1OPKA 3PE0A 2K79A 2LP5A 1I07A 2W10A 4M4ZA 2JXBA 1OOTA 2EYWA 3NGPA 4RTWA 2CUBA 1UUEA 1PRLC 1KJWA 3H0HA 1K1ZA 1X6GA 1CKBA 2XMFA 3M0SA 2RF0A 1BU1A 1KSWA 2MOXA 3PVLA 1AOJA 3EHQA 4LE9A 2EVRA 2K6DA 4D8KA 4RTZA 2J6KA 1M3BA 2RMOA 4J9BA 1JO8A 2ED1A 1UHCA 2AKKA 2DX1A 1YCSB 4ESRA 1M3AA 1RLQC 4Z89A 2AK5A 2KE9A 1GBQA 2IIMA 1W70A 1U06A 5FWBA 2L3SA 2CSQA 1X2QA 4HVVA 1ZUUA 3M0RA 2ABLA 1BK2A 2KRMA 2NUZA 1X6BA 2CH4A 2L2PA 1CSKA 1OPLA 2DMOA 1NYGA 1NG2A 1UG1A 2X3WD 2ECZA 2P4RA 3RNJA 2A08A 2M51A 3QWXX 1GFDA 4LN2A 4AG2C 2DM1A 2RNAA 5FW9A 3VS1A 2L3QA 1NLPC 1VYVA 1ZUKA 2BZ8A 1T0HA 1H3HA 1YWPA 4JJBA 2JMCA 1ZUYA 2QDLA 3H0IA 3ULRB 4RTYA 2KROA 1SPKA 1MV3A 3VS0A 1SHGA 4OMMA 3C0CA 1B07A 2PNIA 1SEMA 2RPNA 2DJQA 2OJ2A 4HXJA 4CC2A 3U23A 2D8JA 2YUQA 4RTVA 1WIEA 4J9FA 2LNHB 2DL8A 1HSQA 2RQRA 1VYTA 1X2KA 2AZSA 3ZL7C 2DILA 2HSPA 1HD3A 2VVKA 2ROLA 3THKA 1PNJA 4IIMA 4EIKA 2HBWA 2ESWA 1E7OA 2GTJA 3EHRA 3NMZC 4DEXA 3IQLA 4OMOA 2PZ1A 2KEAA 4AFZC 2J6FA 1G83A 3I35A 1PKSA 4LUEA 3RBBB 4Z8AA 3REAB 1AWXA 1WYXA 3NPFA 2ENMA 2L3PA 3VS4A 2M0YA 1SSHA 1Y0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NWM A;  2DL7 A;  1JQQ A;  1UGV A;  3TSW A;  1AVZ C;  2DL3 A;  4GLM A;  2JT4 A;  2CRE A;  1NM7 A;  2FRY A;  1M30 A;  2EPD A;  5L23 A;  2D1X A;  2O9V A;  4F16 A;  4HVW A;  2JM8 A;  3EG1 A;  2DE0 X;  2CT4 A;  2FEI A;  4J9E A;  1WFW A;  2A37 A;  2CH4 W;  2KT1 A;  1NEG A;  4HCK A;  4R0K A;  5EC7 A;  2EGA A;  2RQT A;  1M8M A;  4J9I A;  2ED0 A;  4FSS A;  4LNP A;  1S1N A;  3VS2 A;  2O31 A;  3SHW A;  1VA7 A;  1QKW A;  4Z88 A;  2OI3 A;  4JJC A;  1Z9Q A;  2FG0 A;  2JS0 A;  1Y57 A;  1X69 A;  1WX6 A;  3GBQ A;  1MUZ A;  1ZSG A;  1AZG B;  1UDL A;  3EG0 A;  2LQW A;  2ROT A;  2J05 A;  1TUD A;  2DVJ A;  1RI9 A;  1T3S A;  4AG1 C;  1GL5 A;  2K7A A;  1UJY A;  2DL5 A;  3VS5 A;  1K4U S;  2KYM A;  2DLP A;  1AWO A;  1JXM A;  4F17 A;  1WXU A;  4RTT A;  1H92 A;  2I0N A;  4AFS C;  2CUD A;  1RUW A;  2V1R A;  1N5Z A;  3PVQ A;  1AWJ A;  1TG0 A;  3R6N A;  3O5Z A;  5GJW B;  2HEQ A;  2RN8 A;  4RTX A;  2C0O A;  4ORZ A;  2RQV A;  1QWE A;  2DYB A;  4J9C A;  1PHT A;  1WDX A;  2CDT A;  2G6F X;  1WLP B;  4E6R A;  1ZX6 A;  1EFN A;  2HCK A;  2K9G A;  1RLP C;  1M3C A;  1V1C A;  2OAW A;  2VKN A;  1M27 C;  2EYZ A;  2JTE A;  5HCK A;  1T0J A;  2K2M A;  2CT3 A;  2GNC A;  2YUP A;  2SRC A;  1WI7 A;  5IXB A;  3TVT A;  3I9Q A;  2J06 A;  4JJD A;  2FPF A;  4OMQ A;  3VRY A;  2D8H A;  3NHN A;  1GFC A;  3JV3 A;  4CC7 A;  2EGE A;  2KRS A;  1YWO A;  2LX7 A;  4OMN A;  2SEM A;  2EQI A;  1PKT A;  2O2O A;  1E6G A;  2K3B A;  3UF4 A;  2C0I A;  2B86 A;  2DA9 A;  2KXC A;  1H8K A;  2A36 A;  4CC3 A;  4DEY A;  1I1J A;  1HJD A;  1JXO A;  1K76 A;  1KIK A;  2AZV A;  2GTO A;  2BZY A;  4WCI A;  1JEG A;  2LJ0 A;  2LJ1 A;  4AFQ C;  4J9G A;  2VWF A;  1GRI A;  1B3Q A;  1UEC A;  2C0T A;  2E5K A;  1GCQ C;  4J9H A;  1GCP A;  3M0U A;  5I11 A;  2RQW A;  2DRK A;  2FPD A;  3SEM A;  1SHF A;  2X3X D;  1UHF A;  2KNB B;  3I5S A;  2EW3 A;  1A0N B;  1U3O A;  1CKA A;  1W6X A;  2H8H A;  1FYN A;  2LZ6 B;  2MCN A;  2EBP A;  2YSQ A;  1ABO A;  3VS6 A;  1UFF A;  2O88 A;  2KT8 A;  1T3L A;  1X27 A;  3REB B;  3UAT A;  5ECA A;  2MIO A;  4D8D A;  1BB9 A;  1BBZ A;  2DF6 A;  5I22 A;  2FO0 A;  4GBQ A;  2W0Z A;  1SRM A;  2O9S A;  1AZE A;  2DNU A;  2JS2 A;  1TUC A;  1YP5 A;  4J9D A;  3M0T A;  2FRW A;  1K0X A;  2YUN A;  1GCQ A;  1J3T A;  2DRM A;  2J7I A;  4OML A;  1ZBJ A;  4CC4 B;  1Z9Z A;  1AEY A;  1I0C A;  2GGR A;  1IO6 A;  2AKL A;  3VS7 A;  1AD5 A;  1PRM C;  3H0F A;  2EYX A;  2LJ3 A;  1QKX A;  3LH5 A;  4QT7 A;  1YNZ A;  1WXB A;  2LCS A;  4AFU C;  2LQN A;  2CSI A;  1VYU A;  2D0N A;  1WA7 A;  3QWY A;  2EKH A;  2L0A A;  2GQI A;  3EG2 A;  5IH2 A;  2EGC A;  2PTK A;  3EGU A;  4F14 A;  1AWW A;  3VRZ A;  1K0S A;  1OEB A;  5FWC A;  2V1Q A;  5IHN A;  2KXD A;  1U5S A;  3I5R A;  2JMA A;  2GBQ A;  2DL4 A;  3H41 A;  4HVU A;  4ZNX A;  3CQT A;  4JZ4 A;  1JU5 C;  3EG3 A;  2DBM A;  1PWT A;  3FJ5 A;  1W1F A;  2F2W A;  1SRL A;  4IIO A;  2KBT A;  2BZX A;  1QCF A;  1KFZ A;  4Y92 A;  3VS3 A;  3A98 A;  1QLY A;  2RQU A;  3M0P A;  1XOV A;  2J6O A;  2KR3 A;  3KFV A;  4LUD A;  2DBK A;  2YUO A;  1ABQ A;  1WXT A;  4JPB W;  2BTT A;  4KRT A;  4X1V A;  3TSZ A;  1ARK A;  2KGT A;  2YT6 A;  5GJV B;  1X43 A;  2F2V A;  1K9A A;  3UA7 A;  2F2X A;  2KRN A;  4OMP A;  1UE9 A;  2KYB A;  1LCK A;  2JM9 A;  3UA6 A;  5IHK A;  5IHI A;  1OV3 A;  1UJ0 A;  1NEB A;  2LMJ A;  4A63 B;  1FMK A;  4RUG A;  1NLO C;  1MV0 B;  1GBR A;  1YN8 A;  5IXF A;  1E6H A;  1QWF A;  4JZ3 A;  2EYY A;  2FPE A;  4RTU A;  1NYF A;  2HDA A;  2A28 A;  2YDL A;  2JW4 A;  3M0Q A;  1UTI A;  4K11 A;  1ZLM A;  1G2B A;  1OPK A;  3PE0 A;  2K79 A;  2LP5 A;  1I07 A;  2W10 A;  4M4Z A;  2JXB A;  1OOT A;  2EYW A;  3NGP A;  4RTW A;  2CUB A;  1UUE A;  1PRL C;  1KJW A;  3H0H A;  1K1Z A;  1X6G A;  1CKB A;  2XMF A;  3M0S A;  2RF0 A;  1BU1 A;  1KSW A;  2MOX A;  3PVL A;  1AOJ A;  3EHQ A;  4LE9 A;  2EVR A;  2K6D A;  4D8K A;  4RTZ A;  2J6K A;  1M3B A;  2RMO A;  4J9B A;  1JO8 A;  2ED1 A;  1UHC A;  2AKK A;  2DX1 A;  1YCS B;  4ESR A;  1M3A A;  1RLQ C;  4Z89 A;  2AK5 A;  2KE9 A;  1GBQ A;  2IIM A;  1W70 A;  1U06 A;  5FWB A;  2L3S A;  2CSQ A;  1X2Q A;  4HVV A;  1ZUU A;  3M0R A;  2ABL A;  1BK2 A;  2KRM A;  2NUZ A;  1X6B A;  2CH4 A;  2L2P A;  1CSK A;  1OPL A;  2DMO A;  1NYG A;  1NG2 A;  1UG1 A;  2X3W D;  2ECZ A;  2P4R A;  3RNJ A;  2A08 A;  2M51 A;  3QWX X;  1GFD A;  4LN2 A;  4AG2 C;  2DM1 A;  2RNA A;  5FW9 A;  3VS1 A;  2L3Q A;  1NLP C;  1VYV A;  1ZUK A;  2BZ8 A;  1T0H A;  1H3H A;  1YWP A;  4JJB A;  2JMC A;  1ZUY A;  2QDL A;  3H0I A;  3ULR B;  4RTY A;  2KRO A;  1SPK A;  1MV3 A;  3VS0 A;  1SHG A;  4OMM A;  3C0C A;  1B07 A;  2PNI A;  1SEM A;  2RPN A;  2DJQ A;  2OJ2 A;  4HXJ A;  4CC2 A;  3U23 A;  2D8J A;  2YUQ A;  4RTV A;  1WIE A;  4J9F A;  2LNH B;  2DL8 A;  1HSQ A;  2RQR A;  1VYT A;  1X2K A;  2AZS A;  3ZL7 C;  2DIL A;  2HSP A;  1HD3 A;  2VVK A;  2ROL A;  3THK A;  1PNJ A;  4IIM A;  4EIK A;  2HBW A;  2ESW A;  1E7O A;  2GTJ A;  3EHR A;  3NMZ C;  4DEX A;  3IQL A;  4OMO A;  2PZ1 A;  2KEA A;  4AFZ C;  2J6F A;  1G83 A;  3I35 A;  1PKS A;  4LUE A;  3RBB B;  4Z8A A;  3REA B;  1AWX A;  1WYX A;  3NPF A;  2ENM A;  2L3P A;  3VS4 A;  2M0Y A;  1SSH A;  1Y0M A; 
#chains in the Genus database with same CATH topology
 3QO3 A;  2JJ9 A;  4GLM A;  2F5K A;  3OW2 P;  2FRY A;  3A8G B;  5L23 A;  2D1X A;  4C92 G;  4F16 A;  2JM8 A;  3S6W A;  3JCM Q;  2YXY A;  3OSS C;  3CD6 T;  2CH4 W;  4R0K A;  4PL6 A;  2HZY A;  2RQT A;  1M8M A;  4M78 B;  1Q86 U;  3VS2 A;  3LWH A;  4Z88 A;  2LX9 A;  2OI3 A;  1KD1 U;  1Z9Q A;  1WX6 A;  1VQ5 Q;  2YLC A;  1MUZ A;  4M78 A;  3M57 A;  3MP1 A;  2QTX A;  1AZG B;  1Q7Y R;  2BIV A;  2LQW A;  2J05 A;  2HQE A;  2Z0W A;  5CAI A;  1KC8 R;  8AT1 B;  4MZP A;  1UJY A;  2DLP A;  2NUT B;  1VQ6 Q;  1AWO A;  2QDY B;  3OW2 A;  1WXU A;  4XTV A;  2XK0 A;  4FT4 A;  5EG2 A;  3MET A;  2LQK A;  4O6J A;  2KDS A;  4V2S A;  5GAM h;  2Y4Y A;  1TG0 A;  2PVD B;  3CC7 T;  3KBG A;  2NUT A;  6AT1 B;  2NLU A;  4RTX A;  2MK5 A;  2FB7 A;  1PHT A;  2CDT A;  5CKF A;  1WLP B;  1FXX A;  2DJZ A;  2XDB A;  3TEE A;  4LD6 A;  4FSX A;  1ZA1 B;  3A8O B;  2OAW A;  1ZA2 B;  1OUL A;  3A1P A;  4IUU A;  1M27 C;  1WPY A;  2E4H A;  2JTE A;  2YRD A;  1T0J A;  2H3J A;  4KUD K;  2YUP A;  4Y91 A;  4HT9 A;  2K4Y A;  1WI7 A;  3CCQ T;  2C06 A;  2OTL T;  4FL6 A;  4OMQ A;  3NHN A;  1S72 A;  5I2S A;  3PTA A;  2LX7 A;  1YJN A;  3M9Q A;  3E2U A;  3HP9 A;  4N4I A;  4E7K A;  1YCY A;  5DY9 A;  3UF4 A;  1G5V A;  2HKQ B;  2L8D A;  1D1C A;  1WHH A;  4DEY A;  2A36 A;  4OB0 B;  2M0O A;  3JCM V;  4CC3 A;  3ASK A;  4MDW A;  5CR2 A;  1JXO A;  1K76 A;  2GTO A;  2BZY A;  2KVQ G;  3I56 A;  4BY6 B;  3CD6 Q;  2C0T A;  3VU3 C;  1JJ2 P;  4M7A C;  2RQW A;  4M7D C;  2X3X D;  1VQL Q;  2QQA A;  3I5S A;  1IZ6 A;  4EPC A;  1WJS A;  1U3O A;  2P0P A;  4PJO C;  2V8J A;  1KHC A;  4C5G A;  2H8H A;  1TH7 A;  3GOX A;  2CZ0 B;  2R57 A;  4QQ6 A;  2YSQ A;  1ABO A;  1D09 B;  4GY5 A;  4QKU A;  3V7C A;  4X9D A;  1T3L A;  5GAO n;  5ECA A;  5GAM j;  3L2V A;  4M77 G;  1PG5 B;  1BB9 A;  1PCX A;  5GAN 3;  1YHQ A;  4LDV A;  2E12 A;  4J8O A;  2FO0 A;  3M54 A;  5J26 A;  3S3O A;  4E7H A;  1M5Q 1;  4R55 A;  2W0Z A;  1SRM A;  2O9S A;  3CCS T;  1IRE B;  5AYF A;  1MHN A;  2F1L A;  2FRW A;  1M1F A;  3AT1 B;  3PNW C;  2DRM A;  3CBO A;  1QP2 A;  1KQ2 A;  1JJ2 A;  2ATC B;  1I0C A;  2DXU A;  1YJ9 Q;  1AD5 A;  2EYX A;  1QKX A;  1VIE A;  4FYV B;  4QT7 A;  3PFS A;  3HRT A;  4C8Q C;  2D0N A;  1WA7 A;  2DET A;  2EKH A;  2L0A A;  2GQI A;  1QCN A;  4N4H A;  4HCB A;  2EGC A;  2E10 A;  2JTF A;  2M16 A;  3D7S B;  1RI0 A;  1AWW A;  1MMD A;  4FYX B;  1YI2 A;  2KXD A;  2O4X B;  3CCM A;  4RMO A;  2VGN A;  3FB9 A;  1M2O A;  2GCX A;  2DL4 A;  2LNV A;  3G71 Q;  3CQT A;  3EG3 A;  3BW1 A;  2F69 A;  3CCE T;  1PWT A;  2XD0 A;  1W1F A;  1R0C B;  2F2W A;  5GAO p;  2O4X A;  1D3B A;  1P92 A;  1QCF A;  5CCA A;  1QCO A;  4M77 F;  3A98 A;  3QZ9 B;  4B9X A;  3OYL A;  5GAN e;  4A4K A;  2KR3 A;  3OW2 S;  1YJN T;  2YUO A;  4C92 C;  2BTT A;  1VQ8 A;  1NPP A;  4PJM A;  3TSZ A;  1ARK A;  3G4S T;  1ACM B;  1TWB A;  2F2V A;  3G7Z A;  2QGF B;  4P5N A;  2F2X A;  3OS0 A;  2ZPG B;  4OMP A;  4XTW A;  5IHI A;  1OV3 A;  2LMJ A;  4FYW B;  1W2B P;  2XI9 A;  4A63 B;  3OBW A;  1YBY A;  3JSC A;  2FZG B;  3G6E A;  5CIU A;  1GBR A;  1E6H A;  2EYY A;  2FPE A;  3QBY A;  2DTH A;  3E19 A;  4DOV A;  1VQO T;  4M77 B;  3M0Q A;  2LVM A;  3GLX A;  2DD4 A;  2K79 A;  2LP5 A;  2AHJ B;  1M90 R;  3QHS A;  1OOT A;  2EYW A;  2CUB A;  5GAM d;  2EQK A;  4M77 A;  1UUE A;  4MDX A;  3H0H A;  3N5B B;  2QQ9 A;  3M0S A;  2LRQ A;  1BCO A;  3L2Q A;  1BU1 A;  2E5Q A;  2WSE E;  2MOX A;  4LE9 A;  4XQ3 A;  2EVR A;  1UGP B;  2K6D A;  1BIB A;  4KGZ B;  1W2B A;  5IT9 E;  4FYY B;  1M3B A;  3JCM W;  3I55 A;  3NTK A;  3WXM B;  4EDU A;  1SSF A;  1M3A A;  4L59 A;  2D0Q B;  2LCC A;  3OA6 A;  4FT2 A;  1G8X A;  3CME Q;  4PJJ A;  2IIM A;  2RJE A;  4XU0 A;  1FX7 A;  1VQK T;  3QUI A;  5FWB A;  2K5L A;  5GAN 5;  2CSQ A;  1ZSZ C;  4N0A A;  5CO7 A;  2RHY A;  3M0R A;  2ABL A;  4FCY A;  1TTH B;  3CBP A;  4J5Y A;  1YIT A;  1BK2 A;  1WHJ A;  1YI2 T;  1WJQ A;  2NUZ A;  4BE1 A;  1C0M A;  1N8R C;  1OPL A;  2DMO A;  1NYG A;  1WHG A;  1S72 Q;  3RNJ A;  2A08 A;  3CCV Q;  4LN2 A;  4J6X A;  2EKO A;  2RNA A;  3SD4 A;  1VQ5 A;  5FU7 C;  2VB6 A;  1JJ2 S;  1ZUK A;  1T0H A;  2KSS A;  3L2U A;  1MMN A;  3I56 Q;  4JJB A;  3OMG A;  2JMC A;  1ZUY A;  4RTY A;  2XIC A;  1V29 B;  4FW2 A;  3WVE B;  4XTZ A;  2KAF A;  3OYB A;  1Q82 R;  1X75 C;  1PC0 A;  3CC4 A;  1B7T A;  4TVR A;  2MMP A;  1OI1 A;  4MML A;  2I2L A;  4BB7 A;  3J7A F;  2HSP A;  1HD3 A;  2E1H A;  2EYQ A;  2RHZ A;  3MO8 A;  2E6N A;  1IHV A;  3ME9 A;  2LQ8 A;  5CKB A;  1YHQ Q;  2V8I A;  4PJN A;  1RAB B;  4E7S A;  4OMO A;  2DEU A;  3H6Z A;  4LD9 K;  4M75 C;  1NJI R;  3HSB A;  1VQ9 T;  3RBB B;  3CCJ T;  3HHT B;  3L2Z A;  2L3P A;  2M0Y A;  1SSH A;  1Y0M A;  1RAH B;  3M4Y A;  3RKY A;  1BI2 A;  2MWP A;  2X4J A;  3BDL A;  4JLI A;  1UGV A;  3TSW A;  1AVZ C;  2DL3 A;  3T9N A;  2JT4 A;  4ZGE B;  3QII A;  1LOJ A;  4C0D C;  3RES A;  5LJ3 g;  1AHJ B;  4NOY A;  4JS5 A;  1KHI A;  4LDU A;  5GAN 4;  2A0F B;  4HCK A;  5EC7 A;  4PLI A;  3CCM Q;  4J9I A;  2E3H A;  1EIF A;  4LNP A;  4J6W A;  1VA7 A;  2JZ2 A;  1VQL A;  1PSF A;  1X69 A;  3X28 B;  1IB8 A;  4KBM B;  5KCH A;  4IUV A;  3GBQ A;  1OU9 A;  2VXF A;  1ZSG A;  2FHD A;  3QJ6 A;  2CP3 A;  5GAO q;  4M7D G;  2XHC A;  2DVJ A;  1GL5 A;  2K7A A;  1M1K C;  4XAX B;  2KYM A;  1JXM A;  3MHX A;  4F17 A;  4PJO G;  1H92 A;  1VQ8 Q;  1RUW A;  1W2B S;  5KYW B;  4OB3 B;  5A0G A;  2OX7 A;  1VQ5 T;  3PVQ A;  2HEQ A;  3CEY A;  1D1B A;  4J9C A;  2HBP A;  3V7S A;  5LJ3 d;  5KYW A;  2G6F X;  1N8R U;  1VQ6 T;  1YJ9 A;  1LVK A;  3MEU A;  4KGV B;  3G6E Q;  1UB4 A;  1VIF A;  2QK0 A;  1M3C A;  2G3R A;  3SFM A;  2DIG A;  3E1S A;  2K2M A;  2CT3 A;  2GNC A;  1EZZ B;  4C0F A;  2IG0 A;  4Q5W A;  1DJ7 B;  3PT9 A;  2QYZ A;  5FU6 C;  3VRY A;  5DM7 R;  2L89 A;  4CC7 A;  2EGE A;  4C8Q G;  4OMN A;  2SEM A;  3MCA B;  1PKT A;  4QQD A;  1VQP A;  2VGM A;  1WQ7 A;  3HL8 A;  3NTH A;  3M53 A;  3QDF A;  9ATC B;  4B9W A;  4A54 A;  2K5F A;  2KXC A;  4M7D F;  4M7A F;  1RAE B;  2RJC A;  1HJD A;  3OYJ A;  2AZV A;  5KYN A;  2LJ0 A;  4AFQ C;  4J9G A;  3I55 Q;  3JRZ A;  3EAE A;  2XDP A;  3CCU A;  2E5K A;  2EJ9 A;  2DXB A;  3OMC A;  2FPD A;  3P8B B;  1R77 A;  1UHF A;  2KNB B;  3X26 B;  4KT0 E;  5GAN 8;  4NL2 A;  1FYN A;  1RAD B;  5KYU B;  5CQY A;  1YIT Q;  1UFF A;  1X27 A;  3REB B;  3UAT A;  4D8D A;  3GNG A;  1K9M R;  5KYU A;  1VQL T;  5I22 A;  2EAY A;  4GBQ A;  4M7A B;  1HYO A;  4M7D B;  2JS2 A;  1YP5 A;  5KYX B;  2YUN A;  4PJO B;  4OB1 B;  1J3T A;  3MEW A;  3OY9 A;  2J7I A;  4M7A A;  4M7D A;  4OML A;  3OQ5 A;  1ZBJ A;  3V8L A;  2MYS A;  4PFP A;  2COW A;  1AEY A;  2GGR A;  3VS7 A;  4WTO B;  4M77 E;  2CP7 A;  4RCB A;  3V7R A;  4DBQ A;  5AT1 B;  3MJX A;  3O8V A;  3PIP A;  1MNE A;  4DQ2 A;  4EMG A;  1OZ3 A;  2RA2 A;  1Q81 C;  1K8A C;  3EG2 A;  5IH2 A;  3OSV A;  2PTK A;  3R6O A;  3CC4 Q;  1FMV A;  1Q86 R;  1K0S A;  1OEB A;  3OS2 A;  1KD1 R;  3A8H B;  1YJ9 T;  3I5R A;  4O5V A;  3QKJ A;  1M1K U;  2GBQ A;  3RDV A;  3CME A;  4IKF A;  4HVU A;  1IGU A;  4C92 F;  2R58 A;  1KG1 A;  2YWW A;  1TUG B;  1SRL A;  5J39 A;  2DFU A;  4IIO A;  2KBT A;  4DOW A;  2BUD A;  2CP6 A;  1IXD A;  2GFA A;  1ZQ1 A;  3VS3 A;  5GAN j;  1VQ4 Q;  1QLY A;  1XOV A;  3KFV A;  4J7I A;  1WXT A;  3G71 T;  3RER A;  1C6V X;  1KQ1 A;  1ZHI A;  4KRT A;  1RAA B;  3URG A;  3CCV A;  5LJ3 f;  2KGT A;  2YT6 A;  1YIJ A;  3OYI A;  2KMT A;  5LJ5 e;  1UE9 A;  1LCK A;  2JM9 A;  5HKC A;  5IHK A;  5KH6 A;  1UJ0 A;  4ANJ A;  1X6O A;  4M77 D;  1LNX A;  1MV0 B;  3M4G A;  4C92 B;  5IXF A;  2ZPB B;  1RAF B;  3JCM J;  4JZ3 A;  1NYF A;  2HDA A;  2YDL A;  4E7L A;  2QQS A;  3OYN A;  2JW4 A;  3VUB A;  3HPW A;  4ELZ C;  4C92 A;  1ZLM A;  2R5M A;  5GMK m;  3PE0 A;  2COY A;  2JXB A;  4M78 C;  2RD1 A;  1X6G A;  2ZPI B;  1CKB A;  2XMF A;  2QA4 A;  3LYI A;  1NBE B;  5CKH A;  2HMA A;  5GAN g;  3TCJ A;  4XTY A;  3RMS A;  1M2V B;  4FM4 B;  2DX1 A;  4ZTJ A;  1YCS B;  2CGH A;  5IN1 A;  2VAS A;  2E65 A;  1RLQ C;  4F7U G;  2CP0 A;  3A8M B;  4ZN1 A;  4E47 A;  2KE9 A;  4ATO A;  1GBQ A;  1AT1 B;  4DBF A;  1W70 A;  4M75 G;  3BDU A;  2M1H A;  2DKG A;  2L3R A;  4HVV A;  1ZUU A;  4QQG A;  5C0M A;  3VV0 A;  2QI2 A;  1K73 C;  1X6B A;  1BI3 A;  2L2P A;  4A4F A;  1CSK A;  3VUZ A;  2FVU A;  1BCM A;  2COZ A;  3CME T;  2QAS A;  2X3W D;  3HRU A;  5DLQ E;  2P4R A;  4GLK A;  3QJY A;  1VQP Q;  3QWX X;  4AG2 C;  1Q81 U;  5GAO l;  1K8A U;  1SKU B;  1ZSZ B;  3FRN A;  1VYV A;  1WHM A;  2NUP B;  4II1 A;  1XTD A;  2CKK A;  4B6M A;  5GAN d;  4BAC A;  4ZTF A;  5KE2 A;  1S72 T;  4FU6 A;  2QDL A;  3CCU Q;  3ULR B;  1MGQ A;  3CCV T;  3F70 A;  1YIJ T;  1MV3 A;  2B8A A;  2PUO B;  2QAZ A;  4OMM A;  1MMA A;  3FIF A;  5HK0 A;  1SEM A;  4HXJ A;  2LTO A;  3ER0 A;  2HQX A;  4ELY C;  3I56 T;  2DEQ A;  5LL6 S;  4C0G A;  1HSQ A;  1VYT A;  1M8V A;  2RJD A;  5D6W A;  1I5L A;  1NE8 A;  2X35 A;  2EJF A;  5DLO A;  3THK A;  1PNJ A;  4IIM A;  2LT1 A;  4EIK A;  3OYF A;  2E64 A;  5LJ3 h;  1E7O A;  3NMZ C;  4E7Z A;  2CZ7 B;  1WHL A;  2RHU A;  1Y7X A;  5KCO A;  1G83 A;  4DA4 A;  3I35 A;  2DER A;  2X4Y A;  2E3I A;  1PKS A;  4LUE A;  3REA B;  3FDR A;  3UT1 A;  1AWX A;  2QQR A;  3CCR A;  3EH1 A;  2JVV A;  1YHQ T;  4JLG A;  4ZN3 A;  1JQQ A;  2XDD A;  3CC2 A;  2ZPE B;  3AHU A;  5D6X A;  3LGF A;  5CQX A;  1SF9 A;  2ZGW A;  2QEX Q;  2CRE A;  3GP8 A;  1M30 A;  4F7U B;  2O9V A;  2V8K A;  2DD5 A;  2DTI A;  3RKW A;  2DE0 X;  5HK3 A;  4M75 B;  4FIB A;  2CT4 A;  1JRI A;  2DZC A;  2FEI A;  5D6Y A;  2A37 A;  1TXQ A;  2KT1 A;  2EGA A;  4F7U A;  1QVF A;  2O31 A;  1QKW A;  3V8J A;  3S3M A;  3CPF A;  3OYC A;  2JS0 A;  1Y57 A;  2OAU A;  4MZT A;  2VC8 A;  2DXC A;  4C0D B;  5KYY B;  1UDL A;  3EG0 A;  2VUB A;  2EQU A;  4IUR A;  1Y71 A;  1TUD A;  3PMT A;  8ATC B;  1RI9 A;  3CCM T;  1T3S A;  4A4E A;  2EFI A;  4AG1 C;  2DL5 A;  3VS5 A;  1K4U S;  3EFR A;  5KYY A;  3JCM b;  2YRV A;  4AFS C;  2JN0 A;  2V1R A;  4PJL A;  4JRQ A;  1YIJ Q;  3QDR B;  3O5Z A;  5GJW B;  3RUX A;  2PU9 B;  1VQ7 A;  2RN8 A;  2RQV A;  1B34 B;  1K73 U;  2DYB A;  4M7A E;  4M7D E;  4E6R A;  5LJ3 j;  2BE9 B;  1ZX6 A;  1VQ8 T;  1EFN A;  4PJO E;  3KXT A;  3LH0 A;  2K9G A;  3MEV A;  4BDZ A;  1B34 A;  3C95 A;  5GAN 6;  1RL2 A;  1V1C A;  4EMK C;  1VUB A;  4BI8 B;  3FLG A;  1VQN Q;  3JB9 J;  3DB4 A;  2SRC A;  4OB2 B;  5IXB A;  3TRE A;  4JJD A;  2D8H A;  1TU0 B;  2OTJ A;  2KI7 A;  2FL7 A;  1YWO A;  3G6E T;  2DTO A;  5GAO m;  1QMC A;  1VOM A;  1C1A A;  1D0Z A;  2DIQ A;  4OGE A;  2EIF A;  3PGG A;  4MMK A;  5GAN f;  2C0I A;  1PM3 A;  3MKD A;  2QA4 Q;  3UDC A;  1KK7 A;  1Q95 G;  3TQ7 P;  2B86 A;  2X4X A;  3LW5 E;  5CK9 A;  1KIK A;  4WCI A;  1JEG A;  1VQ4 A;  2LJ1 A;  3DLM A;  1MND A;  3HKS A;  2CP5 A;  2VWF A;  1GRI A;  1QW1 A;  4VUB A;  1UEC A;  4C8Q E;  4C5E A;  1GCQ C;  4J9H A;  3L42 A;  5GAN 2;  4C5I A;  5I11 A;  1Q7Y C;  2DRK A;  2ZCF B;  1SHF A;  3JCM g;  3SB2 A;  1KC8 C;  1CKA A;  4XTU A;  2KQW A;  4HA8 A;  4M7A D;  4M7D D;  2YLB A;  2MCN A;  3I55 T;  1UGR B;  2O88 A;  2JUF A;  3EGX B;  1N9R A;  3CPW P;  4PJO D;  3Q1J A;  4J83 A;  1D0Y A;  2VYT A;  3CMA Q;  2DPP B;  4YTL A;  4A53 A;  4JDS A;  3EGX A;  4PFO A;  1TUC A;  5L8R E;  1I5O B;  1I8F A;  1TS9 A;  3M0T A;  4C92 E;  1K0X A;  1YIT T;  4EMH A;  2Y90 A;  1Z9Z A;  2CZ6 B;  3JB9 G;  1IO6 A;  2AKL A;  2PVO B;  2RI5 A;  1PRM C;  5A0D A;  2LJ3 A;  1YJW A;  2XID A;  4JS4 A;  1FWZ A;  1YNZ A;  2LCS A;  4AFU C;  5FLX E;  2LQN A;  1GXI E;  1QVP A;  4M78 G;  1X01 A;  4FW1 A;  3CPW A;  3VRZ A;  3MP8 A;  5FWC A;  2V1Q A;  5IHN A;  2GQV A;  4C8Q D;  3JCM e;  2JNG A;  1QVF S;  3HFO A;  1G3Y A;  3LWI A;  3H9N A;  4ZNX A;  1WJR A;  2QTV A;  4JZ4 A;  2DBM A;  3SWN C;  3FJ5 A;  4XU2 A;  3M56 A;  3OYH A;  2HL5 C;  3CC4 T;  4CI0 C;  2MI6 A;  4R56 A;  1KFZ A;  4Y92 A;  2RQU A;  3M0P A;  3C94 A;  1ABQ A;  1IGQ A;  4JPB W;  3CCL Q;  3OYY A;  3CCR Q;  4C5H A;  4X1V A;  1VQM Q;  3CC2 Q;  2X9H A;  4C92 D;  1K9A A;  1N8R R;  2KYB A;  1VQ4 T;  3UA6 A;  1NEB A;  3VKI A;  2DO3 A;  2OTL A;  4PJO F;  1FMK A;  3X20 B;  1NLO C;  2K3Y A;  2RK1 A;  2WSC E;  4KGX B;  1YN8 A;  1UGS B;  1IRX A;  1QWF A;  5GAN h;  1O75 A;  2CYZ B;  4IUT A;  2A28 A;  2LC4 A;  3ZBD A;  2PVG B;  1HXD A;  4XK8 E;  3E9F A;  3HTR A;  1OQK A;  2RI2 A;  3MEA A;  3QYH B;  4E7I A;  3OYK A;  1PRL C;  4OMF B;  3P8H A;  1KJW A;  3OBY A;  1Q7Y U;  4D6W A;  1JB0 E;  2LCL A;  1KC8 U;  4D8K A;  2J6K A;  2RMO A;  4J9B A;  4C8Q F;  2ED1 A;  1VQ7 Q;  1UHC A;  2E6Z A;  3EG9 B;  1SG5 A;  2RI3 A;  4PK4 A;  4ESR A;  5GMK e;  3GNF B;  5KYX A;  3GF5 A;  1H64 1;  1YJW T;  5LJ5 g;  2H3E B;  4PJO A;  2ZAE A;  3EG9 A;  2L3S A;  3KUF A;  2QEX A;  3CCS A;  3TU4 K;  1JBM A;  2WSF E;  4QVD A;  1RAC B;  3J81 E;  2KRM A;  1KQS A;  2XKO C;  4E7J A;  2CH4 A;  4DBR A;  2OTJ Q;  5FRM A;  1NG2 A;  1UG1 A;  4F7U E;  2ECZ A;  4XU1 A;  4OP0 A;  2GF7 A;  2M51 A;  4M75 E;  4JRP A;  1GFD A;  3L1A A;  1UEB A;  2X51 A;  1U1S A;  3EFS A;  4HCC A;  4XU3 A;  5FW9 A;  3VS1 A;  3INZ A;  4C8Q B;  1V76 A;  2QXF A;  1NLP C;  2BZ8 A;  4MZM A;  1RAI B;  3JCM X;  2F5T X;  3ZFJ A;  4BE2 A;  2DYI A;  4LDW A;  4RCC A;  3H0I A;  4C8Q A;  3SDZ A;  3JCM f;  1VQP T;  3BFM A;  1XQH A;  3CCE A;  1M90 C;  3CPW S;  5LJ5 d;  1FMW A;  5KE3 A;  3RMQ A;  1M1K R;  2DJQ A;  2OJ2 A;  4CC2 A;  3U23 A;  2YUQ A;  4RTV A;  1WIE A;  3C4S A;  4J9F A;  5J3B A;  2LNH B;  2DL8 A;  3CCU T;  1YFN A;  4DBH A;  4F04 B;  1EX4 A;  4LDX A;  2HBW A;  2ESW A;  4L5G A;  4JRI A;  2GTJ A;  2P84 A;  3DLL A;  3G4S A;  1PD0 A;  5I21 A;  1WQW A;  2PZ1 A;  3M59 A;  4AFZ C;  4OGC A;  1OX9 A;  2J6F A;  1VQN A;  2PUK B;  2E70 A;  5FRO A;  4Z8A A;  2CP2 A;  3NPF A;  4E2F B;  2ENM A;  2RO0 A;  4PLL A;  3VS4 A;  4M75 D;  2BE7 D;  2D9T A;  2A3L A;  2NWM A;  2DL7 A;  4HCZ A;  1YJW Q;  1QQJ A;  4LXC A;  1RAG B;  1NM7 A;  2EPD A;  3LGL A;  1VQO A;  1M1G A;  4HVW A;  3EG1 A;  2P0K A;  3EGD B;  3M58 A;  4J9E A;  1PSE A;  1WFW A;  4LDY A;  3RR6 A;  2IVW A;  1NEG A;  2RH2 A;  3UPU A;  2ED0 A;  4FSS A;  1QP3 A;  1S1N A;  2WAC A;  2RM4 A;  3SHW A;  3EGD A;  4HKE A;  1O9S A;  2QEX T;  1M2V A;  4JJC A;  2FG0 A;  3BE3 A;  2K2V A;  4OF1 A;  3OB9 A;  1ZBX A;  2P0Q A;  3CC7 Q;  4AT1 B;  2ROT A;  5GMK i;  1H3Z A;  3P8D A;  3A8L B;  1Q82 C;  4IUQ A;  1BI0 A;  3PMI A;  3M5A A;  5C6S A;  2ZZD A;  3CBM A;  4RTT A;  3CMA A;  2I0N A;  1VQK A;  2CUD A;  3DKM A;  3QZ5 B;  2EWN A;  1N5Z A;  4J6Y A;  4KUL A;  5I2M A;  1AWJ A;  2DVE A;  3R6N A;  1XNI A;  1OU8 A;  2C0O A;  4ORZ A;  5CKE A;  3LLR A;  1QWE A;  3DB3 A;  4BD3 A;  1WDX A;  3CCQ Q;  1D3B B;  2K5I A;  4PKC C;  2OTL Q;  3EFO B;  2BKD N;  2K3X A;  2PQW A;  5IAY A;  1ZSZ A;  1NJI C;  2HCK A;  2NUP A;  5M9O A;  1WZO A;  1RLP C;  7AT1 B;  4IUP A;  2RHI A;  2O01 E;  2VKN A;  3EFO A;  2EYZ A;  5HCK A;  3JB9 H;  1KQS S;  5GAM g;  4BY6 C;  5FU7 B;  3TVT A;  4F7U F;  3I9Q A;  3JCM c;  3GPL A;  2J06 A;  2FPF A;  2XG8 D;  3VYG A;  1R0B G;  3C12 A;  1Q81 R;  5GAO r;  4M75 F;  1GFC A;  3JV3 A;  1BI1 A;  2DZ9 A;  4BI3 A;  2KRS A;  1K8A R;  3JCM h;  2EQI A;  1IHW A;  2O2O A;  2AT1 B;  1E6G A;  2K3B A;  4WF2 A;  1OZ2 A;  2HSE B;  2EQM A;  1WHK A;  1WNL A;  1M90 U;  2DA9 A;  4EMK B;  2EQJ A;  1QVF P;  1H8K A;  1VQN T;  1I1J A;  1G3W A;  1N27 A;  2ZPH B;  1QVG P;  5LJ5 f;  3RIR A;  2RHX A;  2MF2 A;  4EMK A;  1B3Q A;  3CCL A;  5A2Q E;  4PFZ A;  4A4H A;  1GCP A;  3M0U A;  2QA4 T;  1VQM A;  3SEM A;  3OYM A;  4A4G A;  2EW3 A;  1M9S A;  1A0N B;  3V8K A;  2R5A A;  4Y28 E;  3CCS Q;  1D1A A;  1MMG A;  1W6X A;  1BYM A;  1R8O B;  2VXE A;  2LZ6 B;  4JRK A;  2KK4 A;  2XU8 A;  3CXC P;  2EBP A;  1VQ9 A;  3VS6 A;  1WGS A;  4OVA A;  3CCJ A;  2KT8 A;  2RK2 A;  3JCM P;  1XJW B;  2MIO A;  5A0L A;  4QVC A;  1BBZ A;  5GAM e;  3FC3 A;  2DF6 A;  2FZC B;  4M75 A;  2JTM A;  1AZE A;  1QVG A;  2ZPF B;  2DNU A;  4J9D A;  2M9U A;  2E41 A;  4RKU E;  1G3T A;  1GCQ A;  2HL3 A;  1N9S A;  1F1B B;  1LJO A;  3JAM E;  4CC4 B;  2NYS A;  2MWO A;  4QW2 A;  1NZ9 A;  1I81 A;  1TOV A;  3H0F A;  3CMA T;  4UC4 A;  2L5Q A;  3LH5 A;  1HK9 A;  1WXB A;  3OYG A;  2CSI A;  1OX8 A;  1VYU A;  4KUI A;  3CCE Q;  3QWY A;  3CXC A;  4NS5 A;  1Y96 B;  2YRC A;  3EGU A;  4F14 A;  4BI4 A;  3NTI A;  2DAQ A;  1U5S A;  2K57 A;  3FJP A;  1Q82 U;  5D7U A;  4CRI A;  1Y96 A;  3PIO A;  2JMA A;  1YJN Q;  3H41 A;  5GMK h;  1JU5 C;  2FZK B;  3ZEH A;  2DXT A;  3G4S Q;  2QGG A;  3J80 E;  3L2R A;  5HY6 A;  3GIB A;  2BZX A;  4M78 E;  3EH2 A;  1PD1 A;  2J6O A;  4N4G A;  4LUD A;  2DBK A;  1VQ6 A;  2HNI A;  3UWN A;  2AIR B;  1NJI U;  3X25 B;  1K73 R;  5GJV B;  1X43 A;  4M77 C;  3SWN B;  2P4T A;  2DK3 A;  2FYK A;  3UA7 A;  2HQH A;  2KRN A;  3E9G A;  2LDM A;  2RJF A;  1VQO Q;  1K9M C;  3OYE A;  4X34 A;  3CCL T;  3SWN A;  4RUG A;  3CCR T;  2HAX A;  1W4S A;  2MAM A;  5FU6 B;  1VQM T;  4NL3 A;  3CC2 T;  1UGQ B;  4RTU A;  3OYD A;  4ME7 A;  1TSF A;  3S3N A;  1I4K 1;  4KH1 B;  1UTI A;  2IPO B;  4K11 A;  1G2B A;  2QQB A;  1OPK A;  3JB9 D;  1I07 A;  2V26 A;  4N0A C;  2W10 A;  5LJ5 h;  4M4Z A;  2QG9 B;  4RG8 A;  3NGP A;  3M55 A;  4RTW A;  3JB9 I;  1K1Z A;  2MPX C;  1Q86 C;  1NPR A;  2RF0 A;  1KSW A;  1M4Z A;  2A7Y A;  1KD1 C;  1VQK Q;  3PVL A;  1AOJ A;  3EHQ A;  3QPH A;  3QXE B;  4M78 D;  4KH0 B;  2CZ1 B;  4RTZ A;  1JO8 A;  1OYX A;  3RKX A;  2AKK A;  5GMK j;  1YI2 Q;  3CD6 A;  2X4W A;  2M02 A;  4J7F A;  3MPU B;  4PNO A;  1LPL A;  4Z89 A;  2AK5 A;  4BE0 A;  4JJN K;  1U06 A;  3H8Z A;  2RB6 A;  1X2Q A;  2GFU A;  5GAM f;  2EJG A;  1VQ7 T;  3JCM d;  3VJP A;  4RG2 A;  2HD0 A;  4M7A G;  1BIA A;  2VV5 A;  4HT8 A;  4ZGD B;  1U8R A;  1N6A A;  5GAN 7;  1QVG S;  1G3S A;  3LX7 A;  2DM1 A;  3HRS A;  2JOY A;  2L3Q A;  4XTX A;  3OS1 A;  3CC7 A;  4X9C A;  4BDY A;  2OTJ T;  1H3H A;  1YWP A;  5LJ3 e;  2LT4 A;  2D6F A;  3BY7 A;  2KRO A;  3A5Z B;  3CXC S;  4L6V 5;  3VYH B;  1SPK A;  4Z02 A;  3FEO A;  3QSU A;  3VS0 A;  1SHG A;  3C0C A;  1B07 A;  3L2W A;  5LJ5 j;  2PNI A;  5CVI A;  2RPN A;  4BUG A;  1D0X A;  2YHT A;  3JB9 F;  3G1J A;  2D8J A;  4C0Z A;  3CCQ A;  1VQ9 Q;  2RQR A;  1X2K A;  2AZS A;  3CCJ Q;  3ZL7 C;  2DIL A;  2VVK A;  3MP6 A;  2ROL A;  3G71 A;  5GMK l;  3WVD B;  2CS7 A;  4M78 F;  4DEX A;  3EHR A;  2KY9 A;  3IQL A;  4JUV A;  4QVZ A;  2KEA A;  1BKB A;  2Y4X A;  3X24 B;  4ZGJ B;  1U1T A;  4AMC A;  3OS5 A;  5FRN A;  2HKN A;  1K9M U;  3NFC A;  3QG1 A;  1Y07 A;  5CKD A;  3HFN A;  3OYA A;  1WYX A;  3QYG B;  1KQS P; 
#chains in the Genus database with same CATH homology
 2NWM A;  2DL7 A;  1JQQ A;  1UGV A;  3TSW A;  1AVZ C;  2DL3 A;  4GLM A;  2JT4 A;  2CRE A;  1NM7 A;  2FRY A;  1M30 A;  2EPD A;  5L23 A;  2D1X A;  2O9V A;  4F16 A;  4HVW A;  2JM8 A;  3EG1 A;  2DE0 X;  2CT4 A;  2FEI A;  4J9E A;  1WFW A;  2A37 A;  2CH4 W;  2KT1 A;  1NEG A;  4HCK A;  4R0K A;  5EC7 A;  2EGA A;  2RQT A;  1M8M A;  4J9I A;  2ED0 A;  4FSS A;  4LNP A;  1S1N A;  3VS2 A;  2O31 A;  3SHW A;  1VA7 A;  1QKW A;  4Z88 A;  2OI3 A;  4JJC A;  1Z9Q A;  2FG0 A;  2JS0 A;  1Y57 A;  1X69 A;  1WX6 A;  3GBQ A;  1MUZ A;  1ZSG A;  1AZG B;  1UDL A;  3EG0 A;  2LQW A;  2ROT A;  2J05 A;  1TUD A;  2DVJ A;  1RI9 A;  1T3S A;  4AG1 C;  1GL5 A;  2K7A A;  1UJY A;  2DL5 A;  3VS5 A;  1K4U S;  2KYM A;  2DLP A;  1AWO A;  1JXM A;  4F17 A;  1WXU A;  4RTT A;  1H92 A;  2I0N A;  4AFS C;  2CUD A;  1RUW A;  2V1R A;  1N5Z A;  3PVQ A;  1AWJ A;  1TG0 A;  3R6N A;  3O5Z A;  5GJW B;  2HEQ A;  2RN8 A;  4RTX A;  2C0O A;  4ORZ A;  2RQV A;  1QWE A;  2DYB A;  4J9C A;  1PHT A;  1WDX A;  2CDT A;  2G6F X;  1WLP B;  4E6R A;  1ZX6 A;  1EFN A;  2HCK A;  2K9G A;  1RLP C;  1M3C A;  1V1C A;  2OAW A;  2VKN A;  1M27 C;  2EYZ A;  2JTE A;  5HCK A;  1T0J A;  2K2M A;  2CT3 A;  2GNC A;  2YUP A;  2SRC A;  1WI7 A;  5IXB A;  3TVT A;  3I9Q A;  2J06 A;  4JJD A;  2FPF A;  4OMQ A;  3VRY A;  2D8H A;  3NHN A;  1GFC A;  3JV3 A;  4CC7 A;  2EGE A;  2KRS A;  1YWO A;  2LX7 A;  4OMN A;  2SEM A;  2EQI A;  1PKT A;  2O2O A;  1E6G A;  2K3B A;  3UF4 A;  2C0I A;  2B86 A;  2DA9 A;  2KXC A;  1H8K A;  2A36 A;  4CC3 A;  4DEY A;  1I1J A;  1HJD A;  1JXO A;  1K76 A;  1KIK A;  2AZV A;  2GTO A;  2BZY A;  4WCI A;  1JEG A;  2LJ0 A;  2LJ1 A;  4AFQ C;  4J9G A;  2VWF A;  1GRI A;  1B3Q A;  1UEC A;  2C0T A;  2E5K A;  1GCQ C;  4J9H A;  1GCP A;  3M0U A;  5I11 A;  2RQW A;  2DRK A;  2FPD A;  3SEM A;  1SHF A;  2X3X D;  1UHF A;  2KNB B;  3I5S A;  2EW3 A;  1A0N B;  1U3O A;  1CKA A;  1W6X A;  2H8H A;  1FYN A;  2LZ6 B;  2MCN A;  2EBP A;  2YSQ A;  1ABO A;  3VS6 A;  1UFF A;  2O88 A;  2KT8 A;  1T3L A;  1X27 A;  3REB B;  3UAT A;  5ECA A;  2MIO A;  4D8D A;  1BB9 A;  1BBZ A;  2DF6 A;  5I22 A;  2FO0 A;  4GBQ A;  2W0Z A;  1SRM A;  2O9S A;  1AZE A;  2DNU A;  2JS2 A;  1TUC A;  1YP5 A;  4J9D A;  3M0T A;  2FRW A;  1K0X A;  2YUN A;  1GCQ A;  1J3T A;  2DRM A;  2J7I A;  4OML A;  1ZBJ A;  4CC4 B;  1Z9Z A;  1AEY A;  1I0C A;  2GGR A;  1IO6 A;  2AKL A;  3VS7 A;  1AD5 A;  1PRM C;  3H0F A;  2EYX A;  2LJ3 A;  1QKX A;  3LH5 A;  4QT7 A;  1YNZ A;  1WXB A;  2LCS A;  4AFU C;  2LQN A;  2CSI A;  1VYU A;  2D0N A;  1WA7 A;  3QWY A;  2EKH A;  2L0A A;  2GQI A;  3EG2 A;  5IH2 A;  2EGC A;  2PTK A;  3EGU A;  4F14 A;  1AWW A;  3VRZ A;  1K0S A;  1OEB A;  5FWC A;  2V1Q A;  5IHN A;  2KXD A;  1U5S A;  3I5R A;  2JMA A;  2GBQ A;  2DL4 A;  3H41 A;  4HVU A;  4ZNX A;  3CQT A;  4JZ4 A;  1JU5 C;  3EG3 A;  2DBM A;  1PWT A;  3FJ5 A;  1W1F A;  2F2W A;  1SRL A;  4IIO A;  2KBT A;  2BZX A;  1QCF A;  1KFZ A;  4Y92 A;  3VS3 A;  3A98 A;  1QLY A;  2RQU A;  3M0P A;  1XOV A;  2J6O A;  2KR3 A;  3KFV A;  4LUD A;  2DBK A;  2YUO A;  1ABQ A;  1WXT A;  4JPB W;  2BTT A;  4KRT A;  4X1V A;  3TSZ A;  1ARK A;  2KGT A;  2YT6 A;  5GJV B;  1X43 A;  2F2V A;  1K9A A;  3UA7 A;  2F2X A;  2KRN A;  4OMP A;  1UE9 A;  2KYB A;  1LCK A;  2JM9 A;  3UA6 A;  5IHK A;  5IHI A;  1OV3 A;  1UJ0 A;  1NEB A;  2LMJ A;  4A63 B;  1FMK A;  4RUG A;  1NLO C;  1MV0 B;  1GBR A;  1YN8 A;  5IXF A;  1E6H A;  1QWF A;  4JZ3 A;  2EYY A;  2FPE A;  4RTU A;  1NYF A;  2HDA A;  2A28 A;  2YDL A;  2JW4 A;  3M0Q A;  1UTI A;  4K11 A;  1ZLM A;  1G2B A;  1OPK A;  3PE0 A;  2K79 A;  2LP5 A;  1I07 A;  2W10 A;  4M4Z A;  2JXB A;  1OOT A;  2EYW A;  3NGP A;  4RTW A;  2CUB A;  1UUE A;  1PRL C;  1KJW A;  3H0H A;  1K1Z A;  1X6G A;  1CKB A;  2XMF A;  3M0S A;  2RF0 A;  1BU1 A;  1KSW A;  2MOX A;  3PVL A;  1AOJ A;  3EHQ A;  4LE9 A;  2EVR A;  2K6D A;  4D8K A;  4RTZ A;  2J6K A;  1M3B A;  2RMO A;  4J9B A;  1JO8 A;  2ED1 A;  1UHC A;  2AKK A;  2DX1 A;  1YCS B;  4ESR A;  1M3A A;  1RLQ C;  4Z89 A;  2AK5 A;  2KE9 A;  1GBQ A;  2IIM A;  1W70 A;  1U06 A;  5FWB A;  2L3S A;  2CSQ A;  1X2Q A;  4HVV A;  1ZUU A;  3M0R A;  2ABL A;  1BK2 A;  2KRM A;  2NUZ A;  1X6B A;  2CH4 A;  2L2P A;  1CSK A;  1OPL A;  2DMO A;  1NYG A;  1NG2 A;  1UG1 A;  2X3W D;  2ECZ A;  2P4R A;  3RNJ A;  2A08 A;  2M51 A;  3QWX X;  1GFD A;  4LN2 A;  4AG2 C;  2DM1 A;  2RNA A;  5FW9 A;  3VS1 A;  2L3Q A;  1NLP C;  1VYV A;  1ZUK A;  2BZ8 A;  1T0H A;  1H3H A;  1YWP A;  4JJB A;  2JMC A;  1ZUY A;  2QDL A;  3H0I A;  3ULR B;  4RTY A;  2KRO A;  1SPK A;  1MV3 A;  3VS0 A;  1SHG A;  4OMM A;  3C0C A;  1B07 A;  2PNI A;  1SEM A;  2RPN A;  2DJQ A;  2OJ2 A;  4HXJ A;  4CC2 A;  3U23 A;  2D8J A;  2YUQ A;  4RTV A;  1WIE A;  4J9F A;  2LNH B;  2DL8 A;  1HSQ A;  2RQR A;  1VYT A;  1X2K A;  2AZS A;  3ZL7 C;  2DIL A;  2HSP A;  1HD3 A;  2VVK A;  2ROL A;  3THK A;  1PNJ A;  4IIM A;  4EIK A;  2HBW A;  2ESW A;  1E7O A;  2GTJ A;  3EHR A;  3NMZ C;  4DEX A;  3IQL A;  4OMO A;  2PZ1 A;  2KEA A;  4AFZ C;  2J6F A;  1G83 A;  3I35 A;  1PKS A;  4LUE A;  3RBB B;  4Z8A A;  3REA B;  1AWX A;  1WYX A;  3NPF A;  2ENM A;  2L3P A;  3VS4 A;  2M0Y A;  1SSH A;  1Y0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...