1QWFA

C-src sh3 domain complexed with ligand vsl12
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific interactions outside the proline-rich core of two classes of Src homology 3 ligands.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Complex (signal transduction/peptide)
molecule keywords TYROSINE-PROTEIN KINASE TRANSFORMING PROTEIN SRC
total genus 8
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1qwfA00
2GNCA 3UA6A 4ZNXA 1PWTA 2KYMA 2V1QA 2RF0A 4QT7A 4KRTA 5IXBA 1Z9QA 4JJCA 2O88A 2DA9A 1K0SA 2YUNA 2FRWA 2DBKA 2FRYA 3NPFA 2CSQA 1H3HA 2EYWA 2MOXA 2LJ1A 1E6GA 3RNJA 2ED1A 2L3SA 2KE9A 4RTWA 1WYXA 3M0TA 4AG2C 1W70A 4OMPA 2VWFA 1I0CA 2ROLA 1WDXA 2G6FX 1QCFA 5IXFA 1NYFA 3O5ZA 3I5RA 1UFFA 4JJDA 1PRLC 4R0KA 3UF4A 2YSQA 1T3LA 4J9BA 1JXOA 2K7AA 1NLOC 4RTZA 1YWOA 1WXBA 1AZGB 4OMMA 1PRMC 2IIMA 4LN2A 1J3TA 1WX6A 1YCSB 2H8HA 5I22A 2JW4A 2A37A 4E6RA 1KIKA 1UUEA 1BB9A 2LJ0A 3KFVA 1SHGA 3EG2A 3SHWA 2HDAA 2HBWA 1K76A 2HCKA 2DVJA 2K3BA 1UJ0A 1HSQA 3NMZC 2KXDA 3VS7A 2CT3A 2OJ2A 3VS3A 3M0QA 1WXTA 4JZ4A 1AEYA 3H41A 1E7OA 3H0IA 1VYVA 2AK5A 3REBB 5IHIA 5FWCA 3M0PA 1ARKA 2HSPA 2FEIA 1OOTA 4Z8AA 1OEBA 1UE9A 2CUDA 1SRLA 2FO0A 4J9GA 2CH4W 1PKSA 1PKTA 3SEMA 4F17A 1H92A 2M0YA 1Y57A 1VA7A 4JPBW 5EC7A 1X2QA 5HCKA 2J6FA 2DL5A 1QWEA 4HVWA 1X6BA 2O31A 3ZL7C 2PZ1A 2L3PA 4AFZC 2DRMA 1IO6A 1LCKA 3NHNA 1GCQC 2KR3A 2GTOA 2JMAA 1SSHA 1JXMA 5FWBA 1A0NB 2DL3A 3QWYA 4RTYA 1QKWA 2CT4A 1TUDA 1GCQA 2E5KA 1ZX6A 1ABOA 2F2XA 2W10A 2A08A 2ENMA 1PHTA 4OMNA 2DYBA 1M27C 2EYXA 2W0ZA 2DF6A 3EG1A 1V1CA 2L0AA 1GCPA 1YNZA 1M3AA 4CC4B 2SRCA 2YUPA 2O9VA 2KRNA 1GBRA 5IH2A 1X27A 1Y0MA 1EFNA 2BZYA 4J9EA 2EGEA 2DM1A 4F16A 3M0SA 1GFDA 1X43A 3A98A 1BK2A 4WCIA 2J6OA 1U3OA 4JJBA 2LP5A 2LQNA 2A28A 3THKA 2DJQA 1M8MA 3H0HA 1FYNA 3RBBB 5I11A 2DL8A 1H8KA 2DL4A 1G2BA 4HVVA 4HVUA 2EBPA 2NUZA 2CREA 2EYZA 2BZ8A 3JV3A 1K9AA 1ZUYA 2KT8A 2D1XA 1YP5A 2J7IA 2ABLA 3C0CA 2RQVA 1WI7A 2PTKA 3M0UA 2OI3A 4F14A 2O9SA 2LNHB 4IIMA 2DILA 1T0JA 1NM7A 5ECAA 1TUCA 2RN8A 1I1JA 1TG0A 2L3QA 4AFUC 2C0TA 3I35A 1AWWA 4AFQC 2BTTA 2CSIA 3QWXX 1KSWA 2F2VA 3VS0A 2LJ3A 2CDTA 1GFCA 2RPNA 1T3SA 4IIOA 1WXUA 2AKLA 2XMFA 2AZVA 3UA7A 1T0HA 1AOJA 3PVLA 4A63B 1OV3A 1NYGA 4RTXA 1UJYA 2FPEA 3VRYA 2RQWA 2V1RA 1UHFA 2EVRA 2GQIA 1GL5A 2RMOA 1U06A 2CUBA 4CC2A 1VYUA 1JQQA 3CQTA 1K4US 1G83A 1X69A 2YT6A 1KFZA 1UHCA 2QDLA 4AG1C 1JU5C 1I07A 1RLPC 3PE0A 2VVKA 3VS5A 2EPDA 1YN8A 1K0XA 2KGTA 2ED0A 2KT1A 4Z89A 2FG0A 1UECA 4FSSA 1CKAA 1M3BA 2KNBB 2JTEA 2KEAA 2FPFA 1MUZA 1B3QA 2LQWA 3I9QA 2GBQA 2A36A 3VRZA 3TSWA 2BZXA 4J9DA 4LUEA 1PNJA 1ZUKA 4DEXA 2JXBA 1QLYA 1W1FA 4RTUA 4M4ZA 4OMLA 2GTJA 2PNIA 1ABQA 5GJVB 4J9FA 3U23A 2SEMA 4HCKA 2JT4A 1KJWA 1GRIA 2YDLA 4HXJA 1MV0B 5L23A 2ESWA 2C0OA 1SHFA 2EQIA 4J9HA 3LH5A 1AZEA 1NG2A 2K79A 2VKNA 3ULRB 1SPKA 3REAB 1SEMA 2DL7A 4J9IA 1ZSGA 2EYYA 2JMCA 2LX7A 2DNUA 1AD5A 3EG3A 3M0RA 1WFWA 2GGRA 4OMQA 2D8JA 2J05A 1X2KA 4Y92A 3FJ5A 4DEYA 2J6KA 2JS2A 2DMOA 2DE0X 1E6HA 1QWFA 2X3WD 1GBQA 2DLPA 2FPDA 4CC3A 2ECZA 1X6GA 1YWPA 3H0FA 2KBTA 4RUGA 2KRSA 1M30A 5IHKA 1BBZA 4D8KA 3EGUA 1HJDA 4OMOA 4LUDA 2B86A 1NEGA 3NGPA 4X1VA 2LZ6B 3VS1A 2KYBA 1BU1A 1AWOA 2JS0A 1K1ZA 1JEGA 1QKXA 3TSZA 1WA7A 1OPLA 2M51A 1B07A 1RLQC 1RUWA 1ZUUA 1UGVA 3EHRA 3I5SA 1NLPC 4JZ3A 2LMJA 3GBQA 1AWXA 1Z9ZA 3UATA 3VS4A 1N5ZA 4D8DA 1XOVA 3IQLA 1SRMA 4K11A 2KROA 2EKHA 2NWMA 3EHQA 4GLMA 1HD3A 1UG1A 1WIEA 1CSKA 1FMKA 1M3CA 2JM8A 1UDLA 2AKKA 2F2WA 4AFSC 2EW3A 2K9GA 3TVTA 2MIOA 4LNPA 1WLPB 1U5SA 2OAWA 2LCSA 2CH4A 4ESRA 4GBQA 1JO8A 2K6DA 5GJWB 1S1NA 2I0NA 2EGCA 2YUOA 2EGAA 3R6NA 4RTTA 2O2OA 1CKBA 5IHNA 2KXCA 2JM9A 2RNAA 4RTVA 1UTIA 2MCNA 2P4RA 3VS2A 1ZLMA 1MV3A 2L2PA 2HEQA 1AWJA 2X3XD 4ORZA 4Z88A 2C0IA 4J9CA 2YUQA 2KRMA 2K2MA 2RQTA 2J06A 1OPKA 3VS6A 4EIKA 1W6XA 5FW9A 1RI9A 1AVZC 1ZBJA 2D0NA 3EG0A 2ROTA 2DBMA 1VYTA 2RQRA 3PVQA 2RQUA 2DRKA 2DX1A 2AZSA 2D8HA 4LE9A 4CC7A 1NEBA
chains in the Genus database with same CATH superfamily
4PJJA 4KULA 3OYGA 3WXMB 3L2QA 1PWTA 2RF0A 4QT7A 4KRTA 5HK0A 3OYKA 3V8JA 5I21A 3MEWA 4C8QG 3J80E 1MMGA 2FRWA 4EMKA 5FU6B 2ZPBB 2CSQA 2EYWA 2MOXA 3EFRA 3UT1A 2O4XA 4LDWA 3RNJA 2L3SA 5KCOA 1YJ9T 1M1GA 1KC8C 1M1KU 2DIQA 3S3NA 4ZGDB 2BIVA 1VQOQ 1LJOA 3OB9A 3QYHB 4OMPA 3CD6A 1I0CA 2ROLA 1VQLA 2OX7A 3PFSA 3VUBA 5IXFA 2P4TA 4OGEA 4EMGA 3OA6A 1QVFP 4JJDA 2LQ8A 4R0KA 2BUDA 2VGMA 1T3LA 2K7AA 2MI6A 3VYGA 3OQ5A 1R8OB 1B7TA 1YWOA 4MMKA 5LJ3e 1PRMC 2Y90A 1WX6A 2H8HA 5I22A 3I56T 1KIKA 4M77B 3CBMA 1HYOA 3A1PA 3EAEA 1VQOA 2DZ9A 4MMLA 5IN1A 3SHWA 2HBWA 5LJ3g 2DVJA 2K3BA 2MWPA 3NMZC 1HSQA 4M75C 4PL6A 1VQ4A 2KXDA 1UGSB 1W2BA 3VS3A 2DFUA 5A0LA 2AHJB 1VQNQ 4L59A 4XTXA 4AMCA 4FW1A 1VYVA 4M75F 2AK5A 5GAMd 2AT1B 2HSPA 2QA4Q 3MEVA 4BI8B 1EZZB 3TCJA 2MK5A 3ZEHA 2CP0A 4FM4B 3CCQQ 4M7AC 2E41A 5GMKh 4FT4A 2FO0A 1PKTA 1Q86C 2EQMA 3OYBA 1X2QA 1Q81U 1MHNA 1D3BB 4M7DD 1NJIC 2O31A 2NUTB 2O01E 2PZ1A 3BFMA 4AFZC 5GANj 1H641 2DRMA 1LCKA 3G71A 2L3RA 2HBPA 5FU6C 2LCLA 2DL3A 3QWYA 4RTYA 1QKWA 4DOVA 2CP3A 2M1HA 2B8AA 1TUDA 3NTKA 1ZHIA 2E5KA 2F2XA 1VQ7Q 3META 3CCET 3QSUA 2ENMA 1AT1B 4OB3B 2ZPGB 1TH7A 2W0ZA 1VQ9Q 5LJ3f 1KQSS 3OSSC 1Q95G 3I56Q 1V1CA 1G5VA 3X24B 1WHHA 1UGPB 4DBRA 5KYYA 2SRCA 2EFIA 2NUPA 2YUPA 4ANJA 4EMKC 1GBRA 1X27A 1K8AR 1VQMQ 1EFNA 2L89A 2EGEA 2X9HA 4E7SA 1K9MR 2DM1A 3HRUA 4M78C 3A98A 2HQXA 2XIDA 4WCIA 1TXQA 1U3OA 3PIPA 3LW5E 4OB1B 2A28A 1K73U 5GANd 4HVVA 3V8KA 4A54A 4HVUA 1KD1C 2EYZA 4A4KA 3WVEB 4E2FB 5HK3A 2RD1A 1DJ7B 3JV3A 2OTLQ 2DAQA 4PJOC 3CXCS 2LCCA 4XK8E 4LDVA 5GMKm 3G6ET 2PTKA 4Y28E 2DILA 1NM7A 4QQ6A 3UDCA 2RN8A 1I1JA 3OYIA 2KSSA 1ZSZA 3VKIA 4PJOB 3MPUB 4AFUC 1VQ5A 3I35A 1NE8A 1KSWA 2F2VA 2LT4A 3INZA 3VS0A 5GAMj 5CAIA 3M53A 5CKBA 1GFCA 3QIIA 2OTJQ 3L2RA 4C92C 3OYFA 1OV3A 4C5IA 5FLXE 1UJYA 2E70A 3RDVA 2K4YA 4HCCA 1SKUB 2EVRA 1G3SA 1U06A 3VUZA 1SG5A 5CKFA 1IHWA 2YT6A 3PT9A 4AG1C 1YN8A 1TOVA 3PGGA 1YI2Q 3GNGA 2KT1A 1BYMA 4N4HA 4Z89A 4XTUA 1VQPT 5LJ5d 3CCJQ 4ELYC 1K9MC 1XJWB 2E64A 3Q1JA 4WTOB 5D6XA 1NJIR 2A36A 3TSWA 3OW2A 2JXBA 4A4EA 2RI3A 2GTJA 1S72Q 4KT0E 5KYUB 4JRIA 4J9FA 2V8KA 1BI1A 2JT4A 2YDLA 1MMAA 2NYSA 1WPYA 2QASA 3CCSQ 3CCJA 4A4FA 1KQ1A 1SHFA 4J9HA 3CCRT 1NG2A 2M9UA 2VKNA 1I8FA 3ULRB 1YITQ 4FL6A 1SEMA 3RESA 4M75B 4ELZC 1ZSGA 2JMCA 2LX7A 3EGXA 3JCMd 3M0RA 3QG1A 1WFWA 2GGRA 4OMQA 2EAYA 4M75D 3MCAB 2DXTA 2CZ6B 2J05A 3MKDA 4V2SA 1WHLA 2EKOA 2J6KA 2FVUA 1IB8A 1D1BA 2E5QA 2JS2A 3CCEQ 2X3WD 4GY5A 2DLPA 3I55T 4C92B 4CC3A 8AT1B 3QDFA 5AT1B 3H0FA 3LYIA 1BIAA 1O75A 3SB2A 5IHKA 4J7FA 1HJDA 3OMGA 4PJOF 5GAN2 3VS1A 2LZ6B 1ZA1B 4M78D 1BU1A 1AWOA 2JS0A 1QKXA 2HMAA 5HKCA 1IXDA 1I81A 1WA7A 2M51A 1S72T 4F7UG 1UGVA 3EHRA 1M2OA 4JZ3A 5LJ5e 1JB0E 3F70A 5GAN4 1AWXA 2DEQA 1VQ9A 2E3HA 1FMWA 4DBHA 4LDUA 1VQ8T 2YLBA 3H9NA 4CRIA 4C8QD 1M3CA 2JTFA 2RJEA 3HFNA 2MIOA 4LNPA 4BD3A 1K73C 2OAUA 4P5NA 1JO8A 4PFZA 2WSFE 3HSBA 2FB7A 1OZ2A 4QQDA 3JCMe 4XU1A 1K8AC 3M58A 5IHNA 3EFOA 4XTWA 1VQNA 2RNAA 2MCNA 1KQ2A 1VQ4Q 1QCOA 5FU7B 2JUFA 2H3EB 1TWBA 3QBYA 1AWJA 2L5QA 4ORZA 3TU4K 4J9CA 4QVZA 2RQTA 3MP6A 1OPKA 3JCMc 4OMFB 5KH6A 5FW9A 4BI4A 5CCAA 5LJ3h 5DLOA 3S3OA 3I55A 4M7AG 1OX9A 1LVKA 2DX1A 2D6FA 3EFOB 3HHTB 1VQ5T 1TTHB 3CD6T 1YIJT 3UA6A 2V1QA 5IXBA 3EH1A 2O88A 3D7SB 1PD0A 3CCQA 2DA9A 2LTOA 5I2SA 1K0SA 2X4XA 1RABB 3NPFA 2ZZDA 1H3HA 2GQVA 2YRVA 1E6GA 5GAN3 4M7AE 2PU9B 3OYEA 4KGXB 4HCZA 3ZFJA 4RTWA 1WJQA 3BE3A 4C5EA 1GXIE 4DA4A 1KG1A 3OSVA 4WF2A 1YITT 4JJNK 1WDXA 1EIFA 2G6FX 2A0FB 3JCMW 3L2ZA 2LQKA 3O5ZA 1UFFA 4XTVA 5D6YA 1MNEA 4M75G 4QKUA 1NLOC 4RTZA 4Z02A 3A8HB 3L1AA 3CCSA 1QMCA 4OMMA 2DERA 3QXEB 1VQLQ 3GF5A 3CD6Q 4N4IA 1BB9A 1JRIA 2LJ0A 1G3TA 3M56A 4RG8A 1O9SA 7AT1B 1YBYA 1K76A 4N4GA 1YJ9Q 1IGQA 4OGCA 1UJ0A 2M16A 2F5TX 3VV0A 3KBGA 3M0QA 3CCJT 4JZ4A 1BI2A 2PUOB 1E7OA 3H0IA 4BDZA 3MP8A 5IHIA 3REBB 3M0PA 2JOYA 5GMKe 1ARKA 3MJXA 1OULA 2QQ9A 3CC2Q 3CC4Q 1OEBA 1UE9A 1K73R 4KUDK 1SRLA 4J9GA 2CH4W 1WHGA 3QJYA 4C8QA 5GAN5 4F17A 1H92A 2M0YA 4M78G 1NPRA 3KXTA 2P0PA 5KE3A 3V8LA 3OW2P 1QWEA 3OBYA 4HVWA 2DO3A 1WQWA 4LXCA 1YJWQ 3S6WA 1K8AU 2DXBA 1C1AA 1JXMA 4R55A 3CPWS 2COZA 1UGRB 1KK7A 1ZX6A 1ABOA 2W10A 4XU3A 1X75C 2OTJA 2X51A 1TS9A 3BDUA 3EG1A 3MEAA 3NTIA 3QO3A 5CQYA 3JCMJ 3OS2A 4M78E 4AT1B 3JAME 4LDYA 1M2VB 5A0DA 2O9VA 2RHZA 4ZTJA 1JBMA 2JNGA 3ME9A 5LJ3d 4J9EA 4RCBA 3N5BB 2C06A 4F16A 2ZPFB 3OYHA 3VJPA 1BK2A 2J6OA 4PK4A 4JJBA 2LQNA 1NJIU 2DJQA 4II1A 3RBBB 2DL8A 3CC7A 4FYVB 4DBQA 4M7AD 2NUZA 3CC7Q 1VQ9T 2KT8A 3OYAA 2DEUA 2ABLA 2E10A 3J7AF 4F7UA 1WI7A 2OI3A 4F14A 4IIMA 1NBEB 1VQMA 1TG0A 5DY9A 1PCXA 2K3XA 1Q7YC 3TQ7P 5LJ5j 2L3QA 3JB9I 1YJNT 2C0TA 1QP3A 5CQXA 1V76A 1Q7YU 4EPCA 4HCBA 1I5OB 4JDSA 1N27A 2RPNA 1T3SA 4IIOA 1C6VX 2AKLA 2EQKA 3OS5A 4ME7A 1BCOA 3PVLA 4A63B 2R5AA 1NYGA 4RTXA 2MYSA 4JRKA 1I5LA 1UHFA 3M9QA 5GAN7 2GQIA 3G71Q 2RMOA 4NL3A 1QQJA 1UEBA 4F7UE 1JQQA 4MZPA 1KD1R 1VQKQ 2D9TA 1X69A 2NUPB 1V29B 4C0DC 1KFZA 3V7RA 2CKKA 3PE0A 3SFMA 1FWZA 2RB6A 2MWOA 3CC2T 2ED0A 3CC2A 3CCRA 2FG0A 2QA4A 2KNBB 2JTEA 3X25B 1OYXA 2KEAA 2XDBA 1TUGB 2PVOB 1G3WA 2E1HA 4J6YA 1I4K1 3I9QA 4OB0B 2WACA 2GBQA 4TVRA 3GOXA 4DEXA 1QLYA 2HQEA 2BE9B 3JRZA 2RI2A 2KAFA 2PNIA 1YJNQ 3CCVA 1PG5B 1D3BA 2JN0A 2VV5A 3U23A 1ZBXA 1PD1A 1KJWA 3OYLA 1ACMB 2C0OA 1QVGA 2KQWA 2QG9B 2PVDB 3LH5A 1VQPQ 1AZEA 2FYKA 3URGA 3GPLA 4J9IA 2DNUA 3SWNB 1RAGB 2PUKB 2D8JA 4O5VA 1Q82C 4RCCA 4Y92A 3RR6A 4B9WA 1E6HA 1BI0A 2MMPA 1QWFA 1GBQA 2MF2A 8ATCB 2ECZA 1X6GA 1YWPA 1BBZA 3BDLA 2Y4XA 3EGUA 1XQHA 3NTHA 4OMOA 3UWNA 4X1VA 2KYBA 3OYYA 3JB9G 1QVFA 1BIBA 3SDZA 2RJCA 2XKOC 4L5GA 2KMTA 4UC4A 2LMJA 1BCMA 4BACA 1TU0B 3LLRA 4D8DA 1X6OA 1QVGP 1SRMA 5HY6A 2KROA 4M7DA 3M57A 2NWMA 4GLMA 3CMAQ 2WSEE 3P8HA 5I2MA 4CI0C 1FMKA 2JM8A 2AKKA 2F2WA 4EMKB 1VIFA 5LJ3j 1VQ6A 4AFSC 2EW3A 2F1LA 1D0XA 2E6NA 3QZ9B 3TVTA 4XTYA 1U5SA 2LCSA 3GNFB 3BY7A 3CXCA 5GJWB 3PMTA 5FRMA 1S1NA 1EX4A 2DTOA 1FMVA 2EGCA 4NS5A 2EJ9A 3FDRA 3JB9F 2O2OA 4QW2A 3CCLQ 2KXCA 4PLLA 2E65A 2XDDA 3P8BB 4RTVA 2CZ7B 4QVDA 5GAOm 2K57A 3DKMA 3TEEA 3CCVQ 4ZN1A 3VS2A 1ZLMA 1S72A 2HEQA 2C0IA 3LH0A 4FIBA 2KY9A 1ZSZB 2LRQA 2QTXA 3G4SQ 2DK3A 3QUIA 5AYFA 4EIKA 2GFUA 1W6XA 1WGSA 1MNDA 3QDRB 1RAEB 2D0NA 1RI0A 1W2BP 2COWA 1VYTA 3CCMT 3PVQA 2MAMA 1ZSZC 2XDPA 2AZSA 3SD4A 1VQMT 3DLMA 2GNCA 3CC7T 1VQKA 5D6WA 1Q7YR 4ZNXA 5KYXB 2DD4A 1Z9QA 1D0YA 5IT9E 4F7UB 2YUNA 2DBKA 2FRYA 1W4SA 2XU8A 4PJOG 4IURA 3HL8A 4ZN3A 3EGDA 3CCST 1VQNT 4J8OA 3KUFA 5CO7A 2QAZA 2RK2A 2KE9A 2FZCB 1IHVA 1PSEA 2QTVA 5FROA 3CMEQ 1VQ5Q 1VQ6T 2VC8A 4AG2C 1YIJQ 1W70A 4BY6B 3QYGB 2FL7A 5GAMh 4FYYB 1Q82U 1B34B 3C4SA 1QCFA 2GFAA 3I5RA 4KGZB 3CCMQ 1PRLC 2QGFB 3E9GA 1SF9A 1OX8A 1YHQQ 1J3TA 2XI9A 4E6RA 2JVVA 1QVPA 1UUEA 1YIJA 3KFVA 1SHGA 3EG2A 2EQJA 3C95A 3J81E 4BDYA 4JRPA 1NZ9A 4GLKA 3HP9A 3A8GB 3VS7A 2CT3A 2OJ2A 1WXTA 3LWIA 4M7DF 2CP2A 2ZPHB 1AEYA 3CCLA 4L6V5 4FYXB 5FWCA 1OOTA 4PJLA 2CUDA 4YTLA 4M7DG 2O4XB 1PKSA 5GAMg 4JPBW 2J6FA 2DL5A 5LJ5g 3CCVT 1Q82R 3M5AA 1X6BA 3ZL7C 1VQ6Q 1N8RU 4C8QE 4JS4A 1IO6A 3NHNA 1GCQC 3G6EQ 2KR3A 2GTOA 1C0MA 1SSHA 5FWBA 1FX7A 1A0NB 5GANh 4BI3A 1Y07A 5GAOl 4IUPA 2CT4A 4B6MA 1PHTA 4M77G 3G4SA 1MMDA 2DJZA 1M5Q1 3G4ST 2DYBA 1M27C 1Y96A 2EYXA 2X4WA 2ZCFB 2DF6A 5GMKl 3CPWA 1WNLA 5GAMe 1KHIA 2RK1A 2R58A 4LDXA 5GANf 1YNZA 5FRNA 4CC4B 2K3YA 2DETA 2KRNA 2ATCB 6AT1B 4Y91A 9ATCB 4FCYA 1U1SA 2ZGWA 4IUVA 3M0SA 3JCMP 3HRSA 3O8VA 1PC0A 1Y71A 1X43A 2EQUA 4PJNA 3JB9J 2YWWA 5CKEA 1KC8U 1M1KC 2OTLA 2LP5A 1HK9A 3THKA 3H0HA 3M59A 5I11A 2DL4A 2XG8D 1G2BA 2V26A 3L42A 2GCXA 3FJPA 2EBPA 1XTDA 3FLGA 3JCMf 2EIFA 2CREA 4N0AC 3A8MB 2IVWA 2BZ8A 3C94A 2HD0A 3CMAA 1YP5A 3CMAT 2MPXC 3HTRA 3M0UA 2O9SA 2LNHB 1T0JA 1TUCA 4C92F 5GANg 1ZA2B 2DIGA 2QI2A 2X4JA 3E2UA 2VXEA 4IUQA 4AFQC 2BTTA 3QWXX 1RACB 3A5ZB 3GLXA 1QP2A 4FYWB 5GANe 3UPUA 3E19A 5LJ5f 1WXUA 1YHQT 1B34A 1Q81R 1Y7XA 4Q5WA 1T0HA 4EDUA 1AOJA 1RADB 2E3IA 1H3ZA 3VRYA 2RQWA 3CCRQ 4X34A 5CIUA 4CC2A 2LT1A 1VYUA 4RG2A 2BKDN 5GMKj 1N6AA 1K4US 4PFOA 4F7UF 4OP0A 3CCQT 1UHCA 4NOYA 5GAOn 3JB9D 1JU5C 3M54A 1I07A 5M9OA 2VVKA 3VS5A 2EPDA 4OVAA 4C92E 5CKHA 3OS0A 1K0XA 2FZKB 1RL2A 4QQGA 2KGTA 4M78A 5KCHA 3I55Q 4FSSA 4C0GA 4IUTA 2QQBA 2P84A 2CZ1B 2YRCA 2FPFA 1B3QA 4OB2B 3P8DA 4JUVA 1BKBA 1RAAB 1WJSA 1YJNA 1U8RA 2BZXA 1KC8R 1JJ2A 4LD6A 1W1FA 4M4ZA 4OMLA 1VQKT 3DB3A 3EH2A 2RHXA 4M77A 5GJVB 4E7LA 2QYZA 2P0KA 3RMQA 1GRIA 3TREA 4HXJA 2HKQB 2QQSA 5LL6S 5L23A 4XTZA 4E7JA 2EQIA 2VGNA 2GF7A 3REAB 4KUIA 2LX9A 1WHJA 2EYYA 1BI3A 1AD5A 3EG3A 3DLLA 2HQHA 1KD1U 1Y96B 1X2KA 4DEYA 3PMIA 3GIBA 3QZ5B 4KGVB 4C5HA 5GAN6 2FPDA 2QXFA 4FSXA 2KBTA 2LDMA 2KRSA 4RUGA 1YI2T 2L8DA 2VASA 4D8KA 1M9SA 2LC4A 1UB4A 2OTLT 2K5LA 4PKCC 2YHTA 4LUDA 3NGPA 1NEGA 2X35A 3TSZA 1AHJB 1KQSP 4MDWA 1OPLA 1LPLA 3EGXB 4BY6C 1RLQC 1RUWA 1ZUUA 4M75A 3I5SA 1F1BB 3GBQA 1WHMA 2Y4YA 4DBFA 3UATA 5CR2A 1OQKA 3H8ZA 2COYA 2I2LA 1QVFS 1VIEA 4K11A 3RKWA 4XU2A 2OTJT 1HD3A 1PM3A 5L8RE 5KYNA 1CSKA 2K9GA 3MHXA 1WLPB 2CH4A 4ESRA 1FXXA 4C0FA 3CCUT 2K6DA 4C92G 2I0NA 2ZPIB 2YUOA 3CXCP 1IGUA 2EGAA 3R6NA 3HRTA 4A4GA 4RTTA 2JJ9A 2DYIA 4VUBA 2KVQG 4C8QC 1OU9A 2JM9A 4J83A 4KH0B 3LWHA 1D0ZA 2CP7A 2P4RA 4HKEA 3FC3A 1YJ9A 1MV3A 2R5MA 1YJWT 2X3XD 1IZ6A 2YUQA 2H3JA 2KRMA 2K2MA 4E7KA 2E6ZA 2AIRB 2J06A 3PNWC 3RUXA 1D09B 3EGDB 1IRXA 1RI9A 3M4GA 3CBPA 1AVZC 1ZBJA 3EG0A 1VUBA 2DBMA 2QGGA 2RQRA 2RQUA 2DRKA 1UGQB 1YI2A 3AT1B 2HL5C 1KQSA 2VYTA 4O6JA 4LE9A 2RJFA 2DVEA 5KYXA 4CC7A 1GCPA 2M02A 3PTAA 3OYJA 1X01A 4DQ2A 3SWNC 2KYMA 3EG9A 2CP6A 4JJCA 3H6ZA 4M77F 2QEXQ 4E7HA 1KHCA 2X4YA 1JJ2P 3FEOA 2HSEB 2QQRA 2V8JA 2FZGB 2P0QA 4M7AF 2YLCA 2A3LA 2LJ1A 4JRQA 2KI7A 2ED1A 4M7DE 3JCMX 2A7YA 5KE2A 4FW2A 4PLIA 3JCMV 1YFNA 3HKSA 4PFPA 3ZBDA 1WYXA 3M0TA 4M7DC 3FRNA 4E7IA 3A8OB 2VWFA 3MO8A 1N9SA 1OU8A 2QA4T 1M1FA 1N8RC 1NYFA 1QVGS 5DM7R 3AHUA 1RAHB 3UF4A 3CCMA 5GAN8 2YSQA 4J9BA 1JXOA 2WSCE 4KBMB 3FB9A 1WXBA 1AZGB 2PVGB 4M77E 2IIMA 4LN2A 1YCSB 2JW4A 2A37A 5FU7C 1QCNA 2HAXA 1M2VA 3CMEA 2LNVA 3C12A 3CMET 2HDAA 4RKUE 1M90U 2HCKA 4M78B 1G3YA 2K2VA 2XICA 3H41A 2FEIA 4FU6A 3MP1A 4Z8AA 4C92A 5KYWA 2HZYA 5GAOq 3L2WA 2YXYA 2BE7D 3SEMA 3GP8A 3L2VA 1Y57A 1VA7A 2HKNA 2JZ2A 3I56A 3OMCA 4ZGJB 5EC7A 5HCKA 4ZGEB 1LNXA 2F5KA 3RMSA 5GAMf 2L3PA 2XK0A 1VQ7A 1MGQA 2VXFA 1R0BG 4LD9K 2RH2A 3OYMA 2JMAA 3CEYA 2LVMA 2IG0A 4B9XA 3V7SA 2VUBA 1GCQA 3T9NA 2A08A 4BE2A 4OMNA 3JCMg 5GAOr 4N0AA 2RO0A 4M7AA 2L0AA 4M7DB 2F69A 5GMKi 1M3AA 2E4HA 2G3RA 2DXCA 4NL2A 4HT8A 5IH2A 5C0MA 1Y0MA 2BZYA 4MDXA 4OF1A 1N8RR 1WQ7A 1P92A 4PJMA 2DKGA 4BUGA 1M8VA 3G71T 4PJOE 1GFDA 4HA8A 5EG2A 2HNIA 3CCEA 1M8MA 1FYNA 2QEXT 1K9MU 2K5IA 1H8KA 4C5GA 3JCMQ 5C6SA 5CK9A 3OYCA 2M0OA 1K9AA 1ZUYA 1N9RA 1M1KR 4M77D 2D1XA 3JB9H 3CPFA 1M90R 2J7IA 3C0CA 2RQVA 1VQPA 3M55A 5D7UA 4IKFA 3LX7A 3QKJA 5ECAA 4C0ZA 5KYUA 2XD0A 1NPPA 1AWWA 2CSIA 2EYQA 1VQLT 2LJ3A 3PIOA 4BE0A 2CDTA 2FHDA 1YCYA 4JLGA 2R57A 2XMFA 4F04B 2AZVA 3UA7A 1W2BS 2DXUA 2DPPB 1PSFA 1WHKA 2FPEA 2V1RA 1R0CB 4R56A 3G6EA 1GL5A 2CUBA 4IUUA 2ZAEA 3EG9B 2KK4A 3CQTA 1G83A 1G8XA 2RM4A 3A8LB 4JS5A 4DOWA 3S3MA 3ASKA 3SWNA 2QDLA 4EMHA 1RLPC 2IPOB 4X9DA 1YITA 3NFCA 2DD5A 3RIRA 2KDSA 5CVIA 4QVCA 1UECA 1CKAA 1M3BA 3G7ZA 3HPWA 5A2QE 4C0DB 3RERA 4FT2A 3CBOA 3E1SA 4X9CA 1MUZA 2LQWA 3EFSA 3VRZA 4E47A 4A53A 4J9DA 1LOJA 4LUEA 4C8QF 1PNJA 5KYYB 1ZUKA 5CKDA 4RTUA 2RI5A 3X20B 2CZ0B 4PJOA 2CGHA 3CC4T 1ABQA 3LGFA 3V7CA 3VYHB 1YHQA 2SEMA 4HCKA 1OZ3A 2CYZB 1MV0B 1D1AA 2ESWA 1VQ8A 3QPHA 1D1CA 2E12A 5A0GA 4PNOA 2K79A 3RKYA 1XNIA 1SPKA 4XQ3A 2DTIA 2DL7A 3BW1A 1RAIB 4M78F 1ZQ1A 2DZCA 2XHCA 4PJOD 1VOMA 4RMOA 4J6XA 3FIFA 3FJ5A 3X28B 2JTMA 2DMOA 2DE0X 3JCMb 3HFOA 3M4YA 4J6WA 4M7AB 3CCLT 1MMNA 4MZMA 3WVDB 3DB4A 2DTHA 1M30A 2K5FA 2YRDA 1RAFB 2B86A 2QK0A 2QEXA 1K1ZA 1JEGA 1Q81C 2EJFA 3CCUQ 5J39A 3G1JA 1B07A 5DLQE 1NLPC 3CCUA 2CS7A 3OYNA 2NLUA 1Z9ZA 4JLIA 4BB7A 2ZPEB 4BE1A 3VS4A 4MZTA 5LJ5h 1N5ZA 1QW1A 2VB6A 1XOVA 3IQLA 1VQ4T 2PQWA 2EKHA 3EHQA 3R6OA 5KYWB 1R77A 3OYDA 1UG1A 1WIEA 1UDLA 1YJWA 4HT9A 3JSCA 3VU3C 2NUTA 3L2UA 2V8IA 2QQAA 1TSFA 2OAWA 1Q86U 1WZOA 4GBQA 3LGLA 4J5YA 4E7ZA 5IAYA 4A4HA 1M4ZA 2RA2A 2CP5A 4ZTFA 1VQ7T 2Z0WA 1Q86R 3CC4A 4M75E 3OBWA 3OY9A 1HXDA 1CKBA 1VQ8Q 3E9FA 3JCMh 5J26A 4C8QB 1UTIA 4D6WA 3QHSA 1VQOT 4M77C 4ATOA 1U1TA 4XAXB 2L2PA 2RHIA 4Z88A 3OS1A 2RHYA 3ER0A 5J3BA 3X26B 3OW2S 2EWNA 2EJGA 2HL3A 3VS6A 1SSFA 3RKXA 2QDYB 1JJ2S 2ROTA 3MEUA 3QJ6A 3CPWP 1M90C 4XU0A 2D0QB 2RJDA 2D8HA 2RHUA 1WJRA 5GAOp 4C92D 1NEBA 1IREB 4KH1B 4J7IA 1OI1A
chains in the Genus database with same CATH topology
2GNCA 3UA6A 4ZNXA 1PWTA 2KYMA 2V1QA 2RF0A 4QT7A 4KRTA 5IXBA 1Z9QA 4JJCA 2O88A 2DA9A 1K0SA 2YUNA 2FRWA 2DBKA 2FRYA 3NPFA 2CSQA 1H3HA 2EYWA 2MOXA 2LJ1A 1E6GA 3RNJA 2ED1A 2L3SA 2KE9A 4RTWA 1WYXA 3M0TA 4AG2C 1W70A 4OMPA 2VWFA 1I0CA 2ROLA 1WDXA 2G6FX 1QCFA 5IXFA 1NYFA 3O5ZA 3I5RA 1UFFA 4JJDA 1PRLC 4R0KA 3UF4A 2YSQA 1T3LA 4J9BA 1JXOA 2K7AA 1NLOC 4RTZA 1YWOA 1WXBA 1AZGB 4OMMA 1PRMC 2IIMA 4LN2A 1J3TA 1WX6A 1YCSB 2H8HA 5I22A 2JW4A 2A37A 4E6RA 1KIKA 1UUEA 1BB9A 2LJ0A 3KFVA 1SHGA 3EG2A 3SHWA 2HDAA 2HBWA 1K76A 2HCKA 2DVJA 2K3BA 1UJ0A 1HSQA 3NMZC 2KXDA 3VS7A 2CT3A 2OJ2A 3VS3A 3M0QA 1WXTA 4JZ4A 1AEYA 3H41A 1E7OA 3H0IA 1VYVA 2AK5A 3REBB 5IHIA 5FWCA 3M0PA 1ARKA 2HSPA 2FEIA 1OOTA 4Z8AA 1OEBA 1UE9A 2CUDA 1SRLA 2FO0A 4J9GA 2CH4W 1PKSA 1PKTA 3SEMA 4F17A 1H92A 2M0YA 1Y57A 1VA7A 4JPBW 5EC7A 1X2QA 5HCKA 2J6FA 2DL5A 1QWEA 4HVWA 1X6BA 2O31A 3ZL7C 2PZ1A 2L3PA 4AFZC 2DRMA 1IO6A 1LCKA 3NHNA 1GCQC 2KR3A 2GTOA 2JMAA 1SSHA 1JXMA 5FWBA 1A0NB 2DL3A 3QWYA 4RTYA 1QKWA 2CT4A 1TUDA 1GCQA 2E5KA 1ZX6A 1ABOA 2F2XA 2W10A 2A08A 2ENMA 1PHTA 4OMNA 2DYBA 1M27C 2EYXA 2W0ZA 2DF6A 3EG1A 1V1CA 2L0AA 1GCPA 1YNZA 1M3AA 4CC4B 2SRCA 2YUPA 2O9VA 2KRNA 1GBRA 5IH2A 1X27A 1Y0MA 1EFNA 2BZYA 4J9EA 2EGEA 2DM1A 4F16A 3M0SA 1GFDA 1X43A 3A98A 1BK2A 4WCIA 2J6OA 1U3OA 4JJBA 2LP5A 2LQNA 2A28A 3THKA 2DJQA 1M8MA 3H0HA 1FYNA 3RBBB 5I11A 2DL8A 1H8KA 2DL4A 1G2BA 4HVVA 4HVUA 2EBPA 2NUZA 2CREA 2EYZA 2BZ8A 3JV3A 1K9AA 1ZUYA 2KT8A 2D1XA 1YP5A 2J7IA 2ABLA 3C0CA 2RQVA 1WI7A 2PTKA 3M0UA 2OI3A 4F14A 2O9SA 2LNHB 4IIMA 2DILA 1T0JA 1NM7A 5ECAA 1TUCA 2RN8A 1I1JA 1TG0A 2L3QA 4AFUC 2C0TA 3I35A 1AWWA 4AFQC 2BTTA 2CSIA 3QWXX 1KSWA 2F2VA 3VS0A 2LJ3A 2CDTA 1GFCA 2RPNA 1T3SA 4IIOA 1WXUA 2AKLA 2XMFA 2AZVA 3UA7A 1T0HA 1AOJA 3PVLA 4A63B 1OV3A 1NYGA 4RTXA 1UJYA 2FPEA 3VRYA 2RQWA 2V1RA 1UHFA 2EVRA 2GQIA 1GL5A 2RMOA 1U06A 2CUBA 4CC2A 1VYUA 1JQQA 3CQTA 1K4US 1G83A 1X69A 2YT6A 1KFZA 1UHCA 2QDLA 4AG1C 1JU5C 1I07A 1RLPC 3PE0A 2VVKA 3VS5A 2EPDA 1YN8A 1K0XA 2KGTA 2ED0A 2KT1A 4Z89A 2FG0A 1UECA 4FSSA 1CKAA 1M3BA 2KNBB 2JTEA 2KEAA 2FPFA 1MUZA 1B3QA 2LQWA 3I9QA 2GBQA 2A36A 3VRZA 3TSWA 2BZXA 4J9DA 4LUEA 1PNJA 1ZUKA 4DEXA 2JXBA 1QLYA 1W1FA 4RTUA 4M4ZA 4OMLA 2GTJA 2PNIA 1ABQA 5GJVB 4J9FA 3U23A 2SEMA 4HCKA 2JT4A 1KJWA 1GRIA 2YDLA 4HXJA 1MV0B 5L23A 2ESWA 2C0OA 1SHFA 2EQIA 4J9HA 3LH5A 1AZEA 1NG2A 2K79A 2VKNA 3ULRB 1SPKA 3REAB 1SEMA 2DL7A 4J9IA 1ZSGA 2EYYA 2JMCA 2LX7A 2DNUA 1AD5A 3EG3A 3M0RA 1WFWA 2GGRA 4OMQA 2D8JA 2J05A 1X2KA 4Y92A 3FJ5A 4DEYA 2J6KA 2JS2A 2DMOA 2DE0X 1E6HA 1QWFA 2X3WD 1GBQA 2DLPA 2FPDA 4CC3A 2ECZA 1X6GA 1YWPA 3H0FA 2KBTA 4RUGA 2KRSA 1M30A 5IHKA 1BBZA 4D8KA 3EGUA 1HJDA 4OMOA 4LUDA 2B86A 1NEGA 3NGPA 4X1VA 2LZ6B 3VS1A 2KYBA 1BU1A 1AWOA 2JS0A 1K1ZA 1JEGA 1QKXA 3TSZA 1WA7A 1OPLA 2M51A 1B07A 1RLQC 1RUWA 1ZUUA 1UGVA 3EHRA 3I5SA 1NLPC 4JZ3A 2LMJA 3GBQA 1AWXA 1Z9ZA 3UATA 3VS4A 1N5ZA 4D8DA 1XOVA 3IQLA 1SRMA 4K11A 2KROA 2EKHA 2NWMA 3EHQA 4GLMA 1HD3A 1UG1A 1WIEA 1CSKA 1FMKA 1M3CA 2JM8A 1UDLA 2AKKA 2F2WA 4AFSC 2EW3A 2K9GA 3TVTA 2MIOA 4LNPA 1WLPB 1U5SA 2OAWA 2LCSA 2CH4A 4ESRA 4GBQA 1JO8A 2K6DA 5GJWB 1S1NA 2I0NA 2EGCA 2YUOA 2EGAA 3R6NA 4RTTA 2O2OA 1CKBA 5IHNA 2KXCA 2JM9A 2RNAA 4RTVA 1UTIA 2MCNA 2P4RA 3VS2A 1ZLMA 1MV3A 2L2PA 2HEQA 1AWJA 2X3XD 4ORZA 4Z88A 2C0IA 4J9CA 2YUQA 2KRMA 2K2MA 2RQTA 2J06A 1OPKA 3VS6A 4EIKA 1W6XA 5FW9A 1RI9A 1AVZC 1ZBJA 2D0NA 3EG0A 2ROTA 2DBMA 1VYTA 2RQRA 3PVQA 2RQUA 2DRKA 2DX1A 2AZSA 2D8HA 4LE9A 4CC7A 1NEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GNC A;  3UA6 A;  4ZNX A;  1PWT A;  2KYM A;  2V1Q A;  2RF0 A;  4QT7 A;  4KRT A;  5IXB A;  1Z9Q A;  4JJC A;  2O88 A;  2DA9 A;  1K0S A;  2YUN A;  2FRW A;  2DBK A;  2FRY A;  3NPF A;  2CSQ A;  1H3H A;  2EYW A;  2MOX A;  2LJ1 A;  1E6G A;  3RNJ A;  2ED1 A;  2L3S A;  2KE9 A;  4RTW A;  1WYX A;  3M0T A;  4AG2 C;  1W70 A;  4OMP A;  2VWF A;  1I0C A;  2ROL A;  1WDX A;  2G6F X;  1QCF A;  5IXF A;  1NYF A;  3O5Z A;  3I5R A;  1UFF A;  4JJD A;  1PRL C;  4R0K A;  3UF4 A;  2YSQ A;  1T3L A;  4J9B A;  1JXO A;  2K7A A;  1NLO C;  4RTZ A;  1YWO A;  1WXB A;  1AZG B;  4OMM A;  1PRM C;  2IIM A;  4LN2 A;  1J3T A;  1WX6 A;  1YCS B;  2H8H A;  5I22 A;  2JW4 A;  2A37 A;  4E6R A;  1KIK A;  1UUE A;  1BB9 A;  2LJ0 A;  3KFV A;  1SHG A;  3EG2 A;  3SHW A;  2HDA A;  2HBW A;  1K76 A;  2HCK A;  2DVJ A;  2K3B A;  1UJ0 A;  1HSQ A;  3NMZ C;  2KXD A;  3VS7 A;  2CT3 A;  2OJ2 A;  3VS3 A;  3M0Q A;  1WXT A;  4JZ4 A;  1AEY A;  3H41 A;  1E7O A;  3H0I A;  1VYV A;  2AK5 A;  3REB B;  5IHI A;  5FWC A;  3M0P A;  1ARK A;  2HSP A;  2FEI A;  1OOT A;  4Z8A A;  1OEB A;  1UE9 A;  2CUD A;  1SRL A;  2FO0 A;  4J9G A;  2CH4 W;  1PKS A;  1PKT A;  3SEM A;  4F17 A;  1H92 A;  2M0Y A;  1Y57 A;  1VA7 A;  4JPB W;  5EC7 A;  1X2Q A;  5HCK A;  2J6F A;  2DL5 A;  1QWE A;  4HVW A;  1X6B A;  2O31 A;  3ZL7 C;  2PZ1 A;  2L3P A;  4AFZ C;  2DRM A;  1IO6 A;  1LCK A;  3NHN A;  1GCQ C;  2KR3 A;  2GTO A;  2JMA A;  1SSH A;  1JXM A;  5FWB A;  1A0N B;  2DL3 A;  3QWY A;  4RTY A;  1QKW A;  2CT4 A;  1TUD A;  1GCQ A;  2E5K A;  1ZX6 A;  1ABO A;  2F2X A;  2W10 A;  2A08 A;  2ENM A;  1PHT A;  4OMN A;  2DYB A;  1M27 C;  2EYX A;  2W0Z A;  2DF6 A;  3EG1 A;  1V1C A;  2L0A A;  1GCP A;  1YNZ A;  1M3A A;  4CC4 B;  2SRC A;  2YUP A;  2O9V A;  2KRN A;  1GBR A;  5IH2 A;  1X27 A;  1Y0M A;  1EFN A;  2BZY A;  4J9E A;  2EGE A;  2DM1 A;  4F16 A;  3M0S A;  1GFD A;  1X43 A;  3A98 A;  1BK2 A;  4WCI A;  2J6O A;  1U3O A;  4JJB A;  2LP5 A;  2LQN A;  2A28 A;  3THK A;  2DJQ A;  1M8M A;  3H0H A;  1FYN A;  3RBB B;  5I11 A;  2DL8 A;  1H8K A;  2DL4 A;  1G2B A;  4HVV A;  4HVU A;  2EBP A;  2NUZ A;  2CRE A;  2EYZ A;  2BZ8 A;  3JV3 A;  1K9A A;  1ZUY A;  2KT8 A;  2D1X A;  1YP5 A;  2J7I A;  2ABL A;  3C0C A;  2RQV A;  1WI7 A;  2PTK A;  3M0U A;  2OI3 A;  4F14 A;  2O9S A;  2LNH B;  4IIM A;  2DIL A;  1T0J A;  1NM7 A;  5ECA A;  1TUC A;  2RN8 A;  1I1J A;  1TG0 A;  2L3Q A;  4AFU C;  2C0T A;  3I35 A;  1AWW A;  4AFQ C;  2BTT A;  2CSI A;  3QWX X;  1KSW A;  2F2V A;  3VS0 A;  2LJ3 A;  2CDT A;  1GFC A;  2RPN A;  1T3S A;  4IIO A;  1WXU A;  2AKL A;  2XMF A;  2AZV A;  3UA7 A;  1T0H A;  1AOJ A;  3PVL A;  4A63 B;  1OV3 A;  1NYG A;  4RTX A;  1UJY A;  2FPE A;  3VRY A;  2RQW A;  2V1R A;  1UHF A;  2EVR A;  2GQI A;  1GL5 A;  2RMO A;  1U06 A;  2CUB A;  4CC2 A;  1VYU A;  1JQQ A;  3CQT A;  1K4U S;  1G83 A;  1X69 A;  2YT6 A;  1KFZ A;  1UHC A;  2QDL A;  4AG1 C;  1JU5 C;  1I07 A;  1RLP C;  3PE0 A;  2VVK A;  3VS5 A;  2EPD A;  1YN8 A;  1K0X A;  2KGT A;  2ED0 A;  2KT1 A;  4Z89 A;  2FG0 A;  1UEC A;  4FSS A;  1CKA A;  1M3B A;  2KNB B;  2JTE A;  2KEA A;  2FPF A;  1MUZ A;  1B3Q A;  2LQW A;  3I9Q A;  2GBQ A;  2A36 A;  3VRZ A;  3TSW A;  2BZX A;  4J9D A;  4LUE A;  1PNJ A;  1ZUK A;  4DEX A;  2JXB A;  1QLY A;  1W1F A;  4RTU A;  4M4Z A;  4OML A;  2GTJ A;  2PNI A;  1ABQ A;  5GJV B;  4J9F A;  3U23 A;  2SEM A;  4HCK A;  2JT4 A;  1KJW A;  1GRI A;  2YDL A;  4HXJ A;  1MV0 B;  5L23 A;  2ESW A;  2C0O A;  1SHF A;  2EQI A;  4J9H A;  3LH5 A;  1AZE A;  1NG2 A;  2K79 A;  2VKN A;  3ULR B;  1SPK A;  3REA B;  1SEM A;  2DL7 A;  4J9I A;  1ZSG A;  2EYY A;  2JMC A;  2LX7 A;  2DNU A;  1AD5 A;  3EG3 A;  3M0R A;  1WFW A;  2GGR A;  4OMQ A;  2D8J A;  2J05 A;  1X2K A;  4Y92 A;  3FJ5 A;  4DEY A;  2J6K A;  2JS2 A;  2DMO A;  2DE0 X;  1E6H A;  1QWF A;  2X3W D;  1GBQ A;  2DLP A;  2FPD A;  4CC3 A;  2ECZ A;  1X6G A;  1YWP A;  3H0F A;  2KBT A;  4RUG A;  2KRS A;  1M30 A;  5IHK A;  1BBZ A;  4D8K A;  3EGU A;  1HJD A;  4OMO A;  4LUD A;  2B86 A;  1NEG A;  3NGP A;  4X1V A;  2LZ6 B;  3VS1 A;  2KYB A;  1BU1 A;  1AWO A;  2JS0 A;  1K1Z A;  1JEG A;  1QKX A;  3TSZ A;  1WA7 A;  1OPL A;  2M51 A;  1B07 A;  1RLQ C;  1RUW A;  1ZUU A;  1UGV A;  3EHR A;  3I5S A;  1NLP C;  4JZ3 A;  2LMJ A;  3GBQ A;  1AWX A;  1Z9Z A;  3UAT A;  3VS4 A;  1N5Z A;  4D8D A;  1XOV A;  3IQL A;  1SRM A;  4K11 A;  2KRO A;  2EKH A;  2NWM A;  3EHQ A;  4GLM A;  1HD3 A;  1UG1 A;  1WIE A;  1CSK A;  1FMK A;  1M3C A;  2JM8 A;  1UDL A;  2AKK A;  2F2W A;  4AFS C;  2EW3 A;  2K9G A;  3TVT A;  2MIO A;  4LNP A;  1WLP B;  1U5S A;  2OAW A;  2LCS A;  2CH4 A;  4ESR A;  4GBQ A;  1JO8 A;  2K6D A;  5GJW B;  1S1N A;  2I0N A;  2EGC A;  2YUO A;  2EGA A;  3R6N A;  4RTT A;  2O2O A;  1CKB A;  5IHN A;  2KXC A;  2JM9 A;  2RNA A;  4RTV A;  1UTI A;  2MCN A;  2P4R A;  3VS2 A;  1ZLM A;  1MV3 A;  2L2P A;  2HEQ A;  1AWJ A;  2X3X D;  4ORZ A;  4Z88 A;  2C0I A;  4J9C A;  2YUQ A;  2KRM A;  2K2M A;  2RQT A;  2J06 A;  1OPK A;  3VS6 A;  4EIK A;  1W6X A;  5FW9 A;  1RI9 A;  1AVZ C;  1ZBJ A;  2D0N A;  3EG0 A;  2ROT A;  2DBM A;  1VYT A;  2RQR A;  3PVQ A;  2RQU A;  2DRK A;  2DX1 A;  2AZS A;  2D8H A;  4LE9 A;  4CC7 A;  1NEB A; 
#chains in the Genus database with same CATH topology
 4PJJ A;  4KUL A;  3OYG A;  3WXM B;  3L2Q A;  1PWT A;  2RF0 A;  4QT7 A;  4KRT A;  5HK0 A;  3OYK A;  3V8J A;  5I21 A;  3MEW A;  4C8Q G;  3J80 E;  1MMG A;  2FRW A;  4EMK A;  5FU6 B;  2ZPB B;  2CSQ A;  2EYW A;  2MOX A;  3EFR A;  3UT1 A;  2O4X A;  4LDW A;  3RNJ A;  2L3S A;  5KCO A;  1YJ9 T;  1M1G A;  1KC8 C;  1M1K U;  2DIQ A;  3S3N A;  4ZGD B;  2BIV A;  1VQO Q;  1LJO A;  3OB9 A;  3QYH B;  4OMP A;  3CD6 A;  1I0C A;  2ROL A;  1VQL A;  2OX7 A;  3PFS A;  3VUB A;  5IXF A;  2P4T A;  4OGE A;  4EMG A;  3OA6 A;  1QVF P;  4JJD A;  2LQ8 A;  4R0K A;  2BUD A;  2VGM A;  1T3L A;  2K7A A;  2MI6 A;  3VYG A;  3OQ5 A;  1R8O B;  1B7T A;  1YWO A;  4MMK A;  5LJ3 e;  1PRM C;  2Y90 A;  1WX6 A;  2H8H A;  5I22 A;  3I56 T;  1KIK A;  4M77 B;  3CBM A;  1HYO A;  3A1P A;  3EAE A;  1VQO A;  2DZ9 A;  4MML A;  5IN1 A;  3SHW A;  2HBW A;  5LJ3 g;  2DVJ A;  2K3B A;  2MWP A;  3NMZ C;  1HSQ A;  4M75 C;  4PL6 A;  1VQ4 A;  2KXD A;  1UGS B;  1W2B A;  3VS3 A;  2DFU A;  5A0L A;  2AHJ B;  1VQN Q;  4L59 A;  4XTX A;  4AMC A;  4FW1 A;  1VYV A;  4M75 F;  2AK5 A;  5GAM d;  2AT1 B;  2HSP A;  2QA4 Q;  3MEV A;  4BI8 B;  1EZZ B;  3TCJ A;  2MK5 A;  3ZEH A;  2CP0 A;  4FM4 B;  3CCQ Q;  4M7A C;  2E41 A;  5GMK h;  4FT4 A;  2FO0 A;  1PKT A;  1Q86 C;  2EQM A;  3OYB A;  1X2Q A;  1Q81 U;  1MHN A;  1D3B B;  4M7D D;  1NJI C;  2O31 A;  2NUT B;  2O01 E;  2PZ1 A;  3BFM A;  4AFZ C;  5GAN j;  1H64 1;  2DRM A;  1LCK A;  3G71 A;  2L3R A;  2HBP A;  5FU6 C;  2LCL A;  2DL3 A;  3QWY A;  4RTY A;  1QKW A;  4DOV A;  2CP3 A;  2M1H A;  2B8A A;  1TUD A;  3NTK A;  1ZHI A;  2E5K A;  2F2X A;  1VQ7 Q;  3MET A;  3CCE T;  3QSU A;  2ENM A;  1AT1 B;  4OB3 B;  2ZPG B;  1TH7 A;  2W0Z A;  1VQ9 Q;  5LJ3 f;  1KQS S;  3OSS C;  1Q95 G;  3I56 Q;  1V1C A;  1G5V A;  3X24 B;  1WHH A;  1UGP B;  4DBR A;  5KYY A;  2SRC A;  2EFI A;  2NUP A;  2YUP A;  4ANJ A;  4EMK C;  1GBR A;  1X27 A;  1K8A R;  1VQM Q;  1EFN A;  2L89 A;  2EGE A;  2X9H A;  4E7S A;  1K9M R;  2DM1 A;  3HRU A;  4M78 C;  3A98 A;  2HQX A;  2XID A;  4WCI A;  1TXQ A;  1U3O A;  3PIP A;  3LW5 E;  4OB1 B;  2A28 A;  1K73 U;  5GAN d;  4HVV A;  3V8K A;  4A54 A;  4HVU A;  1KD1 C;  2EYZ A;  4A4K A;  3WVE B;  4E2F B;  5HK3 A;  2RD1 A;  1DJ7 B;  3JV3 A;  2OTL Q;  2DAQ A;  4PJO C;  3CXC S;  2LCC A;  4XK8 E;  4LDV A;  5GMK m;  3G6E T;  2PTK A;  4Y28 E;  2DIL A;  1NM7 A;  4QQ6 A;  3UDC A;  2RN8 A;  1I1J A;  3OYI A;  2KSS A;  1ZSZ A;  3VKI A;  4PJO B;  3MPU B;  4AFU C;  1VQ5 A;  3I35 A;  1NE8 A;  1KSW A;  2F2V A;  2LT4 A;  3INZ A;  3VS0 A;  5GAM j;  5CAI A;  3M53 A;  5CKB A;  1GFC A;  3QII A;  2OTJ Q;  3L2R A;  4C92 C;  3OYF A;  1OV3 A;  4C5I A;  5FLX E;  1UJY A;  2E70 A;  3RDV A;  2K4Y A;  4HCC A;  1SKU B;  2EVR A;  1G3S A;  1U06 A;  3VUZ A;  1SG5 A;  5CKF A;  1IHW A;  2YT6 A;  3PT9 A;  4AG1 C;  1YN8 A;  1TOV A;  3PGG A;  1YI2 Q;  3GNG A;  2KT1 A;  1BYM A;  4N4H A;  4Z89 A;  4XTU A;  1VQP T;  5LJ5 d;  3CCJ Q;  4ELY C;  1K9M C;  1XJW B;  2E64 A;  3Q1J A;  4WTO B;  5D6X A;  1NJI R;  2A36 A;  3TSW A;  3OW2 A;  2JXB A;  4A4E A;  2RI3 A;  2GTJ A;  1S72 Q;  4KT0 E;  5KYU B;  4JRI A;  4J9F A;  2V8K A;  1BI1 A;  2JT4 A;  2YDL A;  1MMA A;  2NYS A;  1WPY A;  2QAS A;  3CCS Q;  3CCJ A;  4A4F A;  1KQ1 A;  1SHF A;  4J9H A;  3CCR T;  1NG2 A;  2M9U A;  2VKN A;  1I8F A;  3ULR B;  1YIT Q;  4FL6 A;  1SEM A;  3RES A;  4M75 B;  4ELZ C;  1ZSG A;  2JMC A;  2LX7 A;  3EGX A;  3JCM d;  3M0R A;  3QG1 A;  1WFW A;  2GGR A;  4OMQ A;  2EAY A;  4M75 D;  3MCA B;  2DXT A;  2CZ6 B;  2J05 A;  3MKD A;  4V2S A;  1WHL A;  2EKO A;  2J6K A;  2FVU A;  1IB8 A;  1D1B A;  2E5Q A;  2JS2 A;  3CCE Q;  2X3W D;  4GY5 A;  2DLP A;  3I55 T;  4C92 B;  4CC3 A;  8AT1 B;  3QDF A;  5AT1 B;  3H0F A;  3LYI A;  1BIA A;  1O75 A;  3SB2 A;  5IHK A;  4J7F A;  1HJD A;  3OMG A;  4PJO F;  5GAN 2;  3VS1 A;  2LZ6 B;  1ZA1 B;  4M78 D;  1BU1 A;  1AWO A;  2JS0 A;  1QKX A;  2HMA A;  5HKC A;  1IXD A;  1I81 A;  1WA7 A;  2M51 A;  1S72 T;  4F7U G;  1UGV A;  3EHR A;  1M2O A;  4JZ3 A;  5LJ5 e;  1JB0 E;  3F70 A;  5GAN 4;  1AWX A;  2DEQ A;  1VQ9 A;  2E3H A;  1FMW A;  4DBH A;  4LDU A;  1VQ8 T;  2YLB A;  3H9N A;  4CRI A;  4C8Q D;  1M3C A;  2JTF A;  2RJE A;  3HFN A;  2MIO A;  4LNP A;  4BD3 A;  1K73 C;  2OAU A;  4P5N A;  1JO8 A;  4PFZ A;  2WSF E;  3HSB A;  2FB7 A;  1OZ2 A;  4QQD A;  3JCM e;  4XU1 A;  1K8A C;  3M58 A;  5IHN A;  3EFO A;  4XTW A;  1VQN A;  2RNA A;  2MCN A;  1KQ2 A;  1VQ4 Q;  1QCO A;  5FU7 B;  2JUF A;  2H3E B;  1TWB A;  3QBY A;  1AWJ A;  2L5Q A;  4ORZ A;  3TU4 K;  4J9C A;  4QVZ A;  2RQT A;  3MP6 A;  1OPK A;  3JCM c;  4OMF B;  5KH6 A;  5FW9 A;  4BI4 A;  5CCA A;  5LJ3 h;  5DLO A;  3S3O A;  3I55 A;  4M7A G;  1OX9 A;  1LVK A;  2DX1 A;  2D6F A;  3EFO B;  3HHT B;  1VQ5 T;  1TTH B;  3CD6 T;  1YIJ T;  3UA6 A;  2V1Q A;  5IXB A;  3EH1 A;  2O88 A;  3D7S B;  1PD0 A;  3CCQ A;  2DA9 A;  2LTO A;  5I2S A;  1K0S A;  2X4X A;  1RAB B;  3NPF A;  2ZZD A;  1H3H A;  2GQV A;  2YRV A;  1E6G A;  5GAN 3;  4M7A E;  2PU9 B;  3OYE A;  4KGX B;  4HCZ A;  3ZFJ A;  4RTW A;  1WJQ A;  3BE3 A;  4C5E A;  1GXI E;  4DA4 A;  1KG1 A;  3OSV A;  4WF2 A;  1YIT T;  4JJN K;  1WDX A;  1EIF A;  2G6F X;  2A0F B;  3JCM W;  3L2Z A;  2LQK A;  3O5Z A;  1UFF A;  4XTV A;  5D6Y A;  1MNE A;  4M75 G;  4QKU A;  1NLO C;  4RTZ A;  4Z02 A;  3A8H B;  3L1A A;  3CCS A;  1QMC A;  4OMM A;  2DER A;  3QXE B;  1VQL Q;  3GF5 A;  3CD6 Q;  4N4I A;  1BB9 A;  1JRI A;  2LJ0 A;  1G3T A;  3M56 A;  4RG8 A;  1O9S A;  7AT1 B;  1YBY A;  1K76 A;  4N4G A;  1YJ9 Q;  1IGQ A;  4OGC A;  1UJ0 A;  2M16 A;  2F5T X;  3VV0 A;  3KBG A;  3M0Q A;  3CCJ T;  4JZ4 A;  1BI2 A;  2PUO B;  1E7O A;  3H0I A;  4BDZ A;  3MP8 A;  5IHI A;  3REB B;  3M0P A;  2JOY A;  5GMK e;  1ARK A;  3MJX A;  1OUL A;  2QQ9 A;  3CC2 Q;  3CC4 Q;  1OEB A;  1UE9 A;  1K73 R;  4KUD K;  1SRL A;  4J9G A;  2CH4 W;  1WHG A;  3QJY A;  4C8Q A;  5GAN 5;  4F17 A;  1H92 A;  2M0Y A;  4M78 G;  1NPR A;  3KXT A;  2P0P A;  5KE3 A;  3V8L A;  3OW2 P;  1QWE A;  3OBY A;  4HVW A;  2DO3 A;  1WQW A;  4LXC A;  1YJW Q;  3S6W A;  1K8A U;  2DXB A;  1C1A A;  1JXM A;  4R55 A;  3CPW S;  2COZ A;  1UGR B;  1KK7 A;  1ZX6 A;  1ABO A;  2W10 A;  4XU3 A;  1X75 C;  2OTJ A;  2X51 A;  1TS9 A;  3BDU A;  3EG1 A;  3MEA A;  3NTI A;  3QO3 A;  5CQY A;  3JCM J;  3OS2 A;  4M78 E;  4AT1 B;  3JAM E;  4LDY A;  1M2V B;  5A0D A;  2O9V A;  2RHZ A;  4ZTJ A;  1JBM A;  2JNG A;  3ME9 A;  5LJ3 d;  4J9E A;  4RCB A;  3N5B B;  2C06 A;  4F16 A;  2ZPF B;  3OYH A;  3VJP A;  1BK2 A;  2J6O A;  4PK4 A;  4JJB A;  2LQN A;  1NJI U;  2DJQ A;  4II1 A;  3RBB B;  2DL8 A;  3CC7 A;  4FYV B;  4DBQ A;  4M7A D;  2NUZ A;  3CC7 Q;  1VQ9 T;  2KT8 A;  3OYA A;  2DEU A;  2ABL A;  2E10 A;  3J7A F;  4F7U A;  1WI7 A;  2OI3 A;  4F14 A;  4IIM A;  1NBE B;  1VQM A;  1TG0 A;  5DY9 A;  1PCX A;  2K3X A;  1Q7Y C;  3TQ7 P;  5LJ5 j;  2L3Q A;  3JB9 I;  1YJN T;  2C0T A;  1QP3 A;  5CQX A;  1V76 A;  1Q7Y U;  4EPC A;  4HCB A;  1I5O B;  4JDS A;  1N27 A;  2RPN A;  1T3S A;  4IIO A;  1C6V X;  2AKL A;  2EQK A;  3OS5 A;  4ME7 A;  1BCO A;  3PVL A;  4A63 B;  2R5A A;  1NYG A;  4RTX A;  2MYS A;  4JRK A;  1I5L A;  1UHF A;  3M9Q A;  5GAN 7;  2GQI A;  3G71 Q;  2RMO A;  4NL3 A;  1QQJ A;  1UEB A;  4F7U E;  1JQQ A;  4MZP A;  1KD1 R;  1VQK Q;  2D9T A;  1X69 A;  2NUP B;  1V29 B;  4C0D C;  1KFZ A;  3V7R A;  2CKK A;  3PE0 A;  3SFM A;  1FWZ A;  2RB6 A;  2MWO A;  3CC2 T;  2ED0 A;  3CC2 A;  3CCR A;  2FG0 A;  2QA4 A;  2KNB B;  2JTE A;  3X25 B;  1OYX A;  2KEA A;  2XDB A;  1TUG B;  2PVO B;  1G3W A;  2E1H A;  4J6Y A;  1I4K 1;  3I9Q A;  4OB0 B;  2WAC A;  2GBQ A;  4TVR A;  3GOX A;  4DEX A;  1QLY A;  2HQE A;  2BE9 B;  3JRZ A;  2RI2 A;  2KAF A;  2PNI A;  1YJN Q;  3CCV A;  1PG5 B;  1D3B A;  2JN0 A;  2VV5 A;  3U23 A;  1ZBX A;  1PD1 A;  1KJW A;  3OYL A;  1ACM B;  2C0O A;  1QVG A;  2KQW A;  2QG9 B;  2PVD B;  3LH5 A;  1VQP Q;  1AZE A;  2FYK A;  3URG A;  3GPL A;  4J9I A;  2DNU A;  3SWN B;  1RAG B;  2PUK B;  2D8J A;  4O5V A;  1Q82 C;  4RCC A;  4Y92 A;  3RR6 A;  4B9W A;  1E6H A;  1BI0 A;  2MMP A;  1QWF A;  1GBQ A;  2MF2 A;  8ATC B;  2ECZ A;  1X6G A;  1YWP A;  1BBZ A;  3BDL A;  2Y4X A;  3EGU A;  1XQH A;  3NTH A;  4OMO A;  3UWN A;  4X1V A;  2KYB A;  3OYY A;  3JB9 G;  1QVF A;  1BIB A;  3SDZ A;  2RJC A;  2XKO C;  4L5G A;  2KMT A;  4UC4 A;  2LMJ A;  1BCM A;  4BAC A;  1TU0 B;  3LLR A;  4D8D A;  1X6O A;  1QVG P;  1SRM A;  5HY6 A;  2KRO A;  4M7D A;  3M57 A;  2NWM A;  4GLM A;  3CMA Q;  2WSE E;  3P8H A;  5I2M A;  4CI0 C;  1FMK A;  2JM8 A;  2AKK A;  2F2W A;  4EMK B;  1VIF A;  5LJ3 j;  1VQ6 A;  4AFS C;  2EW3 A;  2F1L A;  1D0X A;  2E6N A;  3QZ9 B;  3TVT A;  4XTY A;  1U5S A;  2LCS A;  3GNF B;  3BY7 A;  3CXC A;  5GJW B;  3PMT A;  5FRM A;  1S1N A;  1EX4 A;  2DTO A;  1FMV A;  2EGC A;  4NS5 A;  2EJ9 A;  3FDR A;  3JB9 F;  2O2O A;  4QW2 A;  3CCL Q;  2KXC A;  4PLL A;  2E65 A;  2XDD A;  3P8B B;  4RTV A;  2CZ7 B;  4QVD A;  5GAO m;  2K57 A;  3DKM A;  3TEE A;  3CCV Q;  4ZN1 A;  3VS2 A;  1ZLM A;  1S72 A;  2HEQ A;  2C0I A;  3LH0 A;  4FIB A;  2KY9 A;  1ZSZ B;  2LRQ A;  2QTX A;  3G4S Q;  2DK3 A;  3QUI A;  5AYF A;  4EIK A;  2GFU A;  1W6X A;  1WGS A;  1MND A;  3QDR B;  1RAE B;  2D0N A;  1RI0 A;  1W2B P;  2COW A;  1VYT A;  3CCM T;  3PVQ A;  2MAM A;  1ZSZ C;  2XDP A;  2AZS A;  3SD4 A;  1VQM T;  3DLM A;  2GNC A;  3CC7 T;  1VQK A;  5D6W A;  1Q7Y R;  4ZNX A;  5KYX B;  2DD4 A;  1Z9Q A;  1D0Y A;  5IT9 E;  4F7U B;  2YUN A;  2DBK A;  2FRY A;  1W4S A;  2XU8 A;  4PJO G;  4IUR A;  3HL8 A;  4ZN3 A;  3EGD A;  3CCS T;  1VQN T;  4J8O A;  3KUF A;  5CO7 A;  2QAZ A;  2RK2 A;  2KE9 A;  2FZC B;  1IHV A;  1PSE A;  2QTV A;  5FRO A;  3CME Q;  1VQ5 Q;  1VQ6 T;  2VC8 A;  4AG2 C;  1YIJ Q;  1W70 A;  4BY6 B;  3QYG B;  2FL7 A;  5GAM h;  4FYY B;  1Q82 U;  1B34 B;  3C4S A;  1QCF A;  2GFA A;  3I5R A;  4KGZ B;  3CCM Q;  1PRL C;  2QGF B;  3E9G A;  1SF9 A;  1OX8 A;  1YHQ Q;  1J3T A;  2XI9 A;  4E6R A;  2JVV A;  1QVP A;  1UUE A;  1YIJ A;  3KFV A;  1SHG A;  3EG2 A;  2EQJ A;  3C95 A;  3J81 E;  4BDY A;  4JRP A;  1NZ9 A;  4GLK A;  3HP9 A;  3A8G B;  3VS7 A;  2CT3 A;  2OJ2 A;  1WXT A;  3LWI A;  4M7D F;  2CP2 A;  2ZPH B;  1AEY A;  3CCL A;  4L6V 5;  4FYX B;  5FWC A;  1OOT A;  4PJL A;  2CUD A;  4YTL A;  4M7D G;  2O4X B;  1PKS A;  5GAM g;  4JPB W;  2J6F A;  2DL5 A;  5LJ5 g;  3CCV T;  1Q82 R;  3M5A A;  1X6B A;  3ZL7 C;  1VQ6 Q;  1N8R U;  4C8Q E;  4JS4 A;  1IO6 A;  3NHN A;  1GCQ C;  3G6E Q;  2KR3 A;  2GTO A;  1C0M A;  1SSH A;  5FWB A;  1FX7 A;  1A0N B;  5GAN h;  4BI3 A;  1Y07 A;  5GAO l;  4IUP A;  2CT4 A;  4B6M A;  1PHT A;  4M77 G;  3G4S A;  1MMD A;  2DJZ A;  1M5Q 1;  3G4S T;  2DYB A;  1M27 C;  1Y96 A;  2EYX A;  2X4W A;  2ZCF B;  2DF6 A;  5GMK l;  3CPW A;  1WNL A;  5GAM e;  1KHI A;  2RK1 A;  2R58 A;  4LDX A;  5GAN f;  1YNZ A;  5FRN A;  4CC4 B;  2K3Y A;  2DET A;  2KRN A;  2ATC B;  6AT1 B;  4Y91 A;  9ATC B;  4FCY A;  1U1S A;  2ZGW A;  4IUV A;  3M0S A;  3JCM P;  3HRS A;  3O8V A;  1PC0 A;  1Y71 A;  1X43 A;  2EQU A;  4PJN A;  3JB9 J;  2YWW A;  5CKE A;  1KC8 U;  1M1K C;  2OTL A;  2LP5 A;  1HK9 A;  3THK A;  3H0H A;  3M59 A;  5I11 A;  2DL4 A;  2XG8 D;  1G2B A;  2V26 A;  3L42 A;  2GCX A;  3FJP A;  2EBP A;  1XTD A;  3FLG A;  3JCM f;  2EIF A;  2CRE A;  4N0A C;  3A8M B;  2IVW A;  2BZ8 A;  3C94 A;  2HD0 A;  3CMA A;  1YP5 A;  3CMA T;  2MPX C;  3HTR A;  3M0U A;  2O9S A;  2LNH B;  1T0J A;  1TUC A;  4C92 F;  5GAN g;  1ZA2 B;  2DIG A;  2QI2 A;  2X4J A;  3E2U A;  2VXE A;  4IUQ A;  4AFQ C;  2BTT A;  3QWX X;  1RAC B;  3A5Z B;  3GLX A;  1QP2 A;  4FYW B;  5GAN e;  3UPU A;  3E19 A;  5LJ5 f;  1WXU A;  1YHQ T;  1B34 A;  1Q81 R;  1Y7X A;  4Q5W A;  1T0H A;  4EDU A;  1AOJ A;  1RAD B;  2E3I A;  1H3Z A;  3VRY A;  2RQW A;  3CCR Q;  4X34 A;  5CIU A;  4CC2 A;  2LT1 A;  1VYU A;  4RG2 A;  2BKD N;  5GMK j;  1N6A A;  1K4U S;  4PFO A;  4F7U F;  4OP0 A;  3CCQ T;  1UHC A;  4NOY A;  5GAO n;  3JB9 D;  1JU5 C;  3M54 A;  1I07 A;  5M9O A;  2VVK A;  3VS5 A;  2EPD A;  4OVA A;  4C92 E;  5CKH A;  3OS0 A;  1K0X A;  2FZK B;  1RL2 A;  4QQG A;  2KGT A;  4M78 A;  5KCH A;  3I55 Q;  4FSS A;  4C0G A;  4IUT A;  2QQB A;  2P84 A;  2CZ1 B;  2YRC A;  2FPF A;  1B3Q A;  4OB2 B;  3P8D A;  4JUV A;  1BKB A;  1RAA B;  1WJS A;  1YJN A;  1U8R A;  2BZX A;  1KC8 R;  1JJ2 A;  4LD6 A;  1W1F A;  4M4Z A;  4OML A;  1VQK T;  3DB3 A;  3EH2 A;  2RHX A;  4M77 A;  5GJV B;  4E7L A;  2QYZ A;  2P0K A;  3RMQ A;  1GRI A;  3TRE A;  4HXJ A;  2HKQ B;  2QQS A;  5LL6 S;  5L23 A;  4XTZ A;  4E7J A;  2EQI A;  2VGN A;  2GF7 A;  3REA B;  4KUI A;  2LX9 A;  1WHJ A;  2EYY A;  1BI3 A;  1AD5 A;  3EG3 A;  3DLL A;  2HQH A;  1KD1 U;  1Y96 B;  1X2K A;  4DEY A;  3PMI A;  3GIB A;  3QZ5 B;  4KGV B;  4C5H A;  5GAN 6;  2FPD A;  2QXF A;  4FSX A;  2KBT A;  2LDM A;  2KRS A;  4RUG A;  1YI2 T;  2L8D A;  2VAS A;  4D8K A;  1M9S A;  2LC4 A;  1UB4 A;  2OTL T;  2K5L A;  4PKC C;  2YHT A;  4LUD A;  3NGP A;  1NEG A;  2X35 A;  3TSZ A;  1AHJ B;  1KQS P;  4MDW A;  1OPL A;  1LPL A;  3EGX B;  4BY6 C;  1RLQ C;  1RUW A;  1ZUU A;  4M75 A;  3I5S A;  1F1B B;  3GBQ A;  1WHM A;  2Y4Y A;  4DBF A;  3UAT A;  5CR2 A;  1OQK A;  3H8Z A;  2COY A;  2I2L A;  1QVF S;  1VIE A;  4K11 A;  3RKW A;  4XU2 A;  2OTJ T;  1HD3 A;  1PM3 A;  5L8R E;  5KYN A;  1CSK A;  2K9G A;  3MHX A;  1WLP B;  2CH4 A;  4ESR A;  1FXX A;  4C0F A;  3CCU T;  2K6D A;  4C92 G;  2I0N A;  2ZPI B;  2YUO A;  3CXC P;  1IGU A;  2EGA A;  3R6N A;  3HRT A;  4A4G A;  4RTT A;  2JJ9 A;  2DYI A;  4VUB A;  2KVQ G;  4C8Q C;  1OU9 A;  2JM9 A;  4J83 A;  4KH0 B;  3LWH A;  1D0Z A;  2CP7 A;  2P4R A;  4HKE A;  3FC3 A;  1YJ9 A;  1MV3 A;  2R5M A;  1YJW T;  2X3X D;  1IZ6 A;  2YUQ A;  2H3J A;  2KRM A;  2K2M A;  4E7K A;  2E6Z A;  2AIR B;  2J06 A;  3PNW C;  3RUX A;  1D09 B;  3EGD B;  1IRX A;  1RI9 A;  3M4G A;  3CBP A;  1AVZ C;  1ZBJ A;  3EG0 A;  1VUB A;  2DBM A;  2QGG A;  2RQR A;  2RQU A;  2DRK A;  1UGQ B;  1YI2 A;  3AT1 B;  2HL5 C;  1KQS A;  2VYT A;  4O6J A;  4LE9 A;  2RJF A;  2DVE A;  5KYX A;  4CC7 A;  1GCP A;  2M02 A;  3PTA A;  3OYJ A;  1X01 A;  4DQ2 A;  3SWN C;  2KYM A;  3EG9 A;  2CP6 A;  4JJC A;  3H6Z A;  4M77 F;  2QEX Q;  4E7H A;  1KHC A;  2X4Y A;  1JJ2 P;  3FEO A;  2HSE B;  2QQR A;  2V8J A;  2FZG B;  2P0Q A;  4M7A F;  2YLC A;  2A3L A;  2LJ1 A;  4JRQ A;  2KI7 A;  2ED1 A;  4M7D E;  3JCM X;  2A7Y A;  5KE2 A;  4FW2 A;  4PLI A;  3JCM V;  1YFN A;  3HKS A;  4PFP A;  3ZBD A;  1WYX A;  3M0T A;  4M7D C;  3FRN A;  4E7I A;  3A8O B;  2VWF A;  3MO8 A;  1N9S A;  1OU8 A;  2QA4 T;  1M1F A;  1N8R C;  1NYF A;  1QVG S;  5DM7 R;  3AHU A;  1RAH B;  3UF4 A;  3CCM A;  5GAN 8;  2YSQ A;  4J9B A;  1JXO A;  2WSC E;  4KBM B;  3FB9 A;  1WXB A;  1AZG B;  2PVG B;  4M77 E;  2IIM A;  4LN2 A;  1YCS B;  2JW4 A;  2A37 A;  5FU7 C;  1QCN A;  2HAX A;  1M2V A;  3CME A;  2LNV A;  3C12 A;  3CME T;  2HDA A;  4RKU E;  1M90 U;  2HCK A;  4M78 B;  1G3Y A;  2K2V A;  2XIC A;  3H41 A;  2FEI A;  4FU6 A;  3MP1 A;  4Z8A A;  4C92 A;  5KYW A;  2HZY A;  5GAO q;  3L2W A;  2YXY A;  2BE7 D;  3SEM A;  3GP8 A;  3L2V A;  1Y57 A;  1VA7 A;  2HKN A;  2JZ2 A;  3I56 A;  3OMC A;  4ZGJ B;  5EC7 A;  5HCK A;  4ZGE B;  1LNX A;  2F5K A;  3RMS A;  5GAM f;  2L3P A;  2XK0 A;  1VQ7 A;  1MGQ A;  2VXF A;  1R0B G;  4LD9 K;  2RH2 A;  3OYM A;  2JMA A;  3CEY A;  2LVM A;  2IG0 A;  4B9X A;  3V7S A;  2VUB A;  1GCQ A;  3T9N A;  2A08 A;  4BE2 A;  4OMN A;  3JCM g;  5GAO r;  4N0A A;  2RO0 A;  4M7A A;  2L0A A;  4M7D B;  2F69 A;  5GMK i;  1M3A A;  2E4H A;  2G3R A;  2DXC A;  4NL2 A;  4HT8 A;  5IH2 A;  5C0M A;  1Y0M A;  2BZY A;  4MDX A;  4OF1 A;  1N8R R;  1WQ7 A;  1P92 A;  4PJM A;  2DKG A;  4BUG A;  1M8V A;  3G71 T;  4PJO E;  1GFD A;  4HA8 A;  5EG2 A;  2HNI A;  3CCE A;  1M8M A;  1FYN A;  2QEX T;  1K9M U;  2K5I A;  1H8K A;  4C5G A;  3JCM Q;  5C6S A;  5CK9 A;  3OYC A;  2M0O A;  1K9A A;  1ZUY A;  1N9R A;  1M1K R;  4M77 D;  2D1X A;  3JB9 H;  3CPF A;  1M90 R;  2J7I A;  3C0C A;  2RQV A;  1VQP A;  3M55 A;  5D7U A;  4IKF A;  3LX7 A;  3QKJ A;  5ECA A;  4C0Z A;  5KYU A;  2XD0 A;  1NPP A;  1AWW A;  2CSI A;  2EYQ A;  1VQL T;  2LJ3 A;  3PIO A;  4BE0 A;  2CDT A;  2FHD A;  1YCY A;  4JLG A;  2R57 A;  2XMF A;  4F04 B;  2AZV A;  3UA7 A;  1W2B S;  2DXU A;  2DPP B;  1PSF A;  1WHK A;  2FPE A;  2V1R A;  1R0C B;  4R56 A;  3G6E A;  1GL5 A;  2CUB A;  4IUU A;  2ZAE A;  3EG9 B;  2KK4 A;  3CQT A;  1G83 A;  1G8X A;  2RM4 A;  3A8L B;  4JS5 A;  4DOW A;  3S3M A;  3ASK A;  3SWN A;  2QDL A;  4EMH A;  1RLP C;  2IPO B;  4X9D A;  1YIT A;  3NFC A;  2DD5 A;  3RIR A;  2KDS A;  5CVI A;  4QVC A;  1UEC A;  1CKA A;  1M3B A;  3G7Z A;  3HPW A;  5A2Q E;  4C0D B;  3RER A;  4FT2 A;  3CBO A;  3E1S A;  4X9C A;  1MUZ A;  2LQW A;  3EFS A;  3VRZ A;  4E47 A;  4A53 A;  4J9D A;  1LOJ A;  4LUE A;  4C8Q F;  1PNJ A;  5KYY B;  1ZUK A;  5CKD A;  4RTU A;  2RI5 A;  3X20 B;  2CZ0 B;  4PJO A;  2CGH A;  3CC4 T;  1ABQ A;  3LGF A;  3V7C A;  3VYH B;  1YHQ A;  2SEM A;  4HCK A;  1OZ3 A;  2CYZ B;  1MV0 B;  1D1A A;  2ESW A;  1VQ8 A;  3QPH A;  1D1C A;  2E12 A;  5A0G A;  4PNO A;  2K79 A;  3RKY A;  1XNI A;  1SPK A;  4XQ3 A;  2DTI A;  2DL7 A;  3BW1 A;  1RAI B;  4M78 F;  1ZQ1 A;  2DZC A;  2XHC A;  4PJO D;  1VOM A;  4RMO A;  4J6X A;  3FIF A;  3FJ5 A;  3X28 B;  2JTM A;  2DMO A;  2DE0 X;  3JCM b;  3HFO A;  3M4Y A;  4J6W A;  4M7A B;  3CCL T;  1MMN A;  4MZM A;  3WVD B;  3DB4 A;  2DTH A;  1M30 A;  2K5F A;  2YRD A;  1RAF B;  2B86 A;  2QK0 A;  2QEX A;  1K1Z A;  1JEG A;  1Q81 C;  2EJF A;  3CCU Q;  5J39 A;  3G1J A;  1B07 A;  5DLQ E;  1NLP C;  3CCU A;  2CS7 A;  3OYN A;  2NLU A;  1Z9Z A;  4JLI A;  4BB7 A;  2ZPE B;  4BE1 A;  3VS4 A;  4MZT A;  5LJ5 h;  1N5Z A;  1QW1 A;  2VB6 A;  1XOV A;  3IQL A;  1VQ4 T;  2PQW A;  2EKH A;  3EHQ A;  3R6O A;  5KYW B;  1R77 A;  3OYD A;  1UG1 A;  1WIE A;  1UDL A;  1YJW A;  4HT9 A;  3JSC A;  3VU3 C;  2NUT A;  3L2U A;  2V8I A;  2QQA A;  1TSF A;  2OAW A;  1Q86 U;  1WZO A;  4GBQ A;  3LGL A;  4J5Y A;  4E7Z A;  5IAY A;  4A4H A;  1M4Z A;  2RA2 A;  2CP5 A;  4ZTF A;  1VQ7 T;  2Z0W A;  1Q86 R;  3CC4 A;  4M75 E;  3OBW A;  3OY9 A;  1HXD A;  1CKB A;  1VQ8 Q;  3E9F A;  3JCM h;  5J26 A;  4C8Q B;  1UTI A;  4D6W A;  3QHS A;  1VQO T;  4M77 C;  4ATO A;  1U1T A;  4XAX B;  2L2P A;  2RHI A;  4Z88 A;  3OS1 A;  2RHY A;  3ER0 A;  5J3B A;  3X26 B;  3OW2 S;  2EWN A;  2EJG A;  2HL3 A;  3VS6 A;  1SSF A;  3RKX A;  2QDY B;  1JJ2 S;  2ROT A;  3MEU A;  3QJ6 A;  3CPW P;  1M90 C;  4XU0 A;  2D0Q B;  2RJD A;  2D8H A;  2RHU A;  1WJR A;  5GAO p;  4C92 D;  1NEB A;  1IRE B;  4KH1 B;  4J7I A;  1OI1 A; 
#chains in the Genus database with same CATH homology
 2GNC A;  3UA6 A;  4ZNX A;  1PWT A;  2KYM A;  2V1Q A;  2RF0 A;  4QT7 A;  4KRT A;  5IXB A;  1Z9Q A;  4JJC A;  2O88 A;  2DA9 A;  1K0S A;  2YUN A;  2FRW A;  2DBK A;  2FRY A;  3NPF A;  2CSQ A;  1H3H A;  2EYW A;  2MOX A;  2LJ1 A;  1E6G A;  3RNJ A;  2ED1 A;  2L3S A;  2KE9 A;  4RTW A;  1WYX A;  3M0T A;  4AG2 C;  1W70 A;  4OMP A;  2VWF A;  1I0C A;  2ROL A;  1WDX A;  2G6F X;  1QCF A;  5IXF A;  1NYF A;  3O5Z A;  3I5R A;  1UFF A;  4JJD A;  1PRL C;  4R0K A;  3UF4 A;  2YSQ A;  1T3L A;  4J9B A;  1JXO A;  2K7A A;  1NLO C;  4RTZ A;  1YWO A;  1WXB A;  1AZG B;  4OMM A;  1PRM C;  2IIM A;  4LN2 A;  1J3T A;  1WX6 A;  1YCS B;  2H8H A;  5I22 A;  2JW4 A;  2A37 A;  4E6R A;  1KIK A;  1UUE A;  1BB9 A;  2LJ0 A;  3KFV A;  1SHG A;  3EG2 A;  3SHW A;  2HDA A;  2HBW A;  1K76 A;  2HCK A;  2DVJ A;  2K3B A;  1UJ0 A;  1HSQ A;  3NMZ C;  2KXD A;  3VS7 A;  2CT3 A;  2OJ2 A;  3VS3 A;  3M0Q A;  1WXT A;  4JZ4 A;  1AEY A;  3H41 A;  1E7O A;  3H0I A;  1VYV A;  2AK5 A;  3REB B;  5IHI A;  5FWC A;  3M0P A;  1ARK A;  2HSP A;  2FEI A;  1OOT A;  4Z8A A;  1OEB A;  1UE9 A;  2CUD A;  1SRL A;  2FO0 A;  4J9G A;  2CH4 W;  1PKS A;  1PKT A;  3SEM A;  4F17 A;  1H92 A;  2M0Y A;  1Y57 A;  1VA7 A;  4JPB W;  5EC7 A;  1X2Q A;  5HCK A;  2J6F A;  2DL5 A;  1QWE A;  4HVW A;  1X6B A;  2O31 A;  3ZL7 C;  2PZ1 A;  2L3P A;  4AFZ C;  2DRM A;  1IO6 A;  1LCK A;  3NHN A;  1GCQ C;  2KR3 A;  2GTO A;  2JMA A;  1SSH A;  1JXM A;  5FWB A;  1A0N B;  2DL3 A;  3QWY A;  4RTY A;  1QKW A;  2CT4 A;  1TUD A;  1GCQ A;  2E5K A;  1ZX6 A;  1ABO A;  2F2X A;  2W10 A;  2A08 A;  2ENM A;  1PHT A;  4OMN A;  2DYB A;  1M27 C;  2EYX A;  2W0Z A;  2DF6 A;  3EG1 A;  1V1C A;  2L0A A;  1GCP A;  1YNZ A;  1M3A A;  4CC4 B;  2SRC A;  2YUP A;  2O9V A;  2KRN A;  1GBR A;  5IH2 A;  1X27 A;  1Y0M A;  1EFN A;  2BZY A;  4J9E A;  2EGE A;  2DM1 A;  4F16 A;  3M0S A;  1GFD A;  1X43 A;  3A98 A;  1BK2 A;  4WCI A;  2J6O A;  1U3O A;  4JJB A;  2LP5 A;  2LQN A;  2A28 A;  3THK A;  2DJQ A;  1M8M A;  3H0H A;  1FYN A;  3RBB B;  5I11 A;  2DL8 A;  1H8K A;  2DL4 A;  1G2B A;  4HVV A;  4HVU A;  2EBP A;  2NUZ A;  2CRE A;  2EYZ A;  2BZ8 A;  3JV3 A;  1K9A A;  1ZUY A;  2KT8 A;  2D1X A;  1YP5 A;  2J7I A;  2ABL A;  3C0C A;  2RQV A;  1WI7 A;  2PTK A;  3M0U A;  2OI3 A;  4F14 A;  2O9S A;  2LNH B;  4IIM A;  2DIL A;  1T0J A;  1NM7 A;  5ECA A;  1TUC A;  2RN8 A;  1I1J A;  1TG0 A;  2L3Q A;  4AFU C;  2C0T A;  3I35 A;  1AWW A;  4AFQ C;  2BTT A;  2CSI A;  3QWX X;  1KSW A;  2F2V A;  3VS0 A;  2LJ3 A;  2CDT A;  1GFC A;  2RPN A;  1T3S A;  4IIO A;  1WXU A;  2AKL A;  2XMF A;  2AZV A;  3UA7 A;  1T0H A;  1AOJ A;  3PVL A;  4A63 B;  1OV3 A;  1NYG A;  4RTX A;  1UJY A;  2FPE A;  3VRY A;  2RQW A;  2V1R A;  1UHF A;  2EVR A;  2GQI A;  1GL5 A;  2RMO A;  1U06 A;  2CUB A;  4CC2 A;  1VYU A;  1JQQ A;  3CQT A;  1K4U S;  1G83 A;  1X69 A;  2YT6 A;  1KFZ A;  1UHC A;  2QDL A;  4AG1 C;  1JU5 C;  1I07 A;  1RLP C;  3PE0 A;  2VVK A;  3VS5 A;  2EPD A;  1YN8 A;  1K0X A;  2KGT A;  2ED0 A;  2KT1 A;  4Z89 A;  2FG0 A;  1UEC A;  4FSS A;  1CKA A;  1M3B A;  2KNB B;  2JTE A;  2KEA A;  2FPF A;  1MUZ A;  1B3Q A;  2LQW A;  3I9Q A;  2GBQ A;  2A36 A;  3VRZ A;  3TSW A;  2BZX A;  4J9D A;  4LUE A;  1PNJ A;  1ZUK A;  4DEX A;  2JXB A;  1QLY A;  1W1F A;  4RTU A;  4M4Z A;  4OML A;  2GTJ A;  2PNI A;  1ABQ A;  5GJV B;  4J9F A;  3U23 A;  2SEM A;  4HCK A;  2JT4 A;  1KJW A;  1GRI A;  2YDL A;  4HXJ A;  1MV0 B;  5L23 A;  2ESW A;  2C0O A;  1SHF A;  2EQI A;  4J9H A;  3LH5 A;  1AZE A;  1NG2 A;  2K79 A;  2VKN A;  3ULR B;  1SPK A;  3REA B;  1SEM A;  2DL7 A;  4J9I A;  1ZSG A;  2EYY A;  2JMC A;  2LX7 A;  2DNU A;  1AD5 A;  3EG3 A;  3M0R A;  1WFW A;  2GGR A;  4OMQ A;  2D8J A;  2J05 A;  1X2K A;  4Y92 A;  3FJ5 A;  4DEY A;  2J6K A;  2JS2 A;  2DMO A;  2DE0 X;  1E6H A;  1QWF A;  2X3W D;  1GBQ A;  2DLP A;  2FPD A;  4CC3 A;  2ECZ A;  1X6G A;  1YWP A;  3H0F A;  2KBT A;  4RUG A;  2KRS A;  1M30 A;  5IHK A;  1BBZ A;  4D8K A;  3EGU A;  1HJD A;  4OMO A;  4LUD A;  2B86 A;  1NEG A;  3NGP A;  4X1V A;  2LZ6 B;  3VS1 A;  2KYB A;  1BU1 A;  1AWO A;  2JS0 A;  1K1Z A;  1JEG A;  1QKX A;  3TSZ A;  1WA7 A;  1OPL A;  2M51 A;  1B07 A;  1RLQ C;  1RUW A;  1ZUU A;  1UGV A;  3EHR A;  3I5S A;  1NLP C;  4JZ3 A;  2LMJ A;  3GBQ A;  1AWX A;  1Z9Z A;  3UAT A;  3VS4 A;  1N5Z A;  4D8D A;  1XOV A;  3IQL A;  1SRM A;  4K11 A;  2KRO A;  2EKH A;  2NWM A;  3EHQ A;  4GLM A;  1HD3 A;  1UG1 A;  1WIE A;  1CSK A;  1FMK A;  1M3C A;  2JM8 A;  1UDL A;  2AKK A;  2F2W A;  4AFS C;  2EW3 A;  2K9G A;  3TVT A;  2MIO A;  4LNP A;  1WLP B;  1U5S A;  2OAW A;  2LCS A;  2CH4 A;  4ESR A;  4GBQ A;  1JO8 A;  2K6D A;  5GJW B;  1S1N A;  2I0N A;  2EGC A;  2YUO A;  2EGA A;  3R6N A;  4RTT A;  2O2O A;  1CKB A;  5IHN A;  2KXC A;  2JM9 A;  2RNA A;  4RTV A;  1UTI A;  2MCN A;  2P4R A;  3VS2 A;  1ZLM A;  1MV3 A;  2L2P A;  2HEQ A;  1AWJ A;  2X3X D;  4ORZ A;  4Z88 A;  2C0I A;  4J9C A;  2YUQ A;  2KRM A;  2K2M A;  2RQT A;  2J06 A;  1OPK A;  3VS6 A;  4EIK A;  1W6X A;  5FW9 A;  1RI9 A;  1AVZ C;  1ZBJ A;  2D0N A;  3EG0 A;  2ROT A;  2DBM A;  1VYT A;  2RQR A;  3PVQ A;  2RQU A;  2DRK A;  2DX1 A;  2AZS A;  2D8H A;  4LE9 A;  4CC7 A;  1NEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...