1QWFA

C-src sh3 domain complexed with ligand vsl12
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific interactions outside the proline-rich core of two classes of Src homology 3 ligands.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Complex (signal transduction/peptide)
molecule keywords TYROSINE-PROTEIN KINASE TRANSFORMING PROTEIN SRC
total genus 8
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1qwfA00
2GNCA 3VRYA 2GBQA 5IXBA 2DLPA 2AZVA 4RUGA 3M0UA 1YCSB 2LJ1A 1UUEA 1WLPB 1E7OA 3EG0A 1QLYA 1GFDA 4OMLA 2F2VA 4K11A 3VS7A 3IQLA 1W6XA 4J9BA 1ABQA 2EGEA 2D8HA 2K79A 1PWTA 3REBB 3I35A 1U3OA 2EBPA 3M0QA 2ED1A 2DNUA 5I22A 3LH5A 1UJ0A 2JS0A 2H8HA 1VYVA 2HCKA 3SEMA 4J9IA 4RTXA 1GCPA 2FPFA 3NMZC 1ZUUA 3VS2A 1WFWA 3RBBB 2EPDA 1UDLA 2DYBA 1KSWA 1H3HA 2BTTA 1BU1A 1AZGB 3UA7A 1FYNA 3PVLA 4CC2A 5L23A 3I5SA 2ROLA 3JV3A 4JJCA 1QCFA 2DBKA 2VKNA 2ABLA 1SEMA 2YUOA 4Y92A 2SRCA 3C0CA 2CSQA 2KR3A 2D8JA 1PKSA 3M0TA 4Z8AA 2JM8A 2DRKA 4AFUC 2AKKA 1WIEA 2RQRA 2FO0A 4AG2C 2JM9A 4AFSC 2EW3A 2CDTA 4LN2A 1B07A 3ZL7C 2DRMA 2JT4A 1VYTA 4OMMA 1SHGA 1UGVA 2CH4W 2ED0A 1KFZA 1Y0MA 1WXUA 3TVTA 2DL4A 3EG2A 1ZUYA 1JEGA 1YNZA 2DBMA 1YWPA 2DM1A 1I07A 2G6FX 2VWFA 3PE0A 2LZ6B 4D8KA 4AG1C 2KRNA 2K9GA 4R0KA 3EG1A 4LUDA 1AOJA 1Z9QA 2KYBA 1UFFA 4HXJA 2NWMA 1HSQA 2DMOA 2J6OA 1T0HA 2I0NA 2PNIA 1K1ZA 1QKXA 3THKA 5HCKA 2RPNA 2LJ0A 2DL7A 2DL5A 4LNPA 2GTOA 1X43A 2JMAA 1GBQA 1WXBA 1XOVA 2K3BA 4RTUA 3CQTA 2HBWA 2RF0A 2K2MA 4LUEA 2RQVA 3QWYA 3VS1A 2HEQA 1MV3A 1RLQC 1W70A 2CREA 3O5ZA 2LCSA 1GL5A 2GGRA 1Y57A 2CUDA 4IIMA 2MOXA 3H0IA 1PHTA 2A37A 5IXFA 2EYWA 1G83A 2KGTA 2JXBA 4ESRA 2FPDA 1ZBJA 2EYYA 2YSQA 3NGPA 1BBZA 3SHWA 1SHFA 1K4US 4JZ4A 2C0IA 1M30A 4J9DA 2A36A 2KE9A 4ZNXA 2V1RA 2DX1A 4J9EA 2KT8A 5IHKA 1S1NA 1ZUKA 1X2QA 2F2WA 2V1QA 1SRLA 2EGCA 1ABOA 1UG1A 1OV3A 1UJYA 1WA7A 1YP5A 2O9SA 1T0JA 2KRSA 1JXMA 2W0ZA 4RTYA 3KFVA 2VVKA 1X69A 3R6NA 2OI3A 1GCQA 2PZ1A 1SRMA 2KNBB 2P4RA 2RMOA 2D1XA 2FRWA 1WXTA 4OMPA 4RTTA 1U5SA 1KIKA 4X1VA 1QKWA 1K9AA 2YUPA 1RLPC 4QT7A 2FEIA 2EGAA 5GJVB 2HSPA 3VS6A 2ECZA 1PKTA 1OOTA 1M27C 1M3AA 3I5RA 4FSSA 1MV0B 3ULRB 4WCIA 2J6KA 2DL8A 2QDLA 2AZSA 1EFNA 2J7IA 2EVRA 1OEBA 1BB9A 3EG3A 2FRYA 2M51A 1H92A 3M0SA 2DILA 2J6FA 2JTEA 1E6HA 2KXCA 1U06A 2ENMA 4RTVA 2KYMA 2FG0A 1JQQA 2A28A 1SPKA 1ZLMA 4JJBA 2ROTA 1AWWA 1CSKA 1JU5C 2C0OA 1WI7A 2CH4A 3H0HA 4A63B 2RQUA 4HVUA 5FWCA 1X6BA 2PTKA 3VS0A 1UHFA 3VS5A 2L3SA 2LX7A 1QWFA 2GQIA 4J9GA 2O2OA 4GBQA 2O31A 2L3QA 1WX6A 1WYXA 1UECA 4J9FA 4E6RA 1BK2A 1G2BA 1UHCA 1T3LA 2D0NA 2DL3A 2OAWA 4IIOA 1JO8A 2YUNA 2LJ3A 1SSHA 2LQWA 3UATA 3VRZA 2KEAA 1RI9A 2O88A 3QWXX 4OMNA 3VS3A 2CT4A 2L0AA 1ARKA 2EYZA 1FMKA 1AVZC 1E6GA 3H41A 4RTZA 3VS4A 2C0TA 2AKLA 3M0PA 5GJWB 3M0RA 1GRIA 5I11A 2DF6A 2F2XA 2KROA 1T3SA 5FWBA 4JPBW 3RNJA 5EC7A 2K7AA 3GBQA 1YWOA 4OMOA 2CT3A 4JZ3A 1V1CA 2ESWA 1TUDA 1K0SA 4Z89A 2CSIA 1UE9A 2KXDA 1VA7A 4AFZC 1AZEA 1RUWA 1NM7A 1ZSGA 1A0NB 4F17A 1PNJA 2KBTA 1AWXA 2O9VA 4KRTA 1CKBA 3NPFA 1X2KA 1VYUA 4CC3A 2LMJA 5IHIA 1QWEA 1NEGA 2RQWA 2A08A 2SEMA 2W10A 2MCNA 3REAB 1H8KA 1K0XA 1NLPC 2BZ8A 3A98A 2X3WD 4F16A 1I1JA 1M8MA 2IIMA 5FW9A 1K76A 1HD3A 1PRLC 1NYFA 4Z88A 1J3TA 2JS2A 1M3BA 2KT1A 4GLMA 4CC7A 2MIOA 4J9HA 2DJQA 1B3QA 2CUBA 2YDLA 1W1FA 2FPEA 2LQNA 4EIKA 4M4ZA 1LCKA 2E5KA 1NG2A 2NUZA 3I9QA 5IH2A 3FJ5A 1HJDA 4HVVA 2HDAA 2RNAA 4HVWA 2OJ2A 1I0CA 4AFQC 2X3XD 2B86A 2DE0X 5IHNA 1CKAA 1TUCA 2BZXA 1X27A 2BZYA 1OPLA 4D8DA 2XMFA 1N5ZA 2JMCA 3H0FA 3EGUA 3UF4A 1PRMC 1GCQC 2LNHB 1ZX6A 1TG0A 1MUZA 1Z9ZA 2AK5A 2EYXA 2YUQA 1OPKA 3NHNA 1NYGA 5ECAA 1KJWA 3EHRA 4J9CA 2EQIA 4HCKA 1AWOA 1WDXA 2KRMA 2DA9A 2DVJA 1GBRA 2GTJA 4DEXA 2JW4A 4DEYA 4OMQA 2L2PA 3TSZA 3EHQA 2LP5A 3TSWA 4JJDA 4CC4B 2RQTA 3PVQA 4RTWA 2M0YA 2YT6A 3UA6A 1AD5A 1YN8A 1M3CA 1NLOC 1IO6A 1GFCA 1NEBA 1UTIA 2K6DA 1AEYA 1JXOA 4LE9A 4F14A 1X6GA 2J06A 2L3PA 4ORZA 2EKHA 2RN8A 1AWJA 2J05A 3U23A
chains in the Genus database with same CATH superfamily
5IXBA 1GXIE 3V7RA 3OYGA 4M75D 1Q7YU 4JS4A 4E7IA 5DLQE 2F5TX 2M02A 1WLPB 4X9DA 1QLYA 2HD0A 1GFDA 3M4YA 3JCMe 1WJQA 4OB3B 2QGGA 4J5YA 2JTMA 3C95A 2CP2A 1BYMA 2K79A 2X4XA 4ELYC 1U3OA 2OTLT 2ED1A 2PUKB 5GAN2 2HCKA 5CVIA 4RTXA 1VQMT 1P92A 4N0AA 1QVPA 4D6WA 2LQ8A 3M57A 4C0ZA 4J83A 2XHCA 2KDSA 3RBBB 2EPDA 1YITQ 3CCVT 5D6XA 1KSWA 2BTTA 1TH7A 4E7JA 2V8IA 3JB9J 2GFAA 3JV3A 2VKNA 5LJ5h 5LJ3e 2ABLA 1SEMA 8AT1B 4C92G 2SRCA 2PQWA 4OP0A 1IXDA 4C92E 3JB9D 1NPRA 3CPWA 1VQLT 1MMDA 3DKMA 2EQMA 2DRKA 2L5QA 2Y4YA 1R8OB 1ZBXA 2WSCE 3L2QA 2DO3A 3EAEA 1TS9A 3GLXA 1PD1A 1M9SA 4OMMA 1UGVA 3H9NA 2ED0A 4MZTA 1KFZA 1WXUA 2KSSA 2DJZA 2E64A 5GAN6 3L2WA 3CBMA 1YNZA 2YRCA 1UGQB 1YWPA 4QVZA 1RAGB 2VWFA 3PE0A 2VYTA 3HTRA 1C0MA 1Q82U 3QZ9B 4HCBA 3M59A 1U1SA 3HPWA 4DOVA 4KGVB 1QCNA 1QVGS 1VOMA 1B34B 1Z9QA 1JJ2A 4M7DE 3FLGA 4C8QA 3MO8A 4LD9K 2I0NA 4AMCA 1KG1A 2QA4A 3THKA 2RPNA 4IURA 2LJ0A 3WXMB 1X43A 4PFOA 5KYNA 2RF0A 3PGGA 1W70A 1FXXA 2GGRA 4A4GA 2M9UA 3M58A 2CUDA 4RKUE 2MOXA 3H0IA 3EGDA 1VQLA 3CEYA 2XDPA 4MZMA 3CCRT 5LL6S 4X9CA 2E70A 3CPWP 5A0GA 3JCMb 2CP7A 1SHFA 1Y71A 1M30A 1YJ9Q 2WACA 2DX1A 4J9EA 2KT8A 4M75F 3SWNA 4PJOE 2EGCA 4C92B 1VQNQ 3G71Q 2XDDA 1UJYA 1YP5A 2O9SA 1T0JA 1Y96A 4F04B 4RTYA 3R6NA 1GCQA 2D9TA 1K73C 3V8JA 2BE9B 4C5IA 1D1CA 2P4RA 2YLCA 3RDVA 3VV0A 1SKUB 2OTLA 4M7AG 4LDUA 2RMOA 1C6VX 4KUIA 1RAEB 1MNEA 2HL3A 4C8QD 2RJDA 1QKWA 2MMPA 2JZ2A 2FEIA 1TXQA 2EGAA 2ZCFB 1VQ4T 2OTJT 3MEWA 4C92A 1YJWA 2ECZA 5GAN7 1PKTA 1M3AA 1IHVA 3I5RA 1M90R 2DL8A 5IN1A 2JOYA 1EFNA 1BB9A 3PNWC 1RACB 3SDZA 4WF2A 2QTVA 2R5AA 2J6FA 4BACA 5GMKh 3GP8A 5KE3A 3OYJA 3MEVA 3JRZA 3CCST 2KK4A 5GMKi 4TVRA 1VQNT 3CC2Q 3DLMA 2MYSA 5I21A 3J80E 2XK0A 5DY9A 5FRMA 5CKEA 3I56A 4FCYA 2RK1A 2O2OA 3EFRA 2O31A 3JCMQ 1EX4A 1LJOA 5D7UA 2K4YA 3I55T 1G2BA 1MNDA 3OYIA 4DBHA 2D0NA 1QP2A 5GAOn 1JO8A 4OF1A 2GCXA 2QG9B 1XTDA 2LJ3A 1G3TA 3UATA 4M78B 2LT1A 2CT4A 2L0AA 1BCMA 3EGXB 4KGZB 2EYZA 4BB7A 2IG0A 1WQWA 2C0TA 4J6YA 1GRIA 3G4ST 2HKNA 2C06A 2KROA 4JPBW 4PJOC 2K7AA 2F1LA 3GBQA 1IZ6A 2CT3A 4E7LA 3L1AA 3CCVA 3QSUA 4XU3A 3CCMA 4DBQA 1VA7A 3RIRA 5KYUB 3N5BB 1ZSGA 1A0NB 4O6JA 2PVDB 1PNJA 2RI5A 2WSEE 2O9VA 3LGFA 1CKBA 3NPFA 1VYUA 2LMJA 5IHIA 3OYFA 1OZ3A 3HRSA 1VQKQ 5D6YA 1NEGA 2A08A 4BY6B 4M7DG 2W10A 5LJ5d 1H8KA 1K0XA 1NLPC 4L6V5 4JRPA 2QQRA 4BY6C 2IIMA 3OYLA 1K76A 1HD3A 1NYFA 1HYOA 1M1KR 3HRTA 4JRQA 4L59A 3G6ET 3H6ZA 4GLMA 4M75A 3RKXA 3NTIA 1VUBA 2YDLA 2GQVA 1W1FA 3QUIA 4A4FA 3OYAA 4ZN3A 1RAIB 5CR2A 1VQKA 3CCET 2E5KA 1NG2A 2PVOB 5GAMe 2ZPEB 2FHDA 1TWBA 4HVVA 2QQAA 4HVWA 4AFQC 5IHNA 2DAQA 1NJIC 3GF5A 3LGLA 2YRDA 2V8KA 2P84A 2DK3A 5LJ3j 1IRXA 4D8DA 1N5ZA 2JMCA 1KQSA 1PRMC 4YTLA 2AK5A 2YUQA 3ZFJA 2V8JA 1KJWA 1N8RR 1M1KC 1IGQA 2P4TA 1D3BA 1AWOA 4IUPA 1YI2T 4MZPA 4J6WA 1HK9A 2CZ6B 1OX8A 2QEXQ 5LJ5f 2NUTA 4CC4B 3PVQA 3LX7A 3G71T 2M0YA 2CS7A 1KQ2A 1D09B 1H3ZA 3QDFA 3AHUA 2XIDA 1UTIA 3CCSQ 2CKKA 3JCMX 1F1BB 1X6GA 2RHYA 5GAMg 2DD5A 1QVFA 4ORZA 4M7DD 2X4WA 3A8OB 1VQOA 1MMAA 2RN8A 1VIEA 4MDWA 3U23A 1BI0A 2VASA 4UC4A 1VQ9A 5GANh 2OTJQ 2EQJA 1YCSB 3OYKA 2V26A 2VV5A 2ZZDA 1QCOA 5I2SA 1UUEA 1YITT 2YHTA 2FB7A 4VUBA 5AT1B 1E7OA 3EG0A 3FIFA 4GY5A 2LDMA 3MP8A 1O9SA 4OMLA 2F2VA 3VS7A 3IQLA 5CCAA 3SWNC 2D8HA 3REBB 1VQOQ 2EBPA 3M0QA 5I22A 1UJ0A 2H8HA 1EZZB 1OU9A 3SEMA 4J9IA 2O4XA 3P8DA 1OU8A 4DA4A 1Q81R 3NMZC 1G3SA 2VB6A 1WFWA 1S72T 1UDLA 2DYBA 2QQBA 1H3HA 1VQ5T 1VQ8T 1FYNA 3PVLA 3DB3A 3MP1A 5GANe 2DPPB 3JB9H 3I5SA 5KYWB 3S3OA 2HBPA 2ROLA 3CXCS 1QCFA 3VU3C 4M7AC 3FC3A 1LNXA 4RCCA 4Y92A 4XAXB 1N6AA 4F7UB 3OYYA 2DEQA 2WSFE 1PKSA 3M0TA 4Z8AA 2JM8A 5A0DA 5KYYA 2AKKA 2P0PA 1MGQA 4LDYA 1M2OA 2CZ1B 2FO0A 4AG2C 2JM9A 4AFSC 2EW3A 2CDTA 4LN2A 1IGUA 2BKDN 3GNGA 3MHXA 2DRMA 5GANf 2JT4A 3RUXA 5KCOA 1SHGA 1YIJA 4PJOF 4II1A 4B6MA 2JJ9A 2DL4A 2EAYA 2DTOA 3X24B 3X20B 5GAOr 1JEGA 2DBMA 4J6XA 2DM1A 5EG2A 2LZ6B 3NTHA 3ER0A 3SD4A 4D8KA 3CC2T 2KRNA 4Y91A 4C5EA 4E7ZA 5FU6C 3TU4K 3VKIA 5DM7R 4HA8A 3CC2A 3SWNB 3RKWA 2KVQG 4BD3A 4HXJA 3I56Q 3PMIA 1TOVA 4M7DC 5DLOA 4RMOA 4EPCA 3V7CA 5HCKA 3UDCA 2DL7A 2GTOA 1NBEB 2K3BA 1WXBA 3S6WA 4RTUA 1YJNT 3QZ5B 3QWYA 2O4XB 2CREA 3LH0A 3X25B 1Y57A 3JCMg 2R5MA 5CKHA 2A37A 5IXFA 1BIAA 4Z02A 3QPHA 3E9FA 2KGTA 2RHXA 3OYNA 1D0ZA 2EYYA 2YSQA 3MP6A 4PJOG 1BBZA 3Q1JA 5CAIA 2OX7A 4M78E 2A36A 2KE9A 4ZNXA 1YJNQ 1FMVA 1Y07A 1VQ5A 2EKOA 4KGXB 2F5KA 3VYGA 2RHZA 3QO3A 1WA7A 1V76A 3J7AF 2W0ZA 2ZGWA 4RG8A 3JSCA 2PZ1A 1M90U 3WVDB 1M1GA 4OB1B 3QBYA 1B7TA 1MMGA 2P0QA 5FRNA 4C5GA 1W2BA 4B9WA 1SG5A 4X1VA 3KBGA 1K9AA 2PUOB 2YUPA 4QT7A 5FROA 3MKDA 1KD1U 3FDRA 2L3RA 1YITA 5IT9E 4PJNA 4M75B 2NUPB 1OOTA 1YJNA 4FSSA 2YXYA 5CKDA 3OS2A 1PCXA 1VQ9T 1XJWB 2LVMA 2QASA 4M75C 1ZA2B 4C0DC 2AZSA 1R0CB 1N8RU 2J7IA 2MPXC 2EVRA 3OW2P 4HCZA 2ZPHB 3VUBA 7AT1B 3M0SA 2RM4A 4F7UA 2DILA 5CIUA 4PJJA 2KYMA 1WZOA 2XI9A 1KD1R 2L8DA 2FG0A 2MAMA 1RAAB 5KCHA 4JJBA 3LWHA 1WI7A 1KC8C 2EQKA 4J7FA 1YI2A 1KHCA 2LQKA 1UHFA 3VS5A 3CC7Q 4M78G 5GANd 2DFUA 3P8BB 2GQIA 4V2SA 4GBQA 1TSFA 4FW2A 5D6WA 1Q81C 4E6RA 1T3LA 4M77A 4BI8B 3M56A 1SSHA 1ZHIA 4PJOD 5GAN4 2KEAA 2O88A 4OMNA 3VS3A 2P0KA 1FMKA 1AVZC 3EGDB 4KH0B 4RTZA 1VQ7A 3CCEA 1TUGB 1VQLQ 2K3XA 1G3WA 3CCUQ 2DF6A 3QIIA 2F2XA 5FWBA 1T3SA 3RNJA 3SB2A 2HAXA 4B9XA 1I4K1 4LDVA 2EFIA 1QQJA 2ESWA 2CSIA 1WNLA 2HZYA 4FW1A 4PJMA 4BE0A 1MHNA 1Y96B 2KQWA 1OZ2A 1AZEA 3OW2A 2IPOB 2CGHA 1NM7A 2K5LA 2DEUA 4Y28E 4F17A 4FYXB 2AHJB 4BDYA 1B34A 4M7AD 4JUVA 2RHUA 1X2KA 3OYCA 1U1TA 3UPUA 5CK9A 2MCNA 1M2VA 3BE3A 3REAB 3CCQT 2BZ8A 4F16A 5KYWA 2X3WD 1BI2A 2MF2A 3OMCA 4O5VA 3F70A 4EMGA 1VQPT 2M16A 4ZN1A 4JJNK 3QDRB 3MEAA 4CC7A 2MIOA 2VXEA 2DJQA 3CCQQ 2E41A 2NLUA 4PL6A 2FZGB 1FX7A 2LTOA 3T9NA 2HL5C 2DERA 2DD4A 2CZ7B 3OYDA 2OTLQ 3FJ5A 3G6EQ 1OX9A 2CZ0B 3CPFA 1HJDA 2RNAA 2QYZA 2X3XD 2B86A 2DE0X 3OYMA 2DXCA 4XTVA 2DZCA 2HQEA 3G71A 3TCJA 2L89A 1YFNA 3FEOA 4F7UE 4KT0E 2H3JA 5GAN3 3H0FA 4CRIA 3CC7T 3UF4A 4JLGA 1I81A 3PIPA 1ZX6A 1TG0A 1D3BB 2EYXA 1OPKA 3OS5A 4C92D 3CD6Q 3CCRQ 1VQ7Q 1NJIU 2EQIA 2DA9A 2GTJA 4DEXA 4DEYA 1RL2A 2DXTA 2LRQA 3EHQA 2QK0A 4JJDA 1ZA1B 5GMKm 1VQ5Q 1YN8A 1JRIA 1NLOC 4A53A 3QJ6A 1IO6A 1GFCA 3SFMA 1NEBA 1WJSA 1BI3A 4FSXA 2KY9A 1H641 4XTYA 2J06A 3CMET 1RABB 5GAMh 4PJOB 2EYQA 1PSFA 3ZEHA 2HKQB 3VRYA 2GBQA 1ACMB 3M55A 5GANg 3G6EA 5GAOm 2LJ1A 3I55Q 3OB9A 1YJWT 2RJFA 1JJ2P 3L2RA 2VGNA 2OTJA 1VQ4A 4K11A 3A8GB 1W6XA 4J9BA 4ELZC 1EIFA 2Y90A 5GAN8 2EGEA 2X4YA 2QA4Q 3I35A 4QQGA 2DNUA 2FZCB 2JS0A 2DIQA 3S3MA 1MMNA 1D1AA 1JB0E 2RB6A 4R55A 2FPFA 3OA6A 2VXFA 1VQ9Q 4ZTJA 1ZUUA 4F7UG 2FZKB 2E4HA 3PMTA 3VJPA 2FL7A 1KK7A 1YHQT 1M1KU 2RI3A 1BU1A 4LXCA 4C0DB 1AZGB 4CC2A 1M90C 1N9SA 5L23A 4M7DF 3C94A 5HK0A 4JJCA 3G4SA 4EMKC 3HKSA 4OB2B 1OI1A 3QYGB 4M78D 3X26B 3C0CA 1I5LA 3TEEA 2KR3A 2D8JA 3M4GA 4ME7A 3CC4Q 3KXTA 1IHWA 5GAOq 4M78F 3VUZA 3HSBA 1QVGA 4AFUC 1D0XA 1BKBA 2BE7D 1WIEA 5GAMf 3CCMQ 3OS1A 3EG9A 4C8QG 1B07A 2QQSA 3MJXA 2DVEA 4KH1B 5HKCA 4P5NA 2EJGA 3I56T 3L2UA 2EIFA 2CH4W 2QA4T 1Y0MA 3HL8A 4X34A 2B8AA 4M77F 4R56A 3JB9I 1ZUYA 3JCMV 4OVAA 1Q86U 1I07A 2G6FX 1KQSS 4MDXA 4DBRA 5LJ5j 2HNIA 1O75A 2E65A 2K9GA 1KC8U 3EH2A 4R0KA 2XICA 1VQ4Q 4LUDA 1AOJA 1K73R 3CCSA 3CCUT 4XK8E 1WQ7A 2KYBA 1UFFA 1KC8R 2LT4A 2DETA 1BI1A 2NWMA 4FU6A 2X4JA 4M7AF 1T0HA 1K1ZA 1QKXA 4RG2A 2F69A 2DL5A 4LNPA 2E5QA 1XOVA 2K5IA 3CQTA 5FU7C 2K2MA 3VS1A 2DTHA 1MV3A 2QQ9A 1FMWA 2LCSA 1GL5A 4FT2A 4ZGDB 1QVFS 4HKEA 1N8RC 2IVWA 5AYFA 1G3YA 5GMKe 1WHKA 1PHTA 8ATCB 4FYVB 1G83A 2FPDA 1ZBJA 2RHIA 3JCMW 1D0YA 4M75E 3SHWA 1ZSZB 1VQ8Q 4GLKA 2C0IA 4KULA 1JJ2S 1K73U 4J9DA 4CI0C 2V1RA 4QVDA 5IHKA 3A8LB 3TREA 3JCMP 2F2WA 2HQXA 2JUFA 3AT1B 1ABOA 2QAZA 1KQSP 4M7AE 2DTIA 2KRSA 4QVCA 1JXMA 1ZSZA 2RD1A 3EFSA 3CCJQ 2KI7A 1VQMA 2VVKA 2OI3A 4C0FA 2R58A 2LX9A 4NL2A 1YI2Q 3OMGA 3CCRA 3RESA 2X51A 2LCCA 2FRWA 3A5ZB 3QHSA 3CBOA 4OMPA 3OYBA 4M7DB 3VYHB 4A4KA 2MWOA 5GJVB 1SF9A 3BDUA 2HSPA 1LOJA 1M27C 3LW5E 4XQ3A 5A2QE 1ZQ1A 4BUGA 4WCIA 4XU0A 4XU2A 1G5VA 1K9MR 1OEBA 3JB9G 1YBYA 3CMEA 2MWPA 9ATCB 3FB9A 3G7ZA 3CCJT 2BUDA 2A3LA 3BFMA 4WTOB 4C0GA 3CCUA 1U06A 2CP6A 1WJRA 4RTVA 4NL3A 1U8RA 1SPKA 1ZLMA 2HQHA 1UGSB 4Q5WA 4E7KA 2ROTA 1AWWA 1CSKA 2K3YA 1K9MC 4J8OA 2C0OA 1Q82C 3OBWA 2MI6A 2CH4A 2DZ9A 1NE8A 3H0HA 4A63B 2RQUA 2YWWA 5FWCA 1X6BA 2X35A 3VS0A 3CCEQ 1VQ6Q 3HFOA 2LX7A 4J9GA 2DXUA 3RR6A 2D6FA 2L3QA 1WX6A 1UEBA 1WYXA 1UECA 4BDZA 1BK2A 1TTHB 4OMFB 1UHCA 2FVUA 4J7IA 2HSEB 5C6SA 5KYYB 2DL3A 4IIOA 2NUPA 4JS5A 3VRZA 5GMKj 1QW1A 1RI9A 4FT4A 3QWXX 3JAME 1ARKA 4IUUA 1E6GA 4M77G 2CYZB 2KMTA 1KD1C 2EJ9A 5GJWB 3JB9F 3M0RA 3RMSA 4RCBA 4JRIA 2QGFB 1YCYA 3V8LA 5EC7A 1YWOA 4OMOA 1FWZA 1YHQA 4M7DA 1V1CA 3C4SA 1VQPA 1UE9A 3X28B 4LD6A 3QYHB 2KXDA 4XU1A 2M1HA 3PIOA 3EGXA 3META 3WVEB 3OSVA 1RUWA 2FYKA 3QKJA 1WHLA 2KBTA 3EFOA 3EG9B 2ZPFB 3URGA 1QWEA 2H3EB 2AIRB 1RAFB 2RQWA 1NJIR 3A1PA 2SEMA 4C92F 2G3RA 1K8AR 1I1JA 1RADB 5FW9A 1PRLC 2AT1B 4Z88A 1IREB 1N27A 3HRUA 5CQXA 1M4ZA 4J9HA 2YLBA 3NTKA 5J39A 2CUBA 1Q7YC 4LDWA 1Q95G 3CD6T 3INZA 2FPEA 2QDYB 4M4ZA 2R57A 3DB4A 1LCKA 4F7UF 1VQ7T 3I9QA 3G1JA 5IH2A 3MPUB 1YJ9A 3CCLT 3JCMc 1I0CA 1RI0A 3L2ZA 4AT1B 1CKAA 1TUCA 1X27A 2BZYA 4M78A 2D0QB 4XTZA 3OBYA 5FU7B 1DJ7B 2XMFA 3EGUA 5GANj 1GCQC 2LNHB 1Z9ZA 1MUZA 2CP3A 1Q7YR 3NHNA 4IKFA 3PTAA 2QEXT 3EHRA 2CP0A 4HCKA 1WDXA 2VC8A 2DVJA 5GAMd 1GBRA 2JW4A 2E10A 3LWIA 4OMQA 3TSZA 3CC7A 3CBPA 5LJ3f 1VIFA 3TSWA 5KYUA 3V8KA 2YT6A 3UA6A 2JTFA 3UT1A 1X75C 2RI2A 3ZBDA 4QQ6A 2K6DA 1AEYA 1JXOA 4XTXA 3R6OA 2L3PA 4A4HA 5LJ5e 4ANJA 4C8QB 1AWJA 3L2VA 4QQDA 2J05A 2X9HA 3ASKA 1LPLA 2GNCA 5M9OA 4EMHA 3EH1A 2DLPA 2AZVA 4RUGA 3M0UA 3QG1A 3HP9A 2QI2A 1M1FA 4ATOA 3JCMf 1NPPA 1G8XA 3GOXA 2RH2A 3A8HB 3OQ5A 3CCQA 2BIVA 2K5FA 3CMAA 4DOWA 1PD0A 1ABQA 1Q81U 1PWTA 2E1HA 3E2UA 3LH5A 2I2LA 5J3BA 4BI3A 1VYVA 1GCPA 3KUFA 3RKYA 1X6OA 2VUBA 5HK3A 3VS2A 3PT9A 1X01A 5KYXB 3UA7A 1OULA 4IUQA 4BI4A 5A0LA 5LJ5g 3GIBA 2DBKA 6AT1B 4PKCC 2ZPIB 1Q82R 4EMKA 4C92C 3CC4A 4ZGJB 2YUOA 4N4GA 3L42A 3OS0A 4BE2A 2CSQA 3QJYA 5L8RE 1V29B 1HXDA 4QW2A 4PJOA 3CPWS 4M77E 1Q86R 1C1AA 1Y7XA 2RQRA 1PG5B 2CP5A 2DKGA 4PK4A 1RAHB 3ZL7C 3CMAQ 2EWNA 1IB8A 1W2BS 2GF7A 4XTWA 3TQ7P 1VYTA 4FIBA 1XQHA 4C5HA 2ATCB 3TVTA 5GMKl 4E7SA 3OY9A 2COZA 3EG2A 4M7AB 4HCCA 4E47A 4ZGEB 5LJ3g 5CKBA 2M0OA 4AG1C 1VQ6A 1M2VB 4PNOA 4OGEA 3CCVQ 3EG1A 4XTUA 3V7SA 1VQ6T 2LNVA 4PFZA 3DLLA 4JRKA 2E6ZA 1ZSZC 2A7YA 1HSQA 2DMOA 5CO7A 4M77B 2JVVA 2J6OA 2PNIA 1I8FA 1AHJB 3HHTB 4DQ2A 3HFNA 5J26A 2JMAA 1GBQA 2HBWA 4LUEA 2RQVA 1TU0B 2HEQA 3O5ZA 1RLQC 3QXEB 4LDXA 1W2BP 2RJEA 4IIMA 4DBFA 1D1BA 2RA2A 3OYEA 3H8ZA 1VQMQ 2EYWA 2XG8D 2NYSA 2VGMA 1OQKA 2JXBA 4ESRA 4QKUA 2QXFA 3NGPA 2RJCA 5KH6A 4N0AC 1PSEA 1YIJQ 5C0MA 2DXBA 1K4US 4JZ4A 1WHHA 4FYYB 1S1NA 1ZUKA 1X2QA 2V1QA 1SRLA 2LCLA 3E1SA 1QP3A 3J81E 1S72A 1UG1A 1OV3A 3RERA 2EJFA 1XNIA 1BCOA 3A8MB 3KFVA 1X69A 2E3HA 3EFOB 2XDBA 2KAFA 1YJWQ 1SRMA 2YRVA 4A4EA 2KNBB 5HY6A 2ZAEA 1PC0A 4KBMB 2D1XA 1K8AC 3FJPA 4ZTFA 1WXTA 3OW2S 3ME9A 4RTTA 1U5SA 2E3IA 1KIKA 1PM3A 1RLPC 2XKOC 3E19A 5GAOp 1S72Q 3GNFB 5GAMj 3CXCP 1R0BG 2NUTB 4JLIA 3VS6A 1K9MU 5I2MA 1MV0B 3ULRB 3CMEQ 2J6KA 2QDLA 1KQ1A 3EG3A 2FRYA 3P8HA 1VQOT 1KHIA 2M51A 1H92A 2HMAA 3RMQA 2JTEA 2QTXA 1Q86C 1E6HA 5KE2A 1AT1B 2KXCA 2LC4A 2ENMA 1QVFP 4JDSA 5IAYA 1JQQA 3MCAB 2A28A 2K57A 1W4SA 1VQPQ 1JU5C 2COWA 4OGCA 1UGRB 4C8QC 1OYXA 5GAN5 3C12A 5FLXE 3O8VA 4HVUA 2EQUA 3OSSC 2PTKA 2XU8A 2QEXA 3BY7A 1YIJT 4N4HA 4BE1A 2L3SA 2ZPBB 1QWFA 4M77D 2XD0A 1WPYA 4J9FA 3JCMJ 3M9QA 3LYIA 4MMKA 2E6NA 2OAWA 2YUNA 1JBMA 2LQWA 1BIBA 2COYA 4M75G 4IUTA 3CCLA 1WHGA 4EMKB 2RK2A 3H41A 3VS4A 4E7HA 4M77C 2AKLA 3M0PA 3CC4T 4EDUA 5FU6B 3CD6A 5I11A 2ZPGB 3M5AA 3NFCA 1VQ8A 2PU9B 1QMCA 4HT8A 4JZ3A 4E2FB 3BW1A 1TUDA 1K0SA 4Z89A 4C8QE 2JN0A 4AFZC 3E9GA 4NOYA 1M5Q1 5LJ3d 5LJ3h 3LLRA 4PLIA 4KRTA 1AWXA 3D7SB 4CC3A 4M78C 2PVGB 4IUVA 1YHQQ 3CCLQ 3CXCA 3UWNA 3CMAT 2GFUA 1WHJA 1UGPB 3A98A 3PFSA 2JNGA 3CCMT 1M8MA 2OAUA 1J3TA 1M8VA 2JS2A 1M3BA 2O01E 2KT1A 4A54A 2E12A 3BDLA 1B3QA 4N4IA 5KYXA 2LQNA 1SSFA 4EIKA 2MK5A 4C8QF 2NUZA 1WGSA 3JCMd 3JCMh 3S3NA 5CQYA 1UB4A 2HDAA 2OJ2A 4L5GA 2DIGA 2BZXA 3GPLA 3M54A 1OPLA 1N9RA 2Z0WA 2K2VA 3I55A 4NS5A 1R77A 4FL6A 1NYGA 2Y4XA 5ECAA 4MMLA 5CKFA 4PJLA 4J9CA 1K8AU 1QVGP 4OB0B 2KRMA 3OYHA 3FRNA 3G4SQ 1I5OB 4PLLA 2L2PA 2RO0A 2LP5A 1VQNA 2RQTA 4RTWA 4M7AA 3MEUA 1AD5A 4KUDK 1NZ9A 3M53A 1M3CA 4PFPA 5GAOl 2DYIA 1YJ9T 4LE9A 3CCJA 4F14A 2A0FB 1WHMA 2EKHA 4FYWB 1VQKT 4FM4B 1LVKA 4HT9A
chains in the Genus database with same CATH topology
2GNCA 3VRYA 2GBQA 5IXBA 2DLPA 2AZVA 4RUGA 3M0UA 1YCSB 2LJ1A 1UUEA 1WLPB 1E7OA 3EG0A 1QLYA 1GFDA 4OMLA 2F2VA 4K11A 3VS7A 3IQLA 1W6XA 4J9BA 1ABQA 2EGEA 2D8HA 2K79A 1PWTA 3REBB 3I35A 1U3OA 2EBPA 3M0QA 2ED1A 2DNUA 5I22A 3LH5A 1UJ0A 2JS0A 2H8HA 1VYVA 2HCKA 3SEMA 4J9IA 4RTXA 1GCPA 2FPFA 3NMZC 1ZUUA 3VS2A 1WFWA 3RBBB 2EPDA 1UDLA 2DYBA 1KSWA 1H3HA 2BTTA 1BU1A 1AZGB 3UA7A 1FYNA 3PVLA 4CC2A 5L23A 3I5SA 2ROLA 3JV3A 4JJCA 1QCFA 2DBKA 2VKNA 2ABLA 1SEMA 2YUOA 4Y92A 2SRCA 3C0CA 2CSQA 2KR3A 2D8JA 1PKSA 3M0TA 4Z8AA 2JM8A 2DRKA 4AFUC 2AKKA 1WIEA 2RQRA 2FO0A 4AG2C 2JM9A 4AFSC 2EW3A 2CDTA 4LN2A 1B07A 3ZL7C 2DRMA 2JT4A 1VYTA 4OMMA 1SHGA 1UGVA 2CH4W 2ED0A 1KFZA 1Y0MA 1WXUA 3TVTA 2DL4A 3EG2A 1ZUYA 1JEGA 1YNZA 2DBMA 1YWPA 2DM1A 1I07A 2G6FX 2VWFA 3PE0A 2LZ6B 4D8KA 4AG1C 2KRNA 2K9GA 4R0KA 3EG1A 4LUDA 1AOJA 1Z9QA 2KYBA 1UFFA 4HXJA 2NWMA 1HSQA 2DMOA 2J6OA 1T0HA 2I0NA 2PNIA 1K1ZA 1QKXA 3THKA 5HCKA 2RPNA 2LJ0A 2DL7A 2DL5A 4LNPA 2GTOA 1X43A 2JMAA 1GBQA 1WXBA 1XOVA 2K3BA 4RTUA 3CQTA 2HBWA 2RF0A 2K2MA 4LUEA 2RQVA 3QWYA 3VS1A 2HEQA 1MV3A 1RLQC 1W70A 2CREA 3O5ZA 2LCSA 1GL5A 2GGRA 1Y57A 2CUDA 4IIMA 2MOXA 3H0IA 1PHTA 2A37A 5IXFA 2EYWA 1G83A 2KGTA 2JXBA 4ESRA 2FPDA 1ZBJA 2EYYA 2YSQA 3NGPA 1BBZA 3SHWA 1SHFA 1K4US 4JZ4A 2C0IA 1M30A 4J9DA 2A36A 2KE9A 4ZNXA 2V1RA 2DX1A 4J9EA 2KT8A 5IHKA 1S1NA 1ZUKA 1X2QA 2F2WA 2V1QA 1SRLA 2EGCA 1ABOA 1UG1A 1OV3A 1UJYA 1WA7A 1YP5A 2O9SA 1T0JA 2KRSA 1JXMA 2W0ZA 4RTYA 3KFVA 2VVKA 1X69A 3R6NA 2OI3A 1GCQA 2PZ1A 1SRMA 2KNBB 2P4RA 2RMOA 2D1XA 2FRWA 1WXTA 4OMPA 4RTTA 1U5SA 1KIKA 4X1VA 1QKWA 1K9AA 2YUPA 1RLPC 4QT7A 2FEIA 2EGAA 5GJVB 2HSPA 3VS6A 2ECZA 1PKTA 1OOTA 1M27C 1M3AA 3I5RA 4FSSA 1MV0B 3ULRB 4WCIA 2J6KA 2DL8A 2QDLA 2AZSA 1EFNA 2J7IA 2EVRA 1OEBA 1BB9A 3EG3A 2FRYA 2M51A 1H92A 3M0SA 2DILA 2J6FA 2JTEA 1E6HA 2KXCA 1U06A 2ENMA 4RTVA 2KYMA 2FG0A 1JQQA 2A28A 1SPKA 1ZLMA 4JJBA 2ROTA 1AWWA 1CSKA 1JU5C 2C0OA 1WI7A 2CH4A 3H0HA 4A63B 2RQUA 4HVUA 5FWCA 1X6BA 2PTKA 3VS0A 1UHFA 3VS5A 2L3SA 2LX7A 1QWFA 2GQIA 4J9GA 2O2OA 4GBQA 2O31A 2L3QA 1WX6A 1WYXA 1UECA 4J9FA 4E6RA 1BK2A 1G2BA 1UHCA 1T3LA 2D0NA 2DL3A 2OAWA 4IIOA 1JO8A 2YUNA 2LJ3A 1SSHA 2LQWA 3UATA 3VRZA 2KEAA 1RI9A 2O88A 3QWXX 4OMNA 3VS3A 2CT4A 2L0AA 1ARKA 2EYZA 1FMKA 1AVZC 1E6GA 3H41A 4RTZA 3VS4A 2C0TA 2AKLA 3M0PA 5GJWB 3M0RA 1GRIA 5I11A 2DF6A 2F2XA 2KROA 1T3SA 5FWBA 4JPBW 3RNJA 5EC7A 2K7AA 3GBQA 1YWOA 4OMOA 2CT3A 4JZ3A 1V1CA 2ESWA 1TUDA 1K0SA 4Z89A 2CSIA 1UE9A 2KXDA 1VA7A 4AFZC 1AZEA 1RUWA 1NM7A 1ZSGA 1A0NB 4F17A 1PNJA 2KBTA 1AWXA 2O9VA 4KRTA 1CKBA 3NPFA 1X2KA 1VYUA 4CC3A 2LMJA 5IHIA 1QWEA 1NEGA 2RQWA 2A08A 2SEMA 2W10A 2MCNA 3REAB 1H8KA 1K0XA 1NLPC 2BZ8A 3A98A 2X3WD 4F16A 1I1JA 1M8MA 2IIMA 5FW9A 1K76A 1HD3A 1PRLC 1NYFA 4Z88A 1J3TA 2JS2A 1M3BA 2KT1A 4GLMA 4CC7A 2MIOA 4J9HA 2DJQA 1B3QA 2CUBA 2YDLA 1W1FA 2FPEA 2LQNA 4EIKA 4M4ZA 1LCKA 2E5KA 1NG2A 2NUZA 3I9QA 5IH2A 3FJ5A 1HJDA 4HVVA 2HDAA 2RNAA 4HVWA 2OJ2A 1I0CA 4AFQC 2X3XD 2B86A 2DE0X 5IHNA 1CKAA 1TUCA 2BZXA 1X27A 2BZYA 1OPLA 4D8DA 2XMFA 1N5ZA 2JMCA 3H0FA 3EGUA 3UF4A 1PRMC 1GCQC 2LNHB 1ZX6A 1TG0A 1MUZA 1Z9ZA 2AK5A 2EYXA 2YUQA 1OPKA 3NHNA 1NYGA 5ECAA 1KJWA 3EHRA 4J9CA 2EQIA 4HCKA 1AWOA 1WDXA 2KRMA 2DA9A 2DVJA 1GBRA 2GTJA 4DEXA 2JW4A 4DEYA 4OMQA 2L2PA 3TSZA 3EHQA 2LP5A 3TSWA 4JJDA 4CC4B 2RQTA 3PVQA 4RTWA 2M0YA 2YT6A 3UA6A 1AD5A 1YN8A 1M3CA 1NLOC 1IO6A 1GFCA 1NEBA 1UTIA 2K6DA 1AEYA 1JXOA 4LE9A 4F14A 1X6GA 2J06A 2L3PA 4ORZA 2EKHA 2RN8A 1AWJA 2J05A 3U23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GNC A;  3VRY A;  2GBQ A;  5IXB A;  2DLP A;  2AZV A;  4RUG A;  3M0U A;  1YCS B;  2LJ1 A;  1UUE A;  1WLP B;  1E7O A;  3EG0 A;  1QLY A;  1GFD A;  4OML A;  2F2V A;  4K11 A;  3VS7 A;  3IQL A;  1W6X A;  4J9B A;  1ABQ A;  2EGE A;  2D8H A;  2K79 A;  1PWT A;  3REB B;  3I35 A;  1U3O A;  2EBP A;  3M0Q A;  2ED1 A;  2DNU A;  5I22 A;  3LH5 A;  1UJ0 A;  2JS0 A;  2H8H A;  1VYV A;  2HCK A;  3SEM A;  4J9I A;  4RTX A;  1GCP A;  2FPF A;  3NMZ C;  1ZUU A;  3VS2 A;  1WFW A;  3RBB B;  2EPD A;  1UDL A;  2DYB A;  1KSW A;  1H3H A;  2BTT A;  1BU1 A;  1AZG B;  3UA7 A;  1FYN A;  3PVL A;  4CC2 A;  5L23 A;  3I5S A;  2ROL A;  3JV3 A;  4JJC A;  1QCF A;  2DBK A;  2VKN A;  2ABL A;  1SEM A;  2YUO A;  4Y92 A;  2SRC A;  3C0C A;  2CSQ A;  2KR3 A;  2D8J A;  1PKS A;  3M0T A;  4Z8A A;  2JM8 A;  2DRK A;  4AFU C;  2AKK A;  1WIE A;  2RQR A;  2FO0 A;  4AG2 C;  2JM9 A;  4AFS C;  2EW3 A;  2CDT A;  4LN2 A;  1B07 A;  3ZL7 C;  2DRM A;  2JT4 A;  1VYT A;  4OMM A;  1SHG A;  1UGV A;  2CH4 W;  2ED0 A;  1KFZ A;  1Y0M A;  1WXU A;  3TVT A;  2DL4 A;  3EG2 A;  1ZUY A;  1JEG A;  1YNZ A;  2DBM A;  1YWP A;  2DM1 A;  1I07 A;  2G6F X;  2VWF A;  3PE0 A;  2LZ6 B;  4D8K A;  4AG1 C;  2KRN A;  2K9G A;  4R0K A;  3EG1 A;  4LUD A;  1AOJ A;  1Z9Q A;  2KYB A;  1UFF A;  4HXJ A;  2NWM A;  1HSQ A;  2DMO A;  2J6O A;  1T0H A;  2I0N A;  2PNI A;  1K1Z A;  1QKX A;  3THK A;  5HCK A;  2RPN A;  2LJ0 A;  2DL7 A;  2DL5 A;  4LNP A;  2GTO A;  1X43 A;  2JMA A;  1GBQ A;  1WXB A;  1XOV A;  2K3B A;  4RTU A;  3CQT A;  2HBW A;  2RF0 A;  2K2M A;  4LUE A;  2RQV A;  3QWY A;  3VS1 A;  2HEQ A;  1MV3 A;  1RLQ C;  1W70 A;  2CRE A;  3O5Z A;  2LCS A;  1GL5 A;  2GGR A;  1Y57 A;  2CUD A;  4IIM A;  2MOX A;  3H0I A;  1PHT A;  2A37 A;  5IXF A;  2EYW A;  1G83 A;  2KGT A;  2JXB A;  4ESR A;  2FPD A;  1ZBJ A;  2EYY A;  2YSQ A;  3NGP A;  1BBZ A;  3SHW A;  1SHF A;  1K4U S;  4JZ4 A;  2C0I A;  1M30 A;  4J9D A;  2A36 A;  2KE9 A;  4ZNX A;  2V1R A;  2DX1 A;  4J9E A;  2KT8 A;  5IHK A;  1S1N A;  1ZUK A;  1X2Q A;  2F2W A;  2V1Q A;  1SRL A;  2EGC A;  1ABO A;  1UG1 A;  1OV3 A;  1UJY A;  1WA7 A;  1YP5 A;  2O9S A;  1T0J A;  2KRS A;  1JXM A;  2W0Z A;  4RTY A;  3KFV A;  2VVK A;  1X69 A;  3R6N A;  2OI3 A;  1GCQ A;  2PZ1 A;  1SRM A;  2KNB B;  2P4R A;  2RMO A;  2D1X A;  2FRW A;  1WXT A;  4OMP A;  4RTT A;  1U5S A;  1KIK A;  4X1V A;  1QKW A;  1K9A A;  2YUP A;  1RLP C;  4QT7 A;  2FEI A;  2EGA A;  5GJV B;  2HSP A;  3VS6 A;  2ECZ A;  1PKT A;  1OOT A;  1M27 C;  1M3A A;  3I5R A;  4FSS A;  1MV0 B;  3ULR B;  4WCI A;  2J6K A;  2DL8 A;  2QDL A;  2AZS A;  1EFN A;  2J7I A;  2EVR A;  1OEB A;  1BB9 A;  3EG3 A;  2FRY A;  2M51 A;  1H92 A;  3M0S A;  2DIL A;  2J6F A;  2JTE A;  1E6H A;  2KXC A;  1U06 A;  2ENM A;  4RTV A;  2KYM A;  2FG0 A;  1JQQ A;  2A28 A;  1SPK A;  1ZLM A;  4JJB A;  2ROT A;  1AWW A;  1CSK A;  1JU5 C;  2C0O A;  1WI7 A;  2CH4 A;  3H0H A;  4A63 B;  2RQU A;  4HVU A;  5FWC A;  1X6B A;  2PTK A;  3VS0 A;  1UHF A;  3VS5 A;  2L3S A;  2LX7 A;  1QWF A;  2GQI A;  4J9G A;  2O2O A;  4GBQ A;  2O31 A;  2L3Q A;  1WX6 A;  1WYX A;  1UEC A;  4J9F A;  4E6R A;  1BK2 A;  1G2B A;  1UHC A;  1T3L A;  2D0N A;  2DL3 A;  2OAW A;  4IIO A;  1JO8 A;  2YUN A;  2LJ3 A;  1SSH A;  2LQW A;  3UAT A;  3VRZ A;  2KEA A;  1RI9 A;  2O88 A;  3QWX X;  4OMN A;  3VS3 A;  2CT4 A;  2L0A A;  1ARK A;  2EYZ A;  1FMK A;  1AVZ C;  1E6G A;  3H41 A;  4RTZ A;  3VS4 A;  2C0T A;  2AKL A;  3M0P A;  5GJW B;  3M0R A;  1GRI A;  5I11 A;  2DF6 A;  2F2X A;  2KRO A;  1T3S A;  5FWB A;  4JPB W;  3RNJ A;  5EC7 A;  2K7A A;  3GBQ A;  1YWO A;  4OMO A;  2CT3 A;  4JZ3 A;  1V1C A;  2ESW A;  1TUD A;  1K0S A;  4Z89 A;  2CSI A;  1UE9 A;  2KXD A;  1VA7 A;  4AFZ C;  1AZE A;  1RUW A;  1NM7 A;  1ZSG A;  1A0N B;  4F17 A;  1PNJ A;  2KBT A;  1AWX A;  2O9V A;  4KRT A;  1CKB A;  3NPF A;  1X2K A;  1VYU A;  4CC3 A;  2LMJ A;  5IHI A;  1QWE A;  1NEG A;  2RQW A;  2A08 A;  2SEM A;  2W10 A;  2MCN A;  3REA B;  1H8K A;  1K0X A;  1NLP C;  2BZ8 A;  3A98 A;  2X3W D;  4F16 A;  1I1J A;  1M8M A;  2IIM A;  5FW9 A;  1K76 A;  1HD3 A;  1PRL C;  1NYF A;  4Z88 A;  1J3T A;  2JS2 A;  1M3B A;  2KT1 A;  4GLM A;  4CC7 A;  2MIO A;  4J9H A;  2DJQ A;  1B3Q A;  2CUB A;  2YDL A;  1W1F A;  2FPE A;  2LQN A;  4EIK A;  4M4Z A;  1LCK A;  2E5K A;  1NG2 A;  2NUZ A;  3I9Q A;  5IH2 A;  3FJ5 A;  1HJD A;  4HVV A;  2HDA A;  2RNA A;  4HVW A;  2OJ2 A;  1I0C A;  4AFQ C;  2X3X D;  2B86 A;  2DE0 X;  5IHN A;  1CKA A;  1TUC A;  2BZX A;  1X27 A;  2BZY A;  1OPL A;  4D8D A;  2XMF A;  1N5Z A;  2JMC A;  3H0F A;  3EGU A;  3UF4 A;  1PRM C;  1GCQ C;  2LNH B;  1ZX6 A;  1TG0 A;  1MUZ A;  1Z9Z A;  2AK5 A;  2EYX A;  2YUQ A;  1OPK A;  3NHN A;  1NYG A;  5ECA A;  1KJW A;  3EHR A;  4J9C A;  2EQI A;  4HCK A;  1AWO A;  1WDX A;  2KRM A;  2DA9 A;  2DVJ A;  1GBR A;  2GTJ A;  4DEX A;  2JW4 A;  4DEY A;  4OMQ A;  2L2P A;  3TSZ A;  3EHQ A;  2LP5 A;  3TSW A;  4JJD A;  4CC4 B;  2RQT A;  3PVQ A;  4RTW A;  2M0Y A;  2YT6 A;  3UA6 A;  1AD5 A;  1YN8 A;  1M3C A;  1NLO C;  1IO6 A;  1GFC A;  1NEB A;  1UTI A;  2K6D A;  1AEY A;  1JXO A;  4LE9 A;  4F14 A;  1X6G A;  2J06 A;  2L3P A;  4ORZ A;  2EKH A;  2RN8 A;  1AWJ A;  2J05 A;  3U23 A; 
#chains in the Genus database with same CATH topology
 5IXB A;  1GXI E;  3V7R A;  3OYG A;  4M75 D;  1Q7Y U;  4JS4 A;  4E7I A;  5DLQ E;  2F5T X;  2M02 A;  1WLP B;  4X9D A;  1QLY A;  2HD0 A;  1GFD A;  3M4Y A;  3JCM e;  1WJQ A;  4OB3 B;  2QGG A;  4J5Y A;  2JTM A;  3C95 A;  2CP2 A;  1BYM A;  2K79 A;  2X4X A;  4ELY C;  1U3O A;  2OTL T;  2ED1 A;  2PUK B;  5GAN 2;  2HCK A;  5CVI A;  4RTX A;  1VQM T;  1P92 A;  4N0A A;  1QVP A;  4D6W A;  2LQ8 A;  3M57 A;  4C0Z A;  4J83 A;  2XHC A;  2KDS A;  3RBB B;  2EPD A;  1YIT Q;  3CCV T;  5D6X A;  1KSW A;  2BTT A;  1TH7 A;  4E7J A;  2V8I A;  3JB9 J;  2GFA A;  3JV3 A;  2VKN A;  5LJ5 h;  5LJ3 e;  2ABL A;  1SEM A;  8AT1 B;  4C92 G;  2SRC A;  2PQW A;  4OP0 A;  1IXD A;  4C92 E;  3JB9 D;  1NPR A;  3CPW A;  1VQL T;  1MMD A;  3DKM A;  2EQM A;  2DRK A;  2L5Q A;  2Y4Y A;  1R8O B;  1ZBX A;  2WSC E;  3L2Q A;  2DO3 A;  3EAE A;  1TS9 A;  3GLX A;  1PD1 A;  1M9S A;  4OMM A;  1UGV A;  3H9N A;  2ED0 A;  4MZT A;  1KFZ A;  1WXU A;  2KSS A;  2DJZ A;  2E64 A;  5GAN 6;  3L2W A;  3CBM A;  1YNZ A;  2YRC A;  1UGQ B;  1YWP A;  4QVZ A;  1RAG B;  2VWF A;  3PE0 A;  2VYT A;  3HTR A;  1C0M A;  1Q82 U;  3QZ9 B;  4HCB A;  3M59 A;  1U1S A;  3HPW A;  4DOV A;  4KGV B;  1QCN A;  1QVG S;  1VOM A;  1B34 B;  1Z9Q A;  1JJ2 A;  4M7D E;  3FLG A;  4C8Q A;  3MO8 A;  4LD9 K;  2I0N A;  4AMC A;  1KG1 A;  2QA4 A;  3THK A;  2RPN A;  4IUR A;  2LJ0 A;  3WXM B;  1X43 A;  4PFO A;  5KYN A;  2RF0 A;  3PGG A;  1W70 A;  1FXX A;  2GGR A;  4A4G A;  2M9U A;  3M58 A;  2CUD A;  4RKU E;  2MOX A;  3H0I A;  3EGD A;  1VQL A;  3CEY A;  2XDP A;  4MZM A;  3CCR T;  5LL6 S;  4X9C A;  2E70 A;  3CPW P;  5A0G A;  3JCM b;  2CP7 A;  1SHF A;  1Y71 A;  1M30 A;  1YJ9 Q;  2WAC A;  2DX1 A;  4J9E A;  2KT8 A;  4M75 F;  3SWN A;  4PJO E;  2EGC A;  4C92 B;  1VQN Q;  3G71 Q;  2XDD A;  1UJY A;  1YP5 A;  2O9S A;  1T0J A;  1Y96 A;  4F04 B;  4RTY A;  3R6N A;  1GCQ A;  2D9T A;  1K73 C;  3V8J A;  2BE9 B;  4C5I A;  1D1C A;  2P4R A;  2YLC A;  3RDV A;  3VV0 A;  1SKU B;  2OTL A;  4M7A G;  4LDU A;  2RMO A;  1C6V X;  4KUI A;  1RAE B;  1MNE A;  2HL3 A;  4C8Q D;  2RJD A;  1QKW A;  2MMP A;  2JZ2 A;  2FEI A;  1TXQ A;  2EGA A;  2ZCF B;  1VQ4 T;  2OTJ T;  3MEW A;  4C92 A;  1YJW A;  2ECZ A;  5GAN 7;  1PKT A;  1M3A A;  1IHV A;  3I5R A;  1M90 R;  2DL8 A;  5IN1 A;  2JOY A;  1EFN A;  1BB9 A;  3PNW C;  1RAC B;  3SDZ A;  4WF2 A;  2QTV A;  2R5A A;  2J6F A;  4BAC A;  5GMK h;  3GP8 A;  5KE3 A;  3OYJ A;  3MEV A;  3JRZ A;  3CCS T;  2KK4 A;  5GMK i;  4TVR A;  1VQN T;  3CC2 Q;  3DLM A;  2MYS A;  5I21 A;  3J80 E;  2XK0 A;  5DY9 A;  5FRM A;  5CKE A;  3I56 A;  4FCY A;  2RK1 A;  2O2O A;  3EFR A;  2O31 A;  3JCM Q;  1EX4 A;  1LJO A;  5D7U A;  2K4Y A;  3I55 T;  1G2B A;  1MND A;  3OYI A;  4DBH A;  2D0N A;  1QP2 A;  5GAO n;  1JO8 A;  4OF1 A;  2GCX A;  2QG9 B;  1XTD A;  2LJ3 A;  1G3T A;  3UAT A;  4M78 B;  2LT1 A;  2CT4 A;  2L0A A;  1BCM A;  3EGX B;  4KGZ B;  2EYZ A;  4BB7 A;  2IG0 A;  1WQW A;  2C0T A;  4J6Y A;  1GRI A;  3G4S T;  2HKN A;  2C06 A;  2KRO A;  4JPB W;  4PJO C;  2K7A A;  2F1L A;  3GBQ A;  1IZ6 A;  2CT3 A;  4E7L A;  3L1A A;  3CCV A;  3QSU A;  4XU3 A;  3CCM A;  4DBQ A;  1VA7 A;  3RIR A;  5KYU B;  3N5B B;  1ZSG A;  1A0N B;  4O6J A;  2PVD B;  1PNJ A;  2RI5 A;  2WSE E;  2O9V A;  3LGF A;  1CKB A;  3NPF A;  1VYU A;  2LMJ A;  5IHI A;  3OYF A;  1OZ3 A;  3HRS A;  1VQK Q;  5D6Y A;  1NEG A;  2A08 A;  4BY6 B;  4M7D G;  2W10 A;  5LJ5 d;  1H8K A;  1K0X A;  1NLP C;  4L6V 5;  4JRP A;  2QQR A;  4BY6 C;  2IIM A;  3OYL A;  1K76 A;  1HD3 A;  1NYF A;  1HYO A;  1M1K R;  3HRT A;  4JRQ A;  4L59 A;  3G6E T;  3H6Z A;  4GLM A;  4M75 A;  3RKX A;  3NTI A;  1VUB A;  2YDL A;  2GQV A;  1W1F A;  3QUI A;  4A4F A;  3OYA A;  4ZN3 A;  1RAI B;  5CR2 A;  1VQK A;  3CCE T;  2E5K A;  1NG2 A;  2PVO B;  5GAM e;  2ZPE B;  2FHD A;  1TWB A;  4HVV A;  2QQA A;  4HVW A;  4AFQ C;  5IHN A;  2DAQ A;  1NJI C;  3GF5 A;  3LGL A;  2YRD A;  2V8K A;  2P84 A;  2DK3 A;  5LJ3 j;  1IRX A;  4D8D A;  1N5Z A;  2JMC A;  1KQS A;  1PRM C;  4YTL A;  2AK5 A;  2YUQ A;  3ZFJ A;  2V8J A;  1KJW A;  1N8R R;  1M1K C;  1IGQ A;  2P4T A;  1D3B A;  1AWO A;  4IUP A;  1YI2 T;  4MZP A;  4J6W A;  1HK9 A;  2CZ6 B;  1OX8 A;  2QEX Q;  5LJ5 f;  2NUT A;  4CC4 B;  3PVQ A;  3LX7 A;  3G71 T;  2M0Y A;  2CS7 A;  1KQ2 A;  1D09 B;  1H3Z A;  3QDF A;  3AHU A;  2XID A;  1UTI A;  3CCS Q;  2CKK A;  3JCM X;  1F1B B;  1X6G A;  2RHY A;  5GAM g;  2DD5 A;  1QVF A;  4ORZ A;  4M7D D;  2X4W A;  3A8O B;  1VQO A;  1MMA A;  2RN8 A;  1VIE A;  4MDW A;  3U23 A;  1BI0 A;  2VAS A;  4UC4 A;  1VQ9 A;  5GAN h;  2OTJ Q;  2EQJ A;  1YCS B;  3OYK A;  2V26 A;  2VV5 A;  2ZZD A;  1QCO A;  5I2S A;  1UUE A;  1YIT T;  2YHT A;  2FB7 A;  4VUB A;  5AT1 B;  1E7O A;  3EG0 A;  3FIF A;  4GY5 A;  2LDM A;  3MP8 A;  1O9S A;  4OML A;  2F2V A;  3VS7 A;  3IQL A;  5CCA A;  3SWN C;  2D8H A;  3REB B;  1VQO Q;  2EBP A;  3M0Q A;  5I22 A;  1UJ0 A;  2H8H A;  1EZZ B;  1OU9 A;  3SEM A;  4J9I A;  2O4X A;  3P8D A;  1OU8 A;  4DA4 A;  1Q81 R;  3NMZ C;  1G3S A;  2VB6 A;  1WFW A;  1S72 T;  1UDL A;  2DYB A;  2QQB A;  1H3H A;  1VQ5 T;  1VQ8 T;  1FYN A;  3PVL A;  3DB3 A;  3MP1 A;  5GAN e;  2DPP B;  3JB9 H;  3I5S A;  5KYW B;  3S3O A;  2HBP A;  2ROL A;  3CXC S;  1QCF A;  3VU3 C;  4M7A C;  3FC3 A;  1LNX A;  4RCC A;  4Y92 A;  4XAX B;  1N6A A;  4F7U B;  3OYY A;  2DEQ A;  2WSF E;  1PKS A;  3M0T A;  4Z8A A;  2JM8 A;  5A0D A;  5KYY A;  2AKK A;  2P0P A;  1MGQ A;  4LDY A;  1M2O A;  2CZ1 B;  2FO0 A;  4AG2 C;  2JM9 A;  4AFS C;  2EW3 A;  2CDT A;  4LN2 A;  1IGU A;  2BKD N;  3GNG A;  3MHX A;  2DRM A;  5GAN f;  2JT4 A;  3RUX A;  5KCO A;  1SHG A;  1YIJ A;  4PJO F;  4II1 A;  4B6M A;  2JJ9 A;  2DL4 A;  2EAY A;  2DTO A;  3X24 B;  3X20 B;  5GAO r;  1JEG A;  2DBM A;  4J6X A;  2DM1 A;  5EG2 A;  2LZ6 B;  3NTH A;  3ER0 A;  3SD4 A;  4D8K A;  3CC2 T;  2KRN A;  4Y91 A;  4C5E A;  4E7Z A;  5FU6 C;  3TU4 K;  3VKI A;  5DM7 R;  4HA8 A;  3CC2 A;  3SWN B;  3RKW A;  2KVQ G;  4BD3 A;  4HXJ A;  3I56 Q;  3PMI A;  1TOV A;  4M7D C;  5DLO A;  4RMO A;  4EPC A;  3V7C A;  5HCK A;  3UDC A;  2DL7 A;  2GTO A;  1NBE B;  2K3B A;  1WXB A;  3S6W A;  4RTU A;  1YJN T;  3QZ5 B;  3QWY A;  2O4X B;  2CRE A;  3LH0 A;  3X25 B;  1Y57 A;  3JCM g;  2R5M A;  5CKH A;  2A37 A;  5IXF A;  1BIA A;  4Z02 A;  3QPH A;  3E9F A;  2KGT A;  2RHX A;  3OYN A;  1D0Z A;  2EYY A;  2YSQ A;  3MP6 A;  4PJO G;  1BBZ A;  3Q1J A;  5CAI A;  2OX7 A;  4M78 E;  2A36 A;  2KE9 A;  4ZNX A;  1YJN Q;  1FMV A;  1Y07 A;  1VQ5 A;  2EKO A;  4KGX B;  2F5K A;  3VYG A;  2RHZ A;  3QO3 A;  1WA7 A;  1V76 A;  3J7A F;  2W0Z A;  2ZGW A;  4RG8 A;  3JSC A;  2PZ1 A;  1M90 U;  3WVD B;  1M1G A;  4OB1 B;  3QBY A;  1B7T A;  1MMG A;  2P0Q A;  5FRN A;  4C5G A;  1W2B A;  4B9W A;  1SG5 A;  4X1V A;  3KBG A;  1K9A A;  2PUO B;  2YUP A;  4QT7 A;  5FRO A;  3MKD A;  1KD1 U;  3FDR A;  2L3R A;  1YIT A;  5IT9 E;  4PJN A;  4M75 B;  2NUP B;  1OOT A;  1YJN A;  4FSS A;  2YXY A;  5CKD A;  3OS2 A;  1PCX A;  1VQ9 T;  1XJW B;  2LVM A;  2QAS A;  4M75 C;  1ZA2 B;  4C0D C;  2AZS A;  1R0C B;  1N8R U;  2J7I A;  2MPX C;  2EVR A;  3OW2 P;  4HCZ A;  2ZPH B;  3VUB A;  7AT1 B;  3M0S A;  2RM4 A;  4F7U A;  2DIL A;  5CIU A;  4PJJ A;  2KYM A;  1WZO A;  2XI9 A;  1KD1 R;  2L8D A;  2FG0 A;  2MAM A;  1RAA B;  5KCH A;  4JJB A;  3LWH A;  1WI7 A;  1KC8 C;  2EQK A;  4J7F A;  1YI2 A;  1KHC A;  2LQK A;  1UHF A;  3VS5 A;  3CC7 Q;  4M78 G;  5GAN d;  2DFU A;  3P8B B;  2GQI A;  4V2S A;  4GBQ A;  1TSF A;  4FW2 A;  5D6W A;  1Q81 C;  4E6R A;  1T3L A;  4M77 A;  4BI8 B;  3M56 A;  1SSH A;  1ZHI A;  4PJO D;  5GAN 4;  2KEA A;  2O88 A;  4OMN A;  3VS3 A;  2P0K A;  1FMK A;  1AVZ C;  3EGD B;  4KH0 B;  4RTZ A;  1VQ7 A;  3CCE A;  1TUG B;  1VQL Q;  2K3X A;  1G3W A;  3CCU Q;  2DF6 A;  3QII A;  2F2X A;  5FWB A;  1T3S A;  3RNJ A;  3SB2 A;  2HAX A;  4B9X A;  1I4K 1;  4LDV A;  2EFI A;  1QQJ A;  2ESW A;  2CSI A;  1WNL A;  2HZY A;  4FW1 A;  4PJM A;  4BE0 A;  1MHN A;  1Y96 B;  2KQW A;  1OZ2 A;  1AZE A;  3OW2 A;  2IPO B;  2CGH A;  1NM7 A;  2K5L A;  2DEU A;  4Y28 E;  4F17 A;  4FYX B;  2AHJ B;  4BDY A;  1B34 A;  4M7A D;  4JUV A;  2RHU A;  1X2K A;  3OYC A;  1U1T A;  3UPU A;  5CK9 A;  2MCN A;  1M2V A;  3BE3 A;  3REA B;  3CCQ T;  2BZ8 A;  4F16 A;  5KYW A;  2X3W D;  1BI2 A;  2MF2 A;  3OMC A;  4O5V A;  3F70 A;  4EMG A;  1VQP T;  2M16 A;  4ZN1 A;  4JJN K;  3QDR B;  3MEA A;  4CC7 A;  2MIO A;  2VXE A;  2DJQ A;  3CCQ Q;  2E41 A;  2NLU A;  4PL6 A;  2FZG B;  1FX7 A;  2LTO A;  3T9N A;  2HL5 C;  2DER A;  2DD4 A;  2CZ7 B;  3OYD A;  2OTL Q;  3FJ5 A;  3G6E Q;  1OX9 A;  2CZ0 B;  3CPF A;  1HJD A;  2RNA A;  2QYZ A;  2X3X D;  2B86 A;  2DE0 X;  3OYM A;  2DXC A;  4XTV A;  2DZC A;  2HQE A;  3G71 A;  3TCJ A;  2L89 A;  1YFN A;  3FEO A;  4F7U E;  4KT0 E;  2H3J A;  5GAN 3;  3H0F A;  4CRI A;  3CC7 T;  3UF4 A;  4JLG A;  1I81 A;  3PIP A;  1ZX6 A;  1TG0 A;  1D3B B;  2EYX A;  1OPK A;  3OS5 A;  4C92 D;  3CD6 Q;  3CCR Q;  1VQ7 Q;  1NJI U;  2EQI A;  2DA9 A;  2GTJ A;  4DEX A;  4DEY A;  1RL2 A;  2DXT A;  2LRQ A;  3EHQ A;  2QK0 A;  4JJD A;  1ZA1 B;  5GMK m;  1VQ5 Q;  1YN8 A;  1JRI A;  1NLO C;  4A53 A;  3QJ6 A;  1IO6 A;  1GFC A;  3SFM A;  1NEB A;  1WJS A;  1BI3 A;  4FSX A;  2KY9 A;  1H64 1;  4XTY A;  2J06 A;  3CME T;  1RAB B;  5GAM h;  4PJO B;  2EYQ A;  1PSF A;  3ZEH A;  2HKQ B;  3VRY A;  2GBQ A;  1ACM B;  3M55 A;  5GAN g;  3G6E A;  5GAO m;  2LJ1 A;  3I55 Q;  3OB9 A;  1YJW T;  2RJF A;  1JJ2 P;  3L2R A;  2VGN A;  2OTJ A;  1VQ4 A;  4K11 A;  3A8G B;  1W6X A;  4J9B A;  4ELZ C;  1EIF A;  2Y90 A;  5GAN 8;  2EGE A;  2X4Y A;  2QA4 Q;  3I35 A;  4QQG A;  2DNU A;  2FZC B;  2JS0 A;  2DIQ A;  3S3M A;  1MMN A;  1D1A A;  1JB0 E;  2RB6 A;  4R55 A;  2FPF A;  3OA6 A;  2VXF A;  1VQ9 Q;  4ZTJ A;  1ZUU A;  4F7U G;  2FZK B;  2E4H A;  3PMT A;  3VJP A;  2FL7 A;  1KK7 A;  1YHQ T;  1M1K U;  2RI3 A;  1BU1 A;  4LXC A;  4C0D B;  1AZG B;  4CC2 A;  1M90 C;  1N9S A;  5L23 A;  4M7D F;  3C94 A;  5HK0 A;  4JJC A;  3G4S A;  4EMK C;  3HKS A;  4OB2 B;  1OI1 A;  3QYG B;  4M78 D;  3X26 B;  3C0C A;  1I5L A;  3TEE A;  2KR3 A;  2D8J A;  3M4G A;  4ME7 A;  3CC4 Q;  3KXT A;  1IHW A;  5GAO q;  4M78 F;  3VUZ A;  3HSB A;  1QVG A;  4AFU C;  1D0X A;  1BKB A;  2BE7 D;  1WIE A;  5GAM f;  3CCM Q;  3OS1 A;  3EG9 A;  4C8Q G;  1B07 A;  2QQS A;  3MJX A;  2DVE A;  4KH1 B;  5HKC A;  4P5N A;  2EJG A;  3I56 T;  3L2U A;  2EIF A;  2CH4 W;  2QA4 T;  1Y0M A;  3HL8 A;  4X34 A;  2B8A A;  4M77 F;  4R56 A;  3JB9 I;  1ZUY A;  3JCM V;  4OVA A;  1Q86 U;  1I07 A;  2G6F X;  1KQS S;  4MDX A;  4DBR A;  5LJ5 j;  2HNI A;  1O75 A;  2E65 A;  2K9G A;  1KC8 U;  3EH2 A;  4R0K A;  2XIC A;  1VQ4 Q;  4LUD A;  1AOJ A;  1K73 R;  3CCS A;  3CCU T;  4XK8 E;  1WQ7 A;  2KYB A;  1UFF A;  1KC8 R;  2LT4 A;  2DET A;  1BI1 A;  2NWM A;  4FU6 A;  2X4J A;  4M7A F;  1T0H A;  1K1Z A;  1QKX A;  4RG2 A;  2F69 A;  2DL5 A;  4LNP A;  2E5Q A;  1XOV A;  2K5I A;  3CQT A;  5FU7 C;  2K2M A;  3VS1 A;  2DTH A;  1MV3 A;  2QQ9 A;  1FMW A;  2LCS A;  1GL5 A;  4FT2 A;  4ZGD B;  1QVF S;  4HKE A;  1N8R C;  2IVW A;  5AYF A;  1G3Y A;  5GMK e;  1WHK A;  1PHT A;  8ATC B;  4FYV B;  1G83 A;  2FPD A;  1ZBJ A;  2RHI A;  3JCM W;  1D0Y A;  4M75 E;  3SHW A;  1ZSZ B;  1VQ8 Q;  4GLK A;  2C0I A;  4KUL A;  1JJ2 S;  1K73 U;  4J9D A;  4CI0 C;  2V1R A;  4QVD A;  5IHK A;  3A8L B;  3TRE A;  3JCM P;  2F2W A;  2HQX A;  2JUF A;  3AT1 B;  1ABO A;  2QAZ A;  1KQS P;  4M7A E;  2DTI A;  2KRS A;  4QVC A;  1JXM A;  1ZSZ A;  2RD1 A;  3EFS A;  3CCJ Q;  2KI7 A;  1VQM A;  2VVK A;  2OI3 A;  4C0F A;  2R58 A;  2LX9 A;  4NL2 A;  1YI2 Q;  3OMG A;  3CCR A;  3RES A;  2X51 A;  2LCC A;  2FRW A;  3A5Z B;  3QHS A;  3CBO A;  4OMP A;  3OYB A;  4M7D B;  3VYH B;  4A4K A;  2MWO A;  5GJV B;  1SF9 A;  3BDU A;  2HSP A;  1LOJ A;  1M27 C;  3LW5 E;  4XQ3 A;  5A2Q E;  1ZQ1 A;  4BUG A;  4WCI A;  4XU0 A;  4XU2 A;  1G5V A;  1K9M R;  1OEB A;  3JB9 G;  1YBY A;  3CME A;  2MWP A;  9ATC B;  3FB9 A;  3G7Z A;  3CCJ T;  2BUD A;  2A3L A;  3BFM A;  4WTO B;  4C0G A;  3CCU A;  1U06 A;  2CP6 A;  1WJR A;  4RTV A;  4NL3 A;  1U8R A;  1SPK A;  1ZLM A;  2HQH A;  1UGS B;  4Q5W A;  4E7K A;  2ROT A;  1AWW A;  1CSK A;  2K3Y A;  1K9M C;  4J8O A;  2C0O A;  1Q82 C;  3OBW A;  2MI6 A;  2CH4 A;  2DZ9 A;  1NE8 A;  3H0H A;  4A63 B;  2RQU A;  2YWW A;  5FWC A;  1X6B A;  2X35 A;  3VS0 A;  3CCE Q;  1VQ6 Q;  3HFO A;  2LX7 A;  4J9G A;  2DXU A;  3RR6 A;  2D6F A;  2L3Q A;  1WX6 A;  1UEB A;  1WYX A;  1UEC A;  4BDZ A;  1BK2 A;  1TTH B;  4OMF B;  1UHC A;  2FVU A;  4J7I A;  2HSE B;  5C6S A;  5KYY B;  2DL3 A;  4IIO A;  2NUP A;  4JS5 A;  3VRZ A;  5GMK j;  1QW1 A;  1RI9 A;  4FT4 A;  3QWX X;  3JAM E;  1ARK A;  4IUU A;  1E6G A;  4M77 G;  2CYZ B;  2KMT A;  1KD1 C;  2EJ9 A;  5GJW B;  3JB9 F;  3M0R A;  3RMS A;  4RCB A;  4JRI A;  2QGF B;  1YCY A;  3V8L A;  5EC7 A;  1YWO A;  4OMO A;  1FWZ A;  1YHQ A;  4M7D A;  1V1C A;  3C4S A;  1VQP A;  1UE9 A;  3X28 B;  4LD6 A;  3QYH B;  2KXD A;  4XU1 A;  2M1H A;  3PIO A;  3EGX A;  3MET A;  3WVE B;  3OSV A;  1RUW A;  2FYK A;  3QKJ A;  1WHL A;  2KBT A;  3EFO A;  3EG9 B;  2ZPF B;  3URG A;  1QWE A;  2H3E B;  2AIR B;  1RAF B;  2RQW A;  1NJI R;  3A1P A;  2SEM A;  4C92 F;  2G3R A;  1K8A R;  1I1J A;  1RAD B;  5FW9 A;  1PRL C;  2AT1 B;  4Z88 A;  1IRE B;  1N27 A;  3HRU A;  5CQX A;  1M4Z A;  4J9H A;  2YLB A;  3NTK A;  5J39 A;  2CUB A;  1Q7Y C;  4LDW A;  1Q95 G;  3CD6 T;  3INZ A;  2FPE A;  2QDY B;  4M4Z A;  2R57 A;  3DB4 A;  1LCK A;  4F7U F;  1VQ7 T;  3I9Q A;  3G1J A;  5IH2 A;  3MPU B;  1YJ9 A;  3CCL T;  3JCM c;  1I0C A;  1RI0 A;  3L2Z A;  4AT1 B;  1CKA A;  1TUC A;  1X27 A;  2BZY A;  4M78 A;  2D0Q B;  4XTZ A;  3OBY A;  5FU7 B;  1DJ7 B;  2XMF A;  3EGU A;  5GAN j;  1GCQ C;  2LNH B;  1Z9Z A;  1MUZ A;  2CP3 A;  1Q7Y R;  3NHN A;  4IKF A;  3PTA A;  2QEX T;  3EHR A;  2CP0 A;  4HCK A;  1WDX A;  2VC8 A;  2DVJ A;  5GAM d;  1GBR A;  2JW4 A;  2E10 A;  3LWI A;  4OMQ A;  3TSZ A;  3CC7 A;  3CBP A;  5LJ3 f;  1VIF A;  3TSW A;  5KYU A;  3V8K A;  2YT6 A;  3UA6 A;  2JTF A;  3UT1 A;  1X75 C;  2RI2 A;  3ZBD A;  4QQ6 A;  2K6D A;  1AEY A;  1JXO A;  4XTX A;  3R6O A;  2L3P A;  4A4H A;  5LJ5 e;  4ANJ A;  4C8Q B;  1AWJ A;  3L2V A;  4QQD A;  2J05 A;  2X9H A;  3ASK A;  1LPL A;  2GNC A;  5M9O A;  4EMH A;  3EH1 A;  2DLP A;  2AZV A;  4RUG A;  3M0U A;  3QG1 A;  3HP9 A;  2QI2 A;  1M1F A;  4ATO A;  3JCM f;  1NPP A;  1G8X A;  3GOX A;  2RH2 A;  3A8H B;  3OQ5 A;  3CCQ A;  2BIV A;  2K5F A;  3CMA A;  4DOW A;  1PD0 A;  1ABQ A;  1Q81 U;  1PWT A;  2E1H A;  3E2U A;  3LH5 A;  2I2L A;  5J3B A;  4BI3 A;  1VYV A;  1GCP A;  3KUF A;  3RKY A;  1X6O A;  2VUB A;  5HK3 A;  3VS2 A;  3PT9 A;  1X01 A;  5KYX B;  3UA7 A;  1OUL A;  4IUQ A;  4BI4 A;  5A0L A;  5LJ5 g;  3GIB A;  2DBK A;  6AT1 B;  4PKC C;  2ZPI B;  1Q82 R;  4EMK A;  4C92 C;  3CC4 A;  4ZGJ B;  2YUO A;  4N4G A;  3L42 A;  3OS0 A;  4BE2 A;  2CSQ A;  3QJY A;  5L8R E;  1V29 B;  1HXD A;  4QW2 A;  4PJO A;  3CPW S;  4M77 E;  1Q86 R;  1C1A A;  1Y7X A;  2RQR A;  1PG5 B;  2CP5 A;  2DKG A;  4PK4 A;  1RAH B;  3ZL7 C;  3CMA Q;  2EWN A;  1IB8 A;  1W2B S;  2GF7 A;  4XTW A;  3TQ7 P;  1VYT A;  4FIB A;  1XQH A;  4C5H A;  2ATC B;  3TVT A;  5GMK l;  4E7S A;  3OY9 A;  2COZ A;  3EG2 A;  4M7A B;  4HCC A;  4E47 A;  4ZGE B;  5LJ3 g;  5CKB A;  2M0O A;  4AG1 C;  1VQ6 A;  1M2V B;  4PNO A;  4OGE A;  3CCV Q;  3EG1 A;  4XTU A;  3V7S A;  1VQ6 T;  2LNV A;  4PFZ A;  3DLL A;  4JRK A;  2E6Z A;  1ZSZ C;  2A7Y A;  1HSQ A;  2DMO A;  5CO7 A;  4M77 B;  2JVV A;  2J6O A;  2PNI A;  1I8F A;  1AHJ B;  3HHT B;  4DQ2 A;  3HFN A;  5J26 A;  2JMA A;  1GBQ A;  2HBW A;  4LUE A;  2RQV A;  1TU0 B;  2HEQ A;  3O5Z A;  1RLQ C;  3QXE B;  4LDX A;  1W2B P;  2RJE A;  4IIM A;  4DBF A;  1D1B A;  2RA2 A;  3OYE A;  3H8Z A;  1VQM Q;  2EYW A;  2XG8 D;  2NYS A;  2VGM A;  1OQK A;  2JXB A;  4ESR A;  4QKU A;  2QXF A;  3NGP A;  2RJC A;  5KH6 A;  4N0A C;  1PSE A;  1YIJ Q;  5C0M A;  2DXB A;  1K4U S;  4JZ4 A;  1WHH A;  4FYY B;  1S1N A;  1ZUK A;  1X2Q A;  2V1Q A;  1SRL A;  2LCL A;  3E1S A;  1QP3 A;  3J81 E;  1S72 A;  1UG1 A;  1OV3 A;  3RER A;  2EJF A;  1XNI A;  1BCO A;  3A8M B;  3KFV A;  1X69 A;  2E3H A;  3EFO B;  2XDB A;  2KAF A;  1YJW Q;  1SRM A;  2YRV A;  4A4E A;  2KNB B;  5HY6 A;  2ZAE A;  1PC0 A;  4KBM B;  2D1X A;  1K8A C;  3FJP A;  4ZTF A;  1WXT A;  3OW2 S;  3ME9 A;  4RTT A;  1U5S A;  2E3I A;  1KIK A;  1PM3 A;  1RLP C;  2XKO C;  3E19 A;  5GAO p;  1S72 Q;  3GNF B;  5GAM j;  3CXC P;  1R0B G;  2NUT B;  4JLI A;  3VS6 A;  1K9M U;  5I2M A;  1MV0 B;  3ULR B;  3CME Q;  2J6K A;  2QDL A;  1KQ1 A;  3EG3 A;  2FRY A;  3P8H A;  1VQO T;  1KHI A;  2M51 A;  1H92 A;  2HMA A;  3RMQ A;  2JTE A;  2QTX A;  1Q86 C;  1E6H A;  5KE2 A;  1AT1 B;  2KXC A;  2LC4 A;  2ENM A;  1QVF P;  4JDS A;  5IAY A;  1JQQ A;  3MCA B;  2A28 A;  2K57 A;  1W4S A;  1VQP Q;  1JU5 C;  2COW A;  4OGC A;  1UGR B;  4C8Q C;  1OYX A;  5GAN 5;  3C12 A;  5FLX E;  3O8V A;  4HVU A;  2EQU A;  3OSS C;  2PTK A;  2XU8 A;  2QEX A;  3BY7 A;  1YIJ T;  4N4H A;  4BE1 A;  2L3S A;  2ZPB B;  1QWF A;  4M77 D;  2XD0 A;  1WPY A;  4J9F A;  3JCM J;  3M9Q A;  3LYI A;  4MMK A;  2E6N A;  2OAW A;  2YUN A;  1JBM A;  2LQW A;  1BIB A;  2COY A;  4M75 G;  4IUT A;  3CCL A;  1WHG A;  4EMK B;  2RK2 A;  3H41 A;  3VS4 A;  4E7H A;  4M77 C;  2AKL A;  3M0P A;  3CC4 T;  4EDU A;  5FU6 B;  3CD6 A;  5I11 A;  2ZPG B;  3M5A A;  3NFC A;  1VQ8 A;  2PU9 B;  1QMC A;  4HT8 A;  4JZ3 A;  4E2F B;  3BW1 A;  1TUD A;  1K0S A;  4Z89 A;  4C8Q E;  2JN0 A;  4AFZ C;  3E9G A;  4NOY A;  1M5Q 1;  5LJ3 d;  5LJ3 h;  3LLR A;  4PLI A;  4KRT A;  1AWX A;  3D7S B;  4CC3 A;  4M78 C;  2PVG B;  4IUV A;  1YHQ Q;  3CCL Q;  3CXC A;  3UWN A;  3CMA T;  2GFU A;  1WHJ A;  1UGP B;  3A98 A;  3PFS A;  2JNG A;  3CCM T;  1M8M A;  2OAU A;  1J3T A;  1M8V A;  2JS2 A;  1M3B A;  2O01 E;  2KT1 A;  4A54 A;  2E12 A;  3BDL A;  1B3Q A;  4N4I A;  5KYX A;  2LQN A;  1SSF A;  4EIK A;  2MK5 A;  4C8Q F;  2NUZ A;  1WGS A;  3JCM d;  3JCM h;  3S3N A;  5CQY A;  1UB4 A;  2HDA A;  2OJ2 A;  4L5G A;  2DIG A;  2BZX A;  3GPL A;  3M54 A;  1OPL A;  1N9R A;  2Z0W A;  2K2V A;  3I55 A;  4NS5 A;  1R77 A;  4FL6 A;  1NYG A;  2Y4X A;  5ECA A;  4MML A;  5CKF A;  4PJL A;  4J9C A;  1K8A U;  1QVG P;  4OB0 B;  2KRM A;  3OYH A;  3FRN A;  3G4S Q;  1I5O B;  4PLL A;  2L2P A;  2RO0 A;  2LP5 A;  1VQN A;  2RQT A;  4RTW A;  4M7A A;  3MEU A;  1AD5 A;  4KUD K;  1NZ9 A;  3M53 A;  1M3C A;  4PFP A;  5GAO l;  2DYI A;  1YJ9 T;  4LE9 A;  3CCJ A;  4F14 A;  2A0F B;  1WHM A;  2EKH A;  4FYW B;  1VQK T;  4FM4 B;  1LVK A;  4HT9 A; 
#chains in the Genus database with same CATH homology
 2GNC A;  3VRY A;  2GBQ A;  5IXB A;  2DLP A;  2AZV A;  4RUG A;  3M0U A;  1YCS B;  2LJ1 A;  1UUE A;  1WLP B;  1E7O A;  3EG0 A;  1QLY A;  1GFD A;  4OML A;  2F2V A;  4K11 A;  3VS7 A;  3IQL A;  1W6X A;  4J9B A;  1ABQ A;  2EGE A;  2D8H A;  2K79 A;  1PWT A;  3REB B;  3I35 A;  1U3O A;  2EBP A;  3M0Q A;  2ED1 A;  2DNU A;  5I22 A;  3LH5 A;  1UJ0 A;  2JS0 A;  2H8H A;  1VYV A;  2HCK A;  3SEM A;  4J9I A;  4RTX A;  1GCP A;  2FPF A;  3NMZ C;  1ZUU A;  3VS2 A;  1WFW A;  3RBB B;  2EPD A;  1UDL A;  2DYB A;  1KSW A;  1H3H A;  2BTT A;  1BU1 A;  1AZG B;  3UA7 A;  1FYN A;  3PVL A;  4CC2 A;  5L23 A;  3I5S A;  2ROL A;  3JV3 A;  4JJC A;  1QCF A;  2DBK A;  2VKN A;  2ABL A;  1SEM A;  2YUO A;  4Y92 A;  2SRC A;  3C0C A;  2CSQ A;  2KR3 A;  2D8J A;  1PKS A;  3M0T A;  4Z8A A;  2JM8 A;  2DRK A;  4AFU C;  2AKK A;  1WIE A;  2RQR A;  2FO0 A;  4AG2 C;  2JM9 A;  4AFS C;  2EW3 A;  2CDT A;  4LN2 A;  1B07 A;  3ZL7 C;  2DRM A;  2JT4 A;  1VYT A;  4OMM A;  1SHG A;  1UGV A;  2CH4 W;  2ED0 A;  1KFZ A;  1Y0M A;  1WXU A;  3TVT A;  2DL4 A;  3EG2 A;  1ZUY A;  1JEG A;  1YNZ A;  2DBM A;  1YWP A;  2DM1 A;  1I07 A;  2G6F X;  2VWF A;  3PE0 A;  2LZ6 B;  4D8K A;  4AG1 C;  2KRN A;  2K9G A;  4R0K A;  3EG1 A;  4LUD A;  1AOJ A;  1Z9Q A;  2KYB A;  1UFF A;  4HXJ A;  2NWM A;  1HSQ A;  2DMO A;  2J6O A;  1T0H A;  2I0N A;  2PNI A;  1K1Z A;  1QKX A;  3THK A;  5HCK A;  2RPN A;  2LJ0 A;  2DL7 A;  2DL5 A;  4LNP A;  2GTO A;  1X43 A;  2JMA A;  1GBQ A;  1WXB A;  1XOV A;  2K3B A;  4RTU A;  3CQT A;  2HBW A;  2RF0 A;  2K2M A;  4LUE A;  2RQV A;  3QWY A;  3VS1 A;  2HEQ A;  1MV3 A;  1RLQ C;  1W70 A;  2CRE A;  3O5Z A;  2LCS A;  1GL5 A;  2GGR A;  1Y57 A;  2CUD A;  4IIM A;  2MOX A;  3H0I A;  1PHT A;  2A37 A;  5IXF A;  2EYW A;  1G83 A;  2KGT A;  2JXB A;  4ESR A;  2FPD A;  1ZBJ A;  2EYY A;  2YSQ A;  3NGP A;  1BBZ A;  3SHW A;  1SHF A;  1K4U S;  4JZ4 A;  2C0I A;  1M30 A;  4J9D A;  2A36 A;  2KE9 A;  4ZNX A;  2V1R A;  2DX1 A;  4J9E A;  2KT8 A;  5IHK A;  1S1N A;  1ZUK A;  1X2Q A;  2F2W A;  2V1Q A;  1SRL A;  2EGC A;  1ABO A;  1UG1 A;  1OV3 A;  1UJY A;  1WA7 A;  1YP5 A;  2O9S A;  1T0J A;  2KRS A;  1JXM A;  2W0Z A;  4RTY A;  3KFV A;  2VVK A;  1X69 A;  3R6N A;  2OI3 A;  1GCQ A;  2PZ1 A;  1SRM A;  2KNB B;  2P4R A;  2RMO A;  2D1X A;  2FRW A;  1WXT A;  4OMP A;  4RTT A;  1U5S A;  1KIK A;  4X1V A;  1QKW A;  1K9A A;  2YUP A;  1RLP C;  4QT7 A;  2FEI A;  2EGA A;  5GJV B;  2HSP A;  3VS6 A;  2ECZ A;  1PKT A;  1OOT A;  1M27 C;  1M3A A;  3I5R A;  4FSS A;  1MV0 B;  3ULR B;  4WCI A;  2J6K A;  2DL8 A;  2QDL A;  2AZS A;  1EFN A;  2J7I A;  2EVR A;  1OEB A;  1BB9 A;  3EG3 A;  2FRY A;  2M51 A;  1H92 A;  3M0S A;  2DIL A;  2J6F A;  2JTE A;  1E6H A;  2KXC A;  1U06 A;  2ENM A;  4RTV A;  2KYM A;  2FG0 A;  1JQQ A;  2A28 A;  1SPK A;  1ZLM A;  4JJB A;  2ROT A;  1AWW A;  1CSK A;  1JU5 C;  2C0O A;  1WI7 A;  2CH4 A;  3H0H A;  4A63 B;  2RQU A;  4HVU A;  5FWC A;  1X6B A;  2PTK A;  3VS0 A;  1UHF A;  3VS5 A;  2L3S A;  2LX7 A;  1QWF A;  2GQI A;  4J9G A;  2O2O A;  4GBQ A;  2O31 A;  2L3Q A;  1WX6 A;  1WYX A;  1UEC A;  4J9F A;  4E6R A;  1BK2 A;  1G2B A;  1UHC A;  1T3L A;  2D0N A;  2DL3 A;  2OAW A;  4IIO A;  1JO8 A;  2YUN A;  2LJ3 A;  1SSH A;  2LQW A;  3UAT A;  3VRZ A;  2KEA A;  1RI9 A;  2O88 A;  3QWX X;  4OMN A;  3VS3 A;  2CT4 A;  2L0A A;  1ARK A;  2EYZ A;  1FMK A;  1AVZ C;  1E6G A;  3H41 A;  4RTZ A;  3VS4 A;  2C0T A;  2AKL A;  3M0P A;  5GJW B;  3M0R A;  1GRI A;  5I11 A;  2DF6 A;  2F2X A;  2KRO A;  1T3S A;  5FWB A;  4JPB W;  3RNJ A;  5EC7 A;  2K7A A;  3GBQ A;  1YWO A;  4OMO A;  2CT3 A;  4JZ3 A;  1V1C A;  2ESW A;  1TUD A;  1K0S A;  4Z89 A;  2CSI A;  1UE9 A;  2KXD A;  1VA7 A;  4AFZ C;  1AZE A;  1RUW A;  1NM7 A;  1ZSG A;  1A0N B;  4F17 A;  1PNJ A;  2KBT A;  1AWX A;  2O9V A;  4KRT A;  1CKB A;  3NPF A;  1X2K A;  1VYU A;  4CC3 A;  2LMJ A;  5IHI A;  1QWE A;  1NEG A;  2RQW A;  2A08 A;  2SEM A;  2W10 A;  2MCN A;  3REA B;  1H8K A;  1K0X A;  1NLP C;  2BZ8 A;  3A98 A;  2X3W D;  4F16 A;  1I1J A;  1M8M A;  2IIM A;  5FW9 A;  1K76 A;  1HD3 A;  1PRL C;  1NYF A;  4Z88 A;  1J3T A;  2JS2 A;  1M3B A;  2KT1 A;  4GLM A;  4CC7 A;  2MIO A;  4J9H A;  2DJQ A;  1B3Q A;  2CUB A;  2YDL A;  1W1F A;  2FPE A;  2LQN A;  4EIK A;  4M4Z A;  1LCK A;  2E5K A;  1NG2 A;  2NUZ A;  3I9Q A;  5IH2 A;  3FJ5 A;  1HJD A;  4HVV A;  2HDA A;  2RNA A;  4HVW A;  2OJ2 A;  1I0C A;  4AFQ C;  2X3X D;  2B86 A;  2DE0 X;  5IHN A;  1CKA A;  1TUC A;  2BZX A;  1X27 A;  2BZY A;  1OPL A;  4D8D A;  2XMF A;  1N5Z A;  2JMC A;  3H0F A;  3EGU A;  3UF4 A;  1PRM C;  1GCQ C;  2LNH B;  1ZX6 A;  1TG0 A;  1MUZ A;  1Z9Z A;  2AK5 A;  2EYX A;  2YUQ A;  1OPK A;  3NHN A;  1NYG A;  5ECA A;  1KJW A;  3EHR A;  4J9C A;  2EQI A;  4HCK A;  1AWO A;  1WDX A;  2KRM A;  2DA9 A;  2DVJ A;  1GBR A;  2GTJ A;  4DEX A;  2JW4 A;  4DEY A;  4OMQ A;  2L2P A;  3TSZ A;  3EHQ A;  2LP5 A;  3TSW A;  4JJD A;  4CC4 B;  2RQT A;  3PVQ A;  4RTW A;  2M0Y A;  2YT6 A;  3UA6 A;  1AD5 A;  1YN8 A;  1M3C A;  1NLO C;  1IO6 A;  1GFC A;  1NEB A;  1UTI A;  2K6D A;  1AEY A;  1JXO A;  4LE9 A;  4F14 A;  1X6G A;  2J06 A;  2L3P A;  4ORZ A;  2EKH A;  2RN8 A;  1AWJ A;  2J05 A;  3U23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...