1QWFA

C-src sh3 domain complexed with ligand vsl12
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE TRANSFORMING PROTEIN SRC
publication title Specific interactions outside the proline-rich core of two classes of Src homology 3 ligands.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Complex (signal transduction/peptide)
total genus 8
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1qwfA00
3REAB 1SRMA 2HEQA 4ORZA 1EFNA 3NGPA 1S1NA 1UGVA 2VVKA 1K4US 2IIMA 1WXBA 3H0IA 3SEMA 2V1QA 1GBRA 4FSSA 2ECZA 1T3LA 1M27C 1YNZA 2RN8A 1PRMC 4OMNA 3U23A 1ZX6A 3TVTA 1UFFA 4J9BA 4LN2A 3C0CA 3EG3A 3I35A 2NUZA 1WXUA 2C0OA 1AWXA 2DILA 2LNHB 3NHNA 1WA7A 1SRLA 4AFSC 2LMJA 1BBZA 2J6KA 1LCKA 2RQRA 4LUDA 1OV3A 1AVZC 4RTWA 2PZ1A 3M0SA 2K2MA 3H0HA 1SEMA 2W0ZA 2PTKA 2LJ1A 1UDLA 1WLPB 2DL4A 2P4RA 2J6OA 1TG0A 2LQWA 2AK5A 2K6DA 1GRIA 1AWOA 1PWTA 2L0AA 2EVRA 2EGCA 2ROTA 1UUEA 4JJBA 2KEAA 1UJ0A 5ECAA 1HD3A 2RMOA 1X43A 4RTYA 2EQIA 2L3QA 4OMPA 2SEMA 4QT7A 3EG1A 1G83A 1VYVA 1GCPA 3UA7A 3LH5A 4GLMA 3H0FA 1OOTA 5IXFA 1E6GA 4DEYA 2LJ0A 2V1RA 2D8JA 1NM7A 4LNPA 4R0KA 1G2BA 3THKA 2EYWA 2EYXA 2CUDA 1H8KA 2EYYA 1U3OA 1OPLA 2L3SA 1WI7A 3FJ5A 2E5KA 1PNJA 3EGUA 4JZ3A 3ULRB 2KRMA 4ZNXA 2A08A 4X1VA 4GBQA 2CH4A 2JT4A 3M0UA 3PVQA 1CKBA 1B3QA 2YDLA 2KXDA 2DMOA 1UHFA 1QLYA 2DM1A 1SPKA 3VS4A 1RLPC 1QCFA 1W6XA 1K76A 4Z89A 1GFCA 2LQNA 3EHRA 3I9QA 5EC7A 3VS1A 1HJDA 2CT4A 2KYMA 2O9SA 4J9IA 2DRMA 2MOXA 2DL7A 1MV0B 1FMKA 2HSPA 1MV3A 2CH4W 1UG1A 1JO8A 1KJWA 1QKXA 2B86A 3M0PA 5I22A 4RTZA 1ZBJA 2M51A 1T0HA 1K0SA 4OMLA 1UE9A 1YN8A 4JJCA 2BZYA 3VRYA 1WFWA 5HCKA 3M0RA 4A63B 4WCIA 1AZEA 1GCQA 1VYTA 1H3HA 1FYNA 2PNIA 1CKAA 4CC7A 1RLQC 1N5ZA 1UHCA 2RNAA 1BU1A 1M30A 2JXBA 4RTUA 1KIKA 2K7AA 1JXOA 2M0YA 1NLOC 4HVUA 2YT6A 3UF4A 5IHKA 2CT3A 2CSIA 1GL5A 5GJWB 1ZUUA 2F2XA 1JEGA 2I0NA 2OAWA 2ED0A 3VS6A 2KT1A 2MCNA 3TSWA 3UATA 2GGRA 3EHQA 2KNBB 2KGTA 2K9GA 4HXJA 2VKNA 2W10A 4RTXA 1E7OA 1PRLC 2HBWA 2XMFA 2LP5A 2GTOA 1X27A 2JM8A 3A98A 1OEBA 1I1JA 2RQTA 4AFUC 1JQQA 1E6HA 2YUOA 3SHWA 2FEIA 1AD5A 2RPNA 2HDAA 4OMMA 2RQWA 4AFZC 2C0TA 1AWJA 1X6GA 2O31A 1Y0MA 3VS7A 2J7IA 1U06A 2DRKA 1YP5A 1AWWA 1OPKA 1JXMA 5IH2A 3KFVA 4F17A 1T3SA 1RUWA 2KROA 4J9EA 4AG1C 1KSWA 2KE9A 1X6BA 4M4ZA 3R6NA 4J9GA 1SHGA 4F14A 2JS0A 2DLPA 2X3WD 1WYXA 2FPEA 1M3CA 1TUCA 4EIKA 1ZUYA 1AEYA 2F2VA 2D0NA 4LE9A 2K79A 2LJ3A 4OMOA 1YWOA 2C0IA 4Y92A 2DX1A 1VA7A 2VWFA 1NEBA 2O88A 2J06A 4Z88A 3PVLA 1UECA 2KXCA 2FPFA 2H8HA 2FRYA 2YSQA 4J9CA 3EG0A 2AZSA 2FG0A 5IHIA 2BZXA 1V1CA 2YUNA 2EGEA 4J9FA 1WIEA 4KRTA 4Z8AA 2DF6A 2JM9A 4J9HA 1QWFA 2LCSA 1U5SA 2EBPA 2DBKA 1PKTA 1M8MA 2DJQA 4IIMA 3VS3A 3REBB 2ABLA 2FPDA 2OI3A 1HSQA 4J9DA 1K9AA 1YCSB 2AKKA 2JMCA 4HVVA 2KR3A 3IQLA 2A37A 1X2QA 4CC3A 4D8DA 2D1XA 1ZLMA 2CREA 2CDTA 2JMAA 4IIOA 4HCKA 1IO6A 1B07A 1ABOA 4HVWA 4RUGA 3VS2A 1QWEA 4RTTA 1AOJA 1VYUA 1K1ZA 5IHNA 2DBMA 4JPBW 2L2PA 1WX6A 2RF0A 2GTJA 4AG2C 2HCKA 2MIOA 1M3BA 3VS5A 1XOVA 1X69A 1I0CA 1SSHA 2GNCA 2YUPA 2GQIA 2QDLA 5GJVB 2DL8A 2K3BA 4OMQA 4CC4B 1UJYA 1TUDA 2L3PA 1WDXA 2AZVA 2KT8A 1T0JA 2G6FX 2RQVA 3ZL7C 1ABQA 1A0NB 3M0TA 1NLPC 1Z9QA 1J3TA 1GBQA 2F2WA 2CSQA 2FO0A 1PKSA 2LZ6B 4JJDA 2D8HA 1QKWA 2DL5A 1BK2A 2BTTA 1SHFA 1YWPA 1Z9ZA 2ED1A 1NG2A 2O9VA 4F16A 2O2OA 5IXBA 3UA6A 3EG2A 2DA9A 4DEXA 5L23A 2EYZA 3VRZA 1H92A 1K0XA 1CSKA 2NWMA 3QWYA 1WXTA 3VS0A 2A28A 2FRWA 4D8KA 1X2KA 3NMZC 3O5ZA 2BZ8A 3I5RA 4LUEA 2EW3A 5I11A 2JS2A 2KYBA 2DYBA 2X3XD 4JZ4A 2DVJA 2ESWA 3PE0A 3NPFA 2EPDA 3JV3A 3M0QA 2CUBA 3TSZA 2DL3A 3I5SA 1I07A 4E6RA 1Y57A 4RTVA 5FW9A 3RBBB 2KBTA 1UTIA 2KRNA 2GBQA 1NYGA 1NYFA 2ROLA 1NEGA 3RNJA 2KRSA 1W1FA 2DE0X 1KFZA 4AFQC 1JU5C 3CQTA 3H41A 2DNUA 1M3AA 3GBQA 1GCQC 2ENMA 2JTEA 2YUQA 2RQUA 2EGAA 2LX7A 2SRCA 1W70A 1ZUKA 1AZGB 4K11A 2A36A 1BB9A 2J05A 5FWCA 2AKLA 2OJ2A 1PHTA 1ARKA 2EKHA 1MUZA 4ESRA 1GFDA 3QWXX 2JW4A 2J6FA 4CC2A 1RI9A 1ZSGA 5FWBA
chains in the Genus database with same CATH superfamily
2QA4T 3REAB 3G1JA 2QTVA 2D0QB 2P0PA 3KBGA 3C12A 1UGVA 2BE9B 2VVKA 1OX8A 1K8AR 3EH2A 1M90U 3H0IA 4R55A 4KH1B 3SEMA 3QSUA 4A4KA 1AHJB 1GBRA 9ATCB 3CCUA 5LJ3d 2EQKA 3P8BB 1YITA 1T3LA 2RN8A 2HQHA 4OP0A 3TVTA 3CMAA 1VIEA 3C0CA 3I35A 2QASA 1WXUA 2C0OA 3VKIA 3CCEQ 3N5BB 3QO3A 2O4XB 1YHQA 1WA7A 1FMWA 1IXDA 1RAFB 1NJIU 4NL3A 2LMJA 3JCMe 3RKWA 1VQNQ 5GAMg 3QXEB 3M0SA 2DEQA 4DA4A 1WZOA 3LX7A 2ZPGB 5GANd 1UDLA 2XDPA 1TG0A 4RMOA 2AK5A 1UUEA 4QVZA 4PJOE 5LJ3h 5ECAA 1I8FA 2RMOA 4RTYA 4WTOB 2X4JA 4OMPA 4C8QA 2SEMA 3L2UA 1G83A 1QVPA 3EG9A 1SKUB 1LPLA 4C92C 2DZ9A 3LH5A 4B9XA 3UWNA 5IXFA 2V1RA 2HNIA 4R0KA 5CKBA 4C0GA 1D1CA 2MAMA 2EYXA 2CUDA 2EYYA 3OA6A 1G3WA 1U3OA 1OPLA 5GANh 2L3SA 1RAAB 1VQKT 3FJ5A 1PNJA 4ZNXA 1N6AA 2CH4A 1F1BB 1Y96A 4FIBA 2K5IA 1QP2A 3MCAB 1D3BB 2PVGB 3CBMA 1UHFA 1C0MA 1QLYA 2DM1A 4D6WA 5AYFA 4M7DE 2RJCA 2RJEA 2LQNA 3VS1A 1OQKA 1VQ5T 2CT4A 3SWNA 3V7CA 1UB4A 2ZPHB 1Q82C 4J9IA 4E7SA 3CMET 1BKBA 2DL7A 2VB6A 1VQOQ 1MV3A 4IUTA 3QYHB 3OYAA 1RL2A 3M0PA 5I22A 3M5AA 1ZBJA 2M51A 2IPOB 3I55Q 1BIAA 2BKDN 4QQ6A 6AT1B 1O75A 1QMCA 1Y71A 1IHVA 5HCKA 1YCYA 3M0RA 4JUVA 4PL6A 2RO0A 2PNIA 1N5ZA 2OTJT 3GP8A 1UHCA 4LD9K 4RTUA 2CS7A 2K7AA 1IGUA 1JXOA 4VUBA 2YT6A 1VQ4Q 1G5VA 1VQ5A 5IHKA 1KG1A 1PSFA 2V8KA 4E7KA 4F7UA 3H8ZA 3CMEA 2D6FA 4BY6C 2F2XA 1JEGA 1XQHA 5LJ5g 1V29B 3CC7A 2MCNA 1JRIA 2L5QA 2E4HA 4OB3B 1E7OA 3OYJA 1QCOA 1PRLC 1XNIA 2HBWA 1Q86R 2RQTA 1TTHB 1D0ZA 3SHWA 5KE2A 3DLMA 1UGSB 3GF5A 1TUGB 3EGDB 1AWJA 5DY9A 5GAOl 1RAIB 5GAMe 3CCJT 1VQ9T 1OPKA 1VQ4T 3KFVA 4F17A 2H3JA 5LJ3f 2KROA 1WHJA 2AHJB 4HT9A 1WQ7A 2DZCA 5D6XA 4F14A 4KGZB 4C8QF 2X3WD 3OYHA 1TOVA 1RAEB 1HXDA 2Z0WA 2K5LA 1YIJQ 1AEYA 1B34B 8ATCB 1VUBA 5HY6A 3V8KA 4OMOA 3ZEHA 2HKQB 3OYFA 1Q7YC 4F7UG 3D7SB 4JLIA 1GXIE 1VQ7Q 4Y91A 2AZSA 2FG0A 1QP3A 3MEUA 5GANf 5FU6C 1V1CA 4IUVA 4J9FA 4ME7A 1VQ9A 5GAOp 4C5HA 1G8XA 1I5LA 4FYWB 3OMCA 2CZ6B 4KULA 2LCSA 2F5KA 1U5SA 2RHIA 2QEXQ 4HKEA 4A4EA 4M78B 2DJQA 3VS3A 3REBB 3MKDA 2EAYA 3VYGA 5KYWA 2OI3A 1HSQA 1M9SA 2KY9A 4HVVA 4XTXA 3LGFA 3CCST 3L2ZA 2CDTA 1VIFA 2JMAA 1B07A 4RUGA 2XIDA 3CPWS 2NUPA 3NTKA 5IHNA 4OMFB 1WX6A 3CCQQ 2HCKA 4OVAA 1XOVA 4ZTFA 1G3SA 3JB9J 5D6YA 3I56Q 4XTYA 1SSHA 1BIBA 2GNCA 1PCXA 3PIPA 4CC4B 1NPRA 1IB8A 1WDXA 1T0JA 2AZVA 2KI7A 2KT8A 1YJ9Q 3CC4Q 2CGHA 4FM4B 4C8QE 1R77A 3J7AF 1M2VA 1GBQA 4C92G 2F2WA 4FW2A 3VUBA 1PKSA 2LZ6B 4JJDA 1QVGS 1QKWA 4C5IA 2JTFA 2BTTA 2LCCA 1SHFA 1YWPA 5GAN2 2ED1A 4OGEA 2EQMA 3QG1A 2F1LA 3UA6A 5HK0A 2DA9A 3GNGA 5LJ5e 2EYZA 5GMKj 4JJNK 3OBWA 3EH1A 5DLOA 2NWMA 3QWYA 2A28A 2FRWA 3X24B 1MNDA 3P8HA 3OYCA 2E65A 4C0ZA 4M7AB 3DKMA 1X2KA 2KAFA 5CKHA 4A4GA 3LWHA 4M78F 2BE7D 5KH6A 3OYKA 1WHLA 2BIVA 3I5RA 1NZ9A 4E7ZA 5I11A 4JRKA 2JS2A 2GFUA 2RD1A 2LVMA 2ZPIB 3RKXA 2B8AA 4TVRA 2PUKB 1NJIR 3BFMA 3CC4T 4PJOD 4XQ3A 4J83A 4M77D 3FIFA 2AT1B 1RABB 4XTVA 2EWNA 4PJLA 1KD1R 2KVQG 4ELZC 3OS0A 3RBBB 3CCMA 2XKOC 1UTIA 3QUIA 5CK9A 2R57A 3A8OB 1NEGA 4C5GA 2KRSA 5J39A 1M1KR 4AFQC 3G4SQ 3EFOA 1VQ6A 2DNUA 1GCQC 2YUQA 2CP7A 1ZUKA 2FZCB 1BB9A 5FWCA 2AKLA 2EFIA 1VQ8T 1XTDA 1GRIA 1RI9A 2VV5A 2HEQA 4ORZA 1SF9A 4E7LA 3OYBA 4ZTJA 1EFNA 2XI9A 3PT9A 2DXBA 1MMAA 3SB2A 2DXTA 4M7DD 4FSSA 2VXEA 4PJOG 5FU7C 1UGPB 4M7AF 1PRMC 1ZX6A 1UFFA 4LN2A 3M4YA 2NUZA 1AWXA 4C8QC 2LNHB 4CI0C 2ZAEA 3S6WA 3OY9A 2XK0A 2E1HA 2VUBA 2RQRA 2RK1A 4M77B 1OV3A 4RTWA 1BYMA 3H0HA 2PTKA 1QVFP 1VQPA 3INZA 1D0XA 2DL4A 3JCMb 2P4RA 4M75B 4ANJA 2ROTA 2EVRA 4JJBA 4FL6A 1W2BP 2PVOB 1HD3A 1LOJA 1KC8U 1QQJA 4QT7A 1YITQ 1VQLT 4XTUA 1IGQA 2E12A 2EJGA 2K2VA 1GCPA 5GAN5 2QDYB 1OOTA 1E6GA 3SWNC 3UPUA 3OQ5A 5IT9E 2NLUA 1K8AC 1KHIA 2P0QA 2O4XA 1YHQQ 1OZ3A 2FL7A 3G71Q 2CP3A 2CZ0B 4PLLA 1WI7A 3X20B 4M7DB 3EGUA 4JZ3A 3OMGA 2HAXA 2KRMA 3CCVA 4BDZA 4GBQA 2JT4A 2HSEB 1K9MR 4L5GA 1B3QA 4DBQA 2MWPA 4O5VA 2KSSA 3J81E 1PG5B 3VS4A 1QCFA 1Y07A 3JCMc 5KYUB 1R0CB 5CIUA 1GFCA 1V76A 1HJDA 1Y7XA 2OTLT 3JB9F 1C6VX 2MMPA 3HRUA 2KYMA 2O9SA 2K5FA 4J7FA 2MOXA 3M57A 2YLCA 1MV0B 1FMKA 2EQJA 4FT2A 3SFMA 4C0FA 2DTHA 2CH4W 3QZ9B 1QKXA 4M75F 5GMKl 4RTZA 2DJZA 4MZPA 2JN0A 1S72T 1K0SA 4OMLA 5KE3A 1YN8A 3PGGA 4ZGEB 1GCQA 2Y4XA 1VQMT 2COZA 3L2VA 4CC7A 1D1BA 3A8LB 4X9CA 2WSCE 4HVUA 3UF4A 4AMCA 2OTLA 2CSIA 1D3BA 2XDDA 1ZUUA 3MHXA 2QA4A 3R6OA 5M9OA 4FYYB 2JOYA 2KT1A 2RHXA 2Y4YA 1QVFA 1KD1U 1JB0E 2GGRA 2QG9B 2H3EB 2RI5A 2KGTA 4HXJA 2K9GA 2RHZA 3C94A 2VKNA 3G6ET 3OYDA 2XMFA 3BW1A 2GTOA 2OAUA 1M1KU 2DO3A 2EJFA 4QQDA 2JM8A 1WHMA 1I5OB 1W2BA 1NPPA 2YUOA 4ZN1A 3OW2S 2FEIA 1M1GA 5KCHA 5KYXB 3JCMP 5KYYA 3FC3A 2DD4A 3WXMB 4YTLA 2C0TA 1X6GA 2O31A 2DIGA 2XHCA 2ATCB 1M4ZA 1WHGA 3CCET 1JXMA 4FYVB 5IH2A 3HFNA 1G3TA 1X6BA 3TCJA 2LCLA 3R6NA 1DJ7B 1VQNT 1YJNQ 1Q81C 2JS0A 4A4HA 1ZUYA 4EMGA 4M7AC 2F2VA 2R58A 2CP0A 2X4WA 2K79A 4Y28E 3Q1JA 3MEWA 1X01A 4X9DA 1VA7A 4IKFA 5LJ3j 1NEBA 3DB3A 4Z88A 3V8JA 1UECA 1XJWB 2VC8A 2FHDA 3FRNA 5KCOA 2EGEA 4PFPA 3S3NA 5GAMd 3EGDA 1WPYA 1QWFA 2RHYA 3JRZA 2WSEE 4BACA 1VQKA 2EBPA 1Q86C 3TQ7P 1M8MA 1Q95G 1TWBA 2F5TX 1K9AA 4C8QG 4GY5A 3QPHA 2VASA 3V7SA 2MK5A 4CC3A 5GANj 2D1XA 2YRDA 4OB0B 4HCKA 4NS5A 1IO6A 3VUZA 3JCMf 3DLLA 1N8RC 1QWEA 4RTTA 1VYUA 4DOWA 4XK8E 1B34A 2DBMA 2JJ9A 4JPBW 2RF0A 2DTIA 4AG2C 3VS5A 5GAMh 1X69A 5LL6S 3LH0A 4JRPA 2M16A 2YUPA 3OS1A 2GQIA 2QDLA 2K3BA 3M58A 4MMLA 4FU6A 2L3PA 3HRTA 3CBPA 1VQOT 3M0TA 1A0NB 3M53A 4PJJA 1K9MU 4N0AA 2CSQA 4M78A 5FLXE 2RB6A 3I55T 2FO0A 1KQ2A 2OTJA 4C0DC 1O9SA 2VYTA 4BI3A 5A0GA 1Q82R 3PMIA 1G3YA 2DL5A 3MJXA 5GAOm 2FZKB 1NG2A 4F16A 1IHWA 2LT4A 3EG2A 4EMKB 4OB2B 5CCAA 1K0XA 2LDMA 1WXTA 1H641 4M75C 1WJRA 2R5MA 2NUTA 4RCCA 4ZGDB 2CYZB 2CP6A 2RM4A 4NL2A 2BZ8A 4LUEA 2KYBA 2DYBA 3QJYA 1N9SA 2DVJA 2O01E 4LD6A 4FSXA 3OYYA 2DYIA 3PE0A 3NPFA 2RK2A 1BI0A 2QI2A 2E10A 4FW1A 2CUBA 3VJPA 4J5YA 3I5SA 4E6RA 2LT1A 4R56A 4LXCA 3CD6Q 1Y57A 3CCLQ 4PJNA 4IUUA 1FX7A 1MMNA 4QQGA 2HL3A 2GBQA 4E7JA 3HPWA 2V8JA 1TS9A 2ROLA 3RNJA 1ZQ1A 3CCJA 4HCCA 2K4YA 4JDSA 3URGA 1VQ4A 5LJ5d 5HK3A 3GBQA 2ENMA 2JTEA 2GF7A 2LX7A 4IUPA 4C92D 4F7UB 1RAHB 2MF2A 3CPWP 1ZSZB 2GQVA 3JB9I 2ZCFB 2JVVA 2A36A 4K11A 1KC8R 1PHTA 2COYA 1ARKA 3JCMV 4DOVA 1D09B 3E19A 4DQ2A 4M7AA 4BI4A 4ESRA 2EKOA 3QWXX 4KH0B 2RJDA 2J6FA 4KUIA 1ZSGA 5FWBA 3UATA 2LX9A 1YI2Q 1EZZB 5KYNA 5CQYA 1M90C 1S1NA 3L1AA 3PMTA 2IIMA 3X25B 4E7HA 1YIJT 3META 3M4GA 3A8HB 5I21A 2VGMA 4ELYC 5GAN7 2A0FB 4HCBA 1M27C 3CD6T 5LJ5h 3CCLT 1YNZA 2C06A 1QVGP 4OMNA 3U23A 1X6OA 1VQ7T 4J9BA 4HT8A 4QW2A 1NJIC 1VQ6Q 3PIOA 3GNFB 3CCSA 2QEXT 1AVZC 4XU2A 4PJMA 2PZ1A 1TU0B 2K2MA 4DBRA 1SEMA 2CP2A 4O6JA 5GAMf 4A4FA 1M1KC 1WLPB 3EGXA 2G3RA 2YRVA 1JJ2S 1YBYA 2MWOA 4IURA 3BE3A 2EGCA 3KXTA 1YI2T 1MHNA 1UJ0A 2QYZA 4C92B 1QW1A 3JCMX 1VQ7A 5FRNA 2EQIA 5GMKe 3MEVA 3QZ5B 3CCRQ 3EG1A 3CCQT 1VOMA 4JLGA 1VYVA 4DBFA 2E6NA 3I56T 3UA7A 5J26A 4GLMA 1BI2A 2D8JA 1G2BA 2X4XA 1YJ9T 2QQSA 2E3HA 4OGCA 1H8KA 2XD0A 3RIRA 3UDCA 2YRCA 4M77A 1PC0A 2A08A 1QCNA 1HYOA 1VQPQ 3M0UA 4KT0E 4M75A 1CKBA 4MDWA 1EIFA 3CPWA 1YJWQ 2DIQA 4J7IA 3CXCP 2R5AA 1SPKA 1PM3A 1RLPC 4PNOA 4LDVA 3I56A 1W6XA 4Z89A 2CP5A 3EHRA 3I9QA 5EC7A 5DM7R 2X4YA 4II1A 3AT1B 3CCRT 2DRMA 3OYIA 2LC4A 2GFAA 1RADB 1Q82U 3CC4A 2HSPA 3CC2Q 4BI8B 2FZGB 2M02A 3O8VA 1JO8A 1KJWA 1RAGB 1M2VB 2WACA 3QDFA 3CXCS 4GLKA 1TH7A 1HK9A 2EQUA 3BDUA 1UE9A 2DAQA 3VRYA 1WFWA 2YLBA 4WCIA 3V8LA 1BI1A 1QVGA 1VYTA 1H3HA 3H9NA 2DD5A 1RLQC 4BY6B 3CCVQ 2RNAA 1BU1A 1M30A 4M78E 2M0YA 1NLOC 3G4ST 3HHTB 2CT3A 1VQ8A 1GL5A 3AHUA 5GJWB 4PJOB 3M55A 5KYUA 2OAWA 2ED0A 2DK3A 3VS6A 2JUFA 3EHQA 4J6YA 3NTHA 1NE8A 2WSFE 3M54A 5LJ5f 4RTXA 4IUQA 1K9MC 3FDRA 4B6MA 5L8RE 4MZMA 1OEBA 2PUOB 1I1JA 3TU4K 4AFUC 4MDXA 3MPUB 4LDWA 1E6HA 4XAXB 3RMQA 2HD0A 1K73R 3CCUQ 3ME9A 3GOXA 3G4SA 2RPNA 3EFOB 3HKSA 3OYMA 4P5NA 4OMMA 2RQWA 4AFZC 2KDSA 3VS7A 3CMAQ 2K57A 2J7IA 5LJ3g 1U06A 2DRKA 1MNEA 2L8DA 3JCMd 1AWWA 2XG8D 1T3SA 4J9EA 3A8MB 4J8OA 1LNXA 3WVDB 1MGQA 2L3RA 2QA4Q 4EMKC 3RUXA 2EIFA 4MZTA 1OULA 2CZ7B 2FPEA 1M3CA 1TUCA 2RJFA 2CZ1B 4KGVB 3M56A 4M7AE 3CXCA 2LJ3A 1YWOA 2C0IA 4Y92A 1WNLA 3OSVA 5GANg 1VQLA 1KHCA 2FPFA 2FRYA 2M1HA 2ZGWA 2YSQA 1P92A 4PJOF 2E64A 2VXFA 4PFZA 2BZXA 4M77F 5KYXA 2E6ZA 4BE2A 3JCMh 1YITT 5GMKm 4F04B 2DF6A 2JM9A 4L6V5 4J9HA 1OZ2A 1IRXA 3CMAT 5GAN6 3BDLA 2ZPFB 2LQ8A 1BI3A 2QAZA 1KQSP 4IIMA 3OS5A 2ABLA 2FPDA 3G7ZA 1YHQT 2AKKA 2JMCA 3G71T 3MP1A 2A37A 1X2QA 4X34A 2CREA 1ZSZC 2RI2A 1M2OA 4N0AC 3VV0A 4M78C 4HVWA 3VS2A 1M5Q1 2RI3A 2XDBA 1AOJA 1K1ZA 1KQSS 2L2PA 1OI1A 2MIOA 1M3BA 5AT1B 3OW2P 1I0CA 2HQXA 3VYHB 4M7DF 2DL8A 4B9WA 1TUDA 1S72A 2DXUA 4PFOA 2L89A 3F70A 4ZGJB 4ZN3A 1ABQA 2BUDA 3PFSA 3G71A 1J3TA 1VQMA 1VQKQ 3BY7A 3J80E 2HKNA 1PD0A 2D8HA 4JRIA 4QKUA 3M59A 1MMGA 4BD3A 3OYGA 4J6XA 4UC4A 5IXBA 2XU8A 4JRQA 3JAME 4AT1B 4M77E 4V2SA 5L23A 3VRZA 2I2LA 3QBYA 3SD4A 2P0KA 2LTOA 1VQ5Q 3VS0A 4C8QD 3OYEA 1WJSA 3NMZC 3G6EA 3CMEQ 4RG8A 4M75E 3O5ZA 1IZ6A 3QYGB 4OB1B 1H3ZA 3JCMW 3CC7Q 2X3XD 4JZ4A 2ESWA 3E9GA 3QHSA 2RA2A 4PK4A 2EPDA 3UT1A 3JV3A 3M0QA 2IG0A 2CKKA 2ZPEB 3HRSA 1I07A 3RERA 3EFRA 3X28B 2DTOA 3JSCA 3A8GB 4RTVA 1AT1B 1X75C 3E2UA 3C4SA 2KBTA 5C6SA 2E70A 2OTJQ 5LJ3e 1NYGA 3JCMQ 1NYFA 2DE0X 2D9TA 1KFZA 3CCEA 1JU5C 2HZYA 3CQTA 4OF1A 3LGLA 4BDYA 3ASKA 1M3AA 4CRIA 3HP9A 2F69A 2SRCA 1OYXA 3HL8A 2DXCA 1KQSA 4EMKA 1VQNA 2V8IA 2J05A 4QVDA 2EKHA 1OU8A 1TXQA 3QDRB 3MEAA 3JCMJ 2JW4A 1JBMA 1K73U 8AT1B 1YJNT 1SRMA 3LWIA 3CC7T 5FU7B 5GANe 2QGFB 3NGPA 1K4US 1I4K1 1WXBA 5IN1A 5GAN4 3L42A 2ZPBB 2JZ2A 2V1QA 1EX4A 2A3LA 4C8QB 3OSSC 3OW2A 1M8VA 5KYYB 2ECZA 3EG9B 1Q81R 4Q5WA 3L2RA 3EG3A 5DLQE 3X26B 3CCJQ 1VQ9Q 3NTIA 2DILA 1WHKA 3NHNA 2M0OA 1SRLA 2QXFA 4AFSC 1BBZA 1ACMB 5CO7A 2J6KA 1LCKA 1ZSZA 4LUDA 1YJNA 4DBHA 2X9HA 5I2SA 2W0ZA 3EAEA 4RG2A 1WJQA 2LJ1A 1Y96B 4N4IA 2J6OA 2LQWA 4PJOC 4BUGA 2YWWA 2K6DA 1AWOA 5J3BA 4M77C 1PWTA 2L0AA 3JB9H 1YFNA 2KEAA 4M78D 3TEEA 4LDYA 1KC8C 1X43A 3SWNB 2L3QA 3RR6A 3E1SA 3S3OA 2DKGA 1VQOA 5GAMj 2EJ9A 5D7UA 1N8RR 1D1AA 3EFSA 3H0FA 2M9UA 1ZA2B 3FJPA 5CKDA 4DEYA 3I55A 2LJ0A 2MYSA 1NM7A 4LNPA 3THKA 2EYWA 1TSFA 1K8AU 4FCYA 1D0YA 3CCSQ 2Y90A 1FWZA 2E5KA 3ULRB 4FYXB 3RMSA 2P4TA 4X1VA 4XU0A 3OYLA 3V7RA 4EDUA 3PVQA 4N4HA 3LW5E 3QJ6A 2YDLA 3CEYA 2KXDA 4M7DC 2DMOA 3LYIA 2HL5C 4N4GA 4C92A 2YXYA 3OBYA 2DERA 1K76A 4M78G 1SSFA 4BB7A 2PQWA 4J6WA 2P84A 4Z02A 3S3MA 3C95A 1UG1A 2B86A 5C0MA 1U8RA 5GMKi 4M7AD 1T0HA 1WHHA 5CR2A 1U1TA 4A53A 3MO8A 2QQAA 4JJCA 2BZYA 4A63B 4HCZA 3HFOA 1AZEA 4JS4A 1UEBA 1FYNA 1MMDA 2A7YA 3PNWC 1BCOA 3ZFJA 4QVCA 2DETA 1CKAA 3CCMQ 5GAOr 1C1AA 1RACB 2JTMA 5GMKh 2JXBA 1KIKA 2QQRA 3M9QA 1JJ2P 3SDZA 3H6ZA 3PTAA 1Q7YR 3T9NA 2JNGA 5GAOq 2NUTB 3LLRA 5GAN3 2GCXA 1KD1C 4XU3A 3DB4A 2I0NA 2PU9B 3QIIA 3TSWA 5CKEA 3GLXA 2KK4A 2KNBB 1LVKA 5A0DA 5IAYA 1YIJA 2W10A 1KQ1A 4RKUE 2MI6A 2LP5A 7AT1B 1X27A 1B7TA 1OU9A 3A98A 1SG5A 3NFCA 5D6WA 4LDUA 3CD6A 2DFUA 3CCLA 2K3XA 1JQQA 4F7UF 1AD5A 2LQKA 2RHUA 2XICA 4M7AG 2RH2A 2HDAA 3RDVA 5LJ5j 3MP8A 3ZBDA 3CCMT 1Y0MA 1M90R 1RI0A 2QK0A 4XU1A 3RESA 2QEXA 1YP5A 5KYWB 1VQ6T 1I81A 1RUWA 1VQ8Q 2DPPB 4AG1C 1KSWA 4HA8A 2KE9A 4M4ZA 3HTRA 4PJOA 1PD1A 4J9GA 1SHGA 2QQBA 4MMKA 2DEUA 2DLPA 1YI2A 3L2QA 1N9RA 4EPCA 1KK7A 1WYXA 5FRMA 4EIKA 1Q81U 2NUPB 4KGXB 3WVEB 1IREB 2D0NA 4LE9A 3ER0A 3JB9D 2FYKA 2QQ9A 2VGNA 2DX1A 3CCQA 3OS2A 3CPFA 2VWFA 5EG2A 2O88A 2J06A 3OYNA 3PVLA 3A1PA 2KXCA 2H8HA 4J9CA 1BCMA 2QTXA 3EG0A 2HBPA 4PKCC 5IHIA 2YUNA 1WIEA 4M75D 1ZBXA 1R8OB 3A5ZB 1YJ9A 4KRTA 4Z8AA 4XTWA 3CBOA 5FROA 2DBKA 3QKJA 1PKTA 2MPXC 3GPLA 4L59A 1Q86U 4J9DA 4C92F 1WQWA 1YCSB 3E9FA 1K73C 2FB7A 2KR3A 3IQLA 5GAOn 3JCMg 2X51A 2LRQA 3EGXB 2HQEA 4D8DA 4M7DA 1ZLMA 5A2QE 4IIOA 2X35A 4F7UE 1ABOA 2IVWA 5CAIA 1JJ2A 1VQPT 4E2FB 1N8RU 3CCRA 1YJWT 2E5QA 2GTJA 2PVDB 3JB9G 1VQLQ 1LJOA 4M77G 5GAN8 2EYQA 3RKYA 2KMTA 2V26A 3KUFA 5GJVB 2KQWA 1FXXA 4C0DB 4OMQA 3TREA 1UJYA 4M75G 2G6FX 1PSEA 4LDXA 3VU3C 2RQVA 2YHTA 3ZL7C 4PLIA 4C5EA 1NLPC 1Z9QA 3FEOA 5CQXA 2ZZDA 4ATOA 3CC2T 1UGRB 2FVUA 1ZHIA 2OX7A 2HMAA 1BK2A 4XTZA 5HKCA 1U1SA 1Z9ZA 2O9VA 2O2OA 1YJWA 4EMHA 4BE1A 4DEXA 4KBMB 4NOYA 2K3YA 3CCVT 1H92A 5CVIA 1CSKA 4JS5A 2OTLQ 4D8KA 2NYSA 1QVFS 4FT4A 4M7DG 2E3IA 2DVEA 2EW3A 5I2MA 3CC2A 3FB9A 4A54A 5A0LA 1NBEB 4C92E 5FU6B 1S72Q 4KUDK 1N27A 3TSZA 1W2BS 2DL3A 3L2WA 3HSBA 5CKFA 1VQMQ 1ZA1B 3MP6A 1Q7YU 5FW9A 4BE0A 3GIBA 2KRNA 3P8DA 2LNVA 1W1FA 3CCUT 1W4SA 4RCBA 2COWA 3H41A 4E47A 2RQUA 2EGAA 1W70A 1WGSA 1AZGB 4WF2A 1R0BG 4E7IA 2OJ2A 3FLGA 3OB9A 1MUZA 2AIRB 1GFDA 1OX9A 3G6EQ 2QGGA 1UGQB 1FMVA 2E41A 1M1FA 4CC2A
chains in the Genus database with same CATH topology
3REAB 1SRMA 2HEQA 4ORZA 1EFNA 3NGPA 1S1NA 1UGVA 2VVKA 1K4US 2IIMA 1WXBA 3H0IA 3SEMA 2V1QA 1GBRA 4FSSA 2ECZA 1T3LA 1M27C 1YNZA 2RN8A 1PRMC 4OMNA 3U23A 1ZX6A 3TVTA 1UFFA 4J9BA 4LN2A 3C0CA 3EG3A 3I35A 2NUZA 1WXUA 2C0OA 1AWXA 2DILA 2LNHB 3NHNA 1WA7A 1SRLA 4AFSC 2LMJA 1BBZA 2J6KA 1LCKA 2RQRA 4LUDA 1OV3A 1AVZC 4RTWA 2PZ1A 3M0SA 2K2MA 3H0HA 1SEMA 2W0ZA 2PTKA 2LJ1A 1UDLA 1WLPB 2DL4A 2P4RA 2J6OA 1TG0A 2LQWA 2AK5A 2K6DA 1GRIA 1AWOA 1PWTA 2L0AA 2EVRA 2EGCA 2ROTA 1UUEA 4JJBA 2KEAA 1UJ0A 5ECAA 1HD3A 2RMOA 1X43A 4RTYA 2EQIA 2L3QA 4OMPA 2SEMA 4QT7A 3EG1A 1G83A 1VYVA 1GCPA 3UA7A 3LH5A 4GLMA 3H0FA 1OOTA 5IXFA 1E6GA 4DEYA 2LJ0A 2V1RA 2D8JA 1NM7A 4LNPA 4R0KA 1G2BA 3THKA 2EYWA 2EYXA 2CUDA 1H8KA 2EYYA 1U3OA 1OPLA 2L3SA 1WI7A 3FJ5A 2E5KA 1PNJA 3EGUA 4JZ3A 3ULRB 2KRMA 4ZNXA 2A08A 4X1VA 4GBQA 2CH4A 2JT4A 3M0UA 3PVQA 1CKBA 1B3QA 2YDLA 2KXDA 2DMOA 1UHFA 1QLYA 2DM1A 1SPKA 3VS4A 1RLPC 1QCFA 1W6XA 1K76A 4Z89A 1GFCA 2LQNA 3EHRA 3I9QA 5EC7A 3VS1A 1HJDA 2CT4A 2KYMA 2O9SA 4J9IA 2DRMA 2MOXA 2DL7A 1MV0B 1FMKA 2HSPA 1MV3A 2CH4W 1UG1A 1JO8A 1KJWA 1QKXA 2B86A 3M0PA 5I22A 4RTZA 1ZBJA 2M51A 1T0HA 1K0SA 4OMLA 1UE9A 1YN8A 4JJCA 2BZYA 3VRYA 1WFWA 5HCKA 3M0RA 4A63B 4WCIA 1AZEA 1GCQA 1VYTA 1H3HA 1FYNA 2PNIA 1CKAA 4CC7A 1RLQC 1N5ZA 1UHCA 2RNAA 1BU1A 1M30A 2JXBA 4RTUA 1KIKA 2K7AA 1JXOA 2M0YA 1NLOC 4HVUA 2YT6A 3UF4A 5IHKA 2CT3A 2CSIA 1GL5A 5GJWB 1ZUUA 2F2XA 1JEGA 2I0NA 2OAWA 2ED0A 3VS6A 2KT1A 2MCNA 3TSWA 3UATA 2GGRA 3EHQA 2KNBB 2KGTA 2K9GA 4HXJA 2VKNA 2W10A 4RTXA 1E7OA 1PRLC 2HBWA 2XMFA 2LP5A 2GTOA 1X27A 2JM8A 3A98A 1OEBA 1I1JA 2RQTA 4AFUC 1JQQA 1E6HA 2YUOA 3SHWA 2FEIA 1AD5A 2RPNA 2HDAA 4OMMA 2RQWA 4AFZC 2C0TA 1AWJA 1X6GA 2O31A 1Y0MA 3VS7A 2J7IA 1U06A 2DRKA 1YP5A 1AWWA 1OPKA 1JXMA 5IH2A 3KFVA 4F17A 1T3SA 1RUWA 2KROA 4J9EA 4AG1C 1KSWA 2KE9A 1X6BA 4M4ZA 3R6NA 4J9GA 1SHGA 4F14A 2JS0A 2DLPA 2X3WD 1WYXA 2FPEA 1M3CA 1TUCA 4EIKA 1ZUYA 1AEYA 2F2VA 2D0NA 4LE9A 2K79A 2LJ3A 4OMOA 1YWOA 2C0IA 4Y92A 2DX1A 1VA7A 2VWFA 1NEBA 2O88A 2J06A 4Z88A 3PVLA 1UECA 2KXCA 2FPFA 2H8HA 2FRYA 2YSQA 4J9CA 3EG0A 2AZSA 2FG0A 5IHIA 2BZXA 1V1CA 2YUNA 2EGEA 4J9FA 1WIEA 4KRTA 4Z8AA 2DF6A 2JM9A 4J9HA 1QWFA 2LCSA 1U5SA 2EBPA 2DBKA 1PKTA 1M8MA 2DJQA 4IIMA 3VS3A 3REBB 2ABLA 2FPDA 2OI3A 1HSQA 4J9DA 1K9AA 1YCSB 2AKKA 2JMCA 4HVVA 2KR3A 3IQLA 2A37A 1X2QA 4CC3A 4D8DA 2D1XA 1ZLMA 2CREA 2CDTA 2JMAA 4IIOA 4HCKA 1IO6A 1B07A 1ABOA 4HVWA 4RUGA 3VS2A 1QWEA 4RTTA 1AOJA 1VYUA 1K1ZA 5IHNA 2DBMA 4JPBW 2L2PA 1WX6A 2RF0A 2GTJA 4AG2C 2HCKA 2MIOA 1M3BA 3VS5A 1XOVA 1X69A 1I0CA 1SSHA 2GNCA 2YUPA 2GQIA 2QDLA 5GJVB 2DL8A 2K3BA 4OMQA 4CC4B 1UJYA 1TUDA 2L3PA 1WDXA 2AZVA 2KT8A 1T0JA 2G6FX 2RQVA 3ZL7C 1ABQA 1A0NB 3M0TA 1NLPC 1Z9QA 1J3TA 1GBQA 2F2WA 2CSQA 2FO0A 1PKSA 2LZ6B 4JJDA 2D8HA 1QKWA 2DL5A 1BK2A 2BTTA 1SHFA 1YWPA 1Z9ZA 2ED1A 1NG2A 2O9VA 4F16A 2O2OA 5IXBA 3UA6A 3EG2A 2DA9A 4DEXA 5L23A 2EYZA 3VRZA 1H92A 1K0XA 1CSKA 2NWMA 3QWYA 1WXTA 3VS0A 2A28A 2FRWA 4D8KA 1X2KA 3NMZC 3O5ZA 2BZ8A 3I5RA 4LUEA 2EW3A 5I11A 2JS2A 2KYBA 2DYBA 2X3XD 4JZ4A 2DVJA 2ESWA 3PE0A 3NPFA 2EPDA 3JV3A 3M0QA 2CUBA 3TSZA 2DL3A 3I5SA 1I07A 4E6RA 1Y57A 4RTVA 5FW9A 3RBBB 2KBTA 1UTIA 2KRNA 2GBQA 1NYGA 1NYFA 2ROLA 1NEGA 3RNJA 2KRSA 1W1FA 2DE0X 1KFZA 4AFQC 1JU5C 3CQTA 3H41A 2DNUA 1M3AA 3GBQA 1GCQC 2ENMA 2JTEA 2YUQA 2RQUA 2EGAA 2LX7A 2SRCA 1W70A 1ZUKA 1AZGB 4K11A 2A36A 1BB9A 2J05A 5FWCA 2AKLA 2OJ2A 1PHTA 1ARKA 2EKHA 1MUZA 4ESRA 1GFDA 3QWXX 2JW4A 2J6FA 4CC2A 1RI9A 1ZSGA 5FWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REA B;  1SRM A;  2HEQ A;  4ORZ A;  1EFN A;  3NGP A;  1S1N A;  1UGV A;  2VVK A;  1K4U S;  2IIM A;  1WXB A;  3H0I A;  3SEM A;  2V1Q A;  1GBR A;  4FSS A;  2ECZ A;  1T3L A;  1M27 C;  1YNZ A;  2RN8 A;  1PRM C;  4OMN A;  3U23 A;  1ZX6 A;  3TVT A;  1UFF A;  4J9B A;  4LN2 A;  3C0C A;  3EG3 A;  3I35 A;  2NUZ A;  1WXU A;  2C0O A;  1AWX A;  2DIL A;  2LNH B;  3NHN A;  1WA7 A;  1SRL A;  4AFS C;  2LMJ A;  1BBZ A;  2J6K A;  1LCK A;  2RQR A;  4LUD A;  1OV3 A;  1AVZ C;  4RTW A;  2PZ1 A;  3M0S A;  2K2M A;  3H0H A;  1SEM A;  2W0Z A;  2PTK A;  2LJ1 A;  1UDL A;  1WLP B;  2DL4 A;  2P4R A;  2J6O A;  1TG0 A;  2LQW A;  2AK5 A;  2K6D A;  1GRI A;  1AWO A;  1PWT A;  2L0A A;  2EVR A;  2EGC A;  2ROT A;  1UUE A;  4JJB A;  2KEA A;  1UJ0 A;  5ECA A;  1HD3 A;  2RMO A;  1X43 A;  4RTY A;  2EQI A;  2L3Q A;  4OMP A;  2SEM A;  4QT7 A;  3EG1 A;  1G83 A;  1VYV A;  1GCP A;  3UA7 A;  3LH5 A;  4GLM A;  3H0F A;  1OOT A;  5IXF A;  1E6G A;  4DEY A;  2LJ0 A;  2V1R A;  2D8J A;  1NM7 A;  4LNP A;  4R0K A;  1G2B A;  3THK A;  2EYW A;  2EYX A;  2CUD A;  1H8K A;  2EYY A;  1U3O A;  1OPL A;  2L3S A;  1WI7 A;  3FJ5 A;  2E5K A;  1PNJ A;  3EGU A;  4JZ3 A;  3ULR B;  2KRM A;  4ZNX A;  2A08 A;  4X1V A;  4GBQ A;  2CH4 A;  2JT4 A;  3M0U A;  3PVQ A;  1CKB A;  1B3Q A;  2YDL A;  2KXD A;  2DMO A;  1UHF A;  1QLY A;  2DM1 A;  1SPK A;  3VS4 A;  1RLP C;  1QCF A;  1W6X A;  1K76 A;  4Z89 A;  1GFC A;  2LQN A;  3EHR A;  3I9Q A;  5EC7 A;  3VS1 A;  1HJD A;  2CT4 A;  2KYM A;  2O9S A;  4J9I A;  2DRM A;  2MOX A;  2DL7 A;  1MV0 B;  1FMK A;  2HSP A;  1MV3 A;  2CH4 W;  1UG1 A;  1JO8 A;  1KJW A;  1QKX A;  2B86 A;  3M0P A;  5I22 A;  4RTZ A;  1ZBJ A;  2M51 A;  1T0H A;  1K0S A;  4OML A;  1UE9 A;  1YN8 A;  4JJC A;  2BZY A;  3VRY A;  1WFW A;  5HCK A;  3M0R A;  4A63 B;  4WCI A;  1AZE A;  1GCQ A;  1VYT A;  1H3H A;  1FYN A;  2PNI A;  1CKA A;  4CC7 A;  1RLQ C;  1N5Z A;  1UHC A;  2RNA A;  1BU1 A;  1M30 A;  2JXB A;  4RTU A;  1KIK A;  2K7A A;  1JXO A;  2M0Y A;  1NLO C;  4HVU A;  2YT6 A;  3UF4 A;  5IHK A;  2CT3 A;  2CSI A;  1GL5 A;  5GJW B;  1ZUU A;  2F2X A;  1JEG A;  2I0N A;  2OAW A;  2ED0 A;  3VS6 A;  2KT1 A;  2MCN A;  3TSW A;  3UAT A;  2GGR A;  3EHQ A;  2KNB B;  2KGT A;  2K9G A;  4HXJ A;  2VKN A;  2W10 A;  4RTX A;  1E7O A;  1PRL C;  2HBW A;  2XMF A;  2LP5 A;  2GTO A;  1X27 A;  2JM8 A;  3A98 A;  1OEB A;  1I1J A;  2RQT A;  4AFU C;  1JQQ A;  1E6H A;  2YUO A;  3SHW A;  2FEI A;  1AD5 A;  2RPN A;  2HDA A;  4OMM A;  2RQW A;  4AFZ C;  2C0T A;  1AWJ A;  1X6G A;  2O31 A;  1Y0M A;  3VS7 A;  2J7I A;  1U06 A;  2DRK A;  1YP5 A;  1AWW A;  1OPK A;  1JXM A;  5IH2 A;  3KFV A;  4F17 A;  1T3S A;  1RUW A;  2KRO A;  4J9E A;  4AG1 C;  1KSW A;  2KE9 A;  1X6B A;  4M4Z A;  3R6N A;  4J9G A;  1SHG A;  4F14 A;  2JS0 A;  2DLP A;  2X3W D;  1WYX A;  2FPE A;  1M3C A;  1TUC A;  4EIK A;  1ZUY A;  1AEY A;  2F2V A;  2D0N A;  4LE9 A;  2K79 A;  2LJ3 A;  4OMO A;  1YWO A;  2C0I A;  4Y92 A;  2DX1 A;  1VA7 A;  2VWF A;  1NEB A;  2O88 A;  2J06 A;  4Z88 A;  3PVL A;  1UEC A;  2KXC A;  2FPF A;  2H8H A;  2FRY A;  2YSQ A;  4J9C A;  3EG0 A;  2AZS A;  2FG0 A;  5IHI A;  2BZX A;  1V1C A;  2YUN A;  2EGE A;  4J9F A;  1WIE A;  4KRT A;  4Z8A A;  2DF6 A;  2JM9 A;  4J9H A;  1QWF A;  2LCS A;  1U5S A;  2EBP A;  2DBK A;  1PKT A;  1M8M A;  2DJQ A;  4IIM A;  3VS3 A;  3REB B;  2ABL A;  2FPD A;  2OI3 A;  1HSQ A;  4J9D A;  1K9A A;  1YCS B;  2AKK A;  2JMC A;  4HVV A;  2KR3 A;  3IQL A;  2A37 A;  1X2Q A;  4CC3 A;  4D8D A;  2D1X A;  1ZLM A;  2CRE A;  2CDT A;  2JMA A;  4IIO A;  4HCK A;  1IO6 A;  1B07 A;  1ABO A;  4HVW A;  4RUG A;  3VS2 A;  1QWE A;  4RTT A;  1AOJ A;  1VYU A;  1K1Z A;  5IHN A;  2DBM A;  4JPB W;  2L2P A;  1WX6 A;  2RF0 A;  2GTJ A;  4AG2 C;  2HCK A;  2MIO A;  1M3B A;  3VS5 A;  1XOV A;  1X69 A;  1I0C A;  1SSH A;  2GNC A;  2YUP A;  2GQI A;  2QDL A;  5GJV B;  2DL8 A;  2K3B A;  4OMQ A;  4CC4 B;  1UJY A;  1TUD A;  2L3P A;  1WDX A;  2AZV A;  2KT8 A;  1T0J A;  2G6F X;  2RQV A;  3ZL7 C;  1ABQ A;  1A0N B;  3M0T A;  1NLP C;  1Z9Q A;  1J3T A;  1GBQ A;  2F2W A;  2CSQ A;  2FO0 A;  1PKS A;  2LZ6 B;  4JJD A;  2D8H A;  1QKW A;  2DL5 A;  1BK2 A;  2BTT A;  1SHF A;  1YWP A;  1Z9Z A;  2ED1 A;  1NG2 A;  2O9V A;  4F16 A;  2O2O A;  5IXB A;  3UA6 A;  3EG2 A;  2DA9 A;  4DEX A;  5L23 A;  2EYZ A;  3VRZ A;  1H92 A;  1K0X A;  1CSK A;  2NWM A;  3QWY A;  1WXT A;  3VS0 A;  2A28 A;  2FRW A;  4D8K A;  1X2K A;  3NMZ C;  3O5Z A;  2BZ8 A;  3I5R A;  4LUE A;  2EW3 A;  5I11 A;  2JS2 A;  2KYB A;  2DYB A;  2X3X D;  4JZ4 A;  2DVJ A;  2ESW A;  3PE0 A;  3NPF A;  2EPD A;  3JV3 A;  3M0Q A;  2CUB A;  3TSZ A;  2DL3 A;  3I5S A;  1I07 A;  4E6R A;  1Y57 A;  4RTV A;  5FW9 A;  3RBB B;  2KBT A;  1UTI A;  2KRN A;  2GBQ A;  1NYG A;  1NYF A;  2ROL A;  1NEG A;  3RNJ A;  2KRS A;  1W1F A;  2DE0 X;  1KFZ A;  4AFQ C;  1JU5 C;  3CQT A;  3H41 A;  2DNU A;  1M3A A;  3GBQ A;  1GCQ C;  2ENM A;  2JTE A;  2YUQ A;  2RQU A;  2EGA A;  2LX7 A;  2SRC A;  1W70 A;  1ZUK A;  1AZG B;  4K11 A;  2A36 A;  1BB9 A;  2J05 A;  5FWC A;  2AKL A;  2OJ2 A;  1PHT A;  1ARK A;  2EKH A;  1MUZ A;  4ESR A;  1GFD A;  3QWX X;  2JW4 A;  2J6F A;  4CC2 A;  1RI9 A;  1ZSG A;  5FWB A; 
#chains in the Genus database with same CATH topology
 2QA4 T;  3REA B;  3G1J A;  2QTV A;  2D0Q B;  2P0P A;  3KBG A;  3C12 A;  1UGV A;  2BE9 B;  2VVK A;  1OX8 A;  1K8A R;  3EH2 A;  1M90 U;  3H0I A;  4R55 A;  4KH1 B;  3SEM A;  3QSU A;  4A4K A;  1AHJ B;  1GBR A;  9ATC B;  3CCU A;  5LJ3 d;  2EQK A;  3P8B B;  1YIT A;  1T3L A;  2RN8 A;  2HQH A;  4OP0 A;  3TVT A;  3CMA A;  1VIE A;  3C0C A;  3I35 A;  2QAS A;  1WXU A;  2C0O A;  3VKI A;  3CCE Q;  3N5B B;  3QO3 A;  2O4X B;  1YHQ A;  1WA7 A;  1FMW A;  1IXD A;  1RAF B;  1NJI U;  4NL3 A;  2LMJ A;  3JCM e;  3RKW A;  1VQN Q;  5GAM g;  3QXE B;  3M0S A;  2DEQ A;  4DA4 A;  1WZO A;  3LX7 A;  2ZPG B;  5GAN d;  1UDL A;  2XDP A;  1TG0 A;  4RMO A;  2AK5 A;  1UUE A;  4QVZ A;  4PJO E;  5LJ3 h;  5ECA A;  1I8F A;  2RMO A;  4RTY A;  4WTO B;  2X4J A;  4OMP A;  4C8Q A;  2SEM A;  3L2U A;  1G83 A;  1QVP A;  3EG9 A;  1SKU B;  1LPL A;  4C92 C;  2DZ9 A;  3LH5 A;  4B9X A;  3UWN A;  5IXF A;  2V1R A;  2HNI A;  4R0K A;  5CKB A;  4C0G A;  1D1C A;  2MAM A;  2EYX A;  2CUD A;  2EYY A;  3OA6 A;  1G3W A;  1U3O A;  1OPL A;  5GAN h;  2L3S A;  1RAA B;  1VQK T;  3FJ5 A;  1PNJ A;  4ZNX A;  1N6A A;  2CH4 A;  1F1B B;  1Y96 A;  4FIB A;  2K5I A;  1QP2 A;  3MCA B;  1D3B B;  2PVG B;  3CBM A;  1UHF A;  1C0M A;  1QLY A;  2DM1 A;  4D6W A;  5AYF A;  4M7D E;  2RJC A;  2RJE A;  2LQN A;  3VS1 A;  1OQK A;  1VQ5 T;  2CT4 A;  3SWN A;  3V7C A;  1UB4 A;  2ZPH B;  1Q82 C;  4J9I A;  4E7S A;  3CME T;  1BKB A;  2DL7 A;  2VB6 A;  1VQO Q;  1MV3 A;  4IUT A;  3QYH B;  3OYA A;  1RL2 A;  3M0P A;  5I22 A;  3M5A A;  1ZBJ A;  2M51 A;  2IPO B;  3I55 Q;  1BIA A;  2BKD N;  4QQ6 A;  6AT1 B;  1O75 A;  1QMC A;  1Y71 A;  1IHV A;  5HCK A;  1YCY A;  3M0R A;  4JUV A;  4PL6 A;  2RO0 A;  2PNI A;  1N5Z A;  2OTJ T;  3GP8 A;  1UHC A;  4LD9 K;  4RTU A;  2CS7 A;  2K7A A;  1IGU A;  1JXO A;  4VUB A;  2YT6 A;  1VQ4 Q;  1G5V A;  1VQ5 A;  5IHK A;  1KG1 A;  1PSF A;  2V8K A;  4E7K A;  4F7U A;  3H8Z A;  3CME A;  2D6F A;  4BY6 C;  2F2X A;  1JEG A;  1XQH A;  5LJ5 g;  1V29 B;  3CC7 A;  2MCN A;  1JRI A;  2L5Q A;  2E4H A;  4OB3 B;  1E7O A;  3OYJ A;  1QCO A;  1PRL C;  1XNI A;  2HBW A;  1Q86 R;  2RQT A;  1TTH B;  1D0Z A;  3SHW A;  5KE2 A;  3DLM A;  1UGS B;  3GF5 A;  1TUG B;  3EGD B;  1AWJ A;  5DY9 A;  5GAO l;  1RAI B;  5GAM e;  3CCJ T;  1VQ9 T;  1OPK A;  1VQ4 T;  3KFV A;  4F17 A;  2H3J A;  5LJ3 f;  2KRO A;  1WHJ A;  2AHJ B;  4HT9 A;  1WQ7 A;  2DZC A;  5D6X A;  4F14 A;  4KGZ B;  4C8Q F;  2X3W D;  3OYH A;  1TOV A;  1RAE B;  1HXD A;  2Z0W A;  2K5L A;  1YIJ Q;  1AEY A;  1B34 B;  8ATC B;  1VUB A;  5HY6 A;  3V8K A;  4OMO A;  3ZEH A;  2HKQ B;  3OYF A;  1Q7Y C;  4F7U G;  3D7S B;  4JLI A;  1GXI E;  1VQ7 Q;  4Y91 A;  2AZS A;  2FG0 A;  1QP3 A;  3MEU A;  5GAN f;  5FU6 C;  1V1C A;  4IUV A;  4J9F A;  4ME7 A;  1VQ9 A;  5GAO p;  4C5H A;  1G8X A;  1I5L A;  4FYW B;  3OMC A;  2CZ6 B;  4KUL A;  2LCS A;  2F5K A;  1U5S A;  2RHI A;  2QEX Q;  4HKE A;  4A4E A;  4M78 B;  2DJQ A;  3VS3 A;  3REB B;  3MKD A;  2EAY A;  3VYG A;  5KYW A;  2OI3 A;  1HSQ A;  1M9S A;  2KY9 A;  4HVV A;  4XTX A;  3LGF A;  3CCS T;  3L2Z A;  2CDT A;  1VIF A;  2JMA A;  1B07 A;  4RUG A;  2XID A;  3CPW S;  2NUP A;  3NTK A;  5IHN A;  4OMF B;  1WX6 A;  3CCQ Q;  2HCK A;  4OVA A;  1XOV A;  4ZTF A;  1G3S A;  3JB9 J;  5D6Y A;  3I56 Q;  4XTY A;  1SSH A;  1BIB A;  2GNC A;  1PCX A;  3PIP A;  4CC4 B;  1NPR A;  1IB8 A;  1WDX A;  1T0J A;  2AZV A;  2KI7 A;  2KT8 A;  1YJ9 Q;  3CC4 Q;  2CGH A;  4FM4 B;  4C8Q E;  1R77 A;  3J7A F;  1M2V A;  1GBQ A;  4C92 G;  2F2W A;  4FW2 A;  3VUB A;  1PKS A;  2LZ6 B;  4JJD A;  1QVG S;  1QKW A;  4C5I A;  2JTF A;  2BTT A;  2LCC A;  1SHF A;  1YWP A;  5GAN 2;  2ED1 A;  4OGE A;  2EQM A;  3QG1 A;  2F1L A;  3UA6 A;  5HK0 A;  2DA9 A;  3GNG A;  5LJ5 e;  2EYZ A;  5GMK j;  4JJN K;  3OBW A;  3EH1 A;  5DLO A;  2NWM A;  3QWY A;  2A28 A;  2FRW A;  3X24 B;  1MND A;  3P8H A;  3OYC A;  2E65 A;  4C0Z A;  4M7A B;  3DKM A;  1X2K A;  2KAF A;  5CKH A;  4A4G A;  3LWH A;  4M78 F;  2BE7 D;  5KH6 A;  3OYK A;  1WHL A;  2BIV A;  3I5R A;  1NZ9 A;  4E7Z A;  5I11 A;  4JRK A;  2JS2 A;  2GFU A;  2RD1 A;  2LVM A;  2ZPI B;  3RKX A;  2B8A A;  4TVR A;  2PUK B;  1NJI R;  3BFM A;  3CC4 T;  4PJO D;  4XQ3 A;  4J83 A;  4M77 D;  3FIF A;  2AT1 B;  1RAB B;  4XTV A;  2EWN A;  4PJL A;  1KD1 R;  2KVQ G;  4ELZ C;  3OS0 A;  3RBB B;  3CCM A;  2XKO C;  1UTI A;  3QUI A;  5CK9 A;  2R57 A;  3A8O B;  1NEG A;  4C5G A;  2KRS A;  5J39 A;  1M1K R;  4AFQ C;  3G4S Q;  3EFO A;  1VQ6 A;  2DNU A;  1GCQ C;  2YUQ A;  2CP7 A;  1ZUK A;  2FZC B;  1BB9 A;  5FWC A;  2AKL A;  2EFI A;  1VQ8 T;  1XTD A;  1GRI A;  1RI9 A;  2VV5 A;  2HEQ A;  4ORZ A;  1SF9 A;  4E7L A;  3OYB A;  4ZTJ A;  1EFN A;  2XI9 A;  3PT9 A;  2DXB A;  1MMA A;  3SB2 A;  2DXT A;  4M7D D;  4FSS A;  2VXE A;  4PJO G;  5FU7 C;  1UGP B;  4M7A F;  1PRM C;  1ZX6 A;  1UFF A;  4LN2 A;  3M4Y A;  2NUZ A;  1AWX A;  4C8Q C;  2LNH B;  4CI0 C;  2ZAE A;  3S6W A;  3OY9 A;  2XK0 A;  2E1H A;  2VUB A;  2RQR A;  2RK1 A;  4M77 B;  1OV3 A;  4RTW A;  1BYM A;  3H0H A;  2PTK A;  1QVF P;  1VQP A;  3INZ A;  1D0X A;  2DL4 A;  3JCM b;  2P4R A;  4M75 B;  4ANJ A;  2ROT A;  2EVR A;  4JJB A;  4FL6 A;  1W2B P;  2PVO B;  1HD3 A;  1LOJ A;  1KC8 U;  1QQJ A;  4QT7 A;  1YIT Q;  1VQL T;  4XTU A;  1IGQ A;  2E12 A;  2EJG A;  2K2V A;  1GCP A;  5GAN 5;  2QDY B;  1OOT A;  1E6G A;  3SWN C;  3UPU A;  3OQ5 A;  5IT9 E;  2NLU A;  1K8A C;  1KHI A;  2P0Q A;  2O4X A;  1YHQ Q;  1OZ3 A;  2FL7 A;  3G71 Q;  2CP3 A;  2CZ0 B;  4PLL A;  1WI7 A;  3X20 B;  4M7D B;  3EGU A;  4JZ3 A;  3OMG A;  2HAX A;  2KRM A;  3CCV A;  4BDZ A;  4GBQ A;  2JT4 A;  2HSE B;  1K9M R;  4L5G A;  1B3Q A;  4DBQ A;  2MWP A;  4O5V A;  2KSS A;  3J81 E;  1PG5 B;  3VS4 A;  1QCF A;  1Y07 A;  3JCM c;  5KYU B;  1R0C B;  5CIU A;  1GFC A;  1V76 A;  1HJD A;  1Y7X A;  2OTL T;  3JB9 F;  1C6V X;  2MMP A;  3HRU A;  2KYM A;  2O9S A;  2K5F A;  4J7F A;  2MOX A;  3M57 A;  2YLC A;  1MV0 B;  1FMK A;  2EQJ A;  4FT2 A;  3SFM A;  4C0F A;  2DTH A;  2CH4 W;  3QZ9 B;  1QKX A;  4M75 F;  5GMK l;  4RTZ A;  2DJZ A;  4MZP A;  2JN0 A;  1S72 T;  1K0S A;  4OML A;  5KE3 A;  1YN8 A;  3PGG A;  4ZGE B;  1GCQ A;  2Y4X A;  1VQM T;  2COZ A;  3L2V A;  4CC7 A;  1D1B A;  3A8L B;  4X9C A;  2WSC E;  4HVU A;  3UF4 A;  4AMC A;  2OTL A;  2CSI A;  1D3B A;  2XDD A;  1ZUU A;  3MHX A;  2QA4 A;  3R6O A;  5M9O A;  4FYY B;  2JOY A;  2KT1 A;  2RHX A;  2Y4Y A;  1QVF A;  1KD1 U;  1JB0 E;  2GGR A;  2QG9 B;  2H3E B;  2RI5 A;  2KGT A;  4HXJ A;  2K9G A;  2RHZ A;  3C94 A;  2VKN A;  3G6E T;  3OYD A;  2XMF A;  3BW1 A;  2GTO A;  2OAU A;  1M1K U;  2DO3 A;  2EJF A;  4QQD A;  2JM8 A;  1WHM A;  1I5O B;  1W2B A;  1NPP A;  2YUO A;  4ZN1 A;  3OW2 S;  2FEI A;  1M1G A;  5KCH A;  5KYX B;  3JCM P;  5KYY A;  3FC3 A;  2DD4 A;  3WXM B;  4YTL A;  2C0T A;  1X6G A;  2O31 A;  2DIG A;  2XHC A;  2ATC B;  1M4Z A;  1WHG A;  3CCE T;  1JXM A;  4FYV B;  5IH2 A;  3HFN A;  1G3T A;  1X6B A;  3TCJ A;  2LCL A;  3R6N A;  1DJ7 B;  1VQN T;  1YJN Q;  1Q81 C;  2JS0 A;  4A4H A;  1ZUY A;  4EMG A;  4M7A C;  2F2V A;  2R58 A;  2CP0 A;  2X4W A;  2K79 A;  4Y28 E;  3Q1J A;  3MEW A;  1X01 A;  4X9D A;  1VA7 A;  4IKF A;  5LJ3 j;  1NEB A;  3DB3 A;  4Z88 A;  3V8J A;  1UEC A;  1XJW B;  2VC8 A;  2FHD A;  3FRN A;  5KCO A;  2EGE A;  4PFP A;  3S3N A;  5GAM d;  3EGD A;  1WPY A;  1QWF A;  2RHY A;  3JRZ A;  2WSE E;  4BAC A;  1VQK A;  2EBP A;  1Q86 C;  3TQ7 P;  1M8M A;  1Q95 G;  1TWB A;  2F5T X;  1K9A A;  4C8Q G;  4GY5 A;  3QPH A;  2VAS A;  3V7S A;  2MK5 A;  4CC3 A;  5GAN j;  2D1X A;  2YRD A;  4OB0 B;  4HCK A;  4NS5 A;  1IO6 A;  3VUZ A;  3JCM f;  3DLL A;  1N8R C;  1QWE A;  4RTT A;  1VYU A;  4DOW A;  4XK8 E;  1B34 A;  2DBM A;  2JJ9 A;  4JPB W;  2RF0 A;  2DTI A;  4AG2 C;  3VS5 A;  5GAM h;  1X69 A;  5LL6 S;  3LH0 A;  4JRP A;  2M16 A;  2YUP A;  3OS1 A;  2GQI A;  2QDL A;  2K3B A;  3M58 A;  4MML A;  4FU6 A;  2L3P A;  3HRT A;  3CBP A;  1VQO T;  3M0T A;  1A0N B;  3M53 A;  4PJJ A;  1K9M U;  4N0A A;  2CSQ A;  4M78 A;  5FLX E;  2RB6 A;  3I55 T;  2FO0 A;  1KQ2 A;  2OTJ A;  4C0D C;  1O9S A;  2VYT A;  4BI3 A;  5A0G A;  1Q82 R;  3PMI A;  1G3Y A;  2DL5 A;  3MJX A;  5GAO m;  2FZK B;  1NG2 A;  4F16 A;  1IHW A;  2LT4 A;  3EG2 A;  4EMK B;  4OB2 B;  5CCA A;  1K0X A;  2LDM A;  1WXT A;  1H64 1;  4M75 C;  1WJR A;  2R5M A;  2NUT A;  4RCC A;  4ZGD B;  2CYZ B;  2CP6 A;  2RM4 A;  4NL2 A;  2BZ8 A;  4LUE A;  2KYB A;  2DYB A;  3QJY A;  1N9S A;  2DVJ A;  2O01 E;  4LD6 A;  4FSX A;  3OYY A;  2DYI A;  3PE0 A;  3NPF A;  2RK2 A;  1BI0 A;  2QI2 A;  2E10 A;  4FW1 A;  2CUB A;  3VJP A;  4J5Y A;  3I5S A;  4E6R A;  2LT1 A;  4R56 A;  4LXC A;  3CD6 Q;  1Y57 A;  3CCL Q;  4PJN A;  4IUU A;  1FX7 A;  1MMN A;  4QQG A;  2HL3 A;  2GBQ A;  4E7J A;  3HPW A;  2V8J A;  1TS9 A;  2ROL A;  3RNJ A;  1ZQ1 A;  3CCJ A;  4HCC A;  2K4Y A;  4JDS A;  3URG A;  1VQ4 A;  5LJ5 d;  5HK3 A;  3GBQ A;  2ENM A;  2JTE A;  2GF7 A;  2LX7 A;  4IUP A;  4C92 D;  4F7U B;  1RAH B;  2MF2 A;  3CPW P;  1ZSZ B;  2GQV A;  3JB9 I;  2ZCF B;  2JVV A;  2A36 A;  4K11 A;  1KC8 R;  1PHT A;  2COY A;  1ARK A;  3JCM V;  4DOV A;  1D09 B;  3E19 A;  4DQ2 A;  4M7A A;  4BI4 A;  4ESR A;  2EKO A;  3QWX X;  4KH0 B;  2RJD A;  2J6F A;  4KUI A;  1ZSG A;  5FWB A;  3UAT A;  2LX9 A;  1YI2 Q;  1EZZ B;  5KYN A;  5CQY A;  1M90 C;  1S1N A;  3L1A A;  3PMT A;  2IIM A;  3X25 B;  4E7H A;  1YIJ T;  3MET A;  3M4G A;  3A8H B;  5I21 A;  2VGM A;  4ELY C;  5GAN 7;  2A0F B;  4HCB A;  1M27 C;  3CD6 T;  5LJ5 h;  3CCL T;  1YNZ A;  2C06 A;  1QVG P;  4OMN A;  3U23 A;  1X6O A;  1VQ7 T;  4J9B A;  4HT8 A;  4QW2 A;  1NJI C;  1VQ6 Q;  3PIO A;  3GNF B;  3CCS A;  2QEX T;  1AVZ C;  4XU2 A;  4PJM A;  2PZ1 A;  1TU0 B;  2K2M A;  4DBR A;  1SEM A;  2CP2 A;  4O6J A;  5GAM f;  4A4F A;  1M1K C;  1WLP B;  3EGX A;  2G3R A;  2YRV A;  1JJ2 S;  1YBY A;  2MWO A;  4IUR A;  3BE3 A;  2EGC A;  3KXT A;  1YI2 T;  1MHN A;  1UJ0 A;  2QYZ A;  4C92 B;  1QW1 A;  3JCM X;  1VQ7 A;  5FRN A;  2EQI A;  5GMK e;  3MEV A;  3QZ5 B;  3CCR Q;  3EG1 A;  3CCQ T;  1VOM A;  4JLG A;  1VYV A;  4DBF A;  2E6N A;  3I56 T;  3UA7 A;  5J26 A;  4GLM A;  1BI2 A;  2D8J A;  1G2B A;  2X4X A;  1YJ9 T;  2QQS A;  2E3H A;  4OGC A;  1H8K A;  2XD0 A;  3RIR A;  3UDC A;  2YRC A;  4M77 A;  1PC0 A;  2A08 A;  1QCN A;  1HYO A;  1VQP Q;  3M0U A;  4KT0 E;  4M75 A;  1CKB A;  4MDW A;  1EIF A;  3CPW A;  1YJW Q;  2DIQ A;  4J7I A;  3CXC P;  2R5A A;  1SPK A;  1PM3 A;  1RLP C;  4PNO A;  4LDV A;  3I56 A;  1W6X A;  4Z89 A;  2CP5 A;  3EHR A;  3I9Q A;  5EC7 A;  5DM7 R;  2X4Y A;  4II1 A;  3AT1 B;  3CCR T;  2DRM A;  3OYI A;  2LC4 A;  2GFA A;  1RAD B;  1Q82 U;  3CC4 A;  2HSP A;  3CC2 Q;  4BI8 B;  2FZG B;  2M02 A;  3O8V A;  1JO8 A;  1KJW A;  1RAG B;  1M2V B;  2WAC A;  3QDF A;  3CXC S;  4GLK A;  1TH7 A;  1HK9 A;  2EQU A;  3BDU A;  1UE9 A;  2DAQ A;  3VRY A;  1WFW A;  2YLB A;  4WCI A;  3V8L A;  1BI1 A;  1QVG A;  1VYT A;  1H3H A;  3H9N A;  2DD5 A;  1RLQ C;  4BY6 B;  3CCV Q;  2RNA A;  1BU1 A;  1M30 A;  4M78 E;  2M0Y A;  1NLO C;  3G4S T;  3HHT B;  2CT3 A;  1VQ8 A;  1GL5 A;  3AHU A;  5GJW B;  4PJO B;  3M55 A;  5KYU A;  2OAW A;  2ED0 A;  2DK3 A;  3VS6 A;  2JUF A;  3EHQ A;  4J6Y A;  3NTH A;  1NE8 A;  2WSF E;  3M54 A;  5LJ5 f;  4RTX A;  4IUQ A;  1K9M C;  3FDR A;  4B6M A;  5L8R E;  4MZM A;  1OEB A;  2PUO B;  1I1J A;  3TU4 K;  4AFU C;  4MDX A;  3MPU B;  4LDW A;  1E6H A;  4XAX B;  3RMQ A;  2HD0 A;  1K73 R;  3CCU Q;  3ME9 A;  3GOX A;  3G4S A;  2RPN A;  3EFO B;  3HKS A;  3OYM A;  4P5N A;  4OMM A;  2RQW A;  4AFZ C;  2KDS A;  3VS7 A;  3CMA Q;  2K57 A;  2J7I A;  5LJ3 g;  1U06 A;  2DRK A;  1MNE A;  2L8D A;  3JCM d;  1AWW A;  2XG8 D;  1T3S A;  4J9E A;  3A8M B;  4J8O A;  1LNX A;  3WVD B;  1MGQ A;  2L3R A;  2QA4 Q;  4EMK C;  3RUX A;  2EIF A;  4MZT A;  1OUL A;  2CZ7 B;  2FPE A;  1M3C A;  1TUC A;  2RJF A;  2CZ1 B;  4KGV B;  3M56 A;  4M7A E;  3CXC A;  2LJ3 A;  1YWO A;  2C0I A;  4Y92 A;  1WNL A;  3OSV A;  5GAN g;  1VQL A;  1KHC A;  2FPF A;  2FRY A;  2M1H A;  2ZGW A;  2YSQ A;  1P92 A;  4PJO F;  2E64 A;  2VXF A;  4PFZ A;  2BZX A;  4M77 F;  5KYX A;  2E6Z A;  4BE2 A;  3JCM h;  1YIT T;  5GMK m;  4F04 B;  2DF6 A;  2JM9 A;  4L6V 5;  4J9H A;  1OZ2 A;  1IRX A;  3CMA T;  5GAN 6;  3BDL A;  2ZPF B;  2LQ8 A;  1BI3 A;  2QAZ A;  1KQS P;  4IIM A;  3OS5 A;  2ABL A;  2FPD A;  3G7Z A;  1YHQ T;  2AKK A;  2JMC A;  3G71 T;  3MP1 A;  2A37 A;  1X2Q A;  4X34 A;  2CRE A;  1ZSZ C;  2RI2 A;  1M2O A;  4N0A C;  3VV0 A;  4M78 C;  4HVW A;  3VS2 A;  1M5Q 1;  2RI3 A;  2XDB A;  1AOJ A;  1K1Z A;  1KQS S;  2L2P A;  1OI1 A;  2MIO A;  1M3B A;  5AT1 B;  3OW2 P;  1I0C A;  2HQX A;  3VYH B;  4M7D F;  2DL8 A;  4B9W A;  1TUD A;  1S72 A;  2DXU A;  4PFO A;  2L89 A;  3F70 A;  4ZGJ B;  4ZN3 A;  1ABQ A;  2BUD A;  3PFS A;  3G71 A;  1J3T A;  1VQM A;  1VQK Q;  3BY7 A;  3J80 E;  2HKN A;  1PD0 A;  2D8H A;  4JRI A;  4QKU A;  3M59 A;  1MMG A;  4BD3 A;  3OYG A;  4J6X A;  4UC4 A;  5IXB A;  2XU8 A;  4JRQ A;  3JAM E;  4AT1 B;  4M77 E;  4V2S A;  5L23 A;  3VRZ A;  2I2L A;  3QBY A;  3SD4 A;  2P0K A;  2LTO A;  1VQ5 Q;  3VS0 A;  4C8Q D;  3OYE A;  1WJS A;  3NMZ C;  3G6E A;  3CME Q;  4RG8 A;  4M75 E;  3O5Z A;  1IZ6 A;  3QYG B;  4OB1 B;  1H3Z A;  3JCM W;  3CC7 Q;  2X3X D;  4JZ4 A;  2ESW A;  3E9G A;  3QHS A;  2RA2 A;  4PK4 A;  2EPD A;  3UT1 A;  3JV3 A;  3M0Q A;  2IG0 A;  2CKK A;  2ZPE B;  3HRS A;  1I07 A;  3RER A;  3EFR A;  3X28 B;  2DTO A;  3JSC A;  3A8G B;  4RTV A;  1AT1 B;  1X75 C;  3E2U A;  3C4S A;  2KBT A;  5C6S A;  2E70 A;  2OTJ Q;  5LJ3 e;  1NYG A;  3JCM Q;  1NYF A;  2DE0 X;  2D9T A;  1KFZ A;  3CCE A;  1JU5 C;  2HZY A;  3CQT A;  4OF1 A;  3LGL A;  4BDY A;  3ASK A;  1M3A A;  4CRI A;  3HP9 A;  2F69 A;  2SRC A;  1OYX A;  3HL8 A;  2DXC A;  1KQS A;  4EMK A;  1VQN A;  2V8I A;  2J05 A;  4QVD A;  2EKH A;  1OU8 A;  1TXQ A;  3QDR B;  3MEA A;  3JCM J;  2JW4 A;  1JBM A;  1K73 U;  8AT1 B;  1YJN T;  1SRM A;  3LWI A;  3CC7 T;  5FU7 B;  5GAN e;  2QGF B;  3NGP A;  1K4U S;  1I4K 1;  1WXB A;  5IN1 A;  5GAN 4;  3L42 A;  2ZPB B;  2JZ2 A;  2V1Q A;  1EX4 A;  2A3L A;  4C8Q B;  3OSS C;  3OW2 A;  1M8V A;  5KYY B;  2ECZ A;  3EG9 B;  1Q81 R;  4Q5W A;  3L2R A;  3EG3 A;  5DLQ E;  3X26 B;  3CCJ Q;  1VQ9 Q;  3NTI A;  2DIL A;  1WHK A;  3NHN A;  2M0O A;  1SRL A;  2QXF A;  4AFS C;  1BBZ A;  1ACM B;  5CO7 A;  2J6K A;  1LCK A;  1ZSZ A;  4LUD A;  1YJN A;  4DBH A;  2X9H A;  5I2S A;  2W0Z A;  3EAE A;  4RG2 A;  1WJQ A;  2LJ1 A;  1Y96 B;  4N4I A;  2J6O A;  2LQW A;  4PJO C;  4BUG A;  2YWW A;  2K6D A;  1AWO A;  5J3B A;  4M77 C;  1PWT A;  2L0A A;  3JB9 H;  1YFN A;  2KEA A;  4M78 D;  3TEE A;  4LDY A;  1KC8 C;  1X43 A;  3SWN B;  2L3Q A;  3RR6 A;  3E1S A;  3S3O A;  2DKG A;  1VQO A;  5GAM j;  2EJ9 A;  5D7U A;  1N8R R;  1D1A A;  3EFS A;  3H0F A;  2M9U A;  1ZA2 B;  3FJP A;  5CKD A;  4DEY A;  3I55 A;  2LJ0 A;  2MYS A;  1NM7 A;  4LNP A;  3THK A;  2EYW A;  1TSF A;  1K8A U;  4FCY A;  1D0Y A;  3CCS Q;  2Y90 A;  1FWZ A;  2E5K A;  3ULR B;  4FYX B;  3RMS A;  2P4T A;  4X1V A;  4XU0 A;  3OYL A;  3V7R A;  4EDU A;  3PVQ A;  4N4H A;  3LW5 E;  3QJ6 A;  2YDL A;  3CEY A;  2KXD A;  4M7D C;  2DMO A;  3LYI A;  2HL5 C;  4N4G A;  4C92 A;  2YXY A;  3OBY A;  2DER A;  1K76 A;  4M78 G;  1SSF A;  4BB7 A;  2PQW A;  4J6W A;  2P84 A;  4Z02 A;  3S3M A;  3C95 A;  1UG1 A;  2B86 A;  5C0M A;  1U8R A;  5GMK i;  4M7A D;  1T0H A;  1WHH A;  5CR2 A;  1U1T A;  4A53 A;  3MO8 A;  2QQA A;  4JJC A;  2BZY A;  4A63 B;  4HCZ A;  3HFO A;  1AZE A;  4JS4 A;  1UEB A;  1FYN A;  1MMD A;  2A7Y A;  3PNW C;  1BCO A;  3ZFJ A;  4QVC A;  2DET A;  1CKA A;  3CCM Q;  5GAO r;  1C1A A;  1RAC B;  2JTM A;  5GMK h;  2JXB A;  1KIK A;  2QQR A;  3M9Q A;  1JJ2 P;  3SDZ A;  3H6Z A;  3PTA A;  1Q7Y R;  3T9N A;  2JNG A;  5GAO q;  2NUT B;  3LLR A;  5GAN 3;  2GCX A;  1KD1 C;  4XU3 A;  3DB4 A;  2I0N A;  2PU9 B;  3QII A;  3TSW A;  5CKE A;  3GLX A;  2KK4 A;  2KNB B;  1LVK A;  5A0D A;  5IAY A;  1YIJ A;  2W10 A;  1KQ1 A;  4RKU E;  2MI6 A;  2LP5 A;  7AT1 B;  1X27 A;  1B7T A;  1OU9 A;  3A98 A;  1SG5 A;  3NFC A;  5D6W A;  4LDU A;  3CD6 A;  2DFU A;  3CCL A;  2K3X A;  1JQQ A;  4F7U F;  1AD5 A;  2LQK A;  2RHU A;  2XIC A;  4M7A G;  2RH2 A;  2HDA A;  3RDV A;  5LJ5 j;  3MP8 A;  3ZBD A;  3CCM T;  1Y0M A;  1M90 R;  1RI0 A;  2QK0 A;  4XU1 A;  3RES A;  2QEX A;  1YP5 A;  5KYW B;  1VQ6 T;  1I81 A;  1RUW A;  1VQ8 Q;  2DPP B;  4AG1 C;  1KSW A;  4HA8 A;  2KE9 A;  4M4Z A;  3HTR A;  4PJO A;  1PD1 A;  4J9G A;  1SHG A;  2QQB A;  4MMK A;  2DEU A;  2DLP A;  1YI2 A;  3L2Q A;  1N9R A;  4EPC A;  1KK7 A;  1WYX A;  5FRM A;  4EIK A;  1Q81 U;  2NUP B;  4KGX B;  3WVE B;  1IRE B;  2D0N A;  4LE9 A;  3ER0 A;  3JB9 D;  2FYK A;  2QQ9 A;  2VGN A;  2DX1 A;  3CCQ A;  3OS2 A;  3CPF A;  2VWF A;  5EG2 A;  2O88 A;  2J06 A;  3OYN A;  3PVL A;  3A1P A;  2KXC A;  2H8H A;  4J9C A;  1BCM A;  2QTX A;  3EG0 A;  2HBP A;  4PKC C;  5IHI A;  2YUN A;  1WIE A;  4M75 D;  1ZBX A;  1R8O B;  3A5Z B;  1YJ9 A;  4KRT A;  4Z8A A;  4XTW A;  3CBO A;  5FRO A;  2DBK A;  3QKJ A;  1PKT A;  2MPX C;  3GPL A;  4L59 A;  1Q86 U;  4J9D A;  4C92 F;  1WQW A;  1YCS B;  3E9F A;  1K73 C;  2FB7 A;  2KR3 A;  3IQL A;  5GAO n;  3JCM g;  2X51 A;  2LRQ A;  3EGX B;  2HQE A;  4D8D A;  4M7D A;  1ZLM A;  5A2Q E;  4IIO A;  2X35 A;  4F7U E;  1ABO A;  2IVW A;  5CAI A;  1JJ2 A;  1VQP T;  4E2F B;  1N8R U;  3CCR A;  1YJW T;  2E5Q A;  2GTJ A;  2PVD B;  3JB9 G;  1VQL Q;  1LJO A;  4M77 G;  5GAN 8;  2EYQ A;  3RKY A;  2KMT A;  2V26 A;  3KUF A;  5GJV B;  2KQW A;  1FXX A;  4C0D B;  4OMQ A;  3TRE A;  1UJY A;  4M75 G;  2G6F X;  1PSE A;  4LDX A;  3VU3 C;  2RQV A;  2YHT A;  3ZL7 C;  4PLI A;  4C5E A;  1NLP C;  1Z9Q A;  3FEO A;  5CQX A;  2ZZD A;  4ATO A;  3CC2 T;  1UGR B;  2FVU A;  1ZHI A;  2OX7 A;  2HMA A;  1BK2 A;  4XTZ A;  5HKC A;  1U1S A;  1Z9Z A;  2O9V A;  2O2O A;  1YJW A;  4EMH A;  4BE1 A;  4DEX A;  4KBM B;  4NOY A;  2K3Y A;  3CCV T;  1H92 A;  5CVI A;  1CSK A;  4JS5 A;  2OTL Q;  4D8K A;  2NYS A;  1QVF S;  4FT4 A;  4M7D G;  2E3I A;  2DVE A;  2EW3 A;  5I2M A;  3CC2 A;  3FB9 A;  4A54 A;  5A0L A;  1NBE B;  4C92 E;  5FU6 B;  1S72 Q;  4KUD K;  1N27 A;  3TSZ A;  1W2B S;  2DL3 A;  3L2W A;  3HSB A;  5CKF A;  1VQM Q;  1ZA1 B;  3MP6 A;  1Q7Y U;  5FW9 A;  4BE0 A;  3GIB A;  2KRN A;  3P8D A;  2LNV A;  1W1F A;  3CCU T;  1W4S A;  4RCB A;  2COW A;  3H41 A;  4E47 A;  2RQU A;  2EGA A;  1W70 A;  1WGS A;  1AZG B;  4WF2 A;  1R0B G;  4E7I A;  2OJ2 A;  3FLG A;  3OB9 A;  1MUZ A;  2AIR B;  1GFD A;  1OX9 A;  3G6E Q;  2QGG A;  1UGQ B;  1FMV A;  2E41 A;  1M1F A;  4CC2 A; 
#chains in the Genus database with same CATH homology
 3REA B;  1SRM A;  2HEQ A;  4ORZ A;  1EFN A;  3NGP A;  1S1N A;  1UGV A;  2VVK A;  1K4U S;  2IIM A;  1WXB A;  3H0I A;  3SEM A;  2V1Q A;  1GBR A;  4FSS A;  2ECZ A;  1T3L A;  1M27 C;  1YNZ A;  2RN8 A;  1PRM C;  4OMN A;  3U23 A;  1ZX6 A;  3TVT A;  1UFF A;  4J9B A;  4LN2 A;  3C0C A;  3EG3 A;  3I35 A;  2NUZ A;  1WXU A;  2C0O A;  1AWX A;  2DIL A;  2LNH B;  3NHN A;  1WA7 A;  1SRL A;  4AFS C;  2LMJ A;  1BBZ A;  2J6K A;  1LCK A;  2RQR A;  4LUD A;  1OV3 A;  1AVZ C;  4RTW A;  2PZ1 A;  3M0S A;  2K2M A;  3H0H A;  1SEM A;  2W0Z A;  2PTK A;  2LJ1 A;  1UDL A;  1WLP B;  2DL4 A;  2P4R A;  2J6O A;  1TG0 A;  2LQW A;  2AK5 A;  2K6D A;  1GRI A;  1AWO A;  1PWT A;  2L0A A;  2EVR A;  2EGC A;  2ROT A;  1UUE A;  4JJB A;  2KEA A;  1UJ0 A;  5ECA A;  1HD3 A;  2RMO A;  1X43 A;  4RTY A;  2EQI A;  2L3Q A;  4OMP A;  2SEM A;  4QT7 A;  3EG1 A;  1G83 A;  1VYV A;  1GCP A;  3UA7 A;  3LH5 A;  4GLM A;  3H0F A;  1OOT A;  5IXF A;  1E6G A;  4DEY A;  2LJ0 A;  2V1R A;  2D8J A;  1NM7 A;  4LNP A;  4R0K A;  1G2B A;  3THK A;  2EYW A;  2EYX A;  2CUD A;  1H8K A;  2EYY A;  1U3O A;  1OPL A;  2L3S A;  1WI7 A;  3FJ5 A;  2E5K A;  1PNJ A;  3EGU A;  4JZ3 A;  3ULR B;  2KRM A;  4ZNX A;  2A08 A;  4X1V A;  4GBQ A;  2CH4 A;  2JT4 A;  3M0U A;  3PVQ A;  1CKB A;  1B3Q A;  2YDL A;  2KXD A;  2DMO A;  1UHF A;  1QLY A;  2DM1 A;  1SPK A;  3VS4 A;  1RLP C;  1QCF A;  1W6X A;  1K76 A;  4Z89 A;  1GFC A;  2LQN A;  3EHR A;  3I9Q A;  5EC7 A;  3VS1 A;  1HJD A;  2CT4 A;  2KYM A;  2O9S A;  4J9I A;  2DRM A;  2MOX A;  2DL7 A;  1MV0 B;  1FMK A;  2HSP A;  1MV3 A;  2CH4 W;  1UG1 A;  1JO8 A;  1KJW A;  1QKX A;  2B86 A;  3M0P A;  5I22 A;  4RTZ A;  1ZBJ A;  2M51 A;  1T0H A;  1K0S A;  4OML A;  1UE9 A;  1YN8 A;  4JJC A;  2BZY A;  3VRY A;  1WFW A;  5HCK A;  3M0R A;  4A63 B;  4WCI A;  1AZE A;  1GCQ A;  1VYT A;  1H3H A;  1FYN A;  2PNI A;  1CKA A;  4CC7 A;  1RLQ C;  1N5Z A;  1UHC A;  2RNA A;  1BU1 A;  1M30 A;  2JXB A;  4RTU A;  1KIK A;  2K7A A;  1JXO A;  2M0Y A;  1NLO C;  4HVU A;  2YT6 A;  3UF4 A;  5IHK A;  2CT3 A;  2CSI A;  1GL5 A;  5GJW B;  1ZUU A;  2F2X A;  1JEG A;  2I0N A;  2OAW A;  2ED0 A;  3VS6 A;  2KT1 A;  2MCN A;  3TSW A;  3UAT A;  2GGR A;  3EHQ A;  2KNB B;  2KGT A;  2K9G A;  4HXJ A;  2VKN A;  2W10 A;  4RTX A;  1E7O A;  1PRL C;  2HBW A;  2XMF A;  2LP5 A;  2GTO A;  1X27 A;  2JM8 A;  3A98 A;  1OEB A;  1I1J A;  2RQT A;  4AFU C;  1JQQ A;  1E6H A;  2YUO A;  3SHW A;  2FEI A;  1AD5 A;  2RPN A;  2HDA A;  4OMM A;  2RQW A;  4AFZ C;  2C0T A;  1AWJ A;  1X6G A;  2O31 A;  1Y0M A;  3VS7 A;  2J7I A;  1U06 A;  2DRK A;  1YP5 A;  1AWW A;  1OPK A;  1JXM A;  5IH2 A;  3KFV A;  4F17 A;  1T3S A;  1RUW A;  2KRO A;  4J9E A;  4AG1 C;  1KSW A;  2KE9 A;  1X6B A;  4M4Z A;  3R6N A;  4J9G A;  1SHG A;  4F14 A;  2JS0 A;  2DLP A;  2X3W D;  1WYX A;  2FPE A;  1M3C A;  1TUC A;  4EIK A;  1ZUY A;  1AEY A;  2F2V A;  2D0N A;  4LE9 A;  2K79 A;  2LJ3 A;  4OMO A;  1YWO A;  2C0I A;  4Y92 A;  2DX1 A;  1VA7 A;  2VWF A;  1NEB A;  2O88 A;  2J06 A;  4Z88 A;  3PVL A;  1UEC A;  2KXC A;  2FPF A;  2H8H A;  2FRY A;  2YSQ A;  4J9C A;  3EG0 A;  2AZS A;  2FG0 A;  5IHI A;  2BZX A;  1V1C A;  2YUN A;  2EGE A;  4J9F A;  1WIE A;  4KRT A;  4Z8A A;  2DF6 A;  2JM9 A;  4J9H A;  1QWF A;  2LCS A;  1U5S A;  2EBP A;  2DBK A;  1PKT A;  1M8M A;  2DJQ A;  4IIM A;  3VS3 A;  3REB B;  2ABL A;  2FPD A;  2OI3 A;  1HSQ A;  4J9D A;  1K9A A;  1YCS B;  2AKK A;  2JMC A;  4HVV A;  2KR3 A;  3IQL A;  2A37 A;  1X2Q A;  4CC3 A;  4D8D A;  2D1X A;  1ZLM A;  2CRE A;  2CDT A;  2JMA A;  4IIO A;  4HCK A;  1IO6 A;  1B07 A;  1ABO A;  4HVW A;  4RUG A;  3VS2 A;  1QWE A;  4RTT A;  1AOJ A;  1VYU A;  1K1Z A;  5IHN A;  2DBM A;  4JPB W;  2L2P A;  1WX6 A;  2RF0 A;  2GTJ A;  4AG2 C;  2HCK A;  2MIO A;  1M3B A;  3VS5 A;  1XOV A;  1X69 A;  1I0C A;  1SSH A;  2GNC A;  2YUP A;  2GQI A;  2QDL A;  5GJV B;  2DL8 A;  2K3B A;  4OMQ A;  4CC4 B;  1UJY A;  1TUD A;  2L3P A;  1WDX A;  2AZV A;  2KT8 A;  1T0J A;  2G6F X;  2RQV A;  3ZL7 C;  1ABQ A;  1A0N B;  3M0T A;  1NLP C;  1Z9Q A;  1J3T A;  1GBQ A;  2F2W A;  2CSQ A;  2FO0 A;  1PKS A;  2LZ6 B;  4JJD A;  2D8H A;  1QKW A;  2DL5 A;  1BK2 A;  2BTT A;  1SHF A;  1YWP A;  1Z9Z A;  2ED1 A;  1NG2 A;  2O9V A;  4F16 A;  2O2O A;  5IXB A;  3UA6 A;  3EG2 A;  2DA9 A;  4DEX A;  5L23 A;  2EYZ A;  3VRZ A;  1H92 A;  1K0X A;  1CSK A;  2NWM A;  3QWY A;  1WXT A;  3VS0 A;  2A28 A;  2FRW A;  4D8K A;  1X2K A;  3NMZ C;  3O5Z A;  2BZ8 A;  3I5R A;  4LUE A;  2EW3 A;  5I11 A;  2JS2 A;  2KYB A;  2DYB A;  2X3X D;  4JZ4 A;  2DVJ A;  2ESW A;  3PE0 A;  3NPF A;  2EPD A;  3JV3 A;  3M0Q A;  2CUB A;  3TSZ A;  2DL3 A;  3I5S A;  1I07 A;  4E6R A;  1Y57 A;  4RTV A;  5FW9 A;  3RBB B;  2KBT A;  1UTI A;  2KRN A;  2GBQ A;  1NYG A;  1NYF A;  2ROL A;  1NEG A;  3RNJ A;  2KRS A;  1W1F A;  2DE0 X;  1KFZ A;  4AFQ C;  1JU5 C;  3CQT A;  3H41 A;  2DNU A;  1M3A A;  3GBQ A;  1GCQ C;  2ENM A;  2JTE A;  2YUQ A;  2RQU A;  2EGA A;  2LX7 A;  2SRC A;  1W70 A;  1ZUK A;  1AZG B;  4K11 A;  2A36 A;  1BB9 A;  2J05 A;  5FWC A;  2AKL A;  2OJ2 A;  1PHT A;  1ARK A;  2EKH A;  1MUZ A;  4ESR A;  1GFD A;  3QWX X;  2JW4 A;  2J6F A;  4CC2 A;  1RI9 A;  1ZSG A;  5FWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...