1QWFA

C-src sh3 domain complexed with ligand vsl12
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE TRANSFORMING PROTEIN SRC
molecule tags Complex (signal transduction/peptide)
source organism Avian sarcoma virus
publication title Specific interactions outside the proline-rich core of two classes of Src homology 3 ligands.
pubmed doi rcsb
total genus 8
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1qwfA00
4WCIA 4AFUC 4JJCA 4M4ZA 1QWEA 2G6FX 4RTXA 3R6NA 4Y92A 1UUEA 1RLQC 2YUPA 5FWCA 3I5RA 3H0FA 1NYFA 2BZXA 4RTYA 1UDLA 1I1JA 3QWYA 1TG0A 2D0NA 1PWTA 2HBWA 2P4RA 2GGRA 1ZUKA 1OV3A 2D1XA 2DL8A 3VS5A 1MUZA 2D8HA 2EKHA 2SEMA 2DL3A 2EYXA 2DRKA 4F17A 4HVUA 1K76A 4CC4B 1W1FA 2L2PA 4J9GA 3EGUA 2KROA 1N5ZA 2JW4A 2RQUA 4J9BA 1AWXA 1SSHA 1WLPB 3JV3A 1JU5C 1YWOA 2JS0A 1NLOC 2DNUA 2O9VA 1ZUUA 2MOXA 2EYWA 2F2WA 2X3XD 2CDTA 2L3PA 4R0KA 1J3TA 1WYXA 2DE0X 1H8KA 2EYZA 1M3CA 1K9AA 2EVRA 2EYYA 1OPKA 3EG2A 1EFNA 1AVZC 1T3LA 4OMPA 1U06A 4RTVA 1GBRA 1YP5A 1X6BA 3I9QA 1UG1A 3UA7A 1G83A 1M27C 4X1VA 1RUWA 4EIKA 2ABLA 1BK2A 1ZBJA 3I5SA 4JPBW 2EGAA 2CUDA 4HXJA 3O5ZA 1JXMA 3M0PA 4HVWA 2F2XA 1OPLA 1Z9QA 2IIMA 1UJYA 2FRYA 3PE0A 2K9GA 1YCSB 1UGVA 3EG3A 1AWWA 2K6DA 2H8HA 2NUZA 1E6GA 4FSSA 2BTTA 4E6RA 2DJQA 1JO8A 3A98A 2ED0A 1JEGA 2KRSA 1X43A 2GNCA 5GJWB 1BU1A 2B86A 3VS2A 4AFZC 1KFZA 2ENMA 2HCKA 2K79A 2DA9A 1WXTA 2LZ6B 4Z88A 3U23A 4QT7A 3CQTA 2AKLA 4LUDA 4AFQC 3M0TA 4J9EA 2J7IA 1ZSGA 2RQTA 4ORZA 2XMFA 2AZVA 2DYBA 3M0SA 5IHIA 3C0CA 1HSQA 2KGTA 1E7OA 4Z89A 2YUOA 1BBZA 2KRMA 5I22A 1SRLA 4RTTA 1W70A 1YNZA 2LJ1A 3SEMA 1FYNA 2LMJA 1X27A 2YSQA 5FWBA 3M0UA 4LE9A 1WI7A 4AG2C 2CSIA 2ESWA 1W6XA 2KE9A 1QWFA 3NPFA 3VRZA 1YN8A 5IXFA 2PZ1A 1H3HA 1M3BA 3ZL7C 4OMQA 4ESRA 2YUQA 3VS7A 1ZUYA 4LNPA 2I0NA 3VS4A 1VYTA 3THKA 2YDLA 3EG1A 1QCFA 2M0YA 2LQNA 2MCNA 2DX1A 3I35A 2FO0A 2ROTA 2LJ3A 2GTOA 2DLPA 3LH5A 1BB9A 4RTUA 5GJVB 1GL5A 2AK5A 2KXDA 4OMNA 4D8KA 1NM7A 2EGCA 2HEQA 3NHNA 1X2KA 2C0OA 1AWOA 1X69A 2RMOA 1UHCA 2J06A 2KR3A 2YUNA 2DMOA 3KFVA 2CREA 5I11A 4J9HA 4DEXA 2KBTA 1YWPA 3VS0A 1GCQA 3VS6A 3SHWA 1AEYA 3H0HA 2OAWA 1UHFA 1T3SA 2YT6A 1SRMA 1TUDA 3ULRB 2EW3A 2W10A 1RLPC 1K0XA 2C0TA 4LUEA 2JM8A 1M8MA 2FG0A 5IH2A 2O88A 2FEIA 2J05A 2O2OA 4JZ3A 1AWJA 1RI9A 3NGPA 4J9IA 4OMLA 2VVKA 3H41A 4IIMA 4OMOA 2SRCA 2EBPA 1A0NB 1OEBA 2L3QA 4K11A 2MIOA 1PKTA 1NLPC 2RQVA 2J6OA 4JJBA 1Y0MA 4RTZA 2FPFA 2LCSA 2JM9A 1IO6A 2DVJA 1UE9A 1AZGB 1WX6A 1Z9ZA 4AFSC 2KRNA 2PTKA 2O31A 3UATA 2V1QA 1CSKA 1HD3A 1M3AA 5HCKA 1T0HA 5FW9A 2GTJA 2CH4W 3TSWA 1X2QA 2DBMA 2VKNA 5IXBA 1UTIA 1PRLC 2A28A 4RUGA 1VA7A 2K7AA 4RTWA 2O9SA 1QKXA 5IHNA 1I07A 2LX7A 2LP5A 2W0ZA 1OOTA 1AD5A 2CT4A 4J9CA 2JMCA 1PKSA 4HCKA 1ABOA 1PHTA 2KNBB 3M0QA 1WXUA 1UECA 4Z8AA 2FPEA 1U5SA 1GCQC 2JT4A 1H92A 4LN2A 2HDAA 1K1ZA 1KSWA 3FJ5A 1QLYA 1MV0B 2GQIA 3EG0A 2X3WD 1Y57A 2BZYA 2EPDA 1PRMC 1JXOA 2RPNA 1GFCA 3GBQA 2C0IA 3RBBB 2JXBA 2LJ0A 4AG1C 4GLMA 1WXBA 1XOVA 1FMKA 2E5KA 2JS2A 1ABQA 1PNJA 1B07A 2DM1A 3VS3A 1JQQA 3PVLA 5EC7A 1CKBA 2ECZA 2VWFA 2M51A 1M30A 1HJDA 1GBQA 2KT8A 4JZ4A 2CUBA 2EGEA 1TUCA 2CT3A 2J6KA 1X6GA 2J6FA 2FRWA 2RF0A 4CC3A 3VRYA 2HSPA 2D8JA 4J9DA 1S1NA 2ROLA 4DEYA 2JTEA 4KRTA 3EHQA 2L3SA 2AZSA 1ARKA 1MV3A 4D8DA 3NMZC 3RNJA 1LCKA 2V1RA 2A37A 1NEBA 2A36A 2KXCA 5ECAA 2KT1A 2K3BA 2CSQA 2LNHB 4HVVA 2FPDA 1SPKA 4ZNXA 1SHFA 1GRIA 1KIKA 3TVTA 1UFFA 2RN8A 3H0IA 1NYGA 1U3OA 1V1CA 1AOJA 3REAB 1G2BA 2DL5A 2AKKA 2JMAA 1VYVA 4OMMA 1WIEA 2F2VA 2ED1A 1SHGA 3EHRA 2RNAA 1SEMA 2LQWA 1E6HA 2DILA 2GBQA 2RQWA 2DL7A 2EQIA 4IIOA 1WFWA 2DRMA 1QKWA 1B3QA 1ZX6A 1K0SA 2QDLA 3M0RA 1GCPA 1WA7A 2OJ2A 4GBQA 2RQRA 3UF4A 4JJDA 2KYMA 3IQLA 2CH4A 4A63B 1NEGA 2KEAA 1UJ0A 2OI3A 3TSZA 1T0JA 2K2MA 1AZEA 1GFDA 3UA6A 3PVQA 5L23A 1WDXA 1I0CA 3QWXX 4CC7A 4F14A 1KJWA 2BZ8A 1ZLMA 4CC2A 2A08A 5IHKA 2NWMA 2PNIA 1VYUA 2DL4A 1CKAA 2DBKA 4J9FA 1K4US 1NG2A 3REBB 2KYBA 2DF6A 2L0AA 4F16A 3VS1A
chains in the Genus database with same CATH superfamily
1N8RU 4JJCA 5GMKh 4RTXA 2D9TA 2V8JA 1UUEA 1Y71A 3CPFA 3HHTB 3I5RA 4C92C 1I1JA 4C92D 2D0NA 2HBWA 1RAFB 4N0AA 3X24B 4PJOC 2DL8A 1K8AU 2SEMA 2DL3A 4F17A 2EQUA 5AT1B 1K76A 3OYLA 3S6WA 2L2PA 3OYEA 4OB1B 3Q1JA 2DETA 2JW4A 3CCRQ 2NUPB 4J9BA 1AWXA 4DBHA 1YWOA 1BKBA 1NLOC 4QQGA 2X3XD 2ZGWA 2CDTA 3PMIA 1J3TA 1VQ5A 1VQKT 1WYXA 3JB9G 1D1BA 2QTXA 3L2RA 3EH1A 2EYZA 2EVRA 5I2MA 3EG2A 1NJIR 3OS0A 1T3LA 3M57A 3SWNA 4M7AF 4RTVA 1DJ7B 1YP5A 2JTMA 1ZA1B 2DTIA 3UA7A 2RO0A 1OZ2A 1BK2A 1XNIA 2EGAA 2CUDA 1JXMA 4E7SA 3CCRA 4F7UF 5KH6A 3HTRA 5J39A 2FRYA 1GXIE 2K9GA 4M78F 4Y91A 1AWWA 3H8ZA 2NUZA 1VQ7Q 1WHMA 1QVPA 3OYMA 2QQSA 4N4HA 2DJQA 1JO8A 3A98A 1WHLA 4C92E 1YJ9T 3META 1X75C 1Q7YR 1MGQA 5I2SA 2KRSA 2RA2A 3VS2A 4AFZC 1KFZA 2ENMA 1ZBXA 3A8MB 5GAMj 1HXDA 3I56T 1VQNT 3CCUQ 4Z88A 3KUFA 4DBFA 3CCMT 4DA4A 2E10A 4RCCA 3JSCA 1U1SA 4AFQC 3M0TA 4J9EA 3CC4A 1ZSGA 4QVZA 3M59A 4HA8A 2V8KA 1YCYA 5CIUA 2FZCB 1YHQT 2P0PA 1VQ6A 1R0BG 4Z89A 3SWNC 1BBZA 1VIFA 4FIBA 1W70A 2X9HA 2GCXA 1X27A 5FWBA 5KYWB 4FL6A 5CKBA 1K73U 2MF2A 4AG2C 2QGGA 4C5EA 2KE9A 1FMVA 3UWNA 3VRZA 4FU6A 5IXFA 1VQ4T 3BFMA 3OY9A 2PZ1A 1H3HA 1HYOA 2V26A 4RCBA 4PFPA 2CP7A 4HCCA 1VYTA 3THKA 1IHVA 8AT1B 2LCLA 3I56Q 1LNXA 2JN0A 4C92F 4BDZA 1SG5A 1SF9A 4PJJA 4M7DA 4PJOE 1MMGA 1ZSZA 3LH5A 1VQ6Q 1X01A 2KXDA 1NM7A 3GLXA 3ME9A 3G4SQ 3CPWS 1X2KA 2C0OA 3QJYA 3DB4A 5LJ5d 5GAOl 4MDXA 4OP0A 4M78B 4M75B 2YUNA 4M77B 3CC4T 2DMOA 3F70A 2QQAA 3KFVA 1LPLA 4J9HA 3RR6A 4LD6A 4FT2A 2OAWA 4M7AG 2YT6A 1QW1A 2PU9B 4J6WA 5CR2A 3L2VA 1ZA2B 1K0XA 3OA6A 2AT1B 1M8MA 2FZKB 2O88A 2O2OA 4PLIA 4JZ3A 1RI9A 1OI1A 1U1TA 2DTOA 3SB2A 3H41A 1KD1C 4JDSA 4IIMA 4OMOA 2DFUA 3CPWP 2EBPA 3I55A 1XQHA 2MIOA 4K11A 1NLPC 3ZBDA 1WJSA 1NE8A 3CMEA 4RTZA 2HKNA 1IO6A 4JRKA 1WX6A 1M8VA 2PTKA 2O31A 2DXTA 2MYSA 5KE3A 2DKGA 1HD3A 5HCKA 1VQ9T 1T0HA 4XTXA 2Y90A 3CD6Q 3BW1A 3TSWA 2KK4A 4BY6C 3CCVT 4RUGA 1VA7A 2K7AA 1C6VX 1VQ8Q 2K5IA 5IHNA 3JCMg 5GANd 4DOVA 2LP5A 1QVFS 3P8HA 4J9CA 3OYCA 4LDVA 1RL2A 1ABOA 2KNBB 3M0QA 1WXUA 2FPEA 2ZPHB 5CVIA 3CMAA 2HDAA 1K1ZA 2QYZA 4M75G 5FU6C 4XU0A 1N8RC 2LVMA 5KYUB 2CP3A 2GQIA 3OYKA 1JXOA 1GFCA 4C8QG 4KULA 3RBBB 1TSFA 2OAUA 2JXBA 2LJ0A 4AG1C 4GLMA 3ZFJA 1XOVA 1TXQA 2YLCA 1ABQA 3QDRB 3VS3A 5KCHA 4E7IA 3JCMX 3CMET 2KT8A 3GNFB 1YI2T 3OYYA 4HT8A 2EGEA 2J6KA 5GAMg 1EZZB 1N8RR 4CC3A 3J81E 1M4ZA 2D8JA 1S1NA 2ROLA 3EFSA 2L3SA 2COWA 2ZPBB 1ARKA 4NOYA 2VASA 3RNJA 1LCKA 1BI2A 2V1RA 4C8QB 3CCVQ 4UC4A 3H9NA 1YITT 4II1A 2PUOB 2K3BA 1YJWQ 2E3IA 3SFMA 4HVVA 4A4KA 4ZNXA 2Y4YA 1SHFA 1KIKA 4PJOF 4DOWA 3UDCA 3X26B 1NYGA 1G3YA 4E7KA 2OX7A 4E2FB 3REAB 4NL2A 3QSUA 1VYVA 3EGDB 3CCJT 4PFOA 3JCMJ 5J3BA 4X34A 1SEMA 1E6HA 3GPLA 5LJ3e 4L59A 2RK2A 5KYXA 4C5IA 3M0RA 4M7AC 1FX7A 1VQKA 1M5Q1 4M7DC 3CMAQ 1Q82U 1OULA 2KYMA 3CC7T 2KEAA 3OW2A 1WQ7A 2OI3A 4M7DB 1T0JA 3HFOA 2E65A 2VGNA 4Z02A 9ATCB 4QW2A 1WDXA 4F14A 3MJXA 3A8HB 2BZ8A 1NJIC 1QCOA 3JCMc 2NWMA 2K3XA 4ZTFA 1VQ9Q 2E6NA 3CCSQ 1D0XA 4BE2A 3REBB 4O5VA 4A54A 1PD0A 2ZPEB 1VOMA 1M2OA 3WVDB 1YJWT 4M4ZA 1QWEA 1VQPT 3VUBA 3R6NA 4CI0C 4PJOD 5D6XA 4MZMA 5FWCA 2CP0A 4A53A 1NYFA 4CRIA 2QEXA 1Q81R 5FU7C 2GGRA 5CO7A 4ANJA 1V29B 5CKDA 5CQYA 2VXFA 3VS5A 1VQ7T 3LH0A 1MUZA 2D8HA 1UEBA 1B7TA 5A0LA 2EYXA 1KD1U 4ZGDB 3FEOA 1IGUA 4CC4B 1Q7YC 2COZA 1N5ZA 5L8RE 3JV3A 2CP2A 3C12A 3CC7A 2MOXA 2L3PA 3I55T 2CGHA 2MI6A 5HK3A 4ZN1A 3NTHA 3EGXA 3V8KA 2DO3A 4M78D 4FSXA 4M75D 2RB6A 4OMPA 2E3HA 2LT4A 3G1JA 3CCLQ 1GBRA 4F04B 1UG1A 4ZN3A 4QQDA 1G83A 2EKOA 3JCMd 2FYKA 3A8LB 4X1VA 3RKXA 2DEQA 3E1SA 1ZBJA 4M7AA 1S72T 3LX7A 1JJ2A 4HVWA 2OTLQ 2F2XA 1Z9QA 1UJYA 4M77C 3PE0A 3OW2S 1D1AA 2CKKA 5LL6S 3EH2A 4FCYA 1Q95G 5GAOm 2L3RA 1R77A 4E7ZA 2EJGA 2K6DA 4DQ2A 3VYGA 2DD5A 1VQPQ 2LNVA 2IVWA 3BE3A 3G4ST 2YXYA 3QDFA 4B6MA 1JEGA 2HKQB 2F1LA 1X43A 1BU1A 3CCQA 2HCKA 2K79A 2DA9A 4J83A 4OGCA 1KQSS 2YRCA 2LZ6B 2KY9A 1RACB 3CCLT 3GNGA 3CQTA 2AKLA 2XG8D 4J7IA 4IUTA 4RKUE 2RQTA 2F5TX 5IAYA 2AZVA 4EPCA 4FW2A 5HK0A 1HSQA 1E7OA 5KYNA 4OB0B 1SRLA 4XTVA 1BCMA 3QO3A 1YNZA 3A8GB 2EFIA 1HK9A 2FZGB 1VQ8A 1FYNA 2G3RA 4FM4B 4E7HA 3CCQQ 2YSQA 4LE9A 1WI7A 4XTYA 3CCST 1I81A 2ESWA 4F7UE 3NPFA 2EQKA 3FDRA 1P92A 3LWIA 3E19A 2GFUA 1WNLA 1ZSZC 2X4WA 4M77A 1OZ3A 3FIFA 3CBPA 2R57A 2YDLA 3GOXA 3EG1A 2ZPFB 2M0YA 2LQNA 1PG5B 1MMDA 2MCNA 2K5FA 3CCVA 2FO0A 2DPPB 2ROTA 4EMHA 3FJPA 4J8OA 4C0DC 1GL5A 1VQMT 2A3LA 3NHNA 2RD1A 1H3ZA 1EIFA 1VQ5T 2QDYB 2RMOA 3TU4K 5GANf 3J80E 2J06A 2LTOA 1JJ2S 2KR3A 5LJ5j 2KMTA 3OYDA 2OTJT 2CREA 1YHQA 4A4EA 1WQWA 1YWPA 1GCQA 3CCEA 2M9UA 1Y7XA 5LJ5g 4X9DA 2I2LA 2LQ8A 2YRDA 1WZOA 3H0HA 1UHFA 1WJQA 1YHQQ 1TUDA 2L89A 4J6XA 3M54A 1KQ2A 1RLPC 3OBYA 4HCZA 4LUEA 2HQHA 1YJNQ 2KSSA 2FG0A 3ER0A 2FEIA 2J05A 1AWJA 2L5QA 4ZTJA 2SRCA 1OEBA 1YJWA 3RDVA 2FL7A 3OYAA 2J6OA 3T9NA 2WACA 1IGQA 4P5NA 1Z9ZA 3G6ET 3QBYA 3RMSA 3UATA 1YITA 1M3AA 2DZ9A 1VQ7A 5DY9A 1QVGA 3FLGA 5FW9A 4XTZA 2VKNA 1UTIA 2A28A 1EX4A 1TWBA 4J6YA 2WSCE 1UGPB 2O9SA 2R5MA 2W0ZA 2R5AA 1OOTA 1MMAA 2JMCA 4F7UG 4C92B 3RERA 1JRIA 4Z8AA 2JT4A 1H92A 1QVFA 2VGMA 4XU3A 1QLYA 1MV0B 4XU2A 1IXDA 3EG0A 3OW2P 1Y57A 3URGA 5KYYA 5GAN8 3OYHA 2EPDA 3GBQA 2CS7A 1VQKQ 3L1AA 2C0IA 2DVEA 2LC4A 1WXBA 4A4HA 2F69A 2E5KA 1W2BA 2JS2A 4NS5A 2D0QB 2NUTB 3WXMB 2QA4T 2DXBA 4KGZB 5GANh 5EC7A 1M30A 1N9RA 2M0OA 3M9QA 3OYFA 4M7DD 2CUBA 1TUCA 2CT3A 4YTLA 2GFAA 2J6FA 3OS5A 3CMEQ 2FRWA 3S3OA 2RHZA 2RF0A 3VRYA 4C0FA 3WVEB 1D3BB 4OF1A 1OU9A 5HKCA 2XDBA 2RHUA 2M02A 5GAN3 1MV3A 2MMPA 3OS2A 5CCAA 1RADB 5KYYB 4PL6A 4KH0B 2OTLA 1NEBA 3MP8A 2A36A 3CD6T 5GAMd 4R55A 1UGSB 5CQXA 2EYQA 4WF2A 3LLRA 2RN8A 4PJOB 3TQ7P 1U3OA 2X35A 4C92A 1K73C 1TH7A 3CXCA 5A2QE 1G2BA 4E7JA 2DXCA 1Q81C 4A4FA 8ATCB 3UPUA 1TS9A 4HCBA 3OYNA 2X4YA 3CPWA 5FRNA 1G5VA 2LQWA 3QG1A 3RESA 2GBQA 3M55A 2EQJA 4IIOA 1OQKA 1QKWA 4M75E 1B3QA 4M77E 3FC3A 4AMCA 3CCRT 2QDLA 3R6OA 1WA7A 2OJ2A 3FB9A 5CK9A 5GANg 3OYIA 3CC7Q 4GBQA 4FYWB 4M78C 2LQKA 3EFRA 4BE0A 1K73R 1VQLA 2V8IA 4MMLA 1AZEA 3RIRA 4IUUA 3V8JA 1OX9A 2BKDN 1PSEA 2XKOC 1AT1B 4OB3B 3RMQA 1KJWA 3PTAA 3X28B 3S3NA 3I56A 2DL4A 4KH1B 2DJZA 2JNGA 2KVQG 1M1GA 4J9FA 2OTLT 1NG2A 2A0FB 3EGDA 2KYBA 2Y4XA 2L0AA 4XTUA 1NBEB 2YHTA 3PIPA 1VQ6T 2YWWA 4C0GA 3QZ9B 2HMAA 3P8DA 1M2VA 1Y96B 5C0MA 1W2BS 1YI2Q 2BE7D 2QI2A 3DLMA 4Y92A 5FU7B 4XU1A 4M7AE 2QAZA 2BZXA 1Q7YU 3HSBA 3EG9B 5GAOn 4RTYA 2HL5C 3CCEQ 3QWYA 1TG0A 2HQXA 2WSEE 2E12A 1WHKA 2D1XA 4M78A 3RKWA 1B34B 2VC8A 2EKHA 3EFOA 4L5GA 3EFOB 1W1FA 4J9GA 2QK0A 3QIIA 5LJ5e 2RJFA 2C06A 2KROA 1WHHA 2DIQA 2RQUA 1QQJA 1WLPB 3EG9A 2DXUA 2GQVA 4M77D 2JUFA 2O9VA 4J7FA 2F2WA 2KI7A 2O01E 4EMKC 2XIDA 3HP9A 2DE0X 3VYHB 4JLIA 3MHXA 1H8KA 1IZ6A 1TTHB 3JCMV 1OPKA 1KG1A 4MZTA 1K8AC 1U06A 2E4HA 3I9QA 5M9OA 1M27C 5C6SA 2D6FA 2E64A 1X6OA 2ABLA 4IUQA 3CCUA 4PJOA 4C8QF 2M1HA 3JCMQ 5GAOq 4JRPA 5LJ3d 1YJ9A 2LT1A 1S72Q 1OPLA 4B9XA 5DLQE 2XHCA 5LJ5h 4M75F 5GAN2 1KHIA 1YCSB 2VXEA 5GAOp 1UGVA 3OMGA 3EG3A 1VQNA 4LD9K 2H8HA 1FWZA 1K8AR 1E6GA 3E9GA 1C0MA 4C8QE 2BTTA 4XK8E 4A4GA 2ED0A 4PJNA 3A8OB 3MP1A 2GNCA 2XU8A 2B86A 3CBMA 2P4TA 1BCOA 1I5OB 1WXTA 2EAYA 2LCCA 3G7ZA 4QT7A 4R56A 1VUBA 2J7IA 1OU8A 4ORZA 2XMFA 2OTJQ 5LJ3f 2DERA 2DTHA 1JB0E 3G71Q 1KC8R 2KGTA 4PNOA 2MK5A 3DKMA 4C0ZA 2YUOA 2KRMA 5I22A 4RTTA 3MEAA 2LMJA 1Q86U 5DLOA 2CP6A 2ATCB 2P84A 5D6WA 1N6AA 2HL3A 4M7DE 3CMAT 4ME7A 4FT4A 3INZA 1QWFA 2BE9B 1M90U 3SWNB 2QTVA 1YN8A 4LXCA 2YUQA 1MMNA 3S3MA 4D6WA 3VS4A 3OSVA 2RI2A 3PGGA 3QHSA 4QKUA 4BB7A 1QCFA 3DB3A 1M90R 2E6ZA 2EIFA 2DX1A 3I35A 2A7YA 4RG2A 2LJ3A 3HKSA 2K57A 2DLPA 1UGQB 1BB9A 2KAFA 4RTUA 1ZSZB 4KGXB 2MWOA 4OMNA 1G3SA 1MHNA 2EGCA 2HEQA 1YI2A 1AWOA 4O6JA 2QXFA 3J7AF 1X69A 4KGVB 1UHCA 1H641 1KC8U 3OYJA 4QVCA 4KT0E 4B9WA 4NL3A 3OBWA 5I11A 3OS1A 5GANj 2PVOB 1TU0B 2CP5A 3L2ZA 1RAEB 4MDWA 1RAGB 3OYGA 3VS0A 2KQWA 3CBOA 1OYXA 3QXEB 1AEYA 1T3SA 3M58A 2DAQA 3ULRB 2EW3A 2W10A 4RMOA 3JCMe 2K3YA 5GAOr 2XD0A 4BI3A 4J9IA 4BD3A 4IURA 2CZ7B 1VQ9A 2XICA 1FMWA 4V2SA 1VQ4Q 1BIBA 1A0NB 3ZEHA 2L3QA 1U8RA 2RQVA 4J5YA 1RI0A 2BIVA 2LCSA 3JB9H 1K9MC 2DVJA 3V7CA 1VQOQ 3CEYA 3CCQT 1JBMA 2KRNA 3CCMA 1CSKA 4FYXB 2GTJA 2CH4W 2DBMA 4BUGA 3QZ5B 3PMTA 1KHCA 2PUKB 4AT1B 1WHJA 2QQBA 3MCAB 5GAMe 2LX7A 3M4GA 2DZCA 2CT4A 1PKSA 4HCKA 1VQ4A 3C94A 4OB2B 1D09B 2AIRB 1PHTA 4IKFA 3OYBA 4JJNK 1YITQ 3CC2T 4LN2A 3M53A 1VQPA 3MP6A 3A5ZB 4XAXB 1WJRA 5D6YA 2BZYA 5LJ3h 3CC4Q 3E2UA 1D0ZA 2RPNA 1M1FA 2LX9A 1KQSP 1V76A 4OMFB 3C4SA 5HY6A 3UT1A 1IREB 2HZYA 4VUBA 3HRTA 4N4GA 3JB9J 1B07A 1JQQA 1CKBA 2QQRA 2ECZA 3RKYA 5LJ3g 1TUGB 1XTDA 3BY7A 1UB4A 4EMKA 2JOYA 1I5LA 3JB9F 3TCJA 3A1PA 4M7AD 5GMKj 4PKCC 2F5KA 2HSPA 1NPPA 5A0DA 2XDDA 1PSFA 2H3EB 4F7UB 3NTIA 2JTEA 1QMCA 2RM4A 4PLLA 3OQ5A 4BI8B 3V8LA 2VYTA 3NMZC 2RI3A 3VUZA 2VUBA 5LJ5f 3GF5A 1MNDA 2A37A 2DYIA 1ZQ1A 4DBQA 1C1AA 1KQ1A 4MMKA 2CSQA 1UGRB 3VKIA 5I21A 2FPDA 3TREA 1GRIA 3ASKA 1D3BA 3KBGA 3TVTA 1UFFA 5GAN7 1VIEA 3CCMQ 3V7RA 1V1CA 2ZZDA 1AOJA 1M1KC 4DBRA 7AT1B 2AKKA 3JCMb 1O75A 2DD4A 4OMMA 2F2VA 5FRMA 2FVUA 5GMKm 1SHGA 1K9MU 2E41A 3EHRA 2NYSA 5A0GA 2R58A 2DILA 2HQEA 2RQWA 1YJ9Q 2DL7A 2PQWA 1YFNA 4PK4A 1WFWA 3M4YA 2DRMA 4PFZA 1ZX6A 3BDLA 4C5GA 1GCPA 3M5AA 3UF4A 1KK7A 4JJDA 1NEGA 3JB9I 4C8QA 4BI4A 3TSZA 1PCXA 3PVQA 2QQ9A 1NJIU 4FW1A 1I0CA 3QWXX 5DM7R 1B34A 4Q5WA 2K2VA 2AHJB 4CC2A 2A08A 3DLLA 2PNIA 2HBPA 2QASA 1NPRA 2E70A 6AT1B 2Z0WA 3LGFA 2O4XB 4C5HA 2RJEA 3HPWA 3VS1A 4WCIA 4AFUC 4OGEA 5KE2A 2G6FX 3NTKA 3GP8A 4JRQA 1RLQC 2YUPA 3PIOA 4BDYA 1LVKA 3H0FA 1I8FA 5GANe 1UDLA 4IUVA 1PWTA 2P4RA 4M78E 1ZUKA 1VQ8T 3L2UA 1OV3A 4WTOB 3JAME 1VQLQ 5GAN4 2CZ0B 3JCMh 2DRKA 3CCSA 2EWNA 4HVUA 4C0DB 3L2WA 1IB8A 3EGUA 2ZPGB 3JB9D 2CZ1B 1SSHA 1JU5C 1VQNQ 2JS0A 2DNUA 3JCMf 1ZUUA 4GLKA 2RHXA 2GF7A 5EG2A 2EYWA 1BIAA 4R0KA 5KYXB 4ZGJB 2EJ9A 4KUIA 3KXTA 1M3CA 1K9AA 2HD0A 3QKJA 2EYYA 2XI9A 1KC8C 1EFNA 1AVZC 3CD6A 1X6BA 3X25B 1RUWA 1NZ9A 4EIKA 2CZ6B 2P0KA 3I5SA 4JPBW 2M16A 4HXJA 3O5ZA 4C8QD 1G3TA 3M0PA 3CCJA 4JUVA 1PM3A 3HL8A 4QQ6A 1R0CB 3LWHA 1G3WA 1I4K1 4L6V5 2IIMA 1W2BP 1OX8A 1BI1A 3CCET 4LDXA 3L2QA 4PJOG 4FYVB 2JJ9A 4XQ3A 1M2VB 1WPYA 1Y96A 4FSSA 3CCLA 2HAXA 2E5QA 3CXCP 1VQ5Q 4E6RA 2K4YA 2COYA 1M90C 3X20B 1SSFA 5GJWB 5IT9E 2DK3A 3QUIA 1QVGP 2QEXQ 3JCMW 3MEUA 1SKUB 4M75A 3BDUA 1IRXA 4E47A 3U23A 5GMKi 2LDMA 2K5LA 4LUDA 1Y07A 2VB6A 3QPHA 3G6EA 2RH2A 2DYBA 3M0SA 5IHIA 3C0CA 3E9FA 3MPUB 2QEXT 3HRSA 3QJ6A 4X9CA 1BYMA 2JVVA 3SEMA 2LJ1A 2NLUA 1O9SA 3M0UA 5D7UA 4EDUA 2CSIA 1W6XA 3SD4A 4N4IA 1IHWA 5GAN5 2ZPIB 1PD1A 1YJNA 1M3BA 3ZL7C 3PFSA 4OMQA 4ESRA 3G71A 1QP2A 3VS7A 1ZUYA 5GMKe 2CYZB 4LNPA 4HKEA 2I0NA 2E1HA 4LDYA 2RJDA 3LYIA 2WSFE 1M1KU 1K9MR 1AHJB 3RUXA 2MPXC 2QA4A 3CCJQ 2GTOA 3LW5E 2NUPA 1YIJA 5GJVB 1LOJA 2AK5A 5FROA 5FLXE 4D8KA 4GY5A 2FHDA 1RAAB 2XK0A 4M7AB 5CKHA 4EMGA 4F7UA 2RI5A 1KQSA 2RHYA 4ELZC 2ZAEA 2JZ2A 3CC2A 3VJPA 3MEVA 3QYGB 4TVRA 4DEXA 2KBTA 4LDWA 3V7SA 3P8BB 2NUTA 4ELYC 2QA4Q 1S72A 3MEWA 3VS6A 3CC2Q 3SHWA 1XJWB 3PT9A 2X51A 4JLGA 1SRMA 5GAMh 5GAN6 2C0TA 5J26A 2JM8A 5IH2A 1JJ2P 1G8XA 2PVGB 4KBMB 2XDPA 4N0AC 4MZPA 4OMLA 3NGPA 4M75C 1BI0A 3MKDA 2VVKA 5CAIA 1YBYA 1QCNA 1YJNT 3G4SA 1D0YA 3G71T 4HT9A 1PKTA 5IN1A 4BY6B 2PVDB 3EAEA 1WHGA 4JJBA 1YIJQ 1Y0MA 2FPFA 4ZGEB 2JM9A 2X4JA 1Q82C 1UE9A 1AZGB 3MO8A 4AFSC 4M77G 1VQOT 4IUPA 3AT1B 1YIJT 2V1QA 1PC0A 3H6ZA 3JRZA 1MNEA 2P0QA 1X2QA 1LJOA 5IXBA 2MAMA 1BI3A 2EQMA 1PRLC 2LRQA 3HRUA 5CKEA 4RTWA 5FU6B 4C92G 1FXXA 1QKXA 3D7SB 3L42A 1I07A 4FYYB 5AYFA 1AD5A 1F1BB 2IPOB 2JTFA 1W4SA 1Q82R 4RG8A 2KDSA 4BACA 3CXCS 5GAMf 1M1KR 1UECA 1N27A 1R8OB 1U5SA 1GCQC 4Y28E 1ZHIA 2DEUA 1KSWA 3FJ5A 3QYHB 4PJLA 1QP3A 4JRIA 2X3WD 2ZCFB 1QVFP 1PRMC 5CKFA 3PNWC 2DIGA 1KD1R 3OMCA 1VQMA 2IG0A 3OB9A 2YRVA 1FMKA 1PNJA 3AHUA 2DM1A 5KCOA 3O8VA 3PVLA 1Q81U 4EMKB 2RK1A 2VWFA 4M7DF 2M51A 4M7DG 1HJDA 3M56A 3I55Q 1GBQA 4JZ4A 2OTJA 1X6GA 2HNIA 3FRNA 4BE1A 3VU3C 4PJMA 1VQOA 4J9DA 4DEYA 3NFCA 1RAHB 4KRTA 1QVGS 3EHQA 1N9SA 4E7LA 4KUDK 2AZSA 4ATOA 2QG9B 4D8DA 4XTWA 1VQMQ 2KXCA 5ECAA 2B8AA 2EJFA 2KT1A 2LNHB 1D1CA 3N5BB 1M9SA 1SPKA 3SDZA 4M78G 2RJCA 2FB7A 3H0IA 3CCUT 1WGSA 2DL5A 2O4XA 2JMAA 1WIEA 1Q86C 2ED1A 1RABB 2L8DA 2RNAA 2QGFB 3VV0A 4QVDA 3EGXB 1VQLT 2EQIA 4C8QC 2VV5A 2YLBA 3HFNA 4LDUA 1K0SA 3JCMP 2HSEB 4M77F 2RQRA 1TOVA 3IQLA 4JS5A 2CH4A 4A63B 1UJ0A 5KYUA 3C95A 2K2MA 1Q86R 1GFDA 2H3JA 3UA6A 5L23A 3TEEA 5LJ3j 2BUDA 4CC7A 4JS4A 3GIBA 2X4XA 1ZLMA 3OSSC 1RAIB 5IHKA 1VYUA 5GMKl 1CKAA 4OVAA 3LGLA 2DBKA 1K4US 3G6EQ 2DF6A 2MWPA 4F16A 5KYWA 2RHIA 1ACMB
chains in the Genus database with same CATH topology
4WCIA 4AFUC 4JJCA 4M4ZA 1QWEA 2G6FX 4RTXA 3R6NA 4Y92A 1UUEA 1RLQC 2YUPA 5FWCA 3I5RA 3H0FA 1NYFA 2BZXA 4RTYA 1UDLA 1I1JA 3QWYA 1TG0A 2D0NA 1PWTA 2HBWA 2P4RA 2GGRA 1ZUKA 1OV3A 2D1XA 2DL8A 3VS5A 1MUZA 2D8HA 2EKHA 2SEMA 2DL3A 2EYXA 2DRKA 4F17A 4HVUA 1K76A 4CC4B 1W1FA 2L2PA 4J9GA 3EGUA 2KROA 1N5ZA 2JW4A 2RQUA 4J9BA 1AWXA 1SSHA 1WLPB 3JV3A 1JU5C 1YWOA 2JS0A 1NLOC 2DNUA 2O9VA 1ZUUA 2MOXA 2EYWA 2F2WA 2X3XD 2CDTA 2L3PA 4R0KA 1J3TA 1WYXA 2DE0X 1H8KA 2EYZA 1M3CA 1K9AA 2EVRA 2EYYA 1OPKA 3EG2A 1EFNA 1AVZC 1T3LA 4OMPA 1U06A 4RTVA 1GBRA 1YP5A 1X6BA 3I9QA 1UG1A 3UA7A 1G83A 1M27C 4X1VA 1RUWA 4EIKA 2ABLA 1BK2A 1ZBJA 3I5SA 4JPBW 2EGAA 2CUDA 4HXJA 3O5ZA 1JXMA 3M0PA 4HVWA 2F2XA 1OPLA 1Z9QA 2IIMA 1UJYA 2FRYA 3PE0A 2K9GA 1YCSB 1UGVA 3EG3A 1AWWA 2K6DA 2H8HA 2NUZA 1E6GA 4FSSA 2BTTA 4E6RA 2DJQA 1JO8A 3A98A 2ED0A 1JEGA 2KRSA 1X43A 2GNCA 5GJWB 1BU1A 2B86A 3VS2A 4AFZC 1KFZA 2ENMA 2HCKA 2K79A 2DA9A 1WXTA 2LZ6B 4Z88A 3U23A 4QT7A 3CQTA 2AKLA 4LUDA 4AFQC 3M0TA 4J9EA 2J7IA 1ZSGA 2RQTA 4ORZA 2XMFA 2AZVA 2DYBA 3M0SA 5IHIA 3C0CA 1HSQA 2KGTA 1E7OA 4Z89A 2YUOA 1BBZA 2KRMA 5I22A 1SRLA 4RTTA 1W70A 1YNZA 2LJ1A 3SEMA 1FYNA 2LMJA 1X27A 2YSQA 5FWBA 3M0UA 4LE9A 1WI7A 4AG2C 2CSIA 2ESWA 1W6XA 2KE9A 1QWFA 3NPFA 3VRZA 1YN8A 5IXFA 2PZ1A 1H3HA 1M3BA 3ZL7C 4OMQA 4ESRA 2YUQA 3VS7A 1ZUYA 4LNPA 2I0NA 3VS4A 1VYTA 3THKA 2YDLA 3EG1A 1QCFA 2M0YA 2LQNA 2MCNA 2DX1A 3I35A 2FO0A 2ROTA 2LJ3A 2GTOA 2DLPA 3LH5A 1BB9A 4RTUA 5GJVB 1GL5A 2AK5A 2KXDA 4OMNA 4D8KA 1NM7A 2EGCA 2HEQA 3NHNA 1X2KA 2C0OA 1AWOA 1X69A 2RMOA 1UHCA 2J06A 2KR3A 2YUNA 2DMOA 3KFVA 2CREA 5I11A 4J9HA 4DEXA 2KBTA 1YWPA 3VS0A 1GCQA 3VS6A 3SHWA 1AEYA 3H0HA 2OAWA 1UHFA 1T3SA 2YT6A 1SRMA 1TUDA 3ULRB 2EW3A 2W10A 1RLPC 1K0XA 2C0TA 4LUEA 2JM8A 1M8MA 2FG0A 5IH2A 2O88A 2FEIA 2J05A 2O2OA 4JZ3A 1AWJA 1RI9A 3NGPA 4J9IA 4OMLA 2VVKA 3H41A 4IIMA 4OMOA 2SRCA 2EBPA 1A0NB 1OEBA 2L3QA 4K11A 2MIOA 1PKTA 1NLPC 2RQVA 2J6OA 4JJBA 1Y0MA 4RTZA 2FPFA 2LCSA 2JM9A 1IO6A 2DVJA 1UE9A 1AZGB 1WX6A 1Z9ZA 4AFSC 2KRNA 2PTKA 2O31A 3UATA 2V1QA 1CSKA 1HD3A 1M3AA 5HCKA 1T0HA 5FW9A 2GTJA 2CH4W 3TSWA 1X2QA 2DBMA 2VKNA 5IXBA 1UTIA 1PRLC 2A28A 4RUGA 1VA7A 2K7AA 4RTWA 2O9SA 1QKXA 5IHNA 1I07A 2LX7A 2LP5A 2W0ZA 1OOTA 1AD5A 2CT4A 4J9CA 2JMCA 1PKSA 4HCKA 1ABOA 1PHTA 2KNBB 3M0QA 1WXUA 1UECA 4Z8AA 2FPEA 1U5SA 1GCQC 2JT4A 1H92A 4LN2A 2HDAA 1K1ZA 1KSWA 3FJ5A 1QLYA 1MV0B 2GQIA 3EG0A 2X3WD 1Y57A 2BZYA 2EPDA 1PRMC 1JXOA 2RPNA 1GFCA 3GBQA 2C0IA 3RBBB 2JXBA 2LJ0A 4AG1C 4GLMA 1WXBA 1XOVA 1FMKA 2E5KA 2JS2A 1ABQA 1PNJA 1B07A 2DM1A 3VS3A 1JQQA 3PVLA 5EC7A 1CKBA 2ECZA 2VWFA 2M51A 1M30A 1HJDA 1GBQA 2KT8A 4JZ4A 2CUBA 2EGEA 1TUCA 2CT3A 2J6KA 1X6GA 2J6FA 2FRWA 2RF0A 4CC3A 3VRYA 2HSPA 2D8JA 4J9DA 1S1NA 2ROLA 4DEYA 2JTEA 4KRTA 3EHQA 2L3SA 2AZSA 1ARKA 1MV3A 4D8DA 3NMZC 3RNJA 1LCKA 2V1RA 2A37A 1NEBA 2A36A 2KXCA 5ECAA 2KT1A 2K3BA 2CSQA 2LNHB 4HVVA 2FPDA 1SPKA 4ZNXA 1SHFA 1GRIA 1KIKA 3TVTA 1UFFA 2RN8A 3H0IA 1NYGA 1U3OA 1V1CA 1AOJA 3REAB 1G2BA 2DL5A 2AKKA 2JMAA 1VYVA 4OMMA 1WIEA 2F2VA 2ED1A 1SHGA 3EHRA 2RNAA 1SEMA 2LQWA 1E6HA 2DILA 2GBQA 2RQWA 2DL7A 2EQIA 4IIOA 1WFWA 2DRMA 1QKWA 1B3QA 1ZX6A 1K0SA 2QDLA 3M0RA 1GCPA 1WA7A 2OJ2A 4GBQA 2RQRA 3UF4A 4JJDA 2KYMA 3IQLA 2CH4A 4A63B 1NEGA 2KEAA 1UJ0A 2OI3A 3TSZA 1T0JA 2K2MA 1AZEA 1GFDA 3UA6A 3PVQA 5L23A 1WDXA 1I0CA 3QWXX 4CC7A 4F14A 1KJWA 2BZ8A 1ZLMA 4CC2A 2A08A 5IHKA 2NWMA 2PNIA 1VYUA 2DL4A 1CKAA 2DBKA 4J9FA 1K4US 1NG2A 3REBB 2KYBA 2DF6A 2L0AA 4F16A 3VS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCI A;  4AFU C;  4JJC A;  4M4Z A;  1QWE A;  2G6F X;  4RTX A;  3R6N A;  4Y92 A;  1UUE A;  1RLQ C;  2YUP A;  5FWC A;  3I5R A;  3H0F A;  1NYF A;  2BZX A;  4RTY A;  1UDL A;  1I1J A;  3QWY A;  1TG0 A;  2D0N A;  1PWT A;  2HBW A;  2P4R A;  2GGR A;  1ZUK A;  1OV3 A;  2D1X A;  2DL8 A;  3VS5 A;  1MUZ A;  2D8H A;  2EKH A;  2SEM A;  2DL3 A;  2EYX A;  2DRK A;  4F17 A;  4HVU A;  1K76 A;  4CC4 B;  1W1F A;  2L2P A;  4J9G A;  3EGU A;  2KRO A;  1N5Z A;  2JW4 A;  2RQU A;  4J9B A;  1AWX A;  1SSH A;  1WLP B;  3JV3 A;  1JU5 C;  1YWO A;  2JS0 A;  1NLO C;  2DNU A;  2O9V A;  1ZUU A;  2MOX A;  2EYW A;  2F2W A;  2X3X D;  2CDT A;  2L3P A;  4R0K A;  1J3T A;  1WYX A;  2DE0 X;  1H8K A;  2EYZ A;  1M3C A;  1K9A A;  2EVR A;  2EYY A;  1OPK A;  3EG2 A;  1EFN A;  1AVZ C;  1T3L A;  4OMP A;  1U06 A;  4RTV A;  1GBR A;  1YP5 A;  1X6B A;  3I9Q A;  1UG1 A;  3UA7 A;  1G83 A;  1M27 C;  4X1V A;  1RUW A;  4EIK A;  2ABL A;  1BK2 A;  1ZBJ A;  3I5S A;  4JPB W;  2EGA A;  2CUD A;  4HXJ A;  3O5Z A;  1JXM A;  3M0P A;  4HVW A;  2F2X A;  1OPL A;  1Z9Q A;  2IIM A;  1UJY A;  2FRY A;  3PE0 A;  2K9G A;  1YCS B;  1UGV A;  3EG3 A;  1AWW A;  2K6D A;  2H8H A;  2NUZ A;  1E6G A;  4FSS A;  2BTT A;  4E6R A;  2DJQ A;  1JO8 A;  3A98 A;  2ED0 A;  1JEG A;  2KRS A;  1X43 A;  2GNC A;  5GJW B;  1BU1 A;  2B86 A;  3VS2 A;  4AFZ C;  1KFZ A;  2ENM A;  2HCK A;  2K79 A;  2DA9 A;  1WXT A;  2LZ6 B;  4Z88 A;  3U23 A;  4QT7 A;  3CQT A;  2AKL A;  4LUD A;  4AFQ C;  3M0T A;  4J9E A;  2J7I A;  1ZSG A;  2RQT A;  4ORZ A;  2XMF A;  2AZV A;  2DYB A;  3M0S A;  5IHI A;  3C0C A;  1HSQ A;  2KGT A;  1E7O A;  4Z89 A;  2YUO A;  1BBZ A;  2KRM A;  5I22 A;  1SRL A;  4RTT A;  1W70 A;  1YNZ A;  2LJ1 A;  3SEM A;  1FYN A;  2LMJ A;  1X27 A;  2YSQ A;  5FWB A;  3M0U A;  4LE9 A;  1WI7 A;  4AG2 C;  2CSI A;  2ESW A;  1W6X A;  2KE9 A;  1QWF A;  3NPF A;  3VRZ A;  1YN8 A;  5IXF A;  2PZ1 A;  1H3H A;  1M3B A;  3ZL7 C;  4OMQ A;  4ESR A;  2YUQ A;  3VS7 A;  1ZUY A;  4LNP A;  2I0N A;  3VS4 A;  1VYT A;  3THK A;  2YDL A;  3EG1 A;  1QCF A;  2M0Y A;  2LQN A;  2MCN A;  2DX1 A;  3I35 A;  2FO0 A;  2ROT A;  2LJ3 A;  2GTO A;  2DLP A;  3LH5 A;  1BB9 A;  4RTU A;  5GJV B;  1GL5 A;  2AK5 A;  2KXD A;  4OMN A;  4D8K A;  1NM7 A;  2EGC A;  2HEQ A;  3NHN A;  1X2K A;  2C0O A;  1AWO A;  1X69 A;  2RMO A;  1UHC A;  2J06 A;  2KR3 A;  2YUN A;  2DMO A;  3KFV A;  2CRE A;  5I11 A;  4J9H A;  4DEX A;  2KBT A;  1YWP A;  3VS0 A;  1GCQ A;  3VS6 A;  3SHW A;  1AEY A;  3H0H A;  2OAW A;  1UHF A;  1T3S A;  2YT6 A;  1SRM A;  1TUD A;  3ULR B;  2EW3 A;  2W10 A;  1RLP C;  1K0X A;  2C0T A;  4LUE A;  2JM8 A;  1M8M A;  2FG0 A;  5IH2 A;  2O88 A;  2FEI A;  2J05 A;  2O2O A;  4JZ3 A;  1AWJ A;  1RI9 A;  3NGP A;  4J9I A;  4OML A;  2VVK A;  3H41 A;  4IIM A;  4OMO A;  2SRC A;  2EBP A;  1A0N B;  1OEB A;  2L3Q A;  4K11 A;  2MIO A;  1PKT A;  1NLP C;  2RQV A;  2J6O A;  4JJB A;  1Y0M A;  4RTZ A;  2FPF A;  2LCS A;  2JM9 A;  1IO6 A;  2DVJ A;  1UE9 A;  1AZG B;  1WX6 A;  1Z9Z A;  4AFS C;  2KRN A;  2PTK A;  2O31 A;  3UAT A;  2V1Q A;  1CSK A;  1HD3 A;  1M3A A;  5HCK A;  1T0H A;  5FW9 A;  2GTJ A;  2CH4 W;  3TSW A;  1X2Q A;  2DBM A;  2VKN A;  5IXB A;  1UTI A;  1PRL C;  2A28 A;  4RUG A;  1VA7 A;  2K7A A;  4RTW A;  2O9S A;  1QKX A;  5IHN A;  1I07 A;  2LX7 A;  2LP5 A;  2W0Z A;  1OOT A;  1AD5 A;  2CT4 A;  4J9C A;  2JMC A;  1PKS A;  4HCK A;  1ABO A;  1PHT A;  2KNB B;  3M0Q A;  1WXU A;  1UEC A;  4Z8A A;  2FPE A;  1U5S A;  1GCQ C;  2JT4 A;  1H92 A;  4LN2 A;  2HDA A;  1K1Z A;  1KSW A;  3FJ5 A;  1QLY A;  1MV0 B;  2GQI A;  3EG0 A;  2X3W D;  1Y57 A;  2BZY A;  2EPD A;  1PRM C;  1JXO A;  2RPN A;  1GFC A;  3GBQ A;  2C0I A;  3RBB B;  2JXB A;  2LJ0 A;  4AG1 C;  4GLM A;  1WXB A;  1XOV A;  1FMK A;  2E5K A;  2JS2 A;  1ABQ A;  1PNJ A;  1B07 A;  2DM1 A;  3VS3 A;  1JQQ A;  3PVL A;  5EC7 A;  1CKB A;  2ECZ A;  2VWF A;  2M51 A;  1M30 A;  1HJD A;  1GBQ A;  2KT8 A;  4JZ4 A;  2CUB A;  2EGE A;  1TUC A;  2CT3 A;  2J6K A;  1X6G A;  2J6F A;  2FRW A;  2RF0 A;  4CC3 A;  3VRY A;  2HSP A;  2D8J A;  4J9D A;  1S1N A;  2ROL A;  4DEY A;  2JTE A;  4KRT A;  3EHQ A;  2L3S A;  2AZS A;  1ARK A;  1MV3 A;  4D8D A;  3NMZ C;  3RNJ A;  1LCK A;  2V1R A;  2A37 A;  1NEB A;  2A36 A;  2KXC A;  5ECA A;  2KT1 A;  2K3B A;  2CSQ A;  2LNH B;  4HVV A;  2FPD A;  1SPK A;  4ZNX A;  1SHF A;  1GRI A;  1KIK A;  3TVT A;  1UFF A;  2RN8 A;  3H0I A;  1NYG A;  1U3O A;  1V1C A;  1AOJ A;  3REA B;  1G2B A;  2DL5 A;  2AKK A;  2JMA A;  1VYV A;  4OMM A;  1WIE A;  2F2V A;  2ED1 A;  1SHG A;  3EHR A;  2RNA A;  1SEM A;  2LQW A;  1E6H A;  2DIL A;  2GBQ A;  2RQW A;  2DL7 A;  2EQI A;  4IIO A;  1WFW A;  2DRM A;  1QKW A;  1B3Q A;  1ZX6 A;  1K0S A;  2QDL A;  3M0R A;  1GCP A;  1WA7 A;  2OJ2 A;  4GBQ A;  2RQR A;  3UF4 A;  4JJD A;  2KYM A;  3IQL A;  2CH4 A;  4A63 B;  1NEG A;  2KEA A;  1UJ0 A;  2OI3 A;  3TSZ A;  1T0J A;  2K2M A;  1AZE A;  1GFD A;  3UA6 A;  3PVQ A;  5L23 A;  1WDX A;  1I0C A;  3QWX X;  4CC7 A;  4F14 A;  1KJW A;  2BZ8 A;  1ZLM A;  4CC2 A;  2A08 A;  5IHK A;  2NWM A;  2PNI A;  1VYU A;  2DL4 A;  1CKA A;  2DBK A;  4J9F A;  1K4U S;  1NG2 A;  3REB B;  2KYB A;  2DF6 A;  2L0A A;  4F16 A;  3VS1 A; 
#chains in the Genus database with same CATH topology
 1N8R U;  4JJC A;  5GMK h;  4RTX A;  2D9T A;  2V8J A;  1UUE A;  1Y71 A;  3CPF A;  3HHT B;  3I5R A;  4C92 C;  1I1J A;  4C92 D;  2D0N A;  2HBW A;  1RAF B;  4N0A A;  3X24 B;  4PJO C;  2DL8 A;  1K8A U;  2SEM A;  2DL3 A;  4F17 A;  2EQU A;  5AT1 B;  1K76 A;  3OYL A;  3S6W A;  2L2P A;  3OYE A;  4OB1 B;  3Q1J A;  2DET A;  2JW4 A;  3CCR Q;  2NUP B;  4J9B A;  1AWX A;  4DBH A;  1YWO A;  1BKB A;  1NLO C;  4QQG A;  2X3X D;  2ZGW A;  2CDT A;  3PMI A;  1J3T A;  1VQ5 A;  1VQK T;  1WYX A;  3JB9 G;  1D1B A;  2QTX A;  3L2R A;  3EH1 A;  2EYZ A;  2EVR A;  5I2M A;  3EG2 A;  1NJI R;  3OS0 A;  1T3L A;  3M57 A;  3SWN A;  4M7A F;  4RTV A;  1DJ7 B;  1YP5 A;  2JTM A;  1ZA1 B;  2DTI A;  3UA7 A;  2RO0 A;  1OZ2 A;  1BK2 A;  1XNI A;  2EGA A;  2CUD A;  1JXM A;  4E7S A;  3CCR A;  4F7U F;  5KH6 A;  3HTR A;  5J39 A;  2FRY A;  1GXI E;  2K9G A;  4M78 F;  4Y91 A;  1AWW A;  3H8Z A;  2NUZ A;  1VQ7 Q;  1WHM A;  1QVP A;  3OYM A;  2QQS A;  4N4H A;  2DJQ A;  1JO8 A;  3A98 A;  1WHL A;  4C92 E;  1YJ9 T;  3MET A;  1X75 C;  1Q7Y R;  1MGQ A;  5I2S A;  2KRS A;  2RA2 A;  3VS2 A;  4AFZ C;  1KFZ A;  2ENM A;  1ZBX A;  3A8M B;  5GAM j;  1HXD A;  3I56 T;  1VQN T;  3CCU Q;  4Z88 A;  3KUF A;  4DBF A;  3CCM T;  4DA4 A;  2E10 A;  4RCC A;  3JSC A;  1U1S A;  4AFQ C;  3M0T A;  4J9E A;  3CC4 A;  1ZSG A;  4QVZ A;  3M59 A;  4HA8 A;  2V8K A;  1YCY A;  5CIU A;  2FZC B;  1YHQ T;  2P0P A;  1VQ6 A;  1R0B G;  4Z89 A;  3SWN C;  1BBZ A;  1VIF A;  4FIB A;  1W70 A;  2X9H A;  2GCX A;  1X27 A;  5FWB A;  5KYW B;  4FL6 A;  5CKB A;  1K73 U;  2MF2 A;  4AG2 C;  2QGG A;  4C5E A;  2KE9 A;  1FMV A;  3UWN A;  3VRZ A;  4FU6 A;  5IXF A;  1VQ4 T;  3BFM A;  3OY9 A;  2PZ1 A;  1H3H A;  1HYO A;  2V26 A;  4RCB A;  4PFP A;  2CP7 A;  4HCC A;  1VYT A;  3THK A;  1IHV A;  8AT1 B;  2LCL A;  3I56 Q;  1LNX A;  2JN0 A;  4C92 F;  4BDZ A;  1SG5 A;  1SF9 A;  4PJJ A;  4M7D A;  4PJO E;  1MMG A;  1ZSZ A;  3LH5 A;  1VQ6 Q;  1X01 A;  2KXD A;  1NM7 A;  3GLX A;  3ME9 A;  3G4S Q;  3CPW S;  1X2K A;  2C0O A;  3QJY A;  3DB4 A;  5LJ5 d;  5GAO l;  4MDX A;  4OP0 A;  4M78 B;  4M75 B;  2YUN A;  4M77 B;  3CC4 T;  2DMO A;  3F70 A;  2QQA A;  3KFV A;  1LPL A;  4J9H A;  3RR6 A;  4LD6 A;  4FT2 A;  2OAW A;  4M7A G;  2YT6 A;  1QW1 A;  2PU9 B;  4J6W A;  5CR2 A;  3L2V A;  1ZA2 B;  1K0X A;  3OA6 A;  2AT1 B;  1M8M A;  2FZK B;  2O88 A;  2O2O A;  4PLI A;  4JZ3 A;  1RI9 A;  1OI1 A;  1U1T A;  2DTO A;  3SB2 A;  3H41 A;  1KD1 C;  4JDS A;  4IIM A;  4OMO A;  2DFU A;  3CPW P;  2EBP A;  3I55 A;  1XQH A;  2MIO A;  4K11 A;  1NLP C;  3ZBD A;  1WJS A;  1NE8 A;  3CME A;  4RTZ A;  2HKN A;  1IO6 A;  4JRK A;  1WX6 A;  1M8V A;  2PTK A;  2O31 A;  2DXT A;  2MYS A;  5KE3 A;  2DKG A;  1HD3 A;  5HCK A;  1VQ9 T;  1T0H A;  4XTX A;  2Y90 A;  3CD6 Q;  3BW1 A;  3TSW A;  2KK4 A;  4BY6 C;  3CCV T;  4RUG A;  1VA7 A;  2K7A A;  1C6V X;  1VQ8 Q;  2K5I A;  5IHN A;  3JCM g;  5GAN d;  4DOV A;  2LP5 A;  1QVF S;  3P8H A;  4J9C A;  3OYC A;  4LDV A;  1RL2 A;  1ABO A;  2KNB B;  3M0Q A;  1WXU A;  2FPE A;  2ZPH B;  5CVI A;  3CMA A;  2HDA A;  1K1Z A;  2QYZ A;  4M75 G;  5FU6 C;  4XU0 A;  1N8R C;  2LVM A;  5KYU B;  2CP3 A;  2GQI A;  3OYK A;  1JXO A;  1GFC A;  4C8Q G;  4KUL A;  3RBB B;  1TSF A;  2OAU A;  2JXB A;  2LJ0 A;  4AG1 C;  4GLM A;  3ZFJ A;  1XOV A;  1TXQ A;  2YLC A;  1ABQ A;  3QDR B;  3VS3 A;  5KCH A;  4E7I A;  3JCM X;  3CME T;  2KT8 A;  3GNF B;  1YI2 T;  3OYY A;  4HT8 A;  2EGE A;  2J6K A;  5GAM g;  1EZZ B;  1N8R R;  4CC3 A;  3J81 E;  1M4Z A;  2D8J A;  1S1N A;  2ROL A;  3EFS A;  2L3S A;  2COW A;  2ZPB B;  1ARK A;  4NOY A;  2VAS A;  3RNJ A;  1LCK A;  1BI2 A;  2V1R A;  4C8Q B;  3CCV Q;  4UC4 A;  3H9N A;  1YIT T;  4II1 A;  2PUO B;  2K3B A;  1YJW Q;  2E3I A;  3SFM A;  4HVV A;  4A4K A;  4ZNX A;  2Y4Y A;  1SHF A;  1KIK A;  4PJO F;  4DOW A;  3UDC A;  3X26 B;  1NYG A;  1G3Y A;  4E7K A;  2OX7 A;  4E2F B;  3REA B;  4NL2 A;  3QSU A;  1VYV A;  3EGD B;  3CCJ T;  4PFO A;  3JCM J;  5J3B A;  4X34 A;  1SEM A;  1E6H A;  3GPL A;  5LJ3 e;  4L59 A;  2RK2 A;  5KYX A;  4C5I A;  3M0R A;  4M7A C;  1FX7 A;  1VQK A;  1M5Q 1;  4M7D C;  3CMA Q;  1Q82 U;  1OUL A;  2KYM A;  3CC7 T;  2KEA A;  3OW2 A;  1WQ7 A;  2OI3 A;  4M7D B;  1T0J A;  3HFO A;  2E65 A;  2VGN A;  4Z02 A;  9ATC B;  4QW2 A;  1WDX A;  4F14 A;  3MJX A;  3A8H B;  2BZ8 A;  1NJI C;  1QCO A;  3JCM c;  2NWM A;  2K3X A;  4ZTF A;  1VQ9 Q;  2E6N A;  3CCS Q;  1D0X A;  4BE2 A;  3REB B;  4O5V A;  4A54 A;  1PD0 A;  2ZPE B;  1VOM A;  1M2O A;  3WVD B;  1YJW T;  4M4Z A;  1QWE A;  1VQP T;  3VUB A;  3R6N A;  4CI0 C;  4PJO D;  5D6X A;  4MZM A;  5FWC A;  2CP0 A;  4A53 A;  1NYF A;  4CRI A;  2QEX A;  1Q81 R;  5FU7 C;  2GGR A;  5CO7 A;  4ANJ A;  1V29 B;  5CKD A;  5CQY A;  2VXF A;  3VS5 A;  1VQ7 T;  3LH0 A;  1MUZ A;  2D8H A;  1UEB A;  1B7T A;  5A0L A;  2EYX A;  1KD1 U;  4ZGD B;  3FEO A;  1IGU A;  4CC4 B;  1Q7Y C;  2COZ A;  1N5Z A;  5L8R E;  3JV3 A;  2CP2 A;  3C12 A;  3CC7 A;  2MOX A;  2L3P A;  3I55 T;  2CGH A;  2MI6 A;  5HK3 A;  4ZN1 A;  3NTH A;  3EGX A;  3V8K A;  2DO3 A;  4M78 D;  4FSX A;  4M75 D;  2RB6 A;  4OMP A;  2E3H A;  2LT4 A;  3G1J A;  3CCL Q;  1GBR A;  4F04 B;  1UG1 A;  4ZN3 A;  4QQD A;  1G83 A;  2EKO A;  3JCM d;  2FYK A;  3A8L B;  4X1V A;  3RKX A;  2DEQ A;  3E1S A;  1ZBJ A;  4M7A A;  1S72 T;  3LX7 A;  1JJ2 A;  4HVW A;  2OTL Q;  2F2X A;  1Z9Q A;  1UJY A;  4M77 C;  3PE0 A;  3OW2 S;  1D1A A;  2CKK A;  5LL6 S;  3EH2 A;  4FCY A;  1Q95 G;  5GAO m;  2L3R A;  1R77 A;  4E7Z A;  2EJG A;  2K6D A;  4DQ2 A;  3VYG A;  2DD5 A;  1VQP Q;  2LNV A;  2IVW A;  3BE3 A;  3G4S T;  2YXY A;  3QDF A;  4B6M A;  1JEG A;  2HKQ B;  2F1L A;  1X43 A;  1BU1 A;  3CCQ A;  2HCK A;  2K79 A;  2DA9 A;  4J83 A;  4OGC A;  1KQS S;  2YRC A;  2LZ6 B;  2KY9 A;  1RAC B;  3CCL T;  3GNG A;  3CQT A;  2AKL A;  2XG8 D;  4J7I A;  4IUT A;  4RKU E;  2RQT A;  2F5T X;  5IAY A;  2AZV A;  4EPC A;  4FW2 A;  5HK0 A;  1HSQ A;  1E7O A;  5KYN A;  4OB0 B;  1SRL A;  4XTV A;  1BCM A;  3QO3 A;  1YNZ A;  3A8G B;  2EFI A;  1HK9 A;  2FZG B;  1VQ8 A;  1FYN A;  2G3R A;  4FM4 B;  4E7H A;  3CCQ Q;  2YSQ A;  4LE9 A;  1WI7 A;  4XTY A;  3CCS T;  1I81 A;  2ESW A;  4F7U E;  3NPF A;  2EQK A;  3FDR A;  1P92 A;  3LWI A;  3E19 A;  2GFU A;  1WNL A;  1ZSZ C;  2X4W A;  4M77 A;  1OZ3 A;  3FIF A;  3CBP A;  2R57 A;  2YDL A;  3GOX A;  3EG1 A;  2ZPF B;  2M0Y A;  2LQN A;  1PG5 B;  1MMD A;  2MCN A;  2K5F A;  3CCV A;  2FO0 A;  2DPP B;  2ROT A;  4EMH A;  3FJP A;  4J8O A;  4C0D C;  1GL5 A;  1VQM T;  2A3L A;  3NHN A;  2RD1 A;  1H3Z A;  1EIF A;  1VQ5 T;  2QDY B;  2RMO A;  3TU4 K;  5GAN f;  3J80 E;  2J06 A;  2LTO A;  1JJ2 S;  2KR3 A;  5LJ5 j;  2KMT A;  3OYD A;  2OTJ T;  2CRE A;  1YHQ A;  4A4E A;  1WQW A;  1YWP A;  1GCQ A;  3CCE A;  2M9U A;  1Y7X A;  5LJ5 g;  4X9D A;  2I2L A;  2LQ8 A;  2YRD A;  1WZO A;  3H0H A;  1UHF A;  1WJQ A;  1YHQ Q;  1TUD A;  2L89 A;  4J6X A;  3M54 A;  1KQ2 A;  1RLP C;  3OBY A;  4HCZ A;  4LUE A;  2HQH A;  1YJN Q;  2KSS A;  2FG0 A;  3ER0 A;  2FEI A;  2J05 A;  1AWJ A;  2L5Q A;  4ZTJ A;  2SRC A;  1OEB A;  1YJW A;  3RDV A;  2FL7 A;  3OYA A;  2J6O A;  3T9N A;  2WAC A;  1IGQ A;  4P5N A;  1Z9Z A;  3G6E T;  3QBY A;  3RMS A;  3UAT A;  1YIT A;  1M3A A;  2DZ9 A;  1VQ7 A;  5DY9 A;  1QVG A;  3FLG A;  5FW9 A;  4XTZ A;  2VKN A;  1UTI A;  2A28 A;  1EX4 A;  1TWB A;  4J6Y A;  2WSC E;  1UGP B;  2O9S A;  2R5M A;  2W0Z A;  2R5A A;  1OOT A;  1MMA A;  2JMC A;  4F7U G;  4C92 B;  3RER A;  1JRI A;  4Z8A A;  2JT4 A;  1H92 A;  1QVF A;  2VGM A;  4XU3 A;  1QLY A;  1MV0 B;  4XU2 A;  1IXD A;  3EG0 A;  3OW2 P;  1Y57 A;  3URG A;  5KYY A;  5GAN 8;  3OYH A;  2EPD A;  3GBQ A;  2CS7 A;  1VQK Q;  3L1A A;  2C0I A;  2DVE A;  2LC4 A;  1WXB A;  4A4H A;  2F69 A;  2E5K A;  1W2B A;  2JS2 A;  4NS5 A;  2D0Q B;  2NUT B;  3WXM B;  2QA4 T;  2DXB A;  4KGZ B;  5GAN h;  5EC7 A;  1M30 A;  1N9R A;  2M0O A;  3M9Q A;  3OYF A;  4M7D D;  2CUB A;  1TUC A;  2CT3 A;  4YTL A;  2GFA A;  2J6F A;  3OS5 A;  3CME Q;  2FRW A;  3S3O A;  2RHZ A;  2RF0 A;  3VRY A;  4C0F A;  3WVE B;  1D3B B;  4OF1 A;  1OU9 A;  5HKC A;  2XDB A;  2RHU A;  2M02 A;  5GAN 3;  1MV3 A;  2MMP A;  3OS2 A;  5CCA A;  1RAD B;  5KYY B;  4PL6 A;  4KH0 B;  2OTL A;  1NEB A;  3MP8 A;  2A36 A;  3CD6 T;  5GAM d;  4R55 A;  1UGS B;  5CQX A;  2EYQ A;  4WF2 A;  3LLR A;  2RN8 A;  4PJO B;  3TQ7 P;  1U3O A;  2X35 A;  4C92 A;  1K73 C;  1TH7 A;  3CXC A;  5A2Q E;  1G2B A;  4E7J A;  2DXC A;  1Q81 C;  4A4F A;  8ATC B;  3UPU A;  1TS9 A;  4HCB A;  3OYN A;  2X4Y A;  3CPW A;  5FRN A;  1G5V A;  2LQW A;  3QG1 A;  3RES A;  2GBQ A;  3M55 A;  2EQJ A;  4IIO A;  1OQK A;  1QKW A;  4M75 E;  1B3Q A;  4M77 E;  3FC3 A;  4AMC A;  3CCR T;  2QDL A;  3R6O A;  1WA7 A;  2OJ2 A;  3FB9 A;  5CK9 A;  5GAN g;  3OYI A;  3CC7 Q;  4GBQ A;  4FYW B;  4M78 C;  2LQK A;  3EFR A;  4BE0 A;  1K73 R;  1VQL A;  2V8I A;  4MML A;  1AZE A;  3RIR A;  4IUU A;  3V8J A;  1OX9 A;  2BKD N;  1PSE A;  2XKO C;  1AT1 B;  4OB3 B;  3RMQ A;  1KJW A;  3PTA A;  3X28 B;  3S3N A;  3I56 A;  2DL4 A;  4KH1 B;  2DJZ A;  2JNG A;  2KVQ G;  1M1G A;  4J9F A;  2OTL T;  1NG2 A;  2A0F B;  3EGD A;  2KYB A;  2Y4X A;  2L0A A;  4XTU A;  1NBE B;  2YHT A;  3PIP A;  1VQ6 T;  2YWW A;  4C0G A;  3QZ9 B;  2HMA A;  3P8D A;  1M2V A;  1Y96 B;  5C0M A;  1W2B S;  1YI2 Q;  2BE7 D;  2QI2 A;  3DLM A;  4Y92 A;  5FU7 B;  4XU1 A;  4M7A E;  2QAZ A;  2BZX A;  1Q7Y U;  3HSB A;  3EG9 B;  5GAO n;  4RTY A;  2HL5 C;  3CCE Q;  3QWY A;  1TG0 A;  2HQX A;  2WSE E;  2E12 A;  1WHK A;  2D1X A;  4M78 A;  3RKW A;  1B34 B;  2VC8 A;  2EKH A;  3EFO A;  4L5G A;  3EFO B;  1W1F A;  4J9G A;  2QK0 A;  3QII A;  5LJ5 e;  2RJF A;  2C06 A;  2KRO A;  1WHH A;  2DIQ A;  2RQU A;  1QQJ A;  1WLP B;  3EG9 A;  2DXU A;  2GQV A;  4M77 D;  2JUF A;  2O9V A;  4J7F A;  2F2W A;  2KI7 A;  2O01 E;  4EMK C;  2XID A;  3HP9 A;  2DE0 X;  3VYH B;  4JLI A;  3MHX A;  1H8K A;  1IZ6 A;  1TTH B;  3JCM V;  1OPK A;  1KG1 A;  4MZT A;  1K8A C;  1U06 A;  2E4H A;  3I9Q A;  5M9O A;  1M27 C;  5C6S A;  2D6F A;  2E64 A;  1X6O A;  2ABL A;  4IUQ A;  3CCU A;  4PJO A;  4C8Q F;  2M1H A;  3JCM Q;  5GAO q;  4JRP A;  5LJ3 d;  1YJ9 A;  2LT1 A;  1S72 Q;  1OPL A;  4B9X A;  5DLQ E;  2XHC A;  5LJ5 h;  4M75 F;  5GAN 2;  1KHI A;  1YCS B;  2VXE A;  5GAO p;  1UGV A;  3OMG A;  3EG3 A;  1VQN A;  4LD9 K;  2H8H A;  1FWZ A;  1K8A R;  1E6G A;  3E9G A;  1C0M A;  4C8Q E;  2BTT A;  4XK8 E;  4A4G A;  2ED0 A;  4PJN A;  3A8O B;  3MP1 A;  2GNC A;  2XU8 A;  2B86 A;  3CBM A;  2P4T A;  1BCO A;  1I5O B;  1WXT A;  2EAY A;  2LCC A;  3G7Z A;  4QT7 A;  4R56 A;  1VUB A;  2J7I A;  1OU8 A;  4ORZ A;  2XMF A;  2OTJ Q;  5LJ3 f;  2DER A;  2DTH A;  1JB0 E;  3G71 Q;  1KC8 R;  2KGT A;  4PNO A;  2MK5 A;  3DKM A;  4C0Z A;  2YUO A;  2KRM A;  5I22 A;  4RTT A;  3MEA A;  2LMJ A;  1Q86 U;  5DLO A;  2CP6 A;  2ATC B;  2P84 A;  5D6W A;  1N6A A;  2HL3 A;  4M7D E;  3CMA T;  4ME7 A;  4FT4 A;  3INZ A;  1QWF A;  2BE9 B;  1M90 U;  3SWN B;  2QTV A;  1YN8 A;  4LXC A;  2YUQ A;  1MMN A;  3S3M A;  4D6W A;  3VS4 A;  3OSV A;  2RI2 A;  3PGG A;  3QHS A;  4QKU A;  4BB7 A;  1QCF A;  3DB3 A;  1M90 R;  2E6Z A;  2EIF A;  2DX1 A;  3I35 A;  2A7Y A;  4RG2 A;  2LJ3 A;  3HKS A;  2K57 A;  2DLP A;  1UGQ B;  1BB9 A;  2KAF A;  4RTU A;  1ZSZ B;  4KGX B;  2MWO A;  4OMN A;  1G3S A;  1MHN A;  2EGC A;  2HEQ A;  1YI2 A;  1AWO A;  4O6J A;  2QXF A;  3J7A F;  1X69 A;  4KGV B;  1UHC A;  1H64 1;  1KC8 U;  3OYJ A;  4QVC A;  4KT0 E;  4B9W A;  4NL3 A;  3OBW A;  5I11 A;  3OS1 A;  5GAN j;  2PVO B;  1TU0 B;  2CP5 A;  3L2Z A;  1RAE B;  4MDW A;  1RAG B;  3OYG A;  3VS0 A;  2KQW A;  3CBO A;  1OYX A;  3QXE B;  1AEY A;  1T3S A;  3M58 A;  2DAQ A;  3ULR B;  2EW3 A;  2W10 A;  4RMO A;  3JCM e;  2K3Y A;  5GAO r;  2XD0 A;  4BI3 A;  4J9I A;  4BD3 A;  4IUR A;  2CZ7 B;  1VQ9 A;  2XIC A;  1FMW A;  4V2S A;  1VQ4 Q;  1BIB A;  1A0N B;  3ZEH A;  2L3Q A;  1U8R A;  2RQV A;  4J5Y A;  1RI0 A;  2BIV A;  2LCS A;  3JB9 H;  1K9M C;  2DVJ A;  3V7C A;  1VQO Q;  3CEY A;  3CCQ T;  1JBM A;  2KRN A;  3CCM A;  1CSK A;  4FYX B;  2GTJ A;  2CH4 W;  2DBM A;  4BUG A;  3QZ5 B;  3PMT A;  1KHC A;  2PUK B;  4AT1 B;  1WHJ A;  2QQB A;  3MCA B;  5GAM e;  2LX7 A;  3M4G A;  2DZC A;  2CT4 A;  1PKS A;  4HCK A;  1VQ4 A;  3C94 A;  4OB2 B;  1D09 B;  2AIR B;  1PHT A;  4IKF A;  3OYB A;  4JJN K;  1YIT Q;  3CC2 T;  4LN2 A;  3M53 A;  1VQP A;  3MP6 A;  3A5Z B;  4XAX B;  1WJR A;  5D6Y A;  2BZY A;  5LJ3 h;  3CC4 Q;  3E2U A;  1D0Z A;  2RPN A;  1M1F A;  2LX9 A;  1KQS P;  1V76 A;  4OMF B;  3C4S A;  5HY6 A;  3UT1 A;  1IRE B;  2HZY A;  4VUB A;  3HRT A;  4N4G A;  3JB9 J;  1B07 A;  1JQQ A;  1CKB A;  2QQR A;  2ECZ A;  3RKY A;  5LJ3 g;  1TUG B;  1XTD A;  3BY7 A;  1UB4 A;  4EMK A;  2JOY A;  1I5L A;  3JB9 F;  3TCJ A;  3A1P A;  4M7A D;  5GMK j;  4PKC C;  2F5K A;  2HSP A;  1NPP A;  5A0D A;  2XDD A;  1PSF A;  2H3E B;  4F7U B;  3NTI A;  2JTE A;  1QMC A;  2RM4 A;  4PLL A;  3OQ5 A;  4BI8 B;  3V8L A;  2VYT A;  3NMZ C;  2RI3 A;  3VUZ A;  2VUB A;  5LJ5 f;  3GF5 A;  1MND A;  2A37 A;  2DYI A;  1ZQ1 A;  4DBQ A;  1C1A A;  1KQ1 A;  4MMK A;  2CSQ A;  1UGR B;  3VKI A;  5I21 A;  2FPD A;  3TRE A;  1GRI A;  3ASK A;  1D3B A;  3KBG A;  3TVT A;  1UFF A;  5GAN 7;  1VIE A;  3CCM Q;  3V7R A;  1V1C A;  2ZZD A;  1AOJ A;  1M1K C;  4DBR A;  7AT1 B;  2AKK A;  3JCM b;  1O75 A;  2DD4 A;  4OMM A;  2F2V A;  5FRM A;  2FVU A;  5GMK m;  1SHG A;  1K9M U;  2E41 A;  3EHR A;  2NYS A;  5A0G A;  2R58 A;  2DIL A;  2HQE A;  2RQW A;  1YJ9 Q;  2DL7 A;  2PQW A;  1YFN A;  4PK4 A;  1WFW A;  3M4Y A;  2DRM A;  4PFZ A;  1ZX6 A;  3BDL A;  4C5G A;  1GCP A;  3M5A A;  3UF4 A;  1KK7 A;  4JJD A;  1NEG A;  3JB9 I;  4C8Q A;  4BI4 A;  3TSZ A;  1PCX A;  3PVQ A;  2QQ9 A;  1NJI U;  4FW1 A;  1I0C A;  3QWX X;  5DM7 R;  1B34 A;  4Q5W A;  2K2V A;  2AHJ B;  4CC2 A;  2A08 A;  3DLL A;  2PNI A;  2HBP A;  2QAS A;  1NPR A;  2E70 A;  6AT1 B;  2Z0W A;  3LGF A;  2O4X B;  4C5H A;  2RJE A;  3HPW A;  3VS1 A;  4WCI A;  4AFU C;  4OGE A;  5KE2 A;  2G6F X;  3NTK A;  3GP8 A;  4JRQ A;  1RLQ C;  2YUP A;  3PIO A;  4BDY A;  1LVK A;  3H0F A;  1I8F A;  5GAN e;  1UDL A;  4IUV A;  1PWT A;  2P4R A;  4M78 E;  1ZUK A;  1VQ8 T;  3L2U A;  1OV3 A;  4WTO B;  3JAM E;  1VQL Q;  5GAN 4;  2CZ0 B;  3JCM h;  2DRK A;  3CCS A;  2EWN A;  4HVU A;  4C0D B;  3L2W A;  1IB8 A;  3EGU A;  2ZPG B;  3JB9 D;  2CZ1 B;  1SSH A;  1JU5 C;  1VQN Q;  2JS0 A;  2DNU A;  3JCM f;  1ZUU A;  4GLK A;  2RHX A;  2GF7 A;  5EG2 A;  2EYW A;  1BIA A;  4R0K A;  5KYX B;  4ZGJ B;  2EJ9 A;  4KUI A;  3KXT A;  1M3C A;  1K9A A;  2HD0 A;  3QKJ A;  2EYY A;  2XI9 A;  1KC8 C;  1EFN A;  1AVZ C;  3CD6 A;  1X6B A;  3X25 B;  1RUW A;  1NZ9 A;  4EIK A;  2CZ6 B;  2P0K A;  3I5S A;  4JPB W;  2M16 A;  4HXJ A;  3O5Z A;  4C8Q D;  1G3T A;  3M0P A;  3CCJ A;  4JUV A;  1PM3 A;  3HL8 A;  4QQ6 A;  1R0C B;  3LWH A;  1G3W A;  1I4K 1;  4L6V 5;  2IIM A;  1W2B P;  1OX8 A;  1BI1 A;  3CCE T;  4LDX A;  3L2Q A;  4PJO G;  4FYV B;  2JJ9 A;  4XQ3 A;  1M2V B;  1WPY A;  1Y96 A;  4FSS A;  3CCL A;  2HAX A;  2E5Q A;  3CXC P;  1VQ5 Q;  4E6R A;  2K4Y A;  2COY A;  1M90 C;  3X20 B;  1SSF A;  5GJW B;  5IT9 E;  2DK3 A;  3QUI A;  1QVG P;  2QEX Q;  3JCM W;  3MEU A;  1SKU B;  4M75 A;  3BDU A;  1IRX A;  4E47 A;  3U23 A;  5GMK i;  2LDM A;  2K5L A;  4LUD A;  1Y07 A;  2VB6 A;  3QPH A;  3G6E A;  2RH2 A;  2DYB A;  3M0S A;  5IHI A;  3C0C A;  3E9F A;  3MPU B;  2QEX T;  3HRS A;  3QJ6 A;  4X9C A;  1BYM A;  2JVV A;  3SEM A;  2LJ1 A;  2NLU A;  1O9S A;  3M0U A;  5D7U A;  4EDU A;  2CSI A;  1W6X A;  3SD4 A;  4N4I A;  1IHW A;  5GAN 5;  2ZPI B;  1PD1 A;  1YJN A;  1M3B A;  3ZL7 C;  3PFS A;  4OMQ A;  4ESR A;  3G71 A;  1QP2 A;  3VS7 A;  1ZUY A;  5GMK e;  2CYZ B;  4LNP A;  4HKE A;  2I0N A;  2E1H A;  4LDY A;  2RJD A;  3LYI A;  2WSF E;  1M1K U;  1K9M R;  1AHJ B;  3RUX A;  2MPX C;  2QA4 A;  3CCJ Q;  2GTO A;  3LW5 E;  2NUP A;  1YIJ A;  5GJV B;  1LOJ A;  2AK5 A;  5FRO A;  5FLX E;  4D8K A;  4GY5 A;  2FHD A;  1RAA B;  2XK0 A;  4M7A B;  5CKH A;  4EMG A;  4F7U A;  2RI5 A;  1KQS A;  2RHY A;  4ELZ C;  2ZAE A;  2JZ2 A;  3CC2 A;  3VJP A;  3MEV A;  3QYG B;  4TVR A;  4DEX A;  2KBT A;  4LDW A;  3V7S A;  3P8B B;  2NUT A;  4ELY C;  2QA4 Q;  1S72 A;  3MEW A;  3VS6 A;  3CC2 Q;  3SHW A;  1XJW B;  3PT9 A;  2X51 A;  4JLG A;  1SRM A;  5GAM h;  5GAN 6;  2C0T A;  5J26 A;  2JM8 A;  5IH2 A;  1JJ2 P;  1G8X A;  2PVG B;  4KBM B;  2XDP A;  4N0A C;  4MZP A;  4OML A;  3NGP A;  4M75 C;  1BI0 A;  3MKD A;  2VVK A;  5CAI A;  1YBY A;  1QCN A;  1YJN T;  3G4S A;  1D0Y A;  3G71 T;  4HT9 A;  1PKT A;  5IN1 A;  4BY6 B;  2PVD B;  3EAE A;  1WHG A;  4JJB A;  1YIJ Q;  1Y0M A;  2FPF A;  4ZGE B;  2JM9 A;  2X4J A;  1Q82 C;  1UE9 A;  1AZG B;  3MO8 A;  4AFS C;  4M77 G;  1VQO T;  4IUP A;  3AT1 B;  1YIJ T;  2V1Q A;  1PC0 A;  3H6Z A;  3JRZ A;  1MNE A;  2P0Q A;  1X2Q A;  1LJO A;  5IXB A;  2MAM A;  1BI3 A;  2EQM A;  1PRL C;  2LRQ A;  3HRU A;  5CKE A;  4RTW A;  5FU6 B;  4C92 G;  1FXX A;  1QKX A;  3D7S B;  3L42 A;  1I07 A;  4FYY B;  5AYF A;  1AD5 A;  1F1B B;  2IPO B;  2JTF A;  1W4S A;  1Q82 R;  4RG8 A;  2KDS A;  4BAC A;  3CXC S;  5GAM f;  1M1K R;  1UEC A;  1N27 A;  1R8O B;  1U5S A;  1GCQ C;  4Y28 E;  1ZHI A;  2DEU A;  1KSW A;  3FJ5 A;  3QYH B;  4PJL A;  1QP3 A;  4JRI A;  2X3W D;  2ZCF B;  1QVF P;  1PRM C;  5CKF A;  3PNW C;  2DIG A;  1KD1 R;  3OMC A;  1VQM A;  2IG0 A;  3OB9 A;  2YRV A;  1FMK A;  1PNJ A;  3AHU A;  2DM1 A;  5KCO A;  3O8V A;  3PVL A;  1Q81 U;  4EMK B;  2RK1 A;  2VWF A;  4M7D F;  2M51 A;  4M7D G;  1HJD A;  3M56 A;  3I55 Q;  1GBQ A;  4JZ4 A;  2OTJ A;  1X6G A;  2HNI A;  3FRN A;  4BE1 A;  3VU3 C;  4PJM A;  1VQO A;  4J9D A;  4DEY A;  3NFC A;  1RAH B;  4KRT A;  1QVG S;  3EHQ A;  1N9S A;  4E7L A;  4KUD K;  2AZS A;  4ATO A;  2QG9 B;  4D8D A;  4XTW A;  1VQM Q;  2KXC A;  5ECA A;  2B8A A;  2EJF A;  2KT1 A;  2LNH B;  1D1C A;  3N5B B;  1M9S A;  1SPK A;  3SDZ A;  4M78 G;  2RJC A;  2FB7 A;  3H0I A;  3CCU T;  1WGS A;  2DL5 A;  2O4X A;  2JMA A;  1WIE A;  1Q86 C;  2ED1 A;  1RAB B;  2L8D A;  2RNA A;  2QGF B;  3VV0 A;  4QVD A;  3EGX B;  1VQL T;  2EQI A;  4C8Q C;  2VV5 A;  2YLB A;  3HFN A;  4LDU A;  1K0S A;  3JCM P;  2HSE B;  4M77 F;  2RQR A;  1TOV A;  3IQL A;  4JS5 A;  2CH4 A;  4A63 B;  1UJ0 A;  5KYU A;  3C95 A;  2K2M A;  1Q86 R;  1GFD A;  2H3J A;  3UA6 A;  5L23 A;  3TEE A;  5LJ3 j;  2BUD A;  4CC7 A;  4JS4 A;  3GIB A;  2X4X A;  1ZLM A;  3OSS C;  1RAI B;  5IHK A;  1VYU A;  5GMK l;  1CKA A;  4OVA A;  3LGL A;  2DBK A;  1K4U S;  3G6E Q;  2DF6 A;  2MWP A;  4F16 A;  5KYW A;  2RHI A;  1ACM B; 
#chains in the Genus database with same CATH homology
 4WCI A;  4AFU C;  4JJC A;  4M4Z A;  1QWE A;  2G6F X;  4RTX A;  3R6N A;  4Y92 A;  1UUE A;  1RLQ C;  2YUP A;  5FWC A;  3I5R A;  3H0F A;  1NYF A;  2BZX A;  4RTY A;  1UDL A;  1I1J A;  3QWY A;  1TG0 A;  2D0N A;  1PWT A;  2HBW A;  2P4R A;  2GGR A;  1ZUK A;  1OV3 A;  2D1X A;  2DL8 A;  3VS5 A;  1MUZ A;  2D8H A;  2EKH A;  2SEM A;  2DL3 A;  2EYX A;  2DRK A;  4F17 A;  4HVU A;  1K76 A;  4CC4 B;  1W1F A;  2L2P A;  4J9G A;  3EGU A;  2KRO A;  1N5Z A;  2JW4 A;  2RQU A;  4J9B A;  1AWX A;  1SSH A;  1WLP B;  3JV3 A;  1JU5 C;  1YWO A;  2JS0 A;  1NLO C;  2DNU A;  2O9V A;  1ZUU A;  2MOX A;  2EYW A;  2F2W A;  2X3X D;  2CDT A;  2L3P A;  4R0K A;  1J3T A;  1WYX A;  2DE0 X;  1H8K A;  2EYZ A;  1M3C A;  1K9A A;  2EVR A;  2EYY A;  1OPK A;  3EG2 A;  1EFN A;  1AVZ C;  1T3L A;  4OMP A;  1U06 A;  4RTV A;  1GBR A;  1YP5 A;  1X6B A;  3I9Q A;  1UG1 A;  3UA7 A;  1G83 A;  1M27 C;  4X1V A;  1RUW A;  4EIK A;  2ABL A;  1BK2 A;  1ZBJ A;  3I5S A;  4JPB W;  2EGA A;  2CUD A;  4HXJ A;  3O5Z A;  1JXM A;  3M0P A;  4HVW A;  2F2X A;  1OPL A;  1Z9Q A;  2IIM A;  1UJY A;  2FRY A;  3PE0 A;  2K9G A;  1YCS B;  1UGV A;  3EG3 A;  1AWW A;  2K6D A;  2H8H A;  2NUZ A;  1E6G A;  4FSS A;  2BTT A;  4E6R A;  2DJQ A;  1JO8 A;  3A98 A;  2ED0 A;  1JEG A;  2KRS A;  1X43 A;  2GNC A;  5GJW B;  1BU1 A;  2B86 A;  3VS2 A;  4AFZ C;  1KFZ A;  2ENM A;  2HCK A;  2K79 A;  2DA9 A;  1WXT A;  2LZ6 B;  4Z88 A;  3U23 A;  4QT7 A;  3CQT A;  2AKL A;  4LUD A;  4AFQ C;  3M0T A;  4J9E A;  2J7I A;  1ZSG A;  2RQT A;  4ORZ A;  2XMF A;  2AZV A;  2DYB A;  3M0S A;  5IHI A;  3C0C A;  1HSQ A;  2KGT A;  1E7O A;  4Z89 A;  2YUO A;  1BBZ A;  2KRM A;  5I22 A;  1SRL A;  4RTT A;  1W70 A;  1YNZ A;  2LJ1 A;  3SEM A;  1FYN A;  2LMJ A;  1X27 A;  2YSQ A;  5FWB A;  3M0U A;  4LE9 A;  1WI7 A;  4AG2 C;  2CSI A;  2ESW A;  1W6X A;  2KE9 A;  1QWF A;  3NPF A;  3VRZ A;  1YN8 A;  5IXF A;  2PZ1 A;  1H3H A;  1M3B A;  3ZL7 C;  4OMQ A;  4ESR A;  2YUQ A;  3VS7 A;  1ZUY A;  4LNP A;  2I0N A;  3VS4 A;  1VYT A;  3THK A;  2YDL A;  3EG1 A;  1QCF A;  2M0Y A;  2LQN A;  2MCN A;  2DX1 A;  3I35 A;  2FO0 A;  2ROT A;  2LJ3 A;  2GTO A;  2DLP A;  3LH5 A;  1BB9 A;  4RTU A;  5GJV B;  1GL5 A;  2AK5 A;  2KXD A;  4OMN A;  4D8K A;  1NM7 A;  2EGC A;  2HEQ A;  3NHN A;  1X2K A;  2C0O A;  1AWO A;  1X69 A;  2RMO A;  1UHC A;  2J06 A;  2KR3 A;  2YUN A;  2DMO A;  3KFV A;  2CRE A;  5I11 A;  4J9H A;  4DEX A;  2KBT A;  1YWP A;  3VS0 A;  1GCQ A;  3VS6 A;  3SHW A;  1AEY A;  3H0H A;  2OAW A;  1UHF A;  1T3S A;  2YT6 A;  1SRM A;  1TUD A;  3ULR B;  2EW3 A;  2W10 A;  1RLP C;  1K0X A;  2C0T A;  4LUE A;  2JM8 A;  1M8M A;  2FG0 A;  5IH2 A;  2O88 A;  2FEI A;  2J05 A;  2O2O A;  4JZ3 A;  1AWJ A;  1RI9 A;  3NGP A;  4J9I A;  4OML A;  2VVK A;  3H41 A;  4IIM A;  4OMO A;  2SRC A;  2EBP A;  1A0N B;  1OEB A;  2L3Q A;  4K11 A;  2MIO A;  1PKT A;  1NLP C;  2RQV A;  2J6O A;  4JJB A;  1Y0M A;  4RTZ A;  2FPF A;  2LCS A;  2JM9 A;  1IO6 A;  2DVJ A;  1UE9 A;  1AZG B;  1WX6 A;  1Z9Z A;  4AFS C;  2KRN A;  2PTK A;  2O31 A;  3UAT A;  2V1Q A;  1CSK A;  1HD3 A;  1M3A A;  5HCK A;  1T0H A;  5FW9 A;  2GTJ A;  2CH4 W;  3TSW A;  1X2Q A;  2DBM A;  2VKN A;  5IXB A;  1UTI A;  1PRL C;  2A28 A;  4RUG A;  1VA7 A;  2K7A A;  4RTW A;  2O9S A;  1QKX A;  5IHN A;  1I07 A;  2LX7 A;  2LP5 A;  2W0Z A;  1OOT A;  1AD5 A;  2CT4 A;  4J9C A;  2JMC A;  1PKS A;  4HCK A;  1ABO A;  1PHT A;  2KNB B;  3M0Q A;  1WXU A;  1UEC A;  4Z8A A;  2FPE A;  1U5S A;  1GCQ C;  2JT4 A;  1H92 A;  4LN2 A;  2HDA A;  1K1Z A;  1KSW A;  3FJ5 A;  1QLY A;  1MV0 B;  2GQI A;  3EG0 A;  2X3W D;  1Y57 A;  2BZY A;  2EPD A;  1PRM C;  1JXO A;  2RPN A;  1GFC A;  3GBQ A;  2C0I A;  3RBB B;  2JXB A;  2LJ0 A;  4AG1 C;  4GLM A;  1WXB A;  1XOV A;  1FMK A;  2E5K A;  2JS2 A;  1ABQ A;  1PNJ A;  1B07 A;  2DM1 A;  3VS3 A;  1JQQ A;  3PVL A;  5EC7 A;  1CKB A;  2ECZ A;  2VWF A;  2M51 A;  1M30 A;  1HJD A;  1GBQ A;  2KT8 A;  4JZ4 A;  2CUB A;  2EGE A;  1TUC A;  2CT3 A;  2J6K A;  1X6G A;  2J6F A;  2FRW A;  2RF0 A;  4CC3 A;  3VRY A;  2HSP A;  2D8J A;  4J9D A;  1S1N A;  2ROL A;  4DEY A;  2JTE A;  4KRT A;  3EHQ A;  2L3S A;  2AZS A;  1ARK A;  1MV3 A;  4D8D A;  3NMZ C;  3RNJ A;  1LCK A;  2V1R A;  2A37 A;  1NEB A;  2A36 A;  2KXC A;  5ECA A;  2KT1 A;  2K3B A;  2CSQ A;  2LNH B;  4HVV A;  2FPD A;  1SPK A;  4ZNX A;  1SHF A;  1GRI A;  1KIK A;  3TVT A;  1UFF A;  2RN8 A;  3H0I A;  1NYG A;  1U3O A;  1V1C A;  1AOJ A;  3REA B;  1G2B A;  2DL5 A;  2AKK A;  2JMA A;  1VYV A;  4OMM A;  1WIE A;  2F2V A;  2ED1 A;  1SHG A;  3EHR A;  2RNA A;  1SEM A;  2LQW A;  1E6H A;  2DIL A;  2GBQ A;  2RQW A;  2DL7 A;  2EQI A;  4IIO A;  1WFW A;  2DRM A;  1QKW A;  1B3Q A;  1ZX6 A;  1K0S A;  2QDL A;  3M0R A;  1GCP A;  1WA7 A;  2OJ2 A;  4GBQ A;  2RQR A;  3UF4 A;  4JJD A;  2KYM A;  3IQL A;  2CH4 A;  4A63 B;  1NEG A;  2KEA A;  1UJ0 A;  2OI3 A;  3TSZ A;  1T0J A;  2K2M A;  1AZE A;  1GFD A;  3UA6 A;  3PVQ A;  5L23 A;  1WDX A;  1I0C A;  3QWX X;  4CC7 A;  4F14 A;  1KJW A;  2BZ8 A;  1ZLM A;  4CC2 A;  2A08 A;  5IHK A;  2NWM A;  2PNI A;  1VYU A;  2DL4 A;  1CKA A;  2DBK A;  4J9F A;  1K4U S;  1NG2 A;  3REB B;  2KYB A;  2DF6 A;  2L0A A;  4F16 A;  3VS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...