1QWKA

Structural genomics of caenorhabditis elegans: hypothetical 35.2 kda protein (aldose reductase family member)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
312
structure length
312
Chain Sequence
b'TASIKLSNGVEMPVIGLGTWQSSPAEVITAVKTAVKAGYRLIDTASVYQNEEAIGTAIKELLEEGVVKREELFITTKAWTHELAPGKLEGGLRESLKKLQLEYVDLYLAHMPAAFNDDMSEHIASPVEDVWRQFDAVYKAGLAKAVGVSNWNNDQISRALALGLTPVHNSQVELHLYFPQHDHVDFCKKHNISVTSYATLGSPGRVNFTLPTGQKLDWAPAPSDLQDQNVLALAEKTHKTPAQVLLRYALDRGCAILPKSIQENRIKENFEVFDFSLTEEDIAKLEESKNSQRLFLQDFMTGHPEDAFAAER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aldo-keto reductase family 1 member C1
molecule tags Oxidoreductase
source organism Caenorhabditis elegans
publication title Structural genomics of Caenorhabditis Elegans: Hypothetical 35.2 kDa protein (aldose reductase family member)
rcsb
total genus 107
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2003-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1qwkA00
3LZ5A 1VBJA 4FA3A 3GHUA 3RX4A 2CLPA 3R8GA 3V0SA 3V36A 2F38A 3GUGA 2PDPA 4F40A 4H7CA 4XZNX 2PDQA 1RY8A 3COTA 1AZ2A 4JIIX 2PDJA 2IPGA 3U2CA 4QXIA 4XVEA 4LBRA 4GCAA 3GHSA 3LENA 3R6IA 4HBKA 3LD5A 1EXBA 5M2FX 3ONCA 5LIYX 3H7RA 2HDJA 1EF3A 4WDUA 1J96A 2PD5A 1AZ1A 2HVOA 4JQAA 1ZUAX 4WRHA 3G1RA 3MC5A 5LIUX 4XO6A 3CAQA 1PYFA 3M0IA 2AGTA 1QWKA 1T40A 2PDFA 2BGSA 1SM9A 2ACSA 4XVDA 4HMNA 2C91A 1S1PA 3C3UA 4LB3A 1JEZA 3UP8A 3CAVA 2R9RA 2DUZA 3Q67A 3V35A 2PDHA 4JTAA 5LIWX 4L1WA 2FZ8A 3NTYA 4L1XA 3T42A 1Z8AA 4G5DA 5LIKX 3V0UA 2FZBA 4QX4A 2FZDA 1VP5A 2HVNA 3UZZA 2INEA 4JTDA 5AZ1A 2IQ0A 1MZRA 2BGQA 4Q7BA 4YVPA 3LBOA 3WBXA 2PDCA 3M4HA 4LAUA 4PMJA 4LB4A 1PZ0A 4GA8A 3MB9A 2NVDA 1LQAA 1ZSXA 2ACRA 2FGBA 1K8CA 1XF0A 3UZXA 2A79A 1IHIA 2WZMA 1Q5MA 3WG6A 1AH3A 3BV7A 2PDIA 2PDNA 4NKCA 2PFHA 4PRRA 2J8TA 3LQLA 1S1RA 1X96A 2HV5A 1S2AA 4WDTA 2NVCA 2P5NA 3R8HA 4H8NA 1FRBA 3ERPA 1Q13A 3H7UA 2ACQA 4RPQA 4WEVX 5HA7A 4GACA 3RX3A 2WZTA 3LNMA 2BP1A 4XZMX 3GHTA 3CV6A 4JTRA 4YU1A 3LN3A 4WGHA 3N2TA 4PUUA 3GHRA 4JIRA 3V0TA 4PUWA 1PZ1A 4XO7A 4XZIA 5DANA 2R24A 1UR3M 4XZHA 3WBWA 1XJBA 4AUBA 2INZA 1A80A 2PDWA 2HEJA 5JH2A 3EB3A 4GQGA 4PRTA 1C9WA 4JQ4A 1EKOA 2FZ9A 2DV0A 4XK2A 1OG6A 4DBUA 2IPWA 1T41A 2PF8A 1RALA 2IS7A 1HQTA 1R38A 1ADSA 3Q65A 4JTCA 4EXAA 3R7MA 5HNTA 3FJNA 1IEIA 3DN5A 2IPJA 3UG8A 1YE4A 1PWLA 4ICCX 3UWEA 3UFYA 4R9OA 2ACUA 3G5EA 3LEPA 1EL3A 3CASA 2IKHA 1MRQA 4YS1A 2IKGA 1X98A 3UZWA 1US0A 1YE6A 2I16A 2I17A 4XZLX 1PWMA 1LWIA 4FAMA 1YNQA 3EB4A 2HE8A 3WCZA 4GABA 3R58A 2PDUA 3FX4A 2PDMA 4ZFCA 1AH4A 1RY0A 2PDYA 4JIHA 3CV7A 3D3FA 4DBSA 1ZQ5A 3UZYA 3N6QA 2PEVA 1YNPA 3B3DA 5JH1A 4DBWA 1Z89A 2HE5A 4MHBA 2VDGA 2IPFA 3H4GA 3DOPA 4FALA 2F2KA 3VXGA 3ONBA 5AZ0A 2PZNA 1X97A 4FZIA 2PDBA 3QKZA 4PR4A 4EXBA 4LBSA 1M9HA 1QRQA 1XGDA 1AH0A 4YVXA 3WBYA 4YVVA 3O0KA 2FVLA 3UGRA 1ZGDA 3BURA 4IGSA 1Z3NA 4ASTA 4LAZA 2IKIA 4JQ1A 2IQDA 3BCJA 4IJRA 3O3RA 1HW6A 1S2CA 4WDXA 4DZ5A 4JQ2A 2PDGA 5C7HA 4GQ0A 3UYIA 4OTKA 2IKJA 3RX2A 2QXWA 3BUVA 3LQGA 3R43A 2DUXA 4WDWA 3R94A 3P2VA 5KETA 3M64A 3EAUA 4IJCA 3LZ3A 3CMFA 2ALRA 4XAPA 5LIXX 3F7JA 2PDLA 2ISFA 2PDXA 4JQ3A 1GVEA 2PD9A 4I5XA 3LUTA 1MI3A 5HNUA 1Z9AA 3KRBA 2PDKA 4QBXA 4GIEA 4Q3MA 3S3GA 4QR6A 1AFSA 4JTQA
chains in the Genus database with same CATH superfamily
2OODA 2CBJA 3UR2A 5CBBA 4A21A 3NEVA 4Z1CA 2ZWYA 1UR1A 3M7SA 1LORA 4MNLA 3V5CA 4IMGA 3R4IA 1F4HA 4AF0A 2WVSA 1W1ZA 2Y85A 2NWSA 3EOEA 4AZ7A 3AYSA 5D8WA 1H0IA 1TV5A 3QY8A 4LBRA 4N9BA 4XD4A 1KBBA 5IRPA 1MVYA 3LD5A 4F0RA 4Z2LA 4L5ZA 1EHNA 1RQHA 4Q32A 3RO8A 2FDMA 3IJIA 1TIWA 1E4MM 4JYEA 4LGXA 4FX8A 1SMAA 1LDCA 5HR7A 4FLQA 1EC7A 1SW0A 1QJWA 1TPDA 4V15A 1JQVA 3MT1A 2V5LA 3H2NA 4U5KA 1XV8A 1B4EA 4CQ8A 1LL4A 3WLNA 3BLLA 3ZLGA 3DGRA 1OJXA 3IARA 5H2ZA 3E2VA 1QDSA 2VC5A 3OODA 1SPQA 3LXCA 1VB9A 5B80A 4JHZA 3MWCA 3W6MA 2VOTA 5IFTA 2HVMA 3T55A 6REQB 2PWHA 4F0LA 3IK4A 3CWOX 1XLKA 4M1BA 5IM51 3TN3A 3I7RA 5ABGA 3P0WA 1LCOA 1YXDA 2ATSA 2E8YA 2ZXBA 4FX7A 1AW1A 1OX4A 3IAQA 2ONEA 3DFHA 4RKAA 4G9PA 2AAAA 3FSUA 1SVDA 1NU5A 1RVGA 1O68A 1LQ2A 4JTKA 1LJYA 2CLHA 2ZUVA 3H53A 2ZUUA 5CLTA 1JYXA 6XIMA 1EGVA 1SZGA 2GK1A 3R79A 4E8DA 2J9YA 1PV8A 3GTNA 3Q94A 3BQ5A 3WH7A 1SFJA 2H3BA 1HF6A 2XFWA 3GR4A 4X60A 1W2PA 2Y5JA 1NY1A 3S6TA 4DPPA 3AICA 1IZKA 2YLLA 1AD4A 5FI8A 2E3ZA 2P5NA 1Z44A 4B3ZA 4BHYA 2MNRA 5HA7A 4HK5A 3TQ0A 2YZRA 1XSKA 3LSCA 1EXPA 4UQBA 3GR7A 4ORIA 3DCPA 4AIEA 4AY8A 3CNYA 1E15A 3QFEA 4KCVA 3WQ8A 1ZPTA 3L4WA 2NVAA 2OU4A 4YWIA 4WJ8A 4HYRA 4RZ5A 2PLMA 2PCQA 4BA0A 2Y7FA 3DC0A 4IXHA 3WSUA 3WD4A 3VDHA 3AIVA 3KFTA 1C8QA 3WBWA 1JPIA 2O55A 4JXCA 4HP5A 5JU6A 2XIBA 1UQYA 1A4LA 4NF7A 1ODZA 1X6UA 3ABQA 4P8WA 3TN6A 5D2WA 1TKKA 1WKFA 4RNIA 3MVTA 3MCMA 5I02A 1A5KC 1THFD 2DIEA 4JTEA 1VCGA 1BVNP 3FJNA 3QGKC 2CW6A 1VLWA 1XYFA 1WBJA 3N11A 3LCIA 3DFNA 1VENA 4P7NA 4R9OA 4WUIA 3PBGA 1DTUA 2QCCA 3QV6A 1O66A 1IXNA 1N8IA 3QHMA 3OLGA 1PWMA 3HG3A 5IXEA 4LUJA 1YNQA 2J74A 1K9TA 2NV1A 3WJZA 3FX4A 4UTIA 1C91A 3POCA 3E49A 3W7QA 4UWMA 5J5DA 1RJRA 2Z00A 3WEZA 4FPSA 1QNQA 1IEWA 3PK7A 1Z89A 4BR1A 1X1NA 1DL3A 1EEXA 3AU6A 3H4GA 5H8UA 3ZLFA 1XLHA 3N6JA 3DFSA 3G3MA 1H7RA 2VZUA 1EZ2A 3EB2A 4FF7A 3GLCA 1RD6A 1Q6GA 5DN1A 4NJGA 4EWJA 4Q8OA 1JRBA 5I07A 2YCLB 1ZBVA 3ITCA 1JCNA 1D8CA 1PDZA 1AJ0A 1WAUA 2XIMA 4QJ5B 3HQPA 1HKWA 3ARWA 4LQ1A 4O13A 1Z3NA 2FTWA 3W71A 1DVJA 3O6DA 1B5TA 3FXYA 2F6XA 4XBKA 2B81A 1ZJBA 4FOKA 3TR9A 3RXZA 4Q8PA 5AOUA 4PTWA 2VO5A 2C18A 3FGCB 3SIZA 3SB0A 4UFJA 2GSEA 5B7YA 3AS0A 3BL3A 3SJ3A 4IG2B 1Q6OA 1UHVA 3RCYA 1H41A 2BTMA 3I6RA 1OG0A 1M04A 3P93A 3N2MA 3TXZA 3LZ3A 4WF7A 4MWAC 1P6BA 3BMVA 1ICSA 2X0HA 2ISFA 3NL5A 2D2JA 4JQ3A 4RDVA 3UY7A 3LRLA 3RR4A 1CXHA 4WKHA 4RJEA 5DXXA 4I7WA 3DYMA 1C7SA 3U57A 3LHTA 4PMDA 4LC6A 4LVDA 2ZZ2A 2OJPA 5D03A 1H1NA 4RV8A 2J79A 3RRAA 4GZ7A 4CUCA 3WO8A 2BY2A 3NDZA 3THUA 1HJXA 2C79A 3WIJA 1O1ZA 2AL2B 3V0SA 2F38A 5KTLA 1EYWA 1XIHA 4AHPA 2W66A 2ZQ0A 3CEPA 1M7XA 4LUSB 3QGAC 3VMOA 3NL6A 3QTPA 2Z2BA 3W7HA 3SCRA 3N73A 4JS3A 2YCKX 2OCZA 1VR6A 4KWOA 3HZ3A 4H7VA 3UD6A 4AZCB 4K7YA 4QNWA 2VUYA 1JUKA 4DAIA 4EXQA 5CSSA 1VBRA 3DFTA 4YYFA 3W7OA 4LYRA 1TFVA 1BWKA 1EA0A 2WJDA 1JI1A 1MEWA 1OABA 3AWNA 3HBLA 1C9DA 3GNOA 2J75A 3M0IA 1LTDA 1GG0A 4CNNA 2QPSA 4WLCA 3UWZA 5D2VA 4MY9A 3SN4A 3MUAA 3QM3A 2YB4A 3DESA 4C1NB 5F2IA 5CPOA 2PU0A 1LT8A 3ZVIA 4XSLA 3ABXA 4TQTA 3UWVA 2WSYA 3CIWA 3AIQA 3NNTA 3DECA 1M3UA 3W7LA 1GORA 1K9DA 1K02A 4AD5A 4GI8A 3BLDA 3OVPA 4JTJA 1TYGA 2FZ8A 1UH4A 2ON3A 4NYYA 3OVRA 3HPAA 3C0SA 3WNOA 3RCNA 2VP8A 3T42A 1OX5A 4PUNA 3B0XA 2Z2AA 2A6NA 5B7ZA 2PB1A 8XIAA 3AYRA 4NVTA 2BGQA 2G95A 2VOMA 3SCPA 1XIBA 3THAA 4YVPA 1HGYA 4X0VA 3CHCA 1F3EA 3GVQA 4DZIA 3EA1A 3G0UA 5D9PA 5CC6A 4BKNA 1MW2A 4PTNA 5CJNA 4KW2A 2F8QA 3S83A 4TO8A 2G96A 3BOLA 4HIBA 3L0GA 2BMBA 4TV5A 4GC3A 1GYLA 3DIPA 3N3TA 2G5WA 4ZB5A 3NO5A 3DUGA 4OBSA 1G9HA 2PTYA 5H1WA 4UC5A 2X09A 3B9EA 3TLQA 2E25A 3E0FA 4MZ8A 2CLOA 1C29A 1XCXA 3ERPA 1TMLA 1V0KA 3B06A 2YBUA 3B9AA 1CNVA 3NVDA 1OGGA 2A5HA 5A8MA 4Y8FA 1E0UA 5HUOA 3KXQA 3H24A 4ATLA 3VMPA 3RMJA 3G8RA 3WEMA 1RVKA 3NPXA 4EACA 1SJDA 4E4FA 1UR3M 1KGUA 2OX4A 5KITA 4ZA0A 1XJBA 3QYQA 1XYLA 5EFDA 3W7GA 4NYUA 2GGIA 4KERA 3OG3A 4YTUA 1V03A 4HQVA 4LNCA 4KFNA 4BWLC 2ZUTA 1KTCA 4GQGA 1J18A 1AG1O 1X7IA 3GNPA 1L2QA 2EG7A 3ALFA 3HG2A 3QKEA 3VKJA 1LOLA 4PE8A 5CGMA 3E0VA 5EB8A 4LEQA 3GNNA 3W2JA 3W7DA 2POTA 3MUIA 3R7MA 3NGFA 4G7EB 2NQ5A 3AS1A 2NQLA 3W3OA 3WFAA 5HNTA 4PCSA 4MWAE 4ZL1A 2YIHA 2A2IA 1W56A 5BOFA 2ASHA 2YDAA 3KOFA 1YE4A 1JG9A 1YBQA 4OQVA 3UFYA 1XIJA 4DXVA 1MXDA 3LEPA 1VHCA 1EP1A 1XLEA 3ITOA 3L66A 3CASA 2AGKA 1Q7QA 1B9BA 3QPYA 2A1YA 2FZMA 2VELA 1VBUA 2VRJA 4H7ZA 3EX1A 3HM7A 2I16A 2WPGA 2E4TA 2I17A 4IISA 1TE6A 3B9OA 3UY8A 4XISA 3UNTA 3C2FA 1G4SA 3G1XA 1AK5A 3HV9A 3RJXA 1XD1A 2WJZA 3VIOA 2BWGA 3N14A 1VFOA 1AH4A 1K6WA 3VNIA 4DBDA 5AN7A 2J24A 3WQWA 4AY7A 2GPTA 3USBA 4GYJA 2QCNA 3EGJA 3V7PA 4U31A 3B3DA 3PTMA 3E6EA 4CD7A 3WUGA 2IUZA 1SW7A 2G3NA 3IRSA 4I8YA 1UR2A 3GIPA 2DW6A 4PR4A 5BU6A 3GB6A 4A2RA 2OZ3A 3S5NA 1A3WA 4YVXA 4O10A 3NZQA 3RM8A 5I3JA 3CZEA 1TJ0A 5BWAA 1UD3A 3A9BA 5DX7A 2EPMX 3ICJA 3BURA 3VNJA 1WXZA 4JQ1A 3VDCA 4M29A 4RDZA 4IJRA 4NAFA 3GH5A 6A3HA 1DJXA 4Z08A 3PFMA 4X0NA 3J7HA 3FYYA 4HCDA 3V75A 1R6WA 5D2TA 3T4WA 4POCA 3LXAA 5HPCA 4Z0SA 3NSMA 2R1MA 2Z29A 4QCEA 2BHZA 1KM2A 3P2VA 3QMSA 5KETA 3P82A 1F73A 2HPIA 2Z7KA 5BOEA 4RW3A 3TYUA 1ISYA 4CLMA 3R1ZA 1Q65A 4OUIA 3GR8A 2ALRA 4CD6A 5CC5A 2VGBA 3KL0A 1VJSA 3BLOA 4LVAA 3CAKA 1GOQA 3P0XA 2QHAA 2X1IA 1Z69A 3APYA 5ABTA 1HJQA 4QFUA 3UXAA 3WF1A 1KBIA 3NDYA 3LCWA 4PGLA 3VINA 2TSYA 1E6ZA 4IX2A 4YTTA 1LBLA 1XIGA 2W3ZA 1X1ZA 2FJUB 1XICA 4U3AA 3AS3A 3R2GA 3EPNA 4CN4A 2O0TA 3NZPA 1M7PA 3WZ0E 3REQB 1CECA 4HA3A 1DV7A 1PAMA 4O19A 3UXDA 2W4XA 2C6QA 3G1DA 4IL2A 1BXNA 4P7OA 2JIWA 1LRQA 4F0HA 1EDQA 1YXCA 4MWAB 3NZGA 3LPPA 1ZL1A 2Z0IA 4OOZA 3SZ8A 2BB0A 3R0KA 4MIMA 2YW3A 2DSWA 3QMTA 5CKSA 1AW2A 4AHOA 1NDZA 3GHSA 3UJFA 4C6IA 1RPKA 5C9ZA 2ZUNA 4D6IA 4PCTA 1Y65A 4MYXA 1Y7VA 5DT5A 5GNXA 2WSPA 2QJGA 2BGNE 5BMXA 1FWFC 4S3FA 1YXYA 5F2MA 3URNA 1R0MA 4NASA 4R34A 1PE1A 3CIXA 4GYPC 1RJQA 5I7GA 5FF4A 2Y70A 3M5ZA 2PC4A 3EEGA 4P8VA 3WQFA 1E1CB 4GMEA 3APGA 2C91A 1NH6A 3LBMA 1UWRA 4DM1A 4M3PA 1S1PA 4LB3A 4X22A 1YW1A 3DFOA 4AZBA 4NXSA 4HYVA 2PDHA 3S42A 3B0PA 1IEVA 3HPFA 3VILA 1CGYA 4MJMA 1OINA 4PL1A 2PA6A 4GIAA 1FKWA 4JEJA 5IOBA 2ICSA 4D8ZA 2GOKA 5F4SA 4I7UA 4DJED 5LA1A 1F2JA 4B5WA 3MO7A 1GVSA 4P7QA 4NJKA 1L6GA 1O6IA 3WMCA 4Q8UA 3WLPA 3QY6A 2QZRA 5AC5A 1ICQA 4INFA 2D69A 3T9PA 4BFAA 3VD7A 2X1UA 3UZXA 2A79A 2VWSA 3VIPA 2OYLA 1QK2A 1XG3A 4GKTA 5BXSA 4Q6JA 3NURA 1WOBA 1N8FA 1A49A 3DFYA 4QP0A 3WNKA 5FL1A 1RP9A 4L4LA 3W70A 3TN4A 4MKSA 2H9AA 3NZ1A 4AH7A 3L4ZA 1TR1A 4WR3A 3TCEA 1S2AA 1R46A 4B4FA 4GACA 4IIGA 5K2ZA 1AJZA 1M65A 2BP1A 1FXQA 3AXXA 3GD6A 5C2CA 1FCQA 1R30A 1S2WA 5M1TA 3TVAA 3PZIA 3O9NA 2QDEA 1IXQA 3GHRA 1P5BA 4IUGA 3DERA 1IZJA 1MZHA 3QC3A 4ICMA 1E56A 2YFOA 1R7AA 2VEPA 3G3DA 2EAWA 3QY7A 4Q4OA 2IQTA 4W87A 5H91A 4AHQA 4HOXA 4AUBA 3UQNA 4LUTA 4C6MA 3D0CA 5EFFA 2HEJA 1KRMA 4GZEA 3PVFA 4FS9A 4ROPA 3HG5A 1TA3B 2XU2A 4HPGA 3LBCA 1RZMA 4LCQA 4OHQA 4I9JA 4TMCA 5GVJA 2Y61A 1ADOA 4PMRA 3LCHA 4YHGA 3HIJA 4IFKA 4MB5A 1UASA 4G6CA 1A3XA 4S38A 2RGLA 1XW8A 3WL1A 5CG7A 3ZWTA 5D30A 3CHFA 4QJ3B 5MKGB 4RE3A 2NQJA 3W7IA 5HANA 1WA3A 5E9XA 1J6OA 1CXIA 3M46A 5AC8A 5C55A 2X0SA 1XGEA 1P0BA 4OKDA 1C8VA 3A21A 1XLIA 3UU0A 3B8UA 3T2QA 1KLZA 3EX6A 1X98A 4H6QA 1YE6A 1I1XA 1GQLA 2OEJA 5DY2A 3W1AA 4CCDA 2GVGA 1G94A 1IIHA 4C7DA 2WW5A 4FAMA 2V2DA 4HT3A 4D9PA 4WXZA 3WCZA 1K4GA 1EH9A 3RO6A 4JOMA 4A22A 3SGGA 3RPMA 3HO8A 4NNAA 4O8AA 5K9DA 1IIGA 2PDYA 4DBSA 2XYLA 3RLGA 2ZX8A 2WVVA 1V08A 3W7RA 1VAHA 3MZ2A 3TC7A 3K1DA 4Y9OA 3W83A 1W5NA 4HHMA 2EHHA 3B8DA 4D1JA 3QQ1A 3GTFA 5KEZA 3ONBA 4PC8A 4J35A 1WOAA 4DF2A 2QGHA 2QNEA 4L7ZA 3VVGA 2HK0A 1PKNA 4RE2A 1EOKA 3MV01 5I3IA 1CXEA 2PGWA 1G4PA 3PUGA 4DF0A 1FWNA 1W1B1 5BXRA 2VCBA 4FR1A 3W01A 5LA0A 4KCTA 2ZVRA 2SFPA 1P0EA 4GYPA 4QQ3A 5DRCA 2O9TA 3W4RA 2LLEA 3G1SA 4GE8A 3G6LA 1TRDA 1AQFA 3RILA 1CBGA 3CQJA 1YX1A 3PJUA 3TCSA 1J4EA 3IWPA 3UCDA 3N6HA 2I56A 4D6EA 4HJFA 3GYEA 1IF2A 5E0FA 4PCFA 5LNVA 2XM2A 4HZ7A 4GY7A 3AMDA 3CO4A 3F1QA 3Q4DA 2VMFA 1RAKA 4H01A 3SQSA 3CYJA 5A1AA 1UD5A 4JTHA 1L8NA 2GSJA 3B9NA 5A69A 3IGUA 3CMFA 1E1EA 4C7GA 4H6RA 4WY0B 4R85A 3VZXA 2VC9A 1PL9A 4RXGA 2YPIA 2VZTA 1SZRA 4PMQA 2FYMA 3HJEA 4G2DA 1XR2A 4W7WA 5D33A 2J7FA 4A8IA 5I09A 5D9OA 2BOGX 5KZ6A 3AFBA 2CKRA 3WJWA 4UOZA 2PBOA 3BH4A 4A3QA 4RZ4A 1JDDA 4FXFA 2D2HA 4GVIA 3GHUA 4FP1A 1QK0A 1F9CA 4E3TA 1ALDA 3KP1A 3GUGA 3PF3A 1WZKA 3M43A 3UEQA 3CPRA 4WSJA 3U4AA 2X1SA 5TAOA 5I24A 1RQBA 4AZ6A 4BF7A 3IRDA 4HBKA 1FHLA 1QPKA 3OA3A 5M2FX 1TWWA 6ENLA 1DTNA 3IVTA 4GXMA 1EF3A 4WDUA 3M5VA 1E4NA 2D24A 3ZWSA 1W5PA 2FHBA 4J2MA 4PUEA 3L0NA 4LAKA 3VD5A 1C93A 5CJ5A 1WDQA 4DZAA 3NJ3A 3S9YA 5KMYA 1ZB5A 4U33A 2GQAA 3CBWA 4EF9A 3VKKA 4GNJA 1RCQA 2E09A 2DUZA 2VFFA 1H7PA 2UV8G 3BAWA 1A50A 1OQFA 4XAZA 5A6TC 4RUBA 2X41A 2XGIA 1MEHA 3NTYA 2HK1A 1J0KA 4WJXA 4DYKA 4XG1A 4QX4A 5C7VA 1BRLA 1E0WA 4HPJA 5I0DA 2WMIA 4F0SA 4GLEA 3SRHA 3PJTA 1HJWA 3ZJ8A 2XTKA 4GHRA 4LB4A 3CMJA 3C0JA 2XVPA 3T0DA 5BOOA 4NU7A 3MB9A 3CEUA 1F3TA 4UFMA 2WQPA 4M6UA 1H7WA 3P74A 5FJPA 3TZNA 3OW1A 2JQXA 2DZVA 3ITGA 3ARZA 2PDIA 4UTKA 2C19A 2XN1A 3F2DA 3W1XA 2PFHA 4MSSA 1LL7A 3G1HA 2Y7GA 2XFFA 1MFUA 1XISA 1WDWA 2R94A 1R7OA 4I7VA 1TVPA 2AL2A 2R1LA 3SFWA 3GHTA 5HINA 2WBKA 5CZTA 3OBAA 1OCNA 3MUCA 4YU1A 2FGLA 1PCWA 3U8GA 4YIWA 1EGMA 1V3KA 4HHHA 4I6VA 1Q4NX 4LS2A 1I0BA 3CGTA 1DIOA 4LBUA 1UROA 4XBJA 2P76A 4JICA 4PUDA 2H8XA 1P7TB 3HG4A 2PP3A 1UP2A 1I6NA 2C7FA 3O16A 2WZEA 4W88A 3NQVA 3O1NA 2INZA 1RXOB 3I65A 1DP0A 1QO2A 2BLEA 1I2QA 4H9UA 5A6MA 3FK4A 5LXXA 3F4VA 4ZE4A 1DWFM 4MB3A 3NZRA 4G7EA 2DV0A 2WLYA 1DIDA 1R3YA 2FPTA 2NV2A 2X1RA 2F6UA 3LERA 1XCFA 1G01A 2FIQA 3WK3A 5BZAA 4DJFA 1HZYA 2YA2A 3T09A 5LNWA 4IZGA 1V3HA 4HSNA 3GXMA 3TFXA 2EBNA 1KGWA 4AC1X 1BF6A 3BLIA 2P1FA 1A5CA 1KM5A 5EKYA 4XQ6A 1DHPA 2EKCA 2IMRA 3VKAA 4ICCX 5DBUA 3UWEA 2GQ9A 2UY5A 3GC2A 4O50A 1M68A 4GQRA 4BEUA 5DMLA 3A12A 3PS7A 2GVEA 1B3YA 1ZCCA 2Z25A 4O1CA 2RGMA 2CLLA 4J3ZA 3KTXA 4RX0A 2VX5A 3E9AA 1I45A 3S5SA 2YGYA 4BCEA 1WUEA 3I3DA 4GABA 6ALDA 5I06A 2OLSA 4REQB 2OSWA 4NP7A 1EWEA 3DHUA 5E0KA 4J4KA 2TYSA 3CV7A 3IJ7A 4J3TA 2PI6A 2QMJA 3N6QA 1BSLA 3GYCA 4WX2A 3UA3A 2QEZA 3NVTA 4DJDD 2A3CA 4PMXA 3L2MA 4P61A 4PN2A 4J27A 1LOSA 2IPFA 3PWGA 3TH6A 2BOFX 4HMCA 2F2KA 1RK6A 1HKKA 4UTJA 1W37A 4B16A 2GDUA 4AIOA 3ABZA 3RUBL 4C6FA 3PZVA 4LV9A 3LRKA 3LGDA 4NUWA 3QYSA 4PTVA 4DWDA 5BRBA 1E9IA 2GJXA 3WH9A 3W76A 3TROA 4JL1A 2H8ZA 4YJ5A 3LMZA 4ZQOA 3BOFA 3IJ6A 1W5QA 3EXRA 2ZVIA 3AHVA 1E9LA 1W8GA 2NXGA 5AHEA 3W25A 4B5TA 3URBA 1TJRA 4ALDA 3GDRA 3WQCA 3CV2A 2QCGA 5U4NA 1UYQA 3OP2A 5G1MA 1KCZA 1H0GA 4KIRA 3FS2A 4IIFA 4KKXA 1CGUA 2FMNA 1DIEA 3AQUA 1QI5A 2XH0A 4MLRA 2VC7A 4Z0JA 1HVQA 1A5AA 4F0KA 4H04A 2I5GA 2V3GA 3H2FA 1SQ7A 4KBXA 5HPOA 4WHBA 3EWBX 1IEQA 4I5XA 3R0DA 1OK6A 2ZADA 3C8FA 5MHBA 3LA4A 2RFGA 3VUPA 3WN6A 4XAGA 3IUDA 1JPMA 1QTWA 4QR6A 3GSMA 3KWXA 1TIMA 1FVPA 4O0QA 4I5RA 3RAOA 3LZ5A 3VOFA 2WK2A 4US5D 3UPMA 1CIUA 2NXIA 3OQEA 4FA3A 3GIQA 1GKQA 2OLAA 3GC5A 1UMYA 4KWWA 1T96A 2FB3A 4BK9A 3SN0A 2HMCA 1Q6DA 3CB8A 4HU0A 1U5VA 3KOZA 1UH2A 2A7PA 4QXIA 3OOQA 3PJWA 2DZXA 1MXSA 3VA8A 3L67A 3S6OA 3ZSTA 1EJVC 3TE9A 8A3HA 4OZOA 2YCJA 5A2CA 1J96A 1ZNNA 4YLWA 5A6LA 2YZ5A 2PD5A 3IUIA 3OLEA 3STFA 1TZ9A 1V8EA 5L6UA 4NL1A 1G1YA 4WQ6A 3VIKA 1XLJA 4ENLA 3T8LA 4GUHA 2PDFA 3AISA 4JTGA 2XSBA 2RAGA 2DY3A 3NPVA 3O06A 3THCA 5BRPA 5T91A 3ZT7A 4FNSA 3TW7A 4N9CA 3WNMA 1OADA 4L56A 2WJFA 3ABSA 2PF0A 1HG3A 2HBVA 3OZYA 4IG2A 4IMEA 1R5YA 5XINA 1PVNA 3KRZA 1ZU8A 4PFMA 1V6YA 1EC8A 1EO7A 3UZJA 2TMDA 2P50A 1BTMA 3AOFA 3NGJA 4P2VA 2VR2A 1EIXA 3FHAA 3TR2A 3EWZA 4ZZ9A 3O05A 2VFEA 2WKJA 1DHKA 4ZCWA 1ZJHA 4S3GA 1ICPA 2X42A 1CXFA 3OBEA 2Q8LA 4GVHA 1X1OA 2C0AA 4XTDA 5EMLA 4PMZA 3W1QA 6REQA 4NZFA 1CPUA 1GGOA 3PZMA 5FAGA 1ZSXA 3AIBA 3IIXA 3VD4A 1P7TA 3ARVA 4IP7A 7TAAA 3MV11 4D6HA 3OLIA 3KDOA 4AQLA 1NWTA 1TJ2A 3GNRA 4TTGA 3UPWA 1JF6A 3ITVA 2Y0FA 1FCUA 2VENA 4NNBA 4RNFA 3UXIA 2ISSA 3ZVHA 5KSWA 4MYAA 3VCCA 4W89A 1UWUA 4BQ2A 2HRWA 4HCLA 2Y63A 5GJNA 1NOUA 3W7PA 4CNUA 5HMFA 3N2CA 5GJMA 4QLKA 1TVNA 1ZJIA 4IGNA 3MCNA 3CM4A 4XZHA 2FPYA 2L5HA 4ERIA 2YSWA 4V1YA 3KBSA 1H11A 3V1HA 1A47A 1XBYA 1C8XA 1RLDA 1TX0A 5JH2A 1LLZA 5I6SA 4H83A 3FVDA 5DT7A 2V67A 4QISA 3CZLA 3KL5A 3STGA 4R27A 2JF7A 4Y9AA 1QW7A 1E6XM 1JAEA 4UMBA 3HPZA 2JE8A 1WAWA 3PZUA 4YYCA 4UB9A 4DHGA 2I1OA 1K6AA 3E2SA 5I3KA 2WOQA 4WY0A 4ZBCA 4BI6A 4CQCA 4LEFA 3CU2A 1OY0A 3H4WA 3V5FA 1WXJA 4KEMA 4KFPA 3ZJ7A 4Y6GA 2VX6A 1E9ZB 3DEQA 4JCMA 1NDWA 3QHOA 2Z1BA 3MP5A 2YFNA 3WDHA 1OFOA 1XIEA 4J3XA 1PS9A 1O95A 3NM3A 1Y5WA 2J7DA 1US0A 5DXYA 1TPEA 4FXSA 3RM4A 3CZ8A 3EWDA 3RR1A 2W0UA 4AWTA 1JZ8A 3EWXA 1S5TA 1HKMA 5GNYA 1R9ZA 3N17A 5TNVA 1SZEA 2GVLA 1GNXA 1VGAA 4PULA 4WSKA 3QBUA 3T0BA 2JKAA 4QDMA 3ISIX 1H7OA 1CI1A 3IIPA 4NX0A 1KRCC 1JL8A 1VFHA 3BPWA 3AO0A 3MMDA 3ZXWA 4AISA 2NLIA 3STPA 4I3GA 5E70A 1JXJA 4PFHA 3UG3A 2V63A 1X97A 2VC6A 4ZO8A 3WNLA 3TTYA 3TYBA 3AXIA 2WMKA 3FNDA 4YVVA 2PWFA 5A8NA 5G2WA 2CERA 5E6YA 1WB0A 2VZOA 5AC4A 4GD0A 1AW5A 3UGRA 3IAPA 2JIEA 1BWVA 4CU6A 5LGZA 3R8RA 3CT2A 3KS6A 1GZJA 5JBEA 3TN5A 3GQYA 3W88A 4AMCA 5I5RA 1PTDA 4B5VA 1EPXA 2Z26A 4IPNB 3WNPA 2ZC8A 3DG3A 2HISA 4QJ1A 2CEQA 1M1BA 2FH8A 4QG6A 3OJGA 1MUMA 1ONRA 1ITCA 1UC5A 2REQA 2XIIA 3ES7A 2YCIX 3BUVA 4UQ9A 3IJ8A 1GQNA 4N6EA 1TJPA 1V02E 4Q7IA 1OIFA 2J9ZA 4AZ5A 2H9AB 4JNYA 2WVTA 3PBMA 1JNEA 1S2UA 2PZ0A 4PMYA 3W7KA 3C6CA 1U1JA 3NQMA 5T9BG 3RJYA 3TYEA 3GVGA 3N25A 3L12A 5JUVA 2XISA 1CT5A 2Q09A 2JFEX 3EKGA 5A3HA 5AY7A 4C7FA 4CU7A 2YR1A 2QVHA 3MMTA 2P0IA 1LF1A 3ZFHA 2QCEA 3VABA 3H2OA 4QE4A 3A13A 4QAIA 3VYLA 5ENLA 2Y5SA 3BLFA 1GZGA 3QJAA 4IT1A 2XWEA 1QR7A 1BD0A 7REQA 4WKAA 4YPJA 2VZVA 2YW4A 4EX4A 2CLPA 3G8EA 4LU0A 4XUGA 5AVHA 1C8YA 3U0HA 1ITUA 3VFLA 4F9JA 3S5OA 4L9YA 4Z42C 3BO9A 5MF5A 2WVVB 3TV8A 1ZAHA 4PBFA 5HNRA 4FNRA 4MUPA 3M0XA 3BICA 3ARRA 1K8XA 5LIYX 5A8PA 4IM4A 5E09A 3HMCA 2PWDA 4JTIA 4XX6A 1QNSA 3C56A 3UESA 1K8YA 4RZBA 1XYMA 3N19B 1XCWA 2P8CA 4WRHA 1JYNA 5CQ1A 4TVDA 2WCGA 1GOMA 4EAYA 2YBVA 2G41A 2AGTA 5HBFA 1CX9A 5CPNA 3W7MA 3MI2A 1V6TA 2WKGA 4O52A 1DJWA 1OC5A 2KAUC 3OPSA 4C1LA 2Y1HA 3QV7A 1X6NA 2HPMA 1JCLA 4PMNA 5HULA 4R33A 1PBGA 1K7EA 5JBDA 4L80A 9XIAA 3L2LA 4K1GA 1M01A 2E1WA 3PSVA 3QPEA 4KCWA 3EKZA 1N2VA 3M1ZA 4MNMA 3ZR5A 1FWWA 2WC4A 1UD8A 4DAFA 3OZMA 2BY0A 4Q4MA 1PKLA 4JTDA 4L4OA 1KNWA 1BXBA 2NX9A 2TPSA 3GAKA 4M7SA 2CLMA 2X7VA 3ATZA 3HPXA 5DBTA 3CLWA 5T8GA 4LWWA 1K8CA 4JFSA 3LGGA 3II1A 4LVGA 3K2GA 3KW3A 3VIJA 3V16A 4QTGA 1VBGA 4IGHA 3B4YA 2ABBA 3MZNA 4FSAA 2A7NA 3CK5A 1UR4A 4GFIA 3PB0A 5J04A 1TPH1 1X96A 1L6SA 3GIYA 2EPNA 1JRCA 2ZDRA 3E12A 1QBAA 4B5UA 4HPXA 2WZTA 1HL8A 1HIZA 5A2BA 5K4XA 1JZ2A 1LLWA 3T0TA 4N0RA 1TWIA 1E43A 2CNCA 5EMMA 2JEQA 3K8LA 3ATYA 5E5CA 3FIGA 3EMCA 2E6AA 1P43A 2VX4A 4K6AA 5FSDC 1PXGA 1Y5VA 3SY8A 3VNKA 3EB3A 4AX7A 1TV8A 1J0JA 1MSSA 4CQ9A 1EKOA 1E5JA 2YXOA 4H1ZA 2WWDA 2ZUMA 2D1ZA 3O63A 4MKNA 3W1TA 4J3VA 3IV8A 1JGIA 1DJGA 4Z2JA 3LPGA 3G2GA 1ME7A 4C91A 1UWSA 4CEUC 4YTSA 4PMVA 1UKOA 3W29A 4EXAA 2YCEA 4UR8A 2BASA 2EKGA 1EJUC 1TUXA 4E2BA 5DMNA 2MANA 6XIAA 4EPBC 3OGVA 1POKA 4B5SA 2DZBA 3GBEA 1VFLA 2WC3A 1TPC1 3P62A 4KETA 5TD4A 4CQAA 1ODUA 2OQYA 2EPHA 1EL3A 3Q58A 4P8XA 2NLYA 4M7TA 3DC8A 1QI4A 3W81A 3TYDA 3DHDA 2OT0A 3MSRA 4R3UA 3DI0A 2J6XA 3GTHA 3W73A 5FIPA 3UWWA 2PBGA 4KESA 3BZJA 4GG9A 2BODX 1Z41A 2HE8A 1D3HA 1FX6A 5ECUA 1SJBA 4MZ1A 2X16A 3XIMA 1YYAA 1W3NA 3NWRA 1V93A 1Z48A 4TVUA 1WQ5A 3D3FA 3NFUA 2QUTA 4KT2A 1B31A 3UR8A 1HXJA 5CBIA 5JH1A 3GDKA 3ARPA 1BF2A 3UVAA 4QSHA 2YYUA 2A85A 2W61A 4RPPA 4ZTYA 1OD0A 3TJXA 2AMXA 3OYZA 3SUWA 3HGOA 2WMGA 3QKZA 4DO4A 3UWUA 2O9OA 4QIUA 1VFFA 2ZIDA 1D7KA 3QEZA 4O12A 4UFLA 1N7KA 1JF5A 1U1UA 1SYTA 1Q6EA 3JR2A 3OVGA 3ARSA 5I79A 3O6AA 3SQLA 4UQEA 2XN2A 3GU9A 1JUBA 2IKIA 3FKRA 4C6DA 1W9XA 3MKVA 1FFQA 1TQJA 1O12A 3BAYA 1SSGA 3EDEA 5D2YA 3PN8A 3CUXA 4QLLA 2Q8XA 3CL7A 5AHLA 5BCAA 1XIDA 5LKYA 1GVIA 3UYIA 3AS2A 4H2CA 5HJYA 5D9MA 3TQPA 4JTFA 6CGTA 2CBIA 3INPA 3R43A 4WDWA 3PUEA 3EBVA 3C8NA 3F4WA 1VPQA 3ZT5A 1X8FA 2J7CA 4BQ3A 1PZ3A 1TE1A 4Y2WA 4E5TA 4ZQRA 5EU9A 2NUXA 3H7VA 5LHEA 4ECLA 3L4XA 1SFTA 2BS9A 2PMQA 3KBMA 2HTMA 5G2IA 5D8ZA 3O0FA 4QBXA 3VM7A 2OELA 1GOXA 3E1F1 1F8MA 3GXTA 4K7VA 4DIAA 3LHWA 3FCPA 2B31A 4XIAA 3VD9A 1TPUA 2XVNA 2R1NA 3WQ6A 4FOUA 1E6NA 2X05A 4NHVA 3HGJA 1KBJA 1BEUA 4KRZA 1FWBC 1FWTA 4GC4A 5IDIA 1I75A 1NDVA 1NFPA 4HSHA 4JIIX 2GDQA 5A95A 4FHAA 3U7VA 5HWNA 3H8AA 3RLUA 3AZTA 2YDQA 1DJIA 3LENA 2OXNA 3CWNA 1FDJA 5EMYA 1XC6A 3DYOA 4O0ZA 5XIMA 1JFHA 4O14A 2YX0A 4GUFA 1T6MA 4URIA 2P3ZA 1ZUAX 2FGZA 5I78A 1UD6A 3ALGA 4QEHA 4GO8A 2ATMA 2J78A 1US2A 1WBHA 3WMBA 1DJZA 4HMNA 4S3AA 2ACSA 2QJNA 1V51A 1LUCB 3G18A 4UR9A 4EOUA 1KA9F 4GX8A 2GWGA 3WDJA 4D72A 3CAVA 3PPHA 3L68A 1MNSA 2VEMA 2VJXA 4JYDA 4UCFA 5E1QA 1JCYA 1TWSA 2HJPA 1A53A 1V4YA 5I77A 4TX9A 2FZBA 3KLKA 4KPLA 4NZ3A 3B97A 4FR6A 3QQWA 5AZ1A 3BW4A 2G3MA 1SJCA 1E0TA 5GNZA 3ANUA 3S1GA 4LAUA 1KFJA 2WWCA 1KM4A 3K8KA 1FWEC 1LT7A 1VFUA 3EPOA 4FIRA 5LSMA 3STEA 2NVDA 1H09A 4OT7A 5EA9A 2YOCA 1VF8A 4D71A 4EAMA 4Z1YA 2NXHA 3W1UA 4OWGA 1IHIA 4HA4A 4LF2A 4OVXA 4KF1A 3W27A 3RN6A 3WY1A 1OHLA 5FF2A 3WX7A 2Y89A 4QG9A 2Z1SA 4UFHA 3WL0A 4HZMA 1OGBA 3PAOA 5EMUA 3UF9A 2D3LA 1K9EA 1EJSC 4C6NA 3BGJA 3F2BA 1A5UA 3ZYZA 2YA1A 2CKSA 4CD4A 3K1GA 1JYWA 4XZMX 2ZBTA 1PTGA 2QF7A 4X63A 2NQ9A 1B3OA 2B7NA 1FCBA 4R7JA 1G4TA 3T78A 2A3EA 1JJKA 4YCPA 1QOQA 4BJHA 3SEPA 2WHKA 3GNXA 1H7NA 3SSZA 1L6WA 3CXOA 4F48A 4JY8A 2O7SA 3EXTA 1A5OC 2J7EA 3VGGA 3VGBA 3V3WA 3GTXA 1UCWA 3U6WA 2CHRA 2QQ6A 2OWXA 2Z24A 3NXFA 1EQCA 3KHJA 5CAKA 4Y96A 1RPXA 3P5ZA 5AYYA 2FVKA 6TIMA 2FZ9A 1JI2A 3TJIA 4GJIA 4W93A 4V2XA 3UR5A 4DBUA 1QHPA 3SADA 8TIMA 5M3WA 2FH6A 1XPGA 3P84A 4PYSA 4O11A 2GJPA 3AJ7A 1JDEA 1DWJM 2OYMA 4ICNA 3M6DA 1UPMB 3SCSA 2R1PA 3B4UA 1PIFA 3MYPA 1LL6A 1VCVA 4KFOA 2NWRA 3C4UA 4BI7A 2Q6ZA 5FJRA 1J2BA 3UG8A 1KFBA 5A6SA 3WLJA 3KCOA 3LTSA 3EDFA 4MG4A 5K9CA 3DDMA 2FDSA 1PX4A 2C0HA 4FK9A 2BNJA 1CYGA 3AIWA 3PWAA 4G1KA 2ISVA 1S5MA 2DVTA 4RNHA 3QSRA 4AEOA 1RBOB 3S9IA 1VYRA 4PB5A 5DEZA 4XKYA 2O4MA 1IEXA 4XZLX 3WLKX 4Z1BA 3FYOA 3RM9A 4E8CA 1UIOA 1U1HA 1VRXA 4G7FA 1OIMA 2YBTA 2ISDA 3EDJA 2D0HA 2WV8A 5AHIA 3MMUA 3GC4A 1OX6A 3LYEA 3OQ8A 2PEVA 1QNVA 4M6VA 3NQ8A 1FHVA 4B3LA 1W1IE 1KWGA 1OF8A 5AZ0A 4FI4A 1UD2A 1DWIM 5AYBA 3UVIA 1NP0A 3DBPA 4AMAA 1XRSA 2GUBA 4UTWC 3S1WA 1IXPA 3XINA 3WBYA 2AKZA 2OQHA 4JHMA 3WUFA 5C8BB 1UW9A 4E4PA 1J0ZA 2ISWA 3EA2A 1QI2A 2FFIA 1TG7A 1KTBA 2QPUA 1CGXA 4M24A 3BSGA 2E40A 2JEPA 1JDCA 4JKKA 1UOZA 1FA2A 4LAZA 4AWEA 3ZS4A 2IQDA 4Z2GA 3VTRA 5A6BA 1UZ4A 3EOOA 4HZ8A 2DQWA 1EA9C 3QF0A 1SJAA 2Q3RA 1OD8A 1H7XA 4DZ5A 1OFEA 2WQDA 3A4AA 1EZWA 3MP3A 5J5RA 3LLXA 4GQ0A 1XRVA 4ML9A 3TX9A 1XIFA 3K4AA 1XYAA 3UJSA 4DJFD 5C9RA 1G4EA 1MW1A 4BWLA 4FO4A 3E2QA 4N2YA 4ZODA 3DENA 4NZ1A 2ZRUA 3KTCA 3QOKA 5CC3A 3MHFA 1EB3A 1KV8A 1B3VA 4S1FA 2F9RA 4RR4A 5DCDA 4LTSA 3DZ1A 1ZBWA 4HNNA 1VJIA 3NEHA 4NY2A 1FTXA 3FSTA 3NA8A 3KRBA 1AQHA 2P10A 5IHSA 2F6KA 3MDUA 2CU0A 2VQUA 1LBFA 5DRIA 4U2YA 1IYXA 4A6GA 3R10A 3WD3A 1R3SA 3CV1A 4J5NA 1IE7C 4O4WA 3THQA 4R53A 4MNJA 3DG7A 3GH4A 1D9EA 4S39A 1E9YB 4WK9A 4L1GA 3U5UA 2D0FA 1WDPA 4RK8A 3W02A 3B8WA 2B7OA 2GUYA 1RY8A 3COTA 4ZGYA 1E73M 4PH6A 2GVYA 3RK8A 4QSFA 1K03A 4DJEC 5C71A 4W5UA 2X30A 4V27A 5H8PA 2ABAA 4PCNA 1QHOA 3MA8A 2VL4A 2WXDM 2GYIA 4IPIA 3NSXA 4GRSA 5IFPA 1W6TA 2DVXA 2NZLA 2V3FA 4ZOAA 5C9XA 3PWIA 3SCOA 1XH0A 1HTIA 2WMFA 3VPLA 7ENLA 1TPVA 3A24A 1VQTA 4GNVA 1XX1A 1XLDA 2I14A 3CH0A 3SFKA 5FEXA 5ABFA 4MDOA 2C8NA 4C5YA 4QE5A 1F61A 3GW0A 1IXOA 3ABRA 4JAWA 4KS0A 4MADA 1B90A 3BLEA 1V6UA 4DX3A 1K8ZA 4OBTA 1J79A 3IUHA 4LUYA 4EWND 2DSUA 2ZX6A 2PTXA 4JTAA 3REQA 4XTIA 2VD9A 3CB3A 1XBXA 1TPB1 3N3MA 3NIYA 1EP3A 5C2GA 2D20A 3HFTA 5LZLA 4LX4A 1QNOA 3APTA 4UUIA 2WNWA 1E55A 3QZ6A 2Y2WA 3PPFA 3AMCA 4AEEA 3UZZA 3BOXA 3VCRA 1W3TA 7ODCA 1L2UA 2YL5A 4KGJA 4CN6A 1BAGA 4UTLA 1XFBA 4BF9A 1XYBA 4KGLA 3UYCA 1EX1A 3PBWA 5I3FA 1ZTVA 3C61A 1EC9A 1CB2A 2ACRA 4DWSC 5AHMA 3V5OA 3W9ZA 2W5FA 1EUAA 3T1GA 3KBWA 4H9XA 4S3CA 2ZXDA 1VJZA 3TNBA 2VEGA 1GYMA 2WHLA 1DXEA 2VI0A 2X7WA 4DNMA 1FH8A 2CZEA 2HV5A 3PFRA 1E0VA 3UW6A 2EPOA 3EDKA 2PTWA 3TK7A 3AI0A 1AUSL 5FCZA 2XIJA 1W3IA 3PNUA 5C9UA 1GQKA 4Y9MA 3P60A 4DN1A 4NI3A 1YTDA 1FQ0A 2QGYA 1WPCA 1IWBA 4PUUA 3L4VA 3EX3A 4HGXA 4PUWA 3MHGA 2QCMA 1V7YA 3SR7A 4RE4A 2W6RA 1X7FA 3CUHA 1VKFA 4FEZA 3MU7A 1UB3A 1TX2A 4NQ1A 1XLLA 1E4IA 3N2OA 3PSWA 3OG2A 1Z7AA 4NJIA 1DJNA 3QR3A 2BSLA 3ARTA 1YBQB 3S2NA 4S3JA 2Z27A 3EDDA 4IJBA 1RCOB 1W2VA 3B0VC 3U2EA 1HO4A 4WIWA 4O53A 1W1A1 3BGGA 3P14A 4CNPA 3TSMA 1VEOA 4JTCA 1B57A 5AC7A 2YDRA 1P1MA 2VX7A 4TX8A 5DMMA 2E77A 4JIQA 4D8AA 2GGEA 2B0MA 4CQBA 4GY0A 3GZ3A 2E7FA 2VZSA 2ZRVA 3NR0A 3TFCA 3BJTA 1W54A 1JAKA 3NQCA 3ABOA 1V5XA 1BWLA 3ELFA 4DBEA 3CUJA 4N42A 4GKLA 2RKXA 5A6KA 4EIVA 3FOKA 3I6TA 2DSKA 3RMEA 2VEKA 4ZFMA 4KRUA 2NV9A 4PL2A 1Q45A 2DH3A 1QVBA 1S46A 4KEZA 4IQLA 1XHGA 3KZPA 3IJDA 1UR9A 3SCVA 5CSRA 3VIGA 4LT9A 3UR7A 2Z1WA 2GFTA 4K39A 3G1YA 4I6KA 3VKCA 4HMDA 1Y5XA 1MUWA 3WELA 3SY1A 2ADAA 1NWRA 1LG1A 3SCTA 3W2LA 1UBSA 3CMGA 2F61A 3AYVA 3PUDA 2UY2A 4KEUA 4QRNA 1RA0A 1OT1A 1H60A 4KQNA 2Z6JA 3ID7A 3L21A 2J7GA 2E9MA 3PZGA 4AZGA 3LPOA 3VOCA 5LGXA 4U10A 1J2WA 4IF2A 2XH7A 1DE5A 3EX4A 3VX1A 5HJLA 5T26A 5KINA 1ZP3A 3O7UA 5DO8A 1I60A 1QATA 2PWUA 1PDYA 2TODA 4DPQA 5M17A 3W37A 1AH0A 1KFCA 5EL1A 3CTLA 1GKRA 5CZ0A 3M0HA 5JBFA 4MB4A 1HL9A 1CGWA 2Z28A 4LYKA 1KFEA 5I00A 6PTDA 1ZGDA 1QAPA 2E9BA 4ASTA 4XZWA 2H90A 2D23A 4AVFA 1UPPA 1GJPA 5TBOA 3FLUA 3F5LA 3UBPC 3U7BA 3YPIA 2OQLA 2DGAA 1W9PA 3WH5A 1JCXA 1S2CA 1V02A 1XG4A 1MEIA 5FJTA 2DT3A 1XBZA 4JQ2A 3D5HA 3QVQA 3SN1A 3LCGA 3MW7A 1FH7A 1H51A 1I2PA 1KBLA 5C7HA 1QBBA 2IKJA 4Q4QA 2A7RA 1A3HA 8CGTA 4TV6A 3NYZA 1J0IA 1H49A 5E6ZA 1K7XA 1RBAA 1E40A 4IMDA 3GU1A 3GX9A 4ADTA 2QMKA 1JPHA 5U7SA 4HYWA 4A8NA 3IEBA 1SO6A 2V5DA 3I6EA 1SMDA 1VH7A 3MP4A 5BRQA 3W7CA 2ZRYA 4XAPA 4E6MA 1TPFA 3MBFA 4N9DA 2CYGA 3UERA 2GUUA 5L9FA 1HKIA 1AJ2A 1YPXA 1NQ6A 4Q3MA 4FXJA 2KZHA 4R7WA 3GKFA 1BPLB 1KCKA 3CHEA 5I03A 3QH2A 3FW6A 3KUMA 4FX6M 3C0QA 1RCXB 1F7BA 1HKJA 2AOSA 3BDKA 3WMSA 5DMYA 4HU8A 3T07A 1WP6A 1OFPA 2QW5A 1B0IA 2IW0A 2JGYA 4IQDA 1IT8A 2IPGA 5CPMA 4GCAA 1W5MA 1LROA 4ZSUA 3LU2A 3T40A 4O8RA 3H2MA 4U4MA 1JR1A 4IWWA 3AHXA 4B91A 5G1TA 3MI6A 5AYZA 6TAAA 1I4NA 2ZZ5A 1GONA 1RR2A 2HDJA 1REQA 3PM6A 4NXKA 4IICA 2DT2A 1EYEA 5CC7A 5GQBA 1R8LA 3F4NA 3VM5A 2P8BA 1PYFA 3VNDA 1JDAA 2VDHA 1HP5A 4X2PA 7A3HA 4H00A 4UTWA 4MF4A 1J0YA 4KWVA 3ZLHA 1ML1A 3KVKA 3PPGA 1G69A 3L4TA 1YPFA 4HK6A 3B03A 3CH9A 4IGMA 5CJMA 3DXIA 3JW7A 1R86A 2RDXA 4YNGA 3V0UA 4OBRA 1VP5A 3F03K 4QS6A 2YXGA 3E02A 3DFQA 1XINA 5BW6A 4JKLA 4HTBA 3WBXA 2WVUA 4HN4A 2G3JA 3B04A 3T05A 3BZGA 1QFEA 1R2TA 5A2AA 2GL5A 2QCDA 3WK2A 3ENLA 2OGYA 2WHMA 2CLFA 4ZOEA 3NQ7A 1QW9A 1IWPA 4BQ5A 2HWGA 1GTEA 3WG6A 2O92A 2PRLA 3WQVA 3CAWA 2NT0A 3UZ5A 3E5PA 2WMJA 2XVLA 4NKCA 3IJQA 4JDYA 5CZKA 1TV4A 3KE0A 5CZJA 1B4KA 4AZIA 4GJ1A 1A0CA 2GWNA 2QCDB 1TV3A 4RPQA 1F05A 2DDXA 5C9WA 1FBAA 1TV7A 1NOFA 1D7FA 3G24A 5CXPA 5BNKA 3W87A 1VLIA 3MHUA 4JIRA 3V0TA 4L61A 5LYRA 3AZRA 3DH7A 1H5YA 3KBNA 5TQLA 3K8MA 3PP7A 3BCDA 4W86A 3CS2A 4Q8NA 2VVSA 4M80A 4IXXA 1Z42A 3VZZA 3TMQA 2XPKA 2EG8A 3FEMA 1KD0A 4REQA 4AC7C 3GG8A 3PTDA 2VUNA 3QW3A 1HJVA 4JQ4A 2VNCA 2VGGA 3H2CA 4LFYA 4GCXA 3IGSA 1T41A 1XLFA 2PF8A 1FP9A 4C60A 3RU6A 2IS7A 4X9SA 2A6LA 3QQ0A 9CGTA 1S3HA 2Y7DA 1BKSA 4HJWA 3LTYA 4GGBA 3W72A 4H2HA 3QRHA 3TYZA 1YIXA 5M03A 1GWJA 4PB3A 2YL6A 3ZR4A 4ILSA 1OYBA 1WZAA 4A3UA 3DG6A 1XKJA 2FPVA 2QJIA 3B8IA 4RDWA 2PGRA 1R3VA 1OVDA 4CNSA 2G8ZA 4DUXA 4XKYB 4X9YA 5CPLA 3WYZA 1D8WA 4B90A 4N4QA 4TTUA 1UH3A 2IKGA 1BKHA 5D2XA 3UZWA 3NSNA 1E6SM 1DORA 3TQKA 3A9IA 3WUBA 2BVYA 2UY4A 5IBXA 1LWJA 1T5AA 3R58A 3MWAA 4FNPA 4B4HA 4RE0A 1R9YA 4J9JA 2HXTA 1GEHA 3M0KA 3QC0A 3I4EA 1HT6A 3GXFA 4DO5A 5J8LA 1NF0A 3KVLA 4NIRA 4ACZA 2YA0A 1LOQA 4LYQA 3GAYA 1T99A 4NILA 2PUZA 1TB3A 1V79A 1KM6A 3RYSA 1OFQA 3WQOA 3G0XA 1JPKA 3W7NA 4E3VA 2HS6A 1W32A 5EPDA 1KB3A 5JIPA 1L0PA 4W8LA 2Q3OA 2V5KA 1XYZA 2HZGA 2V5BA 3KZSA 4GY1A 4AZHA 3AROA 1FHDA 3L23A 4C1NA 1PCKA 2DU2A 4GK8A 1DXIA 3WF3A 4GGHA 3S47A 1NARA 4A4AA 3OLDA 4HNUA 9XIMA 1HVXA 1BYCA 3NQBA 3BW3A 3G77A 1HW6A 1DQUA 4B5XA 4TVCA 2OEMA 3W7EA 1EJ7L 1EP2A 3DAQA 3SY5A 3WD2A 1KKOA 1ENUA 1MWOA 3WD0A 4KCUA 4AVOA 5CAHA 3DX5A 1PB0A 1WUFA 3ZJKA 2ZX9A 3W2KA 5LNUA 5I3DA 4GZIA 1TPWA 4RDYA 3GU2A 3FJ6A 4CKQA 3LHUA 2XINA 1CLKA 2ZRWA 4H3DA 4IIBA 1K7FA 4K38A 3NOEA 3WNNA 3BAXA 3WD1A 1OFAA 5DF0A 4CNTA 5DLCA 4XZ9A 1JZ5A 3JZUA 2PDKA 4N4PA 2YL9A 3KRUA 3H4XA 4WVXA 2GZXA 3FYPA 1AFSA 2B7QA 3GDMA 2E6DA 1EJRC 4S3BA 4FXRA 3THDA 3I10A 2DZPA 4UIOA 4S3KA 4AYSA 3NQ2A 1HKVA 4OUEA 2O4QA 4GUIA 3R8GA 3PC0A 2R82A 2Z1KA 5A8QA 3KWSA 1WKDA 4F40A 4BF5A 2VGFA 1DBTA 4UTTC 1AMKA 2W9MA 4Z1AA 4J3WA 2AL1A 3MSYA 4IIDA 3A4XA 2PP0A 1VFTA 1WE5A 1L9WA 1R87A 4PTXA 1X6LA 1PTAA 3KRSA 1W0MA 3N15A 3CYVA 2XVKA 5IHRA 2A4AA 2PSNA 3SO7A 5K4ZA 2EPKX 1CTNA 4MAZA 1U83A 4MFDA 3FXGA 2GGJA 5AB3A 4AD1A 4D6JA 2X0YA 2DZUA 4G1NA 4ROQA 4H6EA 4JQAA 3E2RA 4P5UA 4OU1A 5CH9A 4ZOBA 4XO6A 5F4WA 1B3XA 1MQQA 1F3XA 3BJFA 4F2BA 2CIPA 2BGSA 1OCQA 1B1YA 1PHWA 2CITA 2WMIB 1TA3A 4PA8A 3C2VA 3WFLA 3FAXA 3PBUA 1H62A 3Q67A 3V35A 1E1FA 3WH6A 4W84A 1C92A 4JBRA 4DI9A 4UZSA 5FJIA 1H2JA 4DELA 1VBHA 2CBUA 3E96A 4HU4A 3WLLA 2V3DA 1P0KA 4FNTA 4HK7A 3U9IA 4BQ4A 2HVNA 2RUSA 3I3EA 1ZAIA 5C5YA 3GS6A 3QGVA 4ERGA 4NNCA 2J8GA 2PURA 1MUCA 1GKPA 4US5A 1CCWB 2CXGA 3CL6A 1PZ0A 3MMWA 4K1WA 1B3WA 4LXFA 4Y7EA 5FKYA 2ZC1A 2P0OA 4AY1A 1B54A 3T7VA 1LQAA 1P48A 4C6LA 3PJXA 4EKJA 1VFMA 4K3ZA 4DZHA 2J7HA 3LHZA 2WZMA 3VGHA 3S2CA 1Q5MA 4F8XA 3DHFA 3VX0A 4DJFC 1FWJC 1RBLA 1ZS2A 2PGEA 3VIMA 1WXYA 5CG0A 1MW3A 5EYWA 2OSXA 4WZHA 2NVCA 2XVGA 3UNDA 4IIHA 3UWYA 2WCSA 4PODA 3OO2A 1NIUA 3TW9A 3P81A 3E0LA 1SO4A 2WKLA 3GG7A 4CCZA 4MB1A 4DF1A 3WLQA 4TUFA 3O15A 5D04C 2JALA 3QLDA 1TZZA 4D2JA 2WM0A 1FCVA 4UTHA 3T0AA 1JUEA 2QJJA 1XI3A 2XIQA 5BROA 3HQNA 1XYCA 4DYJA 2DEPA 3ORWA 1NJJA 1R47A 2PDWA 1UD4A 1UWTA 3N9RA 1FHUA 2CHNA 1TV2A 2Y7EA 2OO6A 1E3XA 4JGDA 1C9WA 1JD7A 4H9TA 2EO7A 3IPWA 1L6YA 2CZVA 1LRTA 1RLCL 4EPDC 1V3IA 2OLHA 3R11A 2JKEA 4W9TA 3GZAA 3ZM8A 1XC4A 1R38A 4C90A 2A3LA 4L64A 1RJPA 1NWUA 2VRQA 4LS1A 2EGZA 3LM3A 3LK6A 1Q63A 2OVLA 1GOWA 3DN5A 3B8VA 3WJYA 3MYOA 4ONVA 1KO0A 4QQUA 4JX4A 4ADSA 4HNCA 1P6CA 1KWKA 3W7JA 1FWHC 3BAKA 1CDGA 1G67A 4C65A 4UR7A 1M7OA 5TIMA 2QKFA 2WNQA 1HUVA 1VIZA 2AQOA 1LWIA 2ZA1A 4MFEA 4A05A 1C90A 2VFIA 1B3ZA 3G1AA 1P0DA 4B3KA 1JIBA 5CLWA 5FSEC 2I5IA 4AFYA 4M5PA 1ZQ5A 4DLMA 4Q8WA 2REQB 4B15A 5FF7A 5G1YA 4EPEC 4QEEA 4EE9A 2HE5A 3H12A 3QOMA 3ARUA 4EPKA 4ZSTA 1M7JA 1A0EA 3K30A 2QT3A 2NT1A 2V6AA 3KBJA 4TMBA 4FALA 4HSOA 5F2LA 1BQCA 4H9MA 3CHDA 1M5WA 4EXBA 1F6KA 4F2TA 1J10A 4O15A 2ZE0A 2J66A 4C6CA 4QE1A 3QV9A 3W85A 4B5NA 4JL2A 5CPTA 1LZOA 4FOJA 3V18A 4TOQA 3XISA 3OB8A 4AD3A 4IHCA 1PYMA 1XSJA 2OZTA 4KWSA 4W8AA 3W24A 3AMGA 2PWVA 3QZEA 2UBPC 4C6EA 1SZFA 3IACA 2PS2A 4JFVA 4ZOCA 3ANYA 4UNLA 1FWIC 1BYAA 1PSCA 1GVQA 1RUSA 3T2OA 3UJEA 4L6OA 4OTKA 4GXWA 1KM0A 4NI8A 1OT2A 1S38A 3NPWA 3U48A 3W22A 3W00A 4GVFA 1M53A 2CZ5A 1XWYA 3QR0A 4JIEA 3TTQA 1Y8BA 1P6WA 3FV9A 2G4JA 3IV3A 1UR8A 4QDWA 3G1VA 4JDBA 3DU0A 2OMAA 3VDGA 3MBDA 5LIXX 1JVNA 1GOKA 1WDDA 4CVUA 3FN9A 5C0QA 3F7JA 4JN7A 3LCLA 4NJJA 4ZB2A 1BYBA 5HNUA 2DZTA 5HMEA 2QAFA 4CD5A 3O6CA 2BHUA 3SW6A 3WLTA 3NOYA 1GW1A 3EOLA 4DB7A 4PMUA 1T7LA 3VFCA 3BQ6A 2OB3A 4NRRA 3TQVA 3E38A 1TCDA 3O6YX 3OZOA 1SUXA 3C2YA 4GI6A 1TMQA 2V38A 1R2SA 4FNUA 1UOKA 3LDVA 4PUMA 4K37A 1GVYA 4W85A 4MGGA 1PO9A 1ONWA 1SGJA 4RW5A 1C3FA 2QV4A 3PNZA 1Q2RA 4QDPA 1QNPA 3FHQA 2BDQA 4RXFA 1FKXA 4MKVA 1E70M 3TU9A 2J77A 3TSBA 3W2MA 3PG8A 1IT7A 1QO5A 1CXKA 2QULA 1UP3A 1TMHA 1AVAA 4E8GA 1XIIA 4WJEA 1AZ1A 1SO5A 4M19A 1O7AA 5LIUX 3LI1A 3RHGA 2OWCA 2XJ7A 3GVWA 4GNKB 4AW7A 1BFNA 4OECA 2VEFA 5ABHA 3NQFA 4LRSA 1OFBA 4AXKA 1ISVA 3RCMA 2OTDA 2ZX7A 3W6YA 1XH1A 1ZZMA 1BTCA 3O2LA 3LLFA 2B4GA 4ERAA 3BMWA 7REQB 2PCEA 3NL3A 2ZTKA 3EZ4A 1Z32X 1G7UA 1OC6A 2XSXA 3SRFA 4HOWA 2WB5A 2ZICA 4FLOA 1F76A 3CPUA 2H6RA 2ZCGA 5F1VA 4IP4A 4GBUA 3D6NA 3BWWA 2ZUWA 3OGSA 1P0NA 3MCOA 5FJUA 2NSOA 1VCFA 5AKQA 1H50A 1GQJA 3ZMRA 4MPKA 3ZR6A 1K4HA 3I7QA 1LRNA 1S39A 3SURA 2E5BA 1EIBA 2Y88A 2I9EA 3P6LA 1W3LA 1KCXA 2FGBA 1RHCA 1XF0A 1Q6LA 2OZ0A 2VYOA 4M81A 1WKYA 5JVLA 2QF8A 3WDPP 4IUOA 1VPXA 2VM8A 2J8FA 3TAKA 2V9DA 3TLLA 3FDGA 3POHA 3O07A 1XLCA 4RZ6A 1HN1A 2DJLA 4BI5A 3LTPA 4ZMGA 1TTIA 2QJMA 2UWFA 3AMKA 2RJGA 5I23A 3H7UA 3RX3A 1SW3A 2JK2A 4DWSD 1PKMA 2XGZA 5D38A 3T8QA 4NX5A 2G0WA 2WZIA 3L5AA 2JF6A 1OYAA 4LSBA 2DUAA 5K7JA 1H5VA 3VGEA 4IMCA 1H3GA 5T9CE 3A3XA 1MMFA 2VGIA 2VQTA 2OEKA 2R24A 4LNYA 3ITLA 1O5RA 4U5IA 5BU9A 3KM8A 3VAVA 2VWTA 3VOHA 1I2RA 3PHAA 4LY8A 2X8RA 3MSDA 3CHVA 4IOTA 4R9XA 4LPCA 2EG6A 3EWWA 4MJ4A 1CEOA 1BVWA 4AB4A 1UKTA 1QHZA 1WZMA 5FESA 3W28A 3WLOA 2Z7GA 1BGAA 4Q6XA 2IPWA 1JNDA 2WSRA 4Q4SA 3IANA 2I9UA 3HTWA 4HA0A 4UFKA 1WDRA 2OO0A 4CN1A 5HMDA 1ADSA 2RHGA 1VS1A 2C16A 2QV5A 1FWCC 4W7UA 5FOOA 4I5UA 1E4LA 2GJRA 1XRFA 2QJHA 2QLYA 1B30A 3GTIA 4PEEA 3H54A 1UIPA 2PLCA 4CCEA 1A5LC 1QOPA 3TJLA 2GDVA 5DCBA 4LOCA 3QMRA 1HL2A 3BAIA 3WQ4A 4FB7A 1QT1A 2TRSA 3B9DA 3S6DA 2UY3A 1KW1A 4HKPA 1OZQA 3GK0A 3PZNA 2XG9A 4GVGA 2J47A 1V0MA 3NL2A 4HCHA 3RITA 3WFZA 4G56A 2QUMA 3VI2A 1E72M 3EB4A 3H21A 3M0YA 2PDUA 2JGQA 2GJXB 5FEWA 1ZRQA 4ACZB 2PDMA 4WOZA 2DSVA 1XM3A 4UNKA 4JYFA 4NT0A 4M51A 4JKMA 4FLRA 3CZGA 3WBAA 1YNPA 4WSHA 2DT0A 3WF2A 4MTVA 3WLRA 3SBFA 2VDGA 3GFZA 5DY3A 5HAOA 1J6PA 1VYSX 1VIWA 2PRHA 2C1GA 1ZENA 3LPFA 4NZ5A 2E0PA 4OJYA 3HMJG 2GQ8A 1XBVA 2V5JA 1R3TA 1XGDA 1TELA 3K4DA 2YXXA 4HU3A 4K8HA 1O5QA 3O0KA 5D09A 2UZ9A 3AXKA 1DPMA 2RDWA 3A47A 4IPJA 2PU1A 1Q6FA 2X2GA 4AYGA 3AU2A 4L9XA 2BXVA 1UG6A 1ZALA 3L9CA 1QASA 2WM1A 2E9LA 3SIMA 4E2DA 3BCJA 5ECVA 1QU4A 1ME8A 3SCWA 3BV4A 2E6FA 1SFSA 5A5WA 4LANA 4LVFA 1HP4A 2WMHA 3BE7A 4XAFA 3FDKA 3HF3A 3A6OA 1PKYA 2YB1A 3LX9A 5HOSA 1QUMA 5RUBA 4ZENA 1S5VA 1XLGA 3S8HA 2R6OA 5DCEA 4CVWA 2DUXA 2V82A 4O1BA 4LW7A 2WHJA 2WZHA 3DFPA 2V81A 3IS4A 4NZCA 2FKPA 7PTDA 4NJHA 3P7YA 1HJSA 4H9ZA 3GO2A 2BHYA 1S5NA 1QOXA 4IMAA 3FFSA 1ZFJA 4IQJA 3S4TA 1Z9AA 1AODA 1GOIA 3QTGA 5H8MA 2OGJA 1KM1A 2ZRZA 3TA6A 1TCMA 2PODA 4HOZA 1Q66A 4HPNA 3EA3A 1A5MC 3NUKA 2E1DA 3ARXA 1L8PA 2J88A 4BS0A 1FUYA 4ES4A 2OYKA 1H4PA 2O7QA 2EF9A 4C5ZA 2ZKMX 3AIRA 2CWNA 2PDPA 3P5YA 3A22A 4H7CA 2VKZG 1DWAM 2PDQA 3NPUA 1PJ9A 1JXKA 3A4JA 1HNYA 3AHZA 4RCXA 2RDUA 4A2SA 4LC8A 4Z2HA 1CGTA 5AHFA 4XWUA 3N2BA 2QUUA 4OV9A 3TTOA 1V7AA 3WQ5A 2F7FA 3S0CA 1EXBA 1CGVA 3RLHA 5HMSA 1H61A 2V5CA 1J0HA 1VRDA 2QDGA 3AXMA 4Z1DA 4OIFA 4GZJA 2BXZA 1F5ZA 2ESCA 1US3A 2V30A 3VNZA 5CBJA 5E93A 3N4EA 4YTRA 4DJDA 4PEKA 4PSPA 3A3WA 4N7QA 4JNZA 3KVJA 1JEZA 4AZCA 3S1XA 2VTFA 2G3FA 5AHNA 1JCJA 3OBKA 3N12A 4L6DA 3IVUA 2WCAA 4L1WA 4O54A 4YMZA 1I1WA 3OEXA 2XHYA 4L1XA 5AFDA 2CWXA 4I9MA 1YTEA 5FAJA 5LIKX 3GE7A 2FZDA 3AHYA 5D4YA 2VT0A 3TXVA 2INEA 5HQLA 1MZRA 5BYWA 1DEDA 1NVMA 2ZDSA 3QSTA 2PDCA 3GUWA 1QW8A 1GHRA 1ZHAA 3W6LA 4EK7A 2ZZ4A 3SGZA 3ARYA 4DXXA 3RPDA 2A0NA 1JULA 4IFOA 4S2BA 1N55A 4ATDA 1UJQA 1Z6KA 3VU2A 3GDBA 1TSIA 3SUSA 3B0YA 3K4WA 4QITA 1YRRA 2OWWA 4GISA 4GH1A 1MXGA 5GJPA 1GW9A 1UUQA 2C1HA 3LQLA 4UXDA 5D9NA 4ZXLA 1FXPA 4MPQA 4H4IA 3CWHA 4NZJA 3N4FA 4I8DA 3H26A 1JFXA 4GJJA 3R12A 2J27A 3AUOA 4XD6A 2EJ1A 3BLKA 1NP2A 5CGQA 1KV5A 1LLOA 1K3UA 1OSEA 1XUUA 1UWQA 2PWGA 4M6QA 4XO7A 2VRKA 2XH4A 4M82A 3PZTA 4P7LA 3CZKA 3H22A 3N9SA 1Q6RA 1OX4B 3IGHX 3B8SA 3G0SA 1E1CA 3G22A 2CXEA 1HX0A 1Q6QA 4MY1A 5HXMA 3LV5A 1TJ1A 5CPQA 1MW0A 1UUMA 3R89A 2RJHA 3KOXA 4MUZA 1PX8A 1UA7A 1JZ4A 1KM3A 3N1AA 1OZMA 3WQPA 1OG6A 2Y5EA 3UWQA 3W1NA 1KXQA 4O17A 3GW3A 2Z1VA 1EDGA 4Q8QA 1N82A 1FH9A 1NFBA 3W1RA 1QI0A 3H70A 1IEIA 1UQZA 2OT1A 1A5BA 4PMOA 5REQB 3WUEA 1TTPA 4Q8VA 3EEZA 1XL9A 2HROA 4NAEA 3VDAA 4GO9A 3CQKA 4PZVA 1FWGC 2PGFA 4Q8MA 4UQCA 4NG3A 2BFGA 4CEXC 1KKRA 1YKWA 2HSAA 1KFWA 1AQMA 4XD3A 1XDJA 1GT8A 4K68A 3C5QA 1GPFA 3OU8A 3VC6A 4AXNA 3TTEA 3B05A 1Q7MA 3FGCA 1AL7A 1BYDA 4DWSB 2V2CA 1FP8A 1PX3A 3VOJA 3LB0A 3UZYA 1GVRA 4X3ZA 3SCUA 1XS2A 3SUUA 3QPZA 4DNHA 4MHBA 1AMYA 2XH2A 3M47A 2Y24A 3DOPA 3G6MA 4BZYA 4AAJA 2PZNA 3OIHA 2AQWA 3I7SA 3GNDA 2EXOA 1YPIA 3LLDA 3ARQA 1M9HA 4PB4A 3D47A 1YDOA 1WDSA 3VE7A 2W63A 4JFWA 4JEQA 3S2MA 1W9UA 3BMXA 5FA5A 1XPYA 5AYIA 1YADA 4D6CA 2O56A 2W67A 4I9AA 4JTLA 1E51A 4O1EA 3HU7A 1W31A 3CUZA 1KCLA 2G4FA 2QPXA 4JHOA 3EWYA 2A21A 3VZYA 5CEWA 3Q2DA 1EOMA 2DJXA 3BW2A 1UZ1A 1LWHA 3KEHA 2OG9A 3MJMA 4UTMA 2AAMA 1FOBA 2XZ9A 2WJEA 1XLAA 3QW4B 4J40A 1X39A 4YHEA 5MKGA 1JCMP 4RLIA 2ZWZA 3R94A 4FIQA 3IK2A 4UFIA 1CLVA 3M64A 2BV9A 2GK1B 3R0UA 2Y8VA 1Q7ZA 3IJLA 1PPIA 3AZSA 3VGFA 5IBXC 3UCQA 3MANA 2EJAA 3HURA 4IH3A 4YTQA 4LVBA 1NWSA 4W5ZA 3W82A 5G2HA 2NUWA 1SU5A 2PDXA 3UGVA 1ISZA 1GVOA 3SRKA 5C70A 4RNJA 5ABFB 1MI3A 3EMQA 3E0IA 3S1VA 3HGRA 1V6WA 5EY5A 1V3LA 4ZQCA 1YNYA 1M03A 1VHNA 4V33A 4DM2A 4Y9NA 3LXBA 4O0KA 3P67A 3L5MA 1VBJA 2FMOA 4EF8A 4Y90A 3ZVHB 3NO1A 4GI4A 3SECA 4OGZA 5A94A 5GPRA 1NEYA 4PCPA 3EOSA 3FKKA 4UMCA 5EMJA 4XZBA 1AZ2A 2R14A 4GI9A 4XB3A 3OGRA 4ORMA 3BGAA 4R7OA 3U2CA 1BHGA 1PZ2A 3U5YA 4QG8A 3GG0A 4D6GA 3RFAA 1VYPX 2FFCA 1T8XA 2TAAA 4XBSA 2Q01A 2ZZ7A 2J4GA 3VIIA 1CW2A 3CO8A 2FQIA 3A4WA 1MFVA 2Z6IA 1JZ7A 1ELSA 2HVOA 2J7BA 3T4CA 4W8BA 4U28A 4B9YA 2C3ZA 3TC6A 3LY0A 4JNMA 2AKMA 1A5SA 2CZDA 3VGDA 3WK0A 2VCCA 3TA9A 1QWKA 1T40A 1SM9A 4JR5A 4XVDA 5G5IA 1UR0A 5LXEA 2CETA 3A3HA 1CLXA 3GFXA 1F6YA 3U2ZA 4IX0A 4DO7A 1S5WA 3UP8A 1Q8AA 7TIMA 1ADDA 1V6XA 3S5YA 4ZO7A 5EMKA 3U3HA 2ZUSA 3Q45A 1JYVA 3M0MA 1FWRA 3RDKA 1RD5A 1RK5A 4D6DA 1SR0A 1UJPA 1KRAC 3P8JA 1Z8AA 1WYIA 4EVZA 2BXYA 1RSCA 3SGUA 3HV8A 3HB9A 2WSQA 4IMFA 1SSDA 2P3EA 1RQEA 4LY4A 4S2CA 3EMZA 3JS3A 4QCFA 1DXFA 2DORA 5IDZA 4BEQA 3BANA 4NRSA 1W1PA 2X1TA 1W91A 3F4DA 2QIWA 1R3WA 3BK0A 4IL0A 2C71A 1WV2A 2MUCA 3E3HA 4X2RA 4Y9PA 1EWDA 2PC8A 3C2OA 2ZOXA 4PRRA 4UOJA 4S3EA 4ADUA 1S1RA 1RH9A 2Z2UA 3SUVA 1O94A 1W9DM 1IGWA 4UZUA 4P8UA 4KRTA 4WEVX 3N13A 1QPRA 3GG1A 3BAJA 3LNMA 4JTRA 1TQXA 4ZEPA 3SQMA 2BX7A 2OPJA 2V3EA 3PBVA 3M0JA 2OKTA 4PRWA 4A3RA 4O1DA 4QNEA 1DWHM 5REQA 1ZP4A 4MY8A 5HDRA 4E38A 1ZAJA 5AECA 3TP4A 4CQDA 4MOZA 3CC1A 3CUFA 4GBDA 3D3AA 1TUFA 4A35A 3V4BA 3TONA 4PRTA 3RNDA 2XGBA 1BGGA 2Q02A 1FDYA 2XDFA 5K9XA 1RALA 1GK8A 2H3DA 4JTUA 3Q65A 4PTDA 1AD1A 3U2OA 4KEVA 1WO2A 1XDMA 3G1FA 1QPOA 4NZ4A 2CFFA 3BC9A 1EUNA 1DYSA 4ZE5A 5C54A 2IPJA 3M07A 1H63A 2POZA 2ZRXA 4XUYA 2E68A 5E9AA 3W84A 3BSMA 2F2HA 1A0DA 4HHPA 4DRSA 3QN3A 8XIMA 1MRQA 2GLKA 3EXSA 4YS1A 1EF2A 1GCYA 2GSHA 4A3YA 1O4UA 3UG4A 1XH2A 5FF3A 4QJ4B 3CUGA 4J3UA 1DE6A 3UXKA 1N8WA 3OA5A 2X2YA 4UTUA 3WQDA 1LP6A 3SDOA 4MVAA 1YQ2A 2EPLX 3UJ2A 3C2EA 4FLSA 5C6MA 2V69A 4JN8A 3WDRA 5I3GA 2DZWA 1UP0A 4JIHA 2A3BA 4D8LA 3F5JA 3UJRA 3T0CA 2WC7A 1GVFA 1QMLA 1A5NC 3MUZ1 3VIFA 5BXPA 5DFAA 2EEXA 4YWSA 2W27A 1TRIA 1CWYA 1DJQA 1EX5A 3MO4A 3LI0A 4DXKA 4O57A 1VEPA 2QUVA 4FZIA 2YCLA 2GGGA 4CU8A 4HN8A 5D05A 4LBSA 3L7RA 1NAL1 5LHFA 2ZX5A 1TR9A 1FFRA 3IGXA 3SAZA 3WF4A 3AC0A 1JGMA 2J25A 3PPCA 3KS5A 1E6QM 2QCHA 3H6OA 3TEVA 4QROA 3WKZA 2QVNA 5HNNA 2BY1A 4HA1A 1V0LA 4YL2A 2E6YA 3W53A 5BXTA 3S9ZA 4WDXA 5FEZA 3KBVA 1YMYA 1CB7B 5HR6A 4UCGA 4DO6A 4F0MA 4B92A 3HGSA 2JKPA 2QXWA 5FD0A 2D3NA 1PUDA 4US6A 3WH8A 2Z4GA 4I9TA 3EAUA 4W4QA 3S1UA 1EJWC 1MDLA 1O5XA 2BG5A 2PTZA 3WQGA 1E6RA 3GM8A 2D73A 3PZQA 4M56A 5AVNA 1D3CA 1UBPC 2A3AA 1XFCA 4JZ5A 1NOWA 2BOEX 2DSZA 3TJ4A 2GJLA 3VMNA 2WLZA 4AWUA 2ZXQA 1O5KA 2V2HA 3ZSSA 1XRTA 3JU2A 3N9KA 1QCWA 3V1PA 1F6PA 1FY6A 1ECEA 4LCSA 2DZSA 1H1YA 1J5SA 2V8ZA 3S3GA 1AQ0A 3CTTA 1IGSA 2OZ8A 1PIGA 4XKMA 2YKKA 3K13A 4L4PA 2B7PA 1HO1A 2I57A 2NX3A 2OOGA 4CCCA 1ISXA 3L0KA 3TYAA 4AX6A 1CENA 4XZNX 2VCAA 1S2VA 3WLIA 3M5YA 4ZTXA 4GWEA 1TVLA 2RH9A 3KP0A 4JFTA 4L6HA 1MNZA 4F79A 1OC7A 2CHOA 4RL3A 4OFCA 4P7RA 1YTKA 4J3SA 1GHSA 4Q4KA 3GDTA 4ZQPA 1ESWA 3MI3A 4K36A 5FEPA 3MTWA 3UG5A 1J8VA 3H2AA 3PB2A 4ATWA 4LUIA 4PUKA 3HN3A 3AWOA 3LCFA 1JDFA 2Y4SA 2GGHA 4UQDA 4E0CA 1POJA 3MVIA 2P53A 4GYKA 2VEIA 5CSYA 2XSAA 4HNLA 4JX5A 5BWFA 2W79A 2R9RA 3IIZA 5F2GA 3SM0A 4XIMA 1IQ8A 1HGWA 1I2NA 5A8OA 3LOTA 1U22A 1JZ3A 4C6KA 2BVWA 2FLIA 3LNPA 1SR9A 2EQDA 4WKFA 2OFJA 7CGTA 3GXDA 5LA2A 2QIIA 2CLEA 3MKKA 2QS8A 1I0DA 1IR2A 3W26A 4IIEA 4D1IA 4H8VA 1MQRA 1WNOA 3HQ1A 3FEQA 4GIYA 1WX0A 1KXHA 4PMJA 3JVAA 2AMGA 3UCCA 4L65A 1XD0A 4GX9A 2QDHA 4IPLA 4O18A 3TWBA 2X40A 3DYPA 3AIUA 3BARA 3DKLA 1G7VA 4V1XA 3UXLA 1M41A 1CZ1A 2YYTA 3MUXA 4Q7NA 3SCQA 1Q3NA 1AH3A 4MM1A 3QFWA 3A5FA 2FHFA 3HOJA 4S23A 2YJQA 4WOQA 3QV8A 3VNLA 1MQPA 1ONEA 1UKQA 3TYCA 3W23A 1OYCA 4KWUA 4WDTA 3A23A 2QCLA 2DIJA 1QPQA 1GZ1A 3R8HA 2J6VA 2INFA 1U5HA 4UTTA 4V28A 1XKYA 1YLVA 3CV6A 3OHMB 2PLJA 3LN3A 4WGHA 3N2TA 2J62A 3VDBA 1PZ1A 1UC4A 4XSMA 3RU8X 4XZIA 1G5AA 4MJ2A 3A5VA 4ACYA 2QCFA 3FA4A 4WGXA 3NQEA 2DVUA 1DWGM 1U33A 3AUJA 1KLYA 3H23A 5JXQA 1OWQA 4IQEA 2ZTJA 1YEYA 1P4CA 2OOFA 5KZEA 3VOIA 1J01A 1LQ0A 1UWAA 1T8QA 1HJUA 7XIMA 4AF0B 1GTHA 2E5DA 3KCLA 1V3MA 4GXPA 1CXLA 1K9FA 1UZHA 1VZWA 1GOOA 1EGZA 2GJNA 3ITXA 1UWIA 1VD6A 5EBUA 4RV3A 1HQTA 4F3HA 1KR1A 1OBAA 4JD4A 4DYEA 1F4AA 2C1IA 3WDIA 3IIOA 4E2VA 3FA5A 3C0LA 3K5XA 2WBGA 3M9YA 4LS0A 1BG4A 5F1UA 3SUTA 3EKLA 4YN5A 5EBAA 4Z2KA 5H6HA 4DUWA 3HA1A 4Y8EA 3B8TA 3EWCA 2D2GA 3OZPA 1KFKA 3AAMA 3PR2A 4AIUA 1JZ6A 1GEQA 4K8GA 2CESA 4GUGA 1OFDA 2E8ZA 3KVMA 1E71M 3VIHA 4ZQMA 1U5JA 4ZFCA 3CLMA 5I2UA 4O4VA 2PTDA 1NTHA 3S5ZA 1V3JA 4QAWA 2NQZA 4E4UA 3WLHA 3BVJA 4MZYA 2ALDA 3VUSA 3UETA 2OX1A 3D46A 3JUGA 5D37A 3W75A 5HQMA 1VPYA 2VR4A 3MSGA 3BCFA 2C13A 4OE7A 4FF5A 1V77A 1W5OA 2PP1A 4DQWA 5CCZA 2PDBA 2CLIA 2BVDA 1QRQA 3NQAA 2ZA3A 4PBEA 5D32A 2XWDA 3UT0A 4M1RA 2NW0A 3RLVA 2FVLA 1EJTC 1MO0A 4WD0A 1W3KA 3OYXA 3OIXA 4M6PA 3NXLA 1EHAA 1XQKA 5HQEA 3RRXA 4LAOA 1V6VA 4EANA 4KIEA 3URAA 3NO3A 3EX2A 3L4UA 3T81A 1MRAA 3JRKA 1NDYA 4ZVJA 3W86A 3LHYA 2BBFA 2W62A 3TSDA 1T0OA 3W1MA 3LM7A 3I3BA 4HB7A 3KOWA 4HNTA 4N6FA 3KL3A 3CQIA 4CGTA 4AD4A 4LAMA 3KDNA 1I9CB 3O8AA 4Q4RA 5FL0A 2D22A 2JBMA 2PDLA 4B2DA 3L4YA 3U4FA 5D02A 1GVEA 2BY3A 3GVRA 1YHTA 2PD9A 3W74A 3E74A 4AG0A 2ZE3A 1IV8A 3ITYA 4GIEA 3CQHA 1U30A 1E5NA 3BG3A 1OF6A 4JTQA 4N02A 2E67A 2XN0A 3GRIA 3L65A 2VR5A 2YDSA