1QWKA

Structural genomics of caenorhabditis elegans: hypothetical 35.2 kda protein (aldose reductase family member)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
312
structure length
312
Chain Sequence
TASIKLSNGVEMPVIGLGTWQSSPAEVITAVKTAVKAGYRLIDTASVYQNEEAIGTAIKELLEEGVVKREELFITTKAWTHELAPGKLEGGLRESLKKLQLEYVDLYLAHMPAAFNDDMSEHIASPVEDVWRQFDAVYKAGLAKAVGVSNWNNDQISRALALGLTPVHNSQVELHLYFPQHDHVDFCKKHNISVTSYATLGSPGRVNFTLPTGQKLDWAPAPSDLQDQNVLALAEKTHKTPAQVLLRYALDRGCAILPKSIQENRIKENFEVFDFSLTEEDIAKLEESKNSQRLFLQDFMTGHPEDAFAAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics of Caenorhabditis Elegans: Hypothetical 35.2 kDa protein (aldose reductase family member)
rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
molecule keywords aldo-keto reductase family 1 member C1
total genus 107
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2003-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1qwkA00
5AZ1A 1AFSA 3LQGA 4FAMA 1XJBA 2PDGA 2PDBA 2PDFA 4DBWA 4HBKA 4JTAA 4PRRA 3M4HA 3LUTA 3V36A 4L1XA 3N2TA 3Q67A 3UWEA 2FZ9A 1PZ0A 4YVXA 4YVVA 4PRTA 3V0SA 3UZZA 4PMJA 3UZXA 1C9WA 3S3GA 2PDLA 2PDQA 4FA3A 4XO6A 1RY8A 2DUXA 2HE5A 3ONBA 4XZIA 2HV5A 5JH2A 2F38A 3LN3A 3N6QA 4FALA 2PDJA 2PD5A 3FJNA 3B3DA 2WZTA 2DV0A 2F2KA 4GQGA 4LB3A 4YU1A 4JIRA 4QXIA 3LQLA 2PDUA 2PD9A 3R7MA 4QR6A 1PWMA 3GHTA 3RX2A 1AZ1A 1HQTA 1R38A 4G5DA 2IQDA 4MHBA 3M0IA 2WZMA 4JQ3A 3R8HA 4XK2A 4IJCA 4IGSA 2PDMA 2IKGA 2PFHA 4XO7A 1SM9A 2PDPA 2IQ0A 1VP5A 2P5NA 4OTKA 1IEIA 1PWLA 1ADSA 4DBSA 1UR3M 4ICCX 3V0TA 3CV6A 1IHIA 3H7RA 4WDWA 1FRBA 4JTDA 3LEPA 3VXGA 1Q5MA 2IPWA 5LIWX 5KETA 3UP8A 1AH4A 3EB4A 2IKJA 3G5EA 4JQAA 4XVEA 4ASTA 3U2CA 2HEJA 2VDGA 3M64A 3R94A 1EXBA 1X96A 4PUUA 2C91A 2IKIA 4JQ4A 3MC5A 4YVPA 5HNUA 1T41A 5HA7A 1J96A 1LWIA 3C3UA 2IPJA 3RX4A 1AH3A 5LIYX 3DOPA 4LB4A 4F40A 4JQ1A 4LAUA 4ZFCA 4L1WA 3ONCA 2AGTA 2BP1A 3GHRA 3WBYA 3R6IA 2ACRA 3BURA 3T42A 3RX3A 4QBXA 3WBXA 3EB3A 1T40A 2I17A 3WCZA 4LBRA 3UFYA 2ACUA 2QXWA 3NTYA 3DN5A 4GIEA 3EAUA 1ZUAX 1OG6A 1Q13A 1VBJA 2PDIA 4HMNA 4JQ2A 3MB9A 2INEA 3LZ5A 1YE6A 3UG8A 4H8NA 3BCJA 1YNPA 3O3RA 4Q3MA 4XZNX 3UZWA 3H4GA 1ZGDA 4IJRA 1S2AA 1EKOA 2FZ8A 2PEVA 3LZ3A 4GACA 3FX4A 1X98A 1YE4A 5HNTA 3ERPA 2CLPA 2PDYA 1US0A 4PR4A 3COTA 2R24A 4DBUA 1MZRA 3LBOA 4WEVX 1XF0A 4JIIX 1Z3NA 1GVEA 3KRBA 1RALA 2NVDA 2HE8A 5DANA 1X97A 2PDKA 4GCAA 4XZLX 3QKZA 1ZQ5A 2NVCA 3BV7A 1ZSXA 4YS1A 1S1RA 3O0KA 1MI3A 1YNQA 4EXAA 2IS7A 3BUVA 3R43A 3LENA 2HVOA 3F7JA 2PDXA 2PF8A 4XAPA 4DZ5A 4PUWA 1M9HA 1QWKA 3CAVA 2ACQA 1XGDA 4WDXA 4WDTA 5AZ0A 3D3FA 2ACSA 2IPGA 3WG6A 3R58A 3H7UA 2ISFA 4RPQA 1Z9AA 3V0UA 3CMFA 4LAZA 1LQAA 3GHUA 1EF3A 2HDJA 3GUGA 2FGBA 2IPFA 1A80A 1JEZA 3GHSA 2BGSA 3WBWA 1S1PA 2PZNA 3V35A 3Q65A 2PDWA 5LIXX 4I5XA 4JTCA 4QX4A 3UZYA 4NKCA 1Z8AA 3CASA 1HW6A 4XZHA 1EL3A 4XVDA 2J8TA 2PDNA 4GA8A 4LBSA 5JH1A 2BGQA 2IKHA 3LD5A 1MRQA 2A79A 1PZ1A 1PYFA 2FZBA 4JIHA 4EXBA 1QRQA 2FZDA 4AUBA 2FVLA 2HVNA 3CAQA 1AZ2A 3P2VA 3R8GA 1AH0A 2I16A 4FZIA 5LIUX 2ALRA 3G1RA 2INZA 1Z89A 2PDCA 1K8CA 4XZMX 4R9OA 5LIKX 4H7CA 2PDHA 3LNMA 2R9RA 4WGHA 4GABA 1RY0A 4JTRA 2DUZA 1S2CA 4JTQA 3CV7A 3UYIA 3UGRA 4WDUA 5C7HA 4Q7BA 4GQ0A 5M2FX 4WRHA
chains in the Genus database with same CATH superfamily
3TNOA 3A47A 3BCDA 3PZQA 1K4GA 3QV6A 5AHNA 4WSJA 1SZEA 4K6AA 3W85A 4FNQA 4W8LA 2PI6A 2VHLA 2HMCA 1M7OA 2P8BA 1TV7A 3MT1A 3F5JA 1QOQA 4UNIA 1P0BA 4GBUA 5H8PA 3QV7A 1Z69A 3NQ7A 4Q4KA 1UPMB 1VFTA 2H9AB 3BG9A 1XLAA 4E5TA 4L80A 3W01A 3LBMA 4IX0A 4N7QA 3EKLA 3TN5A 3ICJA 4C6LA 2OCZA 3GHTA 1DTNA 4AH7A 5D9OA 2O7QA 4F0RA 3W87A 3L2LA 1RCXB 3BAJA 3H53A 2QPXA 2FQIA 2A6NA 1XM3A 4DM1A 4RE2A 1G4TA 3K5XA 4ES4A 4WJ8A 1V3HA 2F61A 4AZHA 4JDYA 4E8CA 4A3YA 3M44A 2UZ9A 1E9ZB 3CWNA 1EZ2A 2PC8A 2Z7GA 3H4WA 4Q8UA 1X1ZA 4MAVA 4S2CA 2BVYA 3DYMA 3CC1A 5KZ6A 3TZFA 3NXLA 4AHOA 3CHDA 4UTFA 1E4MM 3VM5A 3BPWA 4AVFA 4ICNA 1E4NA 3G3MA 3ZLGA 1HVXA 3G5EA 3EOEA 3KZSA 2Y7GA 3BWWA 1SFSA 3N4FA 4NAEA 4KGJA 2BXYA 4ATLA 3UPBA 3UJEA 1M65A 3SSJA 1E40A 3RCNA 3SCOA 2EBNA 3W29A 1VD6A 4H8HA 3BW4A 5D04C 2HZGA 3H21A 4QE1A 2XVGA 1W1ZA 2XVNA 3MJMA 4L1WA 5CAHA 3A5VA 4DJFC 3KCJA 3T42A 2ADAA 4EPDC 5FKYA 1RLDA 1UQZA 1H7PA 2NLYA 2SFPA 1VJZA 3APYA 1QBBA 2I5GA 2WB5A 1EIXA 3GXPA 1DHKA 3W7MA 5F2LA 2XSBA 3H2NA 1W0MA 1AUSL 5FSEC 1UQYA 5G2WA 2HPMA 1HTIA 4IX2A 3MDWA 3INPA 3I65A 4DJFD 2HBXA 4CD5A 1RD6A 2QJIA 3MDUA 3DFPA 8XIMA 4GNJA 1ICQA 2Y62A 1XGZA 1BWVA 1ZNNA 3B0YA 4JX4A 2PMQA 4KEUA 1NAL1 1JPDX 4GHRA 3TFCA 3GC4A 1EA9C 4XBKA 3LK6A 2VP8A 4HYRA 3FX4A 1AMYA 5D2XA 2YIHA 4KGLA 1EJXC 3VCNA 1HF6A 1P1XA 4ZO7A 2PAJA 4MNJA 1JUEA 1KGWA 3AUOA 2ZX9A 3WD1A 4PR4A 1C91A 3KOYA 2X41A 5A8GA 2CHNA 4AB4A 4A8NA 4H04A 3AXMA 3GFYA 3I68A 1UHVA 3NQBA 5DLCA 4R7OA 3YPIA 1KWKA 5FF3A 3ANYA 4J27A 1ZJAA 3NDZA 2HRWA 3N4EA 1R2RA 4S3CA 1D9EA 2PLMA 3TZNA 3IS4A 4G1NA 2J13A 5IFTA 2REQA 2PRMA 4R85A 3DZ1A 4H83A 3D5HA 3QTPA 3O1NA 2QUUA 1EJSC 1YMYA 3V1HA 2PF8A 3K4AA 1XD1A 3EWDA 5AC6A 1UROA 1SSDA 1UJQA 3OGVA 5F4SA 1E1CB 4J4KA 1BRLA 3GNNA 2ACSA 1UPPA 4H9UA 3M0MA 4YYFA 1HXJA 1AD1A 3HG5A 3PR2A 4XG1A 3ZT6A 1FWEC 3RR4A 1JDEA 1J6OA 3WK2A 4O1CA 1PX8A 5D38A 1GHRA 5DMMA 2ZC1A 5GVJA 3USZA 3M0JA 1GK8A 4O0ZA 5FAJA 5AC4A 3I3DA 3V35A 5CAKA 1KD0A 1VPQA 3HG3A 1JUBA 1EUNA 3PUEA 1NELA 3OZMA 3AYRA 3SY1A 1DWGM 3MHFA 4AXKA 1UR2A 3B9OA 4HGXA 3H2OA 2PP3A 5E6ZA 3OVPA 2VC9A 1G4SA 1RQHA 3RJXA 3VCRA 3VDHA 1K7EA 4DXVA 4LVDA 4L7ZA 2OWXA 1VRXA 3UWWA 4U4MA 6XIMA 3C0SA 3C4UA 3MZ2A 2GVEA 1P6WA 2V5LA 3RLVA 1PCKA 3SUVA 5FF4A 3G0XA 5JUVA 1KRAC 1BGGA 1UP0A 2HVNA 3IWPA 4RV8A 3BQ6A 4KRTA 2A3CA 4ZSUA 4PZVA 3WF4A 5I3DA 1XP3A 3WUFA 3IRDA 4X61A 4IZGA 4HPNA 1A0CA 3QY8A 2JEQA 1BGAA 3W70A 4K8HA 4BY3A 4ML9A 4LCSA 5LIKX 2EEXA 2DJXA 5CH9A 3EDJA 3UWVA 2PDHA 1FDZA 1TPEA 3SFWA 1MUMA 3L9CA 2DP3A 1WXJA 4JTRA 1WAUA 1S2CA 5K4ZA 4ZFMA 2CERA 1MXSA 3OU8A 4GGBA 2C15A 3B4UA 2E28A 4WRHA 3NSXA 4A21A 3LRMA 3LTSA 3BW2A 3W53A 3W1PA 1JGMA 2ICSA 3MSRA 3LV6A 1EYEA 2FDMA 4KETA 4LEFA 5HNRA 3REQA 3U2ZA 1HKMA 4PRTA 4IFRA 1EP3A 1DIKA 4WXYA 3UJSA 5CXPA 2PDLA 1TUFA 2W79A 4L4OA 4Y8FA 4UQAA 5JH2A 2YW3A 4GBDA 2O0TA 4FR1A 3VX0A 1O94A 3TC6A 2J6VA 4JEQA 2ZUNA 3WDHA 3MBFA 2CHRA 1GUVA 1FH9A 1W9UA 2OPJA 2VL4A 4REQB 2FMOA 3BSHA 3UETA 4OV4A 1GVIA 2CZ5A 2OSXA 1SJAA 4NU7A 1H2JA 2QJJA 2ZX7A 2ZFAA 4X9YA 2P88A 4G5DA 2DQWA 5K7JA 2H8XA 1KR0A 3MUAA 3OW1A 4ZXLA 4KFNA 3NSMA 3ZQ9A 4IJCA 2GJNA 3GRIA 2B4GA 4O1AA 3QC0A 3FK4A 4LUSA 4MIMA 1ZP4A 1ODZA 1PX3A 3NL6A 3RHGA 5F4WA 1UCWA 2XIBA 1J5TA 3STCA 4IPJA 4IUOA 1XINA 4JTDA 4UB9A 4DJFA 1BTMA 1LORA 2OR2A 3QR1A 1F61A 3M6YA 1VEPA 2QAPA 1HKJA 3N2CA 3A4AA 4ZOEA 4PB5A 1V3JA 5FEWA 2HEJA 3EDFA 4W86A 4YWSA 2DVUA 4URIA 1OC5A 4ZEPA 5JU6A 1ZBKA 4LNYA 2QJHA 4XV0A 4YPJA 4ZQPA 4FLRA 4BEUA 3S6TA 1FX6A 2WVTA 4AWEA 1SMDA 4NQ1A 1XYZA 1N2VA 5D05A 2VEGA 4PL2A 1I75A 3HMCA 4A4AA 2VD8A 3FXYA 3S6DA 4QJ4B 2XU2A 4JTSA 3EOSA 5DO8A 1NJJA 1VFHA 2MANA 3R0KA 2I1OA 2V6AA 1Q6FA 4FHAA 3WFZA 3N1AA 4N2YA 1QK0A 4P7NA 4M3PA 4O13A 2VZUA 3ARVA 3NG3A 3VOFA 1YDYA 4CVWA 2ZUWA 1K9EA 1UR8A 2OQYA 3HGRA 1IEXA 2GUUA 2OKOA 3BCJA 1ZZMA 1KXQA 2GLKA 2AKZA 1J2WA 1CXFA 4JDBA 1TRDA 3EA1A 3GYCA 2FHCA 5AC8A 3JZEA 3A9BA 4IJRA 1PKMA 2P0OA 5DRCA 3I7RA 3CIWA 1NQKA 3NQ6A 2R6OA 4IMDA 4HK5A 5ABFA 2VVSA 1RVGA 5FF0A 1I2PA 2Q3RA 3H7VA 3GW3A 4LUTA 4WEVX 4ZQCA 4PTDA 2XN0A 2ZXQA 2VELA 2ABBA 1CGYA 1WYIA 2CLHA 2Z6IA 4H6RA 4KWVA 1ZCOA 2CKRA 4H6EA 4H00A 2Z2AA 2GWGA 4NP7A 3IARA 1VEMA 1A5MC 4HJWA 1O5KA 4IMFA 4EXAA 5EY5A 1VPXA 5H8MA 4XZBA 2GOUA 2JF7A 2OFJA 1BVWA 1PZ2A 4DEFA 4JN7A 2Z6JA 1CECA 4UWMA 1RXOB 4WDTA 4IICA 3QBUA 4C6FA 2ISFA 1UKOA 3EWYA 4LQ1A 5CPOA 5GJPA 3L23A 1A5CA 3NA8A 1OC7A 1FWAC 4AD3A 3LRKA 3M7SA 2C6QA 2X30A 3CXOA 2IPFA 1FWIC 3MWCA 4KBXA 1LLZA 2PWHA 4E2BA 4J28A 2O4QA 1NY1A 4IGNA 3WBWA 1MSSA 2FJUB 3TOYA 2UY4A 4CN4A 4NZJA 3BXWA 5J5RA 4KCTA 1O5RA 1Q45A 2HISA 4I5XA 1LROA 3OVQA 1MEHA 1JD9A 1GOOA 3MS8A 1VR6A 3SN4A 1BHGA 4B3ZA 4CD7A 3M16A 3NVTA 4EK7A 3S1WA 1JRCA 1ZAJA 1W3JA 1VJIA 1VFSA 8TIMA 1S2UA 1KFJA 2EG6A 1M7XA 2OGJA 4LNCA 1ZB5A 3CAWA 3L5AA 1WA3A 4RNHA 2HS6A 4AUBA 1KW1A 2C1HA 2ZICA 1BG9A 4G8TA 4M6UA 4M56A 4CU7A 4FZIA 4RK8A 1RP8A 1R3VA 3B8DA 3IIXA 1XW8A 2CHOA 3QFWA 3BQ5A 3FW6A 3EXSA 2E1WA 3U6WA 4GK8A 2AQWA 1BG4A 4C1NB 2R9RA 4F0LA 3NSNA 4GABA 4UQCA 3KVLA 3O15A 1BQCA 1HIZA 3UBPC 4LXFA 1W54A 3SAZA 3HO8A 1TPFA 3I3EA 1T8XA 4Y90A 5FL0A 4MPKA 1OFQA 3A24A 3ARTA 2PDFA 3GTXA 4JTAA 4PRRA 3MUCA 1T5AA 3HFYA 4QLJA 4Z2GA 3FCPA 1QW7A 3T9PA 2Z1BA 2XGIA 5M3WA 2YA1A 3EWWA 3MO4A 4FNRA 2ZTJA 4PTVA 4AC7C 4PUNA 1GOXA 3SCRA 4RV3A 7XIMA 3IJ9A 1UB3A 4US6A 2HE5A 2W5FA 3EWCA 3FYPA 5D03A 1TPVA 3T0TA 3HJZA 3LLFA 2VD9A 3RITA 4J3UA 3WMCA 1BEUA 1E5NA 2FKPA 4ADUA 4O1DA 4QXIA 3HIJA 4ZXOA 1RCOB 4ALDA 3FIGA 3TA6A 1BKHA 3FAXA 3CL7A 3LPFA 4NZ3A 1LG1A 1CWYA 2J7GA 2P1FA 2ZTKA 4HB7A 4LY4A 1TSIA 1DXEA 3ZOAA 1EBHA 4N9EA 2VFDA 1EF2A 4LGXA 3H8AA 4IPIA 3AIBA 1QBAA 5AC7A 2NX9A 4GVIA 1T8QA 1DORA 4QS6A 1KFLA 1K9DA 5T26A 4NIRA 3RNDA 2D24A 4BR1A 4GLEA 3NQGA 2VDIA 2DQXA 3UXIA 5C54A 1AH4A 5J04A 1WZMA 3B40A 3OJGA 3FNDA 1XG3A 3GTIA 4HU0A 3B0XA 2EPOA 1I0DA 1W3NA 2AQOA 2HNEA 4S1FA 2PTZA 2WANA 4V15A 3E1F1 1PX4A 2YCLA 2PA6A 2C91A 1THFD 3AMLA 1UUQA 1V6XA 1XWYA 4ZZ9A 5A8PA 3QZEA 4JN6A 1E56A 4Q8MA 2X1UA 1Q8JA 5LA2A 1LLOA 4LOCA 5JXQA 4LWWA 4IHCA 2DT0A 2D2OA 3DOPA 5C9XA 2OEKA 2BVDA 1UD4A 4HYVA 2OQHA 2DGAA 3OB8A 4HNOA 2CBVA 1NM9A 1TE6A 5BW6A 5CGQA 3IJ7A 2YL8A 5EFDA 4I5UA 4G56A 3WCZA 3UFYA 1NP2A 4AWUA 3TLLA 1LWJA 1CGUA 4PYSA 3TTSA 5IRPA 1EUAA 1M68A 3C0LA 1L6FA 4P8WA 1XH0A 2V63A 4M82A 3CPUA 4IMAA 2DZUA 4I9MA 3R4IA 4D6FA 5JBFA 1J18A 1CENA 1LZOA 4JX6A 5CEWA 1NOFA 3UZWA 3VE7A 1MDLA 2VX6A 3QV8A 1P0EA 3QQWA 1O12A 1OFPA 1GTHA 3E2RA 4ZGYA 4WSHA 1YE4A 4HHPA 4WUIA 5M17A 1WOAA 4U5KA 2Z4GA 1HVQA 4C6MA 1LBFA 3A6OA 4HT3A 1BFNA 4D8LA 2V30A 4TX8A 3M07A 3MMUA 3PBMA 4IIBA 2Y8UA 3N13A 1Q6QA 3AFBA 3KVKA 3WLNA 3ISIX 3IJQA 4EACA 4LV9A 4IQJA 4GH1A 1TIWA 1H63A 3L4VA 3RMEA 5AYYA 3W28A 4JL2A 4WKAA 1HJWA 2BVTA 3TIMA 2VR5A 3SZ8A 4XD4A 3UEQA 1ZU8A 1E1CA 1CGWA 4O10A 2R8WA 5B7ZA 2QKFA 2ZZ7A 1YDNA 4LCRA 3S5OA 4UTTC 4MWAB 4OT7A 3RLGA 2QCCA 3MWAA 5LSMA 2I56A 3VD4A 3SIMA 1G5AA 3CEPA 2Z29A 4HTBA 4JKLA 3GG7A 2IPGA 4KEMA 4S3EA 4FOKA 1FTXA 1KTNA 3WNPA 2Z1XA 3VUPA 4J9JA 3WH7A 5MKGB 3PPCA 4X2RA 3GUGA 3I4EA 3NGJA 4O4WA 3ZJ7A 1R46A 4WKHA 4K8GA 4EIVA 2PLKA 1G94A 2OSYA 4BS0A 1R9XA 4YTRA 1PO9A 1ZJHA 3AS0A 4HQVA 3GXMA 3CNYA 1DP0A 2Z2UA 1BXNA 5LIXX 4IQEA 3FHQA 4NKCA 3QHNA 4JD4A 1YPFA 2FPYA 1Q6GA 5HINA 2E6DA 3K30A 3MCOA 4TVUA 3VVGA 4IFOA 1ADDA 2A79A 2HSAA 5I06A 4HZ8A 2VKZG 4O28A 2Y63A 3RXZA 3IAPA 4B3LA 4P2VA 1VBRA 3OOQA 5FJRA 1VB9A 4GJIA 1Q6EA 1TA3B 3JZUA 1ZJIA 2OEMA 1BLIA 3D47A 1UWIA 2Z1SA 2W63A 3MV11 1EX5A 3APGA 4JHOA 5M5DA 3U2OA 4JFVA 1WNOA 3EPMA 1WDQA 1IGSA 4A3RA 4H7CA 4DI8A 1UZHA 1UH2A 2ISVA 2O7SA 4LU0A 1RY0A 2VO5A 2NV9A 2RDTA 4JTQA 2DH3A 3WNOA 2BOEX 4B5VA 1JVNA 4Q7BA 1OINA 2ZBTA 4Y8EA 2O4MA 3AIQA 1IXOA 4FX8A 2BS9A 1ZTVA 3CL6A 1E71M 1PKNA 3OVGA 2CESA 3M4HA 3LUTA 2R14A 2NUWA 4V27A 6REQB 3K4DA 4MFEA 1UWUA 3U2EA 3TYCA 4JN8A 4LUTB 4MJ4A 3H2CA 2VEIA 4M5PA 3IIVA 5D9NA 2CLLA 1S5NA 3H6OA 4AMCA 3GW0A 4DF1A 3NM3A 2V69A 1OJXA 1NWUA 1Q66A 2WMGA 3GFZA 4YCPA 1E55A 4Q32A 3OLEA 4GUJA 1SUXA 4S2BA 4I8DA 3GG8A 3FYOA 1SO6A 2C7FA 3CUHA 4DWSA 5KINA 4D6JA 7ODCA 5E09A 4FMVA 4I90A 1LF1A 4ZB2A 1KLZA 1AG1O 4Q6XA 2V3GA 3RX2A 3QPZA 2P0IA 5ABFB 1Z44A 2NUXA 2FVMA 4DAIA 5LNSA 3PC0A 3QMSA 1FWDC 3ZS4A 4UQ9A 4I8YA 5FIPA 1R7AA 3N11A 3GC2A 4Q8PA 4DB7A 3LCLA 5E6YA 4RCXA 1J12A 3L0GA 5I07A 3AHZA 2ZRYA 4MY9A 2Z26A 2FTYA 1FHVA 1GWJA 3C8NA 2JE8A 3IIOA 1XIDA 3WMSA 5LNVA 3STGA 3ID7A 4WDWA 1FRBA 1MMFA 4DNMA 1K7FA 3CK5A 5CPTA 4F9DA 2H3DA 2PWUA 1TPWA 4LS1A 3ARYA 2XHYA 1VYPX 1OVDA 1H0IA 1EXBA 4YHGA 1YTKA 4QNWA 3W1UA 3GXNA 1YW1A 3DCPA 1POKA 4LVBA 2X1IA 1CX9A 4YVPA 5F1UA 3W86A 3TQPA 4P5UA 3LBCA 4MUZA 1CNVA 4M1BA 1UC5A 4LB4A 4MDPA 2YR1A 2XH7A 3MSYA 2QCHA 1WOBA 2BP1A 1C7SA 3GHRA 1JI1A 2EPHA 2GVLA 5CG7A 2QMKA 4IIHA 3GVQA 2VUYA 3MQTA 2I17A 1KKOA 3LSBA 1KBKA 5GPRA 2B81A 3B06A 2EQDA 3NL3A 4WJXA 2YYTA 3P0XA 2OO6A 4M6QA 4IG2B 2NLIA 3BANA 1WKDA 3TTOA 3VILA 4GYPC 1GOKA 4UQDA 2TMDA 4MG4A 3G8RA 2VR4A 3SW6A 3E49A 2Q01A 4GY0A 5HR6A 1REQB 3W1RA 1O6IA 3F4WA 4GZ7A 3URBA 1ONEA 2UY2A 4QE5A 3QV9A 3PWIA 3IJ8A 3A5FA 2RH9A 1VS1A 1W9BM 3RPTA 3RFAA 4PMYA 3P8IA 3T2OA 4C91A 3B8WA 3VMOA 5HQMA 3TE9A 3BZJA 1RP9A 3C2YA 1HG3A 3DBPA 3PPGA 1W2VA 2OLSA 4NSBA 4H9ZA 3W7LA 1SFTA 3E96A 1EGVA 1IIHA 3CAKA 3OLGA 4NL1A 4QCEA 1HL9A 4JTFA 4JIIX 4ROQA 1KXHA 2CIPA 2ZE0A 5EMLA 1DHPA 4BA0A 2Q09A 1ZENA 3RYSA 1UOZA 2J75A 1RBLA 3RO8A 3KCLA 3CYJA 1QPKA 5CZJA 5FJPA 2OB3A 2WWCA 2Q71A 1F6YA 3N18A 3PUOA 5I24A 3OBEA 4UMBA 4HNLA 3KRUA 1C7TA 4RR4A 1TPUA 1QWKA 4R3UA 1DWAM 3G22A 2QJNA 1EHNA 3TQ0A 4KFPA 3VPLA 1Y5WA 4UFJA 4J3XA 4BQ4A 3RG6A 3VDAA 3B9AA 1AQHA 3IGXA 2X8RA 2XFYA 3TXVA 1XR2A 2IUZA 3VCCA 3B9EA 5D9PA 3UYCA 5D2YA 2GVYA 3OG3A 4LS0A 1TTPA 4FB7A 3G8EA 4UR9A 2WKLA 4HHHA 3RAOA 5EFFA 1NP0A 2ZZ3A 4E2OA 4J3VA 2TAAA 1CB2A 2OVLA 1WX0A 4ERAA 1S2VA 1E6ZA 4OFCA 2PLJA 4O19A 2Z1WA 4IXHA 4EWND 4IP7A 3GH5A 2PRLA 1OYAA 4L64A 3OLDA 3DUGA 3PAOA 2C16A 4YTTA 2Y7DA 4P61A 4HNCA 1JCNA 3VE9A 3VFCA 1D8CA 1VIZA 4QFUA 3LPGA 2A7RA 3QSRA 2J88A 1OADA 4KIRA 3W81A 4MADA 1Q6RA 2W4XA 3ABXA 4PEKA 4JTKA 2QLYA 1QPNA 1XCXA 4MJMA 3P93A 1LG2A 2V81A 2XWEA 1QI2A 2YCJA 1N8IA 4H2HA 4WKFA 3WMBA 1BF6A 4IMGA 1RBOB 1Q6LA 2EPKX 1XLLA 3IGSA 2XYLA 1YTEA 4RDWA 2YA2A 1XRFA 1BXBA 4IQDA 1HKVA 3ARQA 2GQ9A 2QV4A 1ZPTA 3G18A 4XAYA 2FPTA 2E8ZA 2GQ3A 1FCQA 2HCVA 2VEMA 3VZZA 4WDUA 3KOXA 4B5SA 1KV5A 2WHMA 1VLIA 3RPDA 4C6PA 3W7RA 5G1MA 4H19A 4NY2A 4Z1CA 4B2DD 1QNVA 1GEHA 2NQHA 5AHFA 3U5UA 4HBKA 4WY0B 3NZGA 4PGLA 4Q33A 2Z1KA 3VKDA 2WCSA 1CI1A 4CCCA 4M6PA 3UZZA 4UTJA 2VEKA 4O0KA 2JEPA 3PAJA 3GAYA 3TJLA 3F1QA 2AAAA 4I9JA 2VCCA 4JS3A 2DUXA 2Y8KA 1FHUA 2F38A 5BMWA 4ZO8A 2QF7A 3GS6A 3T2PA 1YRRA 3FJNA 4TTGA 3R79A 2HPIA 2PGEA 3RCMA 2F2KA 3DG7A 4MWAA 2W61A 2D0HA 2PWGA 3R7MA 4WX2A 1ISVA 3DXIA 4EE9A 2PP0A 1I1WA 3R0DA 1VGAA 5AHMA 4C5ZA 4XAZA 3QR0A 1PV8A 1R38A 1SVDA 2PF0A 1EWEA 4MHBA 2BTMA 2WZMA 2Y2WA 2G50A 3BMVA 3H2EA 3W75A 2PDMA 1XPGA 4RE3A 4OU1A 5LNRA 4C1KA 2C0HA 4HK6A 2FHBA 4NXKA 2GDVA 1VHCA 4Q4RA 3WZ0E 4AZCA 2QUNA 4AD0A 1ADSA 4PTNA 2TPSA 3NL2A 3IK4A 4C6QA 4LY8A 3AIWA 4POCA 1EYWA 2C1GA 2E7FA 1V4YA 1YLVA 3SCQA 2OLHA 5ABTA 4ENLA 4JTTA 2BNJA 5HMDA 1JNDA 4P8XA 3DAQA 4FIRA 5C5YA 3S6OA 1PB0A 1XFCA 2VEFA 5HJXA 2IKIA 1WQ5A 4MZ1A 4A6GA 1KFWA 2P8CA 3Q37A 3LG3A 2Q8XA 4QE4A 3TCEA 1A5AA 4KIEA 4XZ9A 1TYGA 3CS2A 1XIGA 3A4WA 3TA9A 3RX4A 5A8NA 1S3HA 4JQ1A 1E0VA 5LA1A 3S42A 1QPQA 4B9ZA 2AGTA 1JCMP 4PRWA 1R47A 1M3UA 2XH2A 4Q8NA 5LHEA 8RUCA 3RLHA 4DPPA 3T0BA 5T9CE 3NQFA 4LBRA 3LXAA 1CLVA 4LYRA 1W1PA 2ZZ2A 4RZBA 2VWSA 5I7GA 4B5WA 1JPHA 1R87A 3NAVA 5BWAA 1RR2A 2J8FA 4JBRA 4H01A 2DZSA 1DJHA 3W7GA 3KDNA 4GISA 4NX5A 2GVGA 4CCEA 4N0RA 2Q3OA 4EAYA 2WV8A 2NV2A 4Q8QA 4MF4A 3UXDA 1DJGA 4Q3MA 4UTKA 5HDRA 4PN2A 5D37A 3TYBA 4DY1A 2VRJA 3SUTA 3MA8A 4JKMA 2FZ8A 2PCQA 3RJYA 1KM3A 5FEZA 1ZAIA 3EXRA 2XTKA 5HNTA 5IXEA 5LGXA 4JTGA 4GPNA 4OQVA 4IFKB 2PGWA 3EBVA 1A47A 1Y8BA 3LCIA 1B9ZA 1HJUA 4S3GA 1LYXA 2WJDA 3SFKA 1FWNA 3BL3A 1OZQA 1B3WA 1Z3NA 3LERA 3G1HA 5BCAA 3HQPA 3E3HA 2NVDA 4ICMA 3GUWA 2E68A 5BXPA 4DELA 2QCLA 4U3AA 1NVMA 1TPH1 3WLMA 4NJKA 4V1YA 4CQ8A 3DC0A 3DU0A 3GNPA 3N04A 3KOZA 3G1FA 2IS7A 2Y70A 3WUGA 1ZBVA 4YHEA 3HPFA 5DCDA 2BFGA 1B3VA 2PLCA 3QGVA 1YPIA 4ZE5A 3NZQA 4KEVA 5G2IA 4C65A 4WY0F 4UTHA 1UP3A 4WDXA 2J27A 1E3ZA 3HV9A 3FKKA 1XSIA 3LCGA 3TU9A 1AL8A 8CGTA 2XSXA 1E15A 3HM7A 4OOZA 5GNXA 1FWWA 1RHCA 3S83A 3PBGA 1A80A 3GXDA 3D0CA 3FKRA 5DRIA 3LXCA 1KC7A 4MWAD 1R9ZA 1XCWA 2Z25A 3PBWA 4AG0A 2RDUA 5G2HA 2PDWA 1SSGA 3UZJA 4NG3A 4BFAA 1QU4A 3E0LA 1K1DA 1SO4A 2ODOA 3CM4A 1HKKA 4YTUA 1D7KA 4X60A 3XIMA 1FY6A 3OHIA 3SCNA 4CD6A 4MPQA 1C92A 4WCJA 1EP2A 4NUWA 3M1ZA 3HFTA 1HW6A 3EZ4A 3MZNA 2RHGA 1XQKA 2A7PA 2GGGA 4A2SA 1B90A 3R0UA 4XTIA 4KF1A 3CJPA 4OOUA 4N4QA 3L21A 3RK8A 4AXNA 4PFHA 1F05A 1GOIA 2FZBA 5CBJA 4H7ZA 5IHRA 2D3NA 3BAWA 2FVLA 4QP0A 1X39A 1QVBA 1H3GA 4QQ3A 5DBUA 3FS2A 3PZUA 2D2GA 4JFSA 3TONA 1AK5A 2XM2A 3PB2A 1W5OA 1FH8A 4XKYB 2PDCA 4XUGA 3GDBA 1VZWA 4BI5A 5C9ZA 3TEVA 4C6IA 1WCGA 3EB2A 3TTQA 3LNMA 3T0AA 3ITXA 1UBPC 1I8JA 1BVNP 1MUWA 4HJFA 3KW3A 3IGHX 2NXHA 1T99A 2E9MA 3UGRA 2WM1A 4QHRA 3S1XA 2Q8ZA 3MUZ1 3B0PA 2V67A 3S1GA 3ORWA 2B7QA 2MUCA 5AZ1A 3NEVA 1AFSA 3OBKA 4FAMA 4O14A 1TG7A 4DYKA 1X8CA 1RAKA 1W1YA 1QK2A 2DT2A 3UWEA 3GBDA 3VOCA 4Q7IA 4OV9A 2FZ9A 2EKGA 5H91A 3CB8A 4TR9A 4W87A 1UBSA 2BSLA 3S5NA 2OYMA 4GIRA 4AF0A 3GXFA 1PCWA 4GVFA 1TE1A 3NQ8A 3ONBA 2J8GA 5KSWA 4CNTA 1R3RA 1UWQA 5TNVA 1OM0A 5FJOA 2WJEA 1YXCA 1DQWA 3AYVA 4L1GA 3VNZA 1L2QA 5HULA 4A05A 4X9SA 2PDUA 1ZJBA 4V33A 1B3YA 1SR9A 3NQCA 3PTMA 3NPXA 2Y88A 1LQ0A 2CU0A 1IEWA 3SRHA 1P6BA 1TWIA 1EDQA 3N2BA 3NXFA 5G1TA 3GTNA 4G7EA 4JQ3A 4PMDA 3ITCA 1ECQA 1GPFA 5AYXA 1QHZA 2PFHA 1ZP3A 3KS6A 4Z2JA 1CTNA 1PKLA 5AHLA 5E9XA 4OECA 1GOQA 4JZ5A 3ZWSA 4M7SA 3RU8X 3CV6A 1XC6A 5BOOA 1XLIA 1W3KA 1F3XA 3PZVA 2VX4A 4KS0A 3QXBA 3WLJA 3IUIA 4A3HA 3VMNA 1QNSA 1KWGA 4YL2A 1PVNA 5D2TA 1XBYA 1K4HA 3AQUA 4XB3A 2QNEA 3M64A 2G41A 1F6PA 2PC4A 3SI9A 3QW4B 1QPRA 4J3WA 4GMEA 1G01A 4ZOBA 2XIJA 2GPTA 3UG4A 4DO7A 4UCFA 1GEQA 1OWQA 1JCXA 3MUIA 1DJXA 4L4MA 2BASA 3HGOA 2E5CA 3A3XA 1A49A 3PWAA 3WEMA 2IXUA 4DPQA 2VEPA 4N6EA 1P0KA 1XDMA 6ALDA 1MFVA 2ZA3A 5FI8A 4WIWA 2GSEA 3O05A 2G37A 2BOGX 3QLLA 3W9ZA 1DJNA 3GKFA 3AHVA 1XLKA 2B31A 3D6NA 4GUIA 5KZDA 2F9RA 2E09A 3KRSA 3DN5A 2DVXA 3EA3A 3P7YA 4D6CA 3TQKA 2BHUA 1TA3A 5ENLA 3TR9A 4RLIA 4NILA 1V3KA 1DJWA 1U5JA 1PAMA 1YE6A 3GBEA 2XH0A 4H8NA 3NO5A 4PFMA 2VYOA 4ADTA 4UR8A 1LRQA 3TC3A 1XKYA 3FSTA 3N2XA 1GHSA 2Z7KA 1B9BA 1X98A 1A5LC 2CLOA 4UMAA 2GJRA 1JDFA 4Z2KA 2DDXA 1O68A 5JQ9A 3OODA 1IEVA 1XSKA 5DY3A 2WC3A 4QJ1A 2D1ZA 2E6AA 1DIOA 3COTA 3O9NA 3QC3A 3EPNA 4DUOA 5HJYA 4PA8A 3L5LA 4CU6A 1B3OA 1G9HA 1D3GA 1XSJA 2L5HA 3BLDA 1ZQ5A 2QCDB 4GQQA 4XKYA 3VKAA 3W02A 3WELA 3N9KA 1S1RA 4ZVJA 5I6SA 3AOFA 3CHVA 3CZKA 2R1MA 2G3FA 2EGZA 2QGYA 3MMTA 3BTNA 3LENA 1Q2SA 4HVXA 2HVOA 4QM1A 1J6PA 3ITTA 4O0QA 2DPEA 2PTWA 3FEMA 1M9HA 4W5UA 4QAIA 2RJHA 3VOGA 2WHKA 2AMGA 1W9XA 3QMTA 3O6YX 1E6XM 3BLEA 4UTWA 3V0UA 5HNNA 3WIJA 5ABGA 2HVMA 4C6EA 3MHGA 5FCZA 3M41A 5K2ZA 3DX5A 4W8AA 1F76A 2QULA 3VO0A 5EL1A 4I7WA 1FH7A 3E0VA 1MNSA 5CPMA 3TKFA 1JEZA 4DO5A 4GC3A 3E9AA 3UZ5A 3L0KA 4IWWA 5HANA 4K39A 1S1PA 1V0MA 4IH3A 3LGDA 5A6BD 3Q65A 5DY2A 3S4TA 3S0CA 1EOMA 1UASA 4ORIA 4CNOA 1CIUA 1F3TA 1UD6A 1T96A 4HK7A 4O12A 1L6SA 3LY0A 4GKTA 2GJLA 5IHSA 4CNUA 3LA4A 5J5DA 1E9LA 3F2BA 3CQKA 1FXPA 3GDRA 1V3MA 4YCOA 2D73A 2A4AA 4S3JA 5BRBA 3A4JA 2FZDA 1RD5A 2XZ9A 4LFYA 3N15A 4XWUA 3VOIA 3F4NA 2H9AA 3WQCA 4ZQOA 1QNPA 4Q4SA 3BMXA 3K8MA 4H1ZA 2REQB 5C0QA 5XIAA 1EQCA 1R3SA 4X0NA 1Q4WA 4DM2A 1JZ3A 1ELSA 1SZFA 1W3IA 3BGGA 3W38A 5CJNA 4UTTA 3MANA 3SADA 1ISYA 3FFSA 4YYCA 2WNQA 1H11A 2GUBA 4WGHA 3UG3A 5T8GA 1I2RA 2VTFA 3PHAA 3DC8A 3QGAC 3UYIA 4NJHA 4DJEA 1IR1A 4ACZA 4GIYA 4L6OA 3G0UA 5EMUA 1XJBA 2CLKA 4U33A 2HK0A 4DBWA 3SIZA 3HURA 5LNUA 1E43A 3A3HA 3CTTA 3LM3A 2ZUMA 4TXEA 1J0YA 2J25A 2XIIA 1B3XA 2FVKA 1GVSA 3SB0A 1F6KA 1XLHA 4MWAE 1XIHA 1G4PA 3KHDA 4GI4A 4P7QA 1XRVA 3U9IA 1K7XA 4K37A 2HV5A 1L8PA 3ZJKA 3N6JA 1B30A 4MY8A 3M5ZA 5CZKA 3KBJA 4JIQA 3WJSA 2PS2A 5CSUA 5L9FA 2WZTA 3QYSA 4LB3A 4OUEA 4YU1A 4O57A 4GO8A 3HZ3A 3WKZA 1O7AA 3XINA 1IQ8A 3I4KA 3PBVA 2A21A 5E93A 3VKBA 1JUKA 3DFNA 3N25A 1XX1A 3UY8A 1W9PA 4IMEA 1EJVC 2XN1A 1JFXA 1VBUA 1LTDA 1W32A 4O15A 1YDVA 2BODX 2DSZA 4B15A 1L2UA 1EH9A 3P14A 3CLMA 1Z32X 2DZBA 2OQLA 4A8IA 1NF0A 1B3ZA 3S2MA 4AX7A 3C2VA 1Q5MA 4AF0B 2XM1A 4MB4A 5LIWX 1GCYA 3CQIA 4GRSA 5HUPA 1KBBA 4UTIA 1Z48A 1VYSX 3EB4A 1ZCCA 3QSTA 1A5UA 3IUHA 3FJLA 3TJIA 2OTDA 4DZAA 4Q8VA 4WVXA 1B4EA 4PUUA 2WZEA 3FVDA 5LHFA 4GI6A 1J93A 1NWTA 1PUDA 1TO3A 4M29A 2WQDA 1XRTA 4ORMA 3R12A 2UY3A 3FGCB 3W2KA 3H23A 4B16A 4EOUA 4PH6A 1TWWA 7TIMA 1JPKA 1FVPA 4W5ZA 1XL9A 1H0GA 4MTVA 3EXTA 3KOFA 1FKXA 2J7EA 4RDVA 3DFYA 3RUBL 4DRSA 2QF8A 1LRNA 3OEXA 4U2YA 1V02A 2CLFA 4IOTA 4F2BA 3S9ZA 3PZTA 5EMMA 2Z2BA 1I45A 2YKKA 2RJGA 1W9DM 1OD0A 4S38A 4PSRA 1PBGA 3M9YA 1BQGA 3WH8A 2C79A 4DO4A 3AHXA 2YBUA 4UMCA 1VBGA 2ZUSA 3ALFA 3TUUA 1S5VA 4GE8A 4HMEA 4L9ZA 3LHVA 3MV01 4LAMA 1K77A 2IXVA 2DFAA 3VYLA 1K8YA 3CPRA 3ZYZA 3CUFA 5D02A 3MSDA 1RBAA 4BQ2A 3L68A 1MVYA 3DFTA 1B5TA 4Q8TA 1JPIA 1OT1A 3LZ3A 4US5A 3CHCA 3UERA 1IT8A 2TSYA 1X1OA 1ITQA 3ZVIA 1U30A 5HK4A 1R85A 4O8RA 2E77A 1H7WA 5A5WA 1XIIA 2CXGA 5CKSA 3VNMA 4C60A 4PCPA 1QNOA 1X6NA 3PANA 3SQSA 4UUIA 2BMBA 2YL9A 1F9CA 1VJSA 1JPMA 3LBOA 3O6AA 2Y89A 1KXVA 2ZXDA 3BLFA 1GVEA 3KRBA 5CC3A 1E73M 5DMLA 1ISZA 3IIPA 2YBTA 3GYEA 3NNTA 3TOPA 2JKAA 2PZ0A 4GFSA 1TWSA 2NVCA 4V1XA 4CNSA 6ENLA 3KBWA 3CUIA 3EX6A 1MI3A 1O5QA 1W56A 3NPWA 4P8VA 3UWQA 2V5KA 3UR5A 1YXYA 1HZYA 2ASHA 2JBMA 3SCTA 2HXUA 2PDXA 1W2PA 2WLZA 3AIVA 4D8AA 4DZ5A 5E70A 4RXGA 3CTLA 3EEGA 4N6FA 6TAAA 2G8ZA 2GWNA 1P4CA 2VFFA 4ATWA 4PUJA 2GOKA 3AMCA 5K9DA 4RPQA 1GVYA 4PUKA 3VIMA 4DJED 4MSSA 4KPLA 1IXQA 4PMUA 4W7VA 5LXEA 3FDKA 3I7QA 5G4HC 2FGBA 1IXPA 1WXYA 5A2CA 1NF7A 3ECQA 4I6VA 5DMNA 3JW7A 4ZCWA 2F6XA 1KB3A 1F4AA 4RKAA 5DN1A 2ABAA 2ZXAA 4LTSA 1JI2A 4NAFA 4NJJA 2H6RA 4GYFA 1FCUA 1UR0A 5FESA 1OT2A 3T6CA 5LGZA 2E6YA 3PZ9A 1IF2A 4N42A 1Z8AA 1HP5A 1OF8A 3CUZA 4N4PA 2GQAA 1CCWB 3WN6A 1QATA 3L12A 4DIAA 2PDNA 3SECA 3TJ4A 1PYFA 4EX4A 3SJ3A 3TP4A 4DJEC 1GKRA 2QUTA 4BF7A 1JXKA 3EOLA 4CVUA 3W83A 4UOZA 2X1TA 1QDSA 4HZ7A 2YXOA 1W1IE 1ZHAA 3GK0A 1P48A 1QR7A 1GVQA 3Q45A 1AH0A 4Z08A 3HB9A 3Q94A 2I16A 2QCMA 1WUFA 1IT0A 1XRSA 1EO5A 3WF2A 3RM4A 4WSKA 3UF9A 2YJQA 4KQNA 2O9OA 3V7PA 1RQEA 3ENLA 1WZAA 3HU7A 1A3WA 4L6DA 3H26A 3UR2A 2GYIA 2GZXA 4D6GA 3W7EA 4KRUA 4PMXA 3OLIA 1OFEA 2Y7FA 1RCQA 1T7LA 5M2FX 4HPGA 1LM1A 3G6MA 3PY2A 2OSWA 5A95A 4I3GA 2MNRA 2V5BA 3GH4A 1QCWA 3GG1A 3GKAA 3ABSA 1UZ4A 2WO5A 4FLOA 2JK2A 4Z17A 1FQ0A 4YVXA 4QG8A 1R3TA 4ZB5A 3CB3A 3CMJA 1FDJA 3OA3A 5MF5A 5DQPA 2PDQA 1FHDA 1UR9A 3PM6A 3PZNA 4S23A 3S2JA 3GFXA 3VX1A 4E8GA 4PBGA 4F0KA 1CLKA 3CYVA 1FOBA 3T09A 3V1PA 3CZLA 1LLWA 2QPUA 1BKSA 3RR1A 4GQGA 4HMDA 4GXWA 1CXIA 4J3SA 3AWOA 3U0HA 4WHBA 4CQAA 3WF0A 1DWIM 1MEWA 2GSJA 3UNDA 3OPSA 4ERIA 1EQPA 2OX4A 2WSRA 5I3GA 1LJYA 1KBJA 3O7UA 4HZMA 1LBMA 4C7FA 3STPA 3WDJA 2FH8A 4XO7A 3VOHA 3P62A 4HNUA 1PYMA 2NT1A 3IVTA 1A5BA 2IQ0A 3KP0A 3PWGA 3VGHA 3QW3A 1ICSA 3TYZA 2FTWA 2VX5A 3F4CA 2CBIA 3WENA 2EPNA 5HPOA 2J62A 1UR3M 1Z42A 3N3MA 4IF2A 5E9AA 1WBHA 4PBFA 3LEPA 4HHLA 2D2HA 3VXGA 3PJWA 1OCNA 2PODA 4E4UA 1QWGA 2PTDA 3V75A 5AVNA 1GTEA 3SCSA 1KV8A 3W1XA 4CNNA 4WOZA 1JR1A 1V79A 5DT7A 2QS8A 3ES8A 2ZWYA 3WJYA 5CC6A 1HGWA 1OFOA 2YFOA 1JYNA 2XFFA 4JQ4A 1Q3NA 3CV2A 1RA0A 2YCLB 4LF1A 3SEPA 3A64A 3OG2A 3WQ4A 1O1ZA 4JNMA 1B1YA 2O9PA 1WE5A 2EG8A 2ZRVA 4TQTA 1AH3A 3W1LA 3GR8A 2WZIA 1E0WA 1E6RA 2VOTA 3M0HA 3WFLA 1Z41A 1QW9A 3WD2A 2TODA 3PJTA 2W91A 4YN5A 4OGZA 4D6IA 2FTPA 4IIDA 1LQ2A 4QBXA 5FF2A 1MNZA 1OK6A 4HP5A 4AWTA 1S2WA 3WBEA 1ZALA 3T08A 1S3TC 1QT1A 9XIMA 3R25A 1DJQA 3ZWTA 3QF0A 1K6AA 2E5DA 2PDIA 5JBEA 7REQB 2V3EA 2Y7EA 4IL2A 3S5ZA 3C86A 4TX9A 4ZQNA 1YNPA 4AD5A 1WO2A 4X63A 2AAMA 4RL3A 4LH8A 4XZNX 3TAKA 1D7FA 2GJPA 4JOMA 4B5NA 3MW7A 1VCGA 3PNZA 4QNEA 1RK5A 2YDSA 3TMLA 3RRXA 2NV1A 5BMXA 1QI0A 1G7VA 2BY1A 3U57A 5JMUA 3GWQA 2CLPA 3BO9A 1SMAA 3W2UA 4RNFA 2PDYA 1Q6OA 2A3HA 3W2JA 4S3BA 1OF6A 2WM0A 1ONRA 4WLCA 2XIQA 4XD3A 1W37A 3ARPA 3CEUA 4MNKA 2EKCA 3TYAA 1M7PA 1EPXA 1VFLA 3ZR4A 3IVUA 4HOWA 3O06A 3B4YA 1GT8A 5I3KA 3E6EA 3O6DA 2VVNA 1JZ4A 2PTYA 3TXZA 8XIAA 1FWCC 1IE7C 2ALDA 2E1DA 1O66A 1QHPA 5E1QA 3B9NA 1C93A 1V7AA 3P81A 2XH4A 1C8QA 4DVOA 1KTBA 3LYEA 1AMKA 4AW7A 3BV4A 4R7JA 1EC8A 1JF6A 4AX6A 3MP5A 3CZ8A 3LU2A 5C55A 5I77A 3EEZA 1WKFA 4FLQA 5HQLA 1AJZA 3W7NA 4KCVA 3C0JA 1OX5A 4LPCA 3VA8A 2NXIA 1WXZA 4MGGA 3GVRA 4LRSA 1NSJA 3OIHA 3RRAA 1A53A 4E8DA 5D8WA 1GPWA 2DT3A 3N17A 2WC7A 1VCVA 1DXIA 3HGSA 2ZZ1A 1DL3A 1EO7A 3H70A 1XPYA 3F4DA 1A4LA 2WYSA 3VNDA 1NOWA 4GI8A 4Q8WA 1Q6DA 4DQWA 1ITCA 2VUNA 3M0KA 5DX7A 4NI3A 1OFDA 3LD5A 2VQUA 1PZ1A 2J6XA 1OX6A 4LX4A 5DXXA 5JBDA 3S2NA 1TTQA 4AFYA 3NWRA 4ACYA 3VIGA 2NQLA 1E6SM 4G2DA 4OBTA 5CC7A 3R8GA 3OZYA 5LIUX 5T9BG 3KRZA 4JIEA 1E9IA 3NZ1A 4GOAA 5A8MA 3VGGA 2Y5EA 1JIBA 5FACA 4TX6A 2CEQA 2INZA 3PVFA 3B0UX 3T78A 1V6UA 3II1A 1K8CA 2BXVA 3W00A 1V8EA 5H8UA 2IQTA 2KAUC 4L61A 1UC4A 4XUYA 3A12A 4B5XA 3VIKA 1TV2A 2R94A 3ZLHA 4QAWA 1H62A 5K9CA 4NNAA 4YMZA 4QQUA 3M0XA 4RX0A 2OJPA 5D2WA 3SRFA 4OBRA 3DG3A 4AY7A 3BAXA 4PB3A 2Z00A 1ICPA 3ZZ1A 3CZEA 4WF7A 3CZJA 4XTDA 2QDDA 2WHJA 4K1WA 1JYVA 3IUDA 1MYRA 1OHLA 1PZ0A 3WLIA 5TQLA 4S3DA 3GX9A 2AL2A 2DSKA 4ECLA 3UWYA 3GXTA 1DQXA 3GIPA 4WK9A 1PTAA 2V0TA 1K9TA 3LHZA 3EKGA 1IZKA 2J66A 4GGHA 2D0GA 3SM0A 2WNNA 4E6MA 3AALA 4KW2A 3LN3A 2PDJA 1RPKA 4N9BA 1XIEA 3R89A 2QT3A 3NDOA 1EXPA 1R2TA 1GW9A 1BYAA 2V2CA 3LQLA 4RW3A 3FSUA 3MUY1 4AD1A 1SW7A 4DJDA 3M47A 4ONVA 3DFQA 3QPEA 3LGEA 4HA4A 3DESA 1JDAA 4LUJA 3TC7A 5I3HA 4BQ5A 1R0MA 4NYYA 3C2OA 4US5D 3EWZA 2WCAA 1H7NA 4LC8A 3BOXA 3W7JA 3W0KA 3WQ5A 1PTGA 2O92A 1DIDA 4RW5A 3IGUA 3E12A 3N2OA 3B9DA 4HA1A 5AB3A 1JJKA 3JVAA 3C2EA 4QDPA 4H41A 5H2ZA 4CCZA 4ICCX 3WH5A 1GVFA 2QJGA 1IHIA 3H7RA 3KDOA 3TLQA 2J7HA 3UVIA 5JIPA 3RPMA 3UP8A 2YDQA 2CBUA 3UW6A 2NQ9A 1AA1B 2Y6ZA 1PS9A 2IKJA 1GONA 4JTUA 3M0YA 2BV9A 4F4RA 1NOUA 1G1YA 1WKYA 5FAGA 1XIMA 4GY7A 1HN1A 1TPC1 1SU5A 1XI3A 5HNUA 3T81A 5DCBA 4RNJA 1YBQA 1MQQA 3T2QA 4GFIA 5I09A 5LIYX 1B57A 5C70A 2OOGA 4JEJA 4GYKA 4LAUA 5C2CA 2VC6A 1LT8A 1KCLA 3CUGA 1J0KA 5HXMA 5A2AA 3V5CA 1L6WA 3KAOA 2QQ6A 2V9DA 1UKQA 1RSCA 2O56A 1G69A 3W2NA 1JF5A 2WW5A 2DW7A 1X8FA 3R2GA 4E0CA 3C52A 4DYJA 4DUXA 1ZRQA 4MLJA 1YNYA 4J35A 1EGZA 1N82A 3TJXA 3UG8A 1WP6A 5IM51 3ABRA 4EKJA 3W1AA 3E2QA 4M80A 5CJ5A 3EYPA 1LP6A 1V6VA 1IZCA 4XZWA 1S2AA 1GOWA 4EVZA 3L2MA 4YXGA 1XDLA 3TR2A 3CIXA 3MJYA 3GAKA 3K46A 4K7YA 4IIEA 4L56A 2W6RA 1XKJA 2FJKA 1V93A 5CPLA 1GGOA 1CGTA 2QJMA 1X7IA 1Q7ZA 2YDRA 2YZ5A 3CIVA 4X2PA 5BNKA 4R33A 3WQVA 2Z0IA 1QW8A 4H9VA 4A22A 2E3ZA 4NJGA 1EGMA 3M7WA 4LVFA 3GR4A 3BLPX 3DIPA 4G7EB 4XZLX 3QKZA 4AZIA 3GZ3A 3BV7A 1ZSXA 4JTLA 4PEEA 3I7SA 1F74A 3LGGA 2Q02A 3VIOA 3C2FA 3EWXA 3AUJA 3G1YA 1I4NA 3VNKA 1W5QA 4OIFA 1F8MA 2PUZA 3UY7A 1JRBA 4W85A 2QAFA 3SO7A 1VEOA 2X0HA 1UYQA 3MU7A 3UPMA 3WLLA 2ZXBA 2DZPA 1AQFA 2OZ0A 1KM5A 1J5SA 1UD5A 1EF3A 3NJ3A 3IAQA 3ITVA 1OSEA 1GKPA 2VX7A 1M7JA 3HG2A 1ZBWA 4AZ5A 1XICA 2DEPA 1EFZA 1E9YB 1R2SA 1VFFA 5GQBA 1NTHA 1QOPA 2ZZ4A 1F8IA 3IK2A 1F73A 3AZSA 2WSQA 3LB0A 2J4GA 3JUGA 3S1VA 1U5HA 2WCGA 4UBPC 1Z7AA 3MBDA 3MMDA 3A13A 2ZA1A 2CPUA 3ZMRA 4PUDA 3WDIA 1IEQA 3KTSA 3VGEA 2OG9A 3PJUA 2ZRWA 3AJ7A 5JH1A 3KL5A 4E4FA 2JF6A 1J01A 4TOQA 4KERA 4UZUA 1QRQA 2CLIA 4B4HA 2ZE3A 3WO8A 1GQJA 3MTWA 4QIUA 2DVTA 1JAEA 3I10A 1KTCA 5D9MA 3UT0A 2Z27A 1CLXA 1KCKA 3TV8A 1E51A 1QOXA 1W5MA 2CKSA 4M6VA 4QJ3B 1CXHA 3NVDA 2XISA 2FZNA 4XZMX 2OMAA 2GGHA 3CUJA 1JNEA 2G95A 3HJEA 1A4MA 4DJDD 2DSVA 2ZOXA 3GU9A 3IJIA 2PU0A 4FI4A 3KP1A 2VRKA 3SGGA 4JAWA 3KFTA 2V38A 1JCYA 2NT0A 3NGFA 1H7XA 3C0QA 1HGYA 2QCGA 1TVPA 2PBOA 5FJJA 2POTA 3WYZA 1P5BA 2PDGA 3W1NA 4IQLA 2B0MA 1NWRA 3AHTA 4FXJA 4C6KA 2NQJA 1E3XA 2WSYA 2GL5A 4M19A 5HQEA 1ESWA 3PK7A 4XKMA 5LXXA 4N02A 3AROA 4PL1A 2YCKX 5D4YA 3IV3A 3QPYA 3AIEA 1R9YA 1DQUA 2V8ZA 3H54A 5D2VA 3PP7A 4UTUA 3TAOA 4TVDA 1BXCA 3REQB 3J7HA 1QHOA 1TCMA 2PURA 4D1IA 1H7OA 1ISXA 1TELA 1XQLA 3MCNA 2ZZ6A 1WPCA 4O18A 1RZMA 5CPSA 1V5XA 1KXTA 2D23A 3AYSA 2PD9A 3W6YA 2DSWA 3K1DA 1VH7A 1DOSA 3VD9A 3O0FA 5DCEA 3QH2A 3OGSA 1TV8A 4DAFA 5A8OA 2GFTA 3RMJA 1I1XA 4ACZB 3S1UA 3L2IA 1AVAA 4AZGA 5C2XA 4HNTA 3SN0A 4AEFA 1V6WA 2EAWA 5C9UA 1X1NA 3A21A 3EMQA 4AHPA 4NZ5A 4CQCA 3W7OA 1LOLA 5D30A 2QPSA 3ME3A 4DBSA 2YLAA 4MKSA 4ZL1A 4QROA 5KITA 2WMIB 4TV6A 3USBA 2PWDA 4Z1AA 4NVTA 2ON3A 3KOWA 1S46A 2QDHA 3N19B 3GDLA 4EPBC 3NQ2A 3I6RA 5B7YA 5K4XA 2QEZA 3SCUA 2VDGA 3ITGA 3R94A 4UOJA 1OEPA 1TJRA 4ZO6A 4IP5A 1VFUA 3MC5A 1KLYA 3N9SA 3A22A 4JHMA 4YTSA 1WDRA 5CGMA 1Q7QA 1H1YA 2A3EA 1OD8A 4ERGA 2WKJA 4TIMA 4AWSA 5SWUA 1JYWA 3LNPA 1RPXA 5AOUA 3UR8A 3FDGA 3ONCA 3HN3A 4JKKA 1KM0A 4IGHA 4MOZA 3W4RA 3QZAA 3VGBA 5HWMA 2ZKMX 4JX5A 1SO3A 3SGUA 2ACUA 2VOMA 1SR0A 5CCZA 3OA5A 3PF3A 3HQOA 2ZWZA 2GJXA 1OYBA 1LRTA 2VFEA 2Y4SA 3GIQA 3W24A 2PSNA 4NAEB 1HNYA 4DWSD 3AAMA 5K3VA 4F0SA 1TX2A 2VM8A 2Y8VA 3WL1A 3BG5A 1XLDA 3W7QA 3L5MA 2V2DA 5B80A 4DNHA 2GDUA 3GTHA 3LLXA 1EKOA 3A4XA 3EWUA 2FFIA 4W88A 1IXNA 1V0KA 5AY7A 4DYEA 1AD4A 2GGIA 4AIEA 4F2UA 1QMLA 1FFRA 4F79A 1LL4A 4KWSA 2PRHA 3G1XA 1NU5A 5A6LA 5I0DA 5CZ0A 4JPGA 2OZ3A 1SYTA 7ENLA 1RQBA 3H2MA 1J0JA 1Q2RA 4Y9PA 4GWEA 4JXCA 4UC5A 3AU2A 4FNTA 4UR7A 1AW2A 3GNXA 4CQDA 3BDKA 5C71A 2B7NA 1PDZA 2YW4A 2NWSA 3T0DA 2XVKA 3NQAA 4UTMA 5XINA 3PTDA 1XCFA 1YYAA 1HX0A 1TR1A 3KBSA 3IANA 3U5YA 3T0CA 4G6CA 1T6MA 4B4FA 5AC5A 1JQXA 4HYWA 1OCQA 2ACQA 2X42A 2G96A 1NH6A 3CZGA 4B3KA 1KGUA 2WK2A 1UWAA 2R91A 2NX1A 1ZLPA 3R58A 1XH2A 2QCDA 1EC7A 5GNYA 5AECA 2J9XA 3CMFA 1PIGA 3EOUA 2ZDRA 1YHTA 4GH3A 3NZRA 3ATYA 2YOCA 3BAKA 5AFDA 2XZ7A 1MW2A 3WF1A 5KZMA 3VTRA 4N9CA 3OO2A 3OZOA 1XDJA 2PZNA 3HG4A 1DE5A 3KL3A 4LVGA 4M1RA 2CWNA 4ROPA 3QMRA 4TMBA 3TTYA 1KO0A 3UWUA 1RJPA 1FWHC 2PGRA 1UKTA 3UESA 4UNLA 5AHIA 3A9IA 4BI6A 3QOKA 1KQZA 1V6YA 3LTYA 1V02E 2IKHA 3G2GA 3GY1A 4K2SA 1H41A 1V08A 2VGGA 1WZKA 4EXQA 4AY8A 4MZYA 3LMZA 3PZOA 5A6KA 1PKYA 3W6LA 1GVOA 2INFA 3FY1A 3EX4A 3GXIA 1G6CA 3E38A 1EA0A 1BAGA 3P2VA 4OUIA 2E9BA 2UV8G 4PTXA 1NFBA 2QGHA 3VABA 2RAGA 1QO2A 3G1AA 2EPMX 3TN6A 1WZLA 3G1SA 2DW6A 1EP1A 3EDKA 4HN8A 4LC6A 2AL2B 4UQEA 4LUSB 2VXNA 2QIWA 3WEZA 3BJTA 3DFSA 2JIEA 2ZRXA 2DUZA 3T40A 1JDCA 3URQA 4K68A 1UWRA 3TWBA 4UNKA 1N8FA 4I9AA 4U28A 2CC0A 1VFMA 3H4XA 4XBJA 2I9UA 2P50A 1BYBA 3UVAA 4Q4QA 2J47A 3P60A 1J11A 3KLKA 3NPUA 1TV4A 4PMQA 3S3GA 1HT6A 3MKVA 2CITA 2W62A 2D2JA 4PTMA 4LJ3A 3VM7A 1H61A 1SPQA 2J74A 4FALA 3IVSA 4JL1A 3C8FA 1TQJA 1I9CB 4IT1A 4Z1BA 3TN4A 3VKCA 3VNIA 3RLUA 3HBLA 1BWLA 3LCHA 3B8TA 2DIEA 4ILSA 4YNGA 3FXGA 7TAAA 1EEXA 1GYLA 5C8BB 2O55A 3NM1A 1UKSA 3KEHA 2QDGA 1HQTA 4O52A 4LEQA 2WBKA 3UCQA 1E0TA 2WKGA 2P53A 3MI6A 4L6HA 3M0IA 4RPPA 2BHZA 5M1TA 3FJ6A 4XK2A 1ENUA 4GXPA 3M0LA 5TAOA 2YZRA 3FA3A 4AZ6A 4FXRA 1DKWA 3BC9A 4LUYA 4IXXA 1PE1A 3ITOA 4MJZA 3SBFA 4LUIA 3WD3A 2W3ZA 4OTKA 3CWOX 1PWLA 1R86A 3KWSA 6PTDA 1GORA 4K36A 3NURA 4MVAA 4FXSA 3OP2A 3MSGA 1W1A1 4AC1X 3IJ6A 1QI5A 1DIEA 2H8ZA 3ARZA 3PTKA 1VC4A 3EKZA 2ISSA 1C8YA 1S5TA 1A0DA 4QISA 5FOOA 3GNDA 2I57A 3GVVA 1J79A 2OT0A 1FWGC 2VFGA 2A7NA 3T44A 1U1HA 2A3BA 3ZT7A 3QEZA 1POJA 2OWWA 2RDXA 3F2CA 3DENA 3B8VA 3BOFA 5GJMA 2ZVIA 2WAGA 3PG8A 5HA7A 3VDBA 1LWIA 2VFIA 1FUYA 3C3UA 2E4TA 3EWBX 4DO6A 4AQLA 5I3FA 1FA2A 3WUEA 4C1LA 4ZFCA 4GUGA 1GZJA 1J2BA 2X16A 4AIOA 3LHWA 1WDDA 3LHTA 3OGRA 3DHDA 5CLTA 4HTYA 4DWSC 5TD4A 1DPMA 3TWAA 3WLTA 1G67A 3VINA 3WBXA 1DJIA 3APTA 1J0HA 1T40A 3EB3A 2B7PA 3HPSA 4HNVA 3BSMA 2GK1A 3DG6A 5C6MA 2FB2A 4GNVA 2FMNA 1A50A 5EB8A 1R3YA 1ZUAX 3SCWA 4GD0A 1Q13A 4W8BA 2CYGA 3ITYA 3TW6A 4UFMA 4FF7A 1W5PA 1LBLA 3O8AA 3OTRA 3AIUA 4KCWA 4JTIA 3ABQA 2INEA 3DYOA 4IISA 3LZ5A 4CEXC 2CWXA 3F2DA 3O3RA 2DORA 4O54A 2F6UA 1C90A 1OGSA 4EPKA 4GXMA 4BF5A 3KL0A 1OQFA 1XYCA 3MP3A 4F0HA 3PTQA 3SY8A 3GC5A 5C9WA 1IV8A 1S5WA 3G1DA 1DWHM 1XYBA 5K9XA 1XS2A 2ANUA 3GB6A 1H09A 5EYWA 9RUBA 1GQKA 7PTDA 3WH6A 3SUSA 2NSXA 4OKDA 1US0A 4NYUA 5CBBA 3PZMA 5BU6A 4RZ6A 1F07A 1XG4A 1MZRA 2EPLX 2ZADA 2VURA 3DHPA 4FPSA 3H22A 3VIHA 4J2MA 3ARUA 3O16A 2ZQ0A 1JZ8A 1BWKA 5FL1A 1X97A 4NRRA 4RZ5A 1J9YA 1W1VA 2JGQA 3WK3A 2ESCA 4XIMA 5RUBA 1BRLB 2A0NA 5KTLA 4Q22A 1OFBA 2OT1A 2CZEA 1P7TB 4BWLC 4JCMA 3DBNA 2OOFA 2ZUUA 3V5OA 1I2NA 3F03K 1FWBC 3FOKA 5F4XA 1UZ1A 3UCDA 1VLWA 4EPEC 1CBGA 4UIOA 4R7WA 1JZ7A 4LBUA 1VRDA 3CAVA 5EGRA 1PEZA 5EPDA 4PUMA 4B91A 3SQLA 2WMHA 1UUOA 1XGEA 2VENA 4LAZA 1XLMA 1LQAA 2YSWA 6TIMA 3VI2A 3LMYA 1TMHA 4ZSTA 2NZLA 4PBEA 3GZAA 4JYEA 1OX4A 3QHOA 4TU1A 3W7DA 3PZIA 4Q4MA 3P74A 3S47A 3ES7A 4FSAA 2C8NA 4AVNA 3R13A 3GDMA 4O50A 3W37A 2X0SA 1ZBCA 3ZLFA 1E5JA 1E4LA 4Y9AA 5CBIA 1PHQA 4BQ3A 5AKQA 1OC6A 3K13A 1U33A 3N3TA 3L67A 1JG9A 4JYFA 2W66A 3HQ1A 1XIJA 4XZHA 2G3IA 4XVDA 3CQ0A 3NQDA 5BWFA 3ZIZA 1W1TA 1UA3A 3UGVA 3B97A 3N29A 4LRTA 3VU2A 1UUMA 2G3JA 4QLLA 3ITLA 4RE0A 4NASA 2OYLA 1CB7B 1Q65A 3CAQA 1AZ2A 3OIXA 3PG9A 2BWGA 4R53A 5M03A 3LOTA 1GKQA 3WQEA 2YLLA 3M0VA 3EGJA 2FH6A 1CXLA 3N34A 5G4EA 2OKTA 2R1LA 1O4UA 2W9MA 4NZFA 3W6MA 1CXEA 3CO8A 3SRKA 4XBSA 3KE0A 3WLHA 4HKPA 1SJBA 5GNZA 3BG3A 3P3BA 3JRKA 4BWLA 1CDGA 4FP1A 2XDFA 5I3IA 5PTDA 3U8GA 3BLKA 3N73A 1BVZA 3F5KA 3ANUA 4DX3A 1YIXA 2POZA 3ZSTA 1M6JA 2J7DA 1XXXA 1H4PA 5HBFA 1UH3A 2I14A 3R5EA 3ARXA 4H6KA 3AHYA 3IRSA 4UQBA 1U1JA 4FOUA 4A35A 3BW3A 2J24A 2PCEA 3H2FA 3LCWA 3V0SA 1SW3A 3MUXA 3SY5A 4PMJA 3UZXA 3VIIA 5IDZA 3ANVA 1GJPA 2XIMA 1SZNA 4UFKA 2X7VA 4GJ1A 4LCQA 2ZUTA 4QG9A 1JFHA 3PPFA 4HPHA 4PUEA 4IP4A 3TMQA 4M51A 4OZOA 2PD5A 2XJ7A 5HWJA 1LL6A 4GUFA 3E5BA 4NNCA 3AISA 2VI0A 3SGZA 2YCEA 4JIRA 1ITUA 1MO0A 1EWDA 3M5XA 5JIWA 4EP8C 3RU6A 4LF2A 2AOSA 4A3QA 4JTJA 4P8UA 4W89A 4Y9NA 1MWOA 3VNLA 2XSAA 2IKGA 2J9YA 4MM1A 5A69A 4U2ZA 2PDPA 5U7SA 4GO9A 3L4ZA 1VP5A 3S8HA 2P5NA 1DWJM 1IEIA 4GJJA 1U5VA 4JYDA 3KCOA 4LALA 1TWZA 2E6FA 1TJ2A 3T07A 3W7CA 1XLGA 1EEPA 4Q7NA 5REQA 3W2MA 3MKKA 4V2XA 3WSUA 4UFLA 3ELFA 1NFGA 1H1NA 2GQ8A 3W71A 4ZBCA 3UXAA 4XVEA 3DYPA 1EOKA 2WLYA 2E40A 3QFEA 2VZTA 4WXZA 1SO5A 2FLIA 2RGLA 1M01A 5TIMA 3P84A 1M5WA 2QCEA 1J96A 2ONEA 3UQNA 1JDDA 2IPJA 3ZJ6A 3GVGA 3UJFA 1HL8A 3VGFA 4BZYA 2TYSA 5A2BA 4UTWC 4MWAC 1BD0A 4RDYA 1ML1A 2A5HA 4MB5A 1EDTA 3WLPA 4CU8A 1W8GA 4JCLA 5JVLA 2WVVB 1NARA 2OU4A 2BBFA 4GVGA 2Y5SA 3RGTA 1T0OA 1R8LA 2FB3A 3DGRA 2V68A 1ISWA 3EAUA 2OGYA 3EDEA 1EJUC 3PUDA 2NUYA 2H3BA 3BICA 1E0UA 1AW1A 3WNLA 2G4JA 4D71A 3THQA 9XIAA 1AQ0A 1XLFA 5D33A 5ECUA 3N9RA 4NZ4A 4AYSA 4J5NA 1TZ7A 3KXQA 4J1OA 6XIAA 1GOMA 2WVSA 3B04A 4UFIA 3VDGA 1C29A 2V5CA 1TPB1 2E9LA 5LZLA 3P6LA 2ZYFA 1XISA 1R5YA 4IGMA 1LUCB 1IWPA 3QM3A 4GVHA 1P7TA 1TJ0A 3T05A 3BLLA 4W4QA 9CGTA 4YLWA 4N9DA 3PFRA 3FYYA 3G1VA 3WQPA 1OBAA 1OK4A 2ISDA 3QZ6A 3L4YA 3OHMB 4LANA 4Y6GA 4WJEA 4PULA 4B2DA 1K3UA 1YX1A 4OWGA 1F3EA 4HOZA 3KTCA 1RALA 2HE8A 1N7KA 3B05A 3AS3A 1XHGA 3TDFA 1HKWA 2QW5A 2WMKA 3HA1A 2ZIDA 3KHJA 1A5KC 1FCVA 2D69A 3BLOA 4XISA 2XN2A 3O0KA 1LUCA 3AWNA 1B4KA 4BKNA 1P43A 3GU2A 1UD3A 5EMKA 3I6EA 1MFUA 3NUKA 3BVJA 3BUVA 3R43A 4C5YA 4DWSB 4I7UA 1QASA 3LSCA 3CMGA 1SQ7A 2XIOA 4BCEA 4MNLA 1JAKA 3LV5A 4E2VA 3DEQA 3RM8A 4KWUA 3FLUA 4QDMA 1M03A 1DJZA 4H8VA 4QLKA 1IWBA 4UFHA 1Z9AA 2NVAA 4Z2LA 1JL8A 1TPDA 3S2CA 3TN3A 3WX7A 1H1ZA 3T8LA 3IIZA 2HDJA 2FPVA 3PFMA 3JU2A 4HU8A 3NFUA 3PB0A 2C19A 4AISA 2YL6A 1DBTA 4NAFB 1UKPA 1VHNA 2J78A 3POCA 1E72M 4KWWA 4FOJA 3W7HA 4PCSA 2BB0A 3N14A 5DBTA 3MYPA 1X6LA 3M6DA 4J3ZA 4PE8A 5TF0A 1KQYA 3CT7A 3DKLA 2BDQA 4KCUA 5HJLA 1C9DA 2E8YA 3CASA 2R82A 3FAWA 4RJEA 4MYXA 1UP2A 1I60A 5BU9A 1MRQA 2C0AA 1QNRA 2GUYA 3GH7A 4EXBA 3VD5A 4GZEA 1MW1A 3T4CA 1D8WA 3STFA 3ZR5A 4ML4A 3MMWA 3WQDA 4HCLA 1G0CA 3S5YA 1MEIA 5I03A 4FNPA 1U22A 4R88A 5CZTA 1FBAA 1Z89A 4TUFA 4GX9A 1WAWA 4CD4A 4EF8A 3STEA 2Y1HA 4ATDA 2YGYA 4Z1DA 3QN3A 2KZHA 5C7HA 3ZO9A 4MKNA 4NZ1A 3W1TA 1TMLA 3NCOA 4OBSA 1OG0A 2O9RA 3P67A 1K9FA 1DTUA 4BF9A 3PSVA 4ZQMA 1R30A 4Y2WA 4QSHA 3N4AA 1M53A 2WVUA 2G4FA 3Q67A 3W7PA 4A8LA 4R5EA 3LHYA 4B9YA 3HF3A 4TVCA 2WSPA 3PN8A 4WZHA 3WNMA 1L6YA 3MKCA 1ZY9A 1C9WA 2EHHA 2VR2A 3VC6A 3B8UA 4ZO9A 4XO6A 2ZZ5A 1O95A 3WLOA 3GE7A 1RY8A 4KKXA 4XZIA 1KRCC 2JGYA 4DXKA 2BVWA 3N6QA 2OODA 4F66A 2ATSA 1OYCA 4LS2A 4MJ2A 2QVNA 4NXSA 2DV0A 2OEJA 2WXDM 1JQVA 3SDOA 4B90A 2WOQA 4MB1A 4E3VA 4MFDA 4EWJA 4KESA 2DH2A 2X7WA 1GQIA 3D3AA 4BJHA 3AO0A 4LAOA 2NW0A 2J7BA 4INFA 3QVQA 1G7UA 3DECA 4RNIA 1JYXA 2ZX5A 3JS3A 2QCFA 3QY6A 1KFEA 4D72A 1ZAHA 3MVIA 4R34A 4AD4A 4GX8A 1W9VA 2ZC8A 5EMJA 4H9MA 3TFXA 3UXKA 2D20A 2W67A 2J7CA 4J40A 4YJ5A 2DY3A 4OVXA 4I5RA 5BROA 5HWNA 4QSFA 2XG9A 3W73A 1V51A 1OFRA 3LCFA 2X2GA 2BX7A 1BYDA 4DHGA 1AW5A 3NEHA 1L9WA 2I5IA 5L6UA 3GM8A 5C9RA 1XYFA 2ZRZA 3EOOA 1EHAA 2WVVA 3U2CA 1UH4A 4G1KA 2WNWA 1VQTA 1UA7A 1UMYA 5A1AA 1X96A 2G3NA 1YXDA 3WK0A 1ALDA 1KFBA 1IWAA 3E2SA 1FWRA 1PTDA 4NRSA 1MRAA 3KBVA 4X22A 1HO4A 1T41A 3BE7A 4L5ZA 5GJNA 3DI1A 3N2MA 1JZ6A 5HMSA 4XAGA 4QTGA 4C6OA 5FEXA 3WLRA 4F40A 1HJSA 5I5RA 2H90A 3CV1A 1ME7A 3T8QA 3R6IA 5AN7A 3WBYA 4ZE4A 5BXTA 3L7RA 1QNQA 2V3FA 3DFOA 2WMJA 4PCNA 2WC4A 5A6JA 3AMGA 1MQRA 3VOJA 2E67A 1XBXA 1WBJA 3TSMA 3RCYA 3B03A 3NTYA 2Y85A 5A8QA 2VJXA 2V5JA 2WSKA 3BSGA 3M5YA 2VMFA 2GGJA 5AYBA 1L6GA 4DLFA 1H5YA 1KCZA 4IFKA 3VUSA 5BRQA 2GGEA 3WNNA 5E0FA 3MB9A 1BPLB 1U83A 1OCBA 5E5CA 3KTXA 3W72A 2IMRA 4W7WA 4XIAA 3TQVA 3ZM8A 3BJFA 2P3ZA 3UCCA 4DF2A 3VKKA 1VYRA 3NO3A 2PGFA 4DBEA 5E0KA 2PEVA 1CGXA 1KFKA 4MAZA 1PXGA 1Q63A 3B8SA 4XD6A 2FFCA 2QHAA 2RGMA 3W07A 1UIPA 2WHLA 4KMQA 3O6CA 1UG6A 3NYDA 1VIWA 2VQTA 3QR3A 3LRLA 1KA9F 3PZGA 2A2IA 1J0ZA 7A3HA 3TCSA 2RDWA 5FJTA 5ABHA 1ZL1A 3FA4A 3VFLA 4TO8A 4BEQA 4UOQA 3GNOA 4LYQA 2FYMA 2PDKA 4GCAA 1XLJA 2HWGA 2YB1A 3UU0A 1FDYA 5I3JA 5ABEA 3VZXA 4F0MA 3TW7A 3WBAA 2NWRA 1XIBA 2ZX8A 1E4IA 4DUWA 5BYWA 2YA0A 1V0LA 3E0WA 4HNNA 3U7BA 3HMJG 1H50A 1Y5XA 2YFNA 2XINA 4RDZA 2XGBA 4RE4A 2ZRUA 4JTEA 4IPLA 4K8EA 2P10A 4GQBA 4O1EA 1A5OC 1E0XA 1HJQA 1OB0A 1MXDA 3PSWA 1AL7A 1RK6A 5HMEA 5DELA 1KFCA 4IL0A 4HD5A 3TW9A 4WOQA 1B31A 1QJWA 3ZT5A 1EZWA 4XSMA 2ISWA 3NDYA 4PODA 3AJXA 1WUEA 3VAVA 4BHYA 3DH7A 4QDWA 4D6EA 1AJ2A 2ZDSA 2QMJA 5G5IA 1SJDA 3KLLA 3CUXA 3P8JA 2F6KA 4PMOA 2WZHA 3WFAA 4GNKB 1XLEA 2QYGA 4Q4OA 1AQMA 4JGDA 4KFOA 3UZYA 2AKMA 4AU0A 4MLRA 1VBHA 1S5MA 3QJAA 1OIFA 1GQNA 4F48A 1M41A 2RKXA 3NQMA 1VCFA 4D1JA 2BGQA 2X0YA 1ONXA 3L65A 3Q2DA 4LVAA 3ALGA 4FF5A 1W17A 1W1B1 1IGWA 3ZXWA 1TIMA 3WDRA 4L9YA 5A6TC 5BOEA 1MUCA 2PB1A 1Q85A 1TKKA 4IG2A 7CGTA 5IFPA 4RXFA 3W23A 2XUCA 2VDHA 4C90A 4V28A 3BJSA 3WL0A 4F8XA 3ARSA 1V3IA 4AEOA 1X7FA 4UCGA 2WNZA 4GZIA 3W7IA 4R9OA 3W1MA 3E5PA 1XYAA 3AZTA 2Y0FA 4JFUA 3IJDA 2D22A 5CLWA 4NI8A 5BZAA 2WQPA 1JZ5A 2J9ZA 2VT0A 2VC5A 2X2YA 2HK1A 1DWFM 3VD7A 2F8QA 3THCA 1E70M 2Y24A 4BK9A 4D6DA 1BSIA 1KNWA 4O1BA 5CSSA 4ZQRA 2P76A 1O1HA 2OO0A 5KZEA 4QGCA 2DSUA 1VAHA 3E0IA 1OGGA 3DDMA 1CXKA 1VKFA 2PDBA 3KBMA 3G3DA 1C8XA 3L66A 1OFAA 1V6TA 1HJVA 4FR6A 3V4BA 5DT5A 2BG5A 5BXRA 3V36A 4L1XA 1W3HA 8A3HA 3WF3A 1OY0A 4FO4A 1P1MA 3ZR6A 4Q6JA 1IZJA 3BZGA 1ME8A 3D46A 4FK9A 1FWTA 2WBGA 1XV8A 4F9JA 4UZSA 1TR9A 5AHEA 1SZGA 3DKJA 3E02A 3Q4DA 3O2LA 5DXYA 2YCIX 2BLEA 3UA4A 3RF9A 3S9YA 1QAPA 3C3NA 1F7BA 3FV9A 5C7VA 4KH2A 3QQ1A 4YTQA 1LCOA 2BHYA 2WPBA 1OIMA 4CN6A 3QYQA 1SGJA 2XFRA 4M8UA 3RM9A 3VZYA 1OGBA 1GVRA 1RLCL 3PULA 1EJRC 2NQZA 2IW0A 4QR6A 4CKQA 5T91A 2Z24A 4FXFA 4C6JA 1K8ZA 3TSBA 3AI0A 2VWTA 3ZFHA 2IQDA 3UPWA 1V77A 3AIRA 3K4WA 3AMKA 3CU2A 1NDVA 3HGJA 4DN1A 4EAMA 3TX9A 3EA2A 3BMWA 4S3FA 3AXKA 1KM1A 2YB4A 2EJAA 2FGZA 1A3HA 3U4FA 4C6NA 4D2JA 3IEBA 1WDWA 3AU6A 2BGNE 7REQA 5DF0A 1ONWA 1PSCA 2ZCGA 1LWHA 1YTDA 1TV3A 4HHMA 1Y0EA 2OLAA 4H7VA 4P7OA 3IV8A 3MYOA 4NX0A 1ME9A 4MY1A 3G6LA 1HO1A 1I2QA 1J8VA 4ASTA 5H1WA 1TZ9A 4QG6A 1RH9A 5BRPA 3TYUA 4PB4A 5I79A 2WMIA 4HSNA 5EA9A 3V18A 3VIFA 3O07A 4NNBA 3QGKC 3SQMA 3VIJA 4UXDA 3CPGA 3SRDA 5LKYA 3R10A 2EJ1A 4QRNA 3FA5A 2PWVA 5A6BA 2PP1A 2R1NA 3GIYA 2DUAA 2G97A 3W82A 2F2HA 1F2JA 3FGCA 5FJUA 3W88A 2VZOA 1GJWA 1MDRA 4G9PA 3WNKA 2XWDA 4HCDA 4ZENA 1M1BA 3E74A 1E6QM 4F2TA 4Y9MA 5CQ1A 3ZVHA 4R27A 3K8KA 3MI2A 5EKYA 2C71A 4H6QA 1CW2A 3V16A 3RDKA 1SFJA 1HJXA 3O63A 4R9XA 2QR6A 4PMZA 4AY1A 3P5YA 4JQ2A 5F2MA 2UWFA 2JFEX 5FA5A 3RO6A 2X05A 6CGTA 4QEHA 3MY9A 1WKEA 1EJWC 1S39A 3H12A 2R1PA 3E2VA 4GKLA 4GZJA 1X6UA 3H4GA 4I6KA 4E3TA 3XISA 1ZGDA 1XIFA 1TCDA 2WJFA 4KT2A 2F84A 4FEZA 1C8VA 1EJ7L 4AIUA 1KR1A 3GLCA 4HPJA 4KRZA 4H4IA 3ERPA 4C7GA 2OZTA 2W27A 2YXXA 4AZCB 4FNUA 4YWIA 3ABZA 5KEZA 1GG0A 1RJQA 2E0PA 3DI0A 2PTXA 3WDPP 3HV8A 1UWSA 1DEDA 4K1GA 5HATA 1JCJA 3DERA 3R1ZA 3RIKA 4DI9A 1TVLA 4X0VA 4HU4A 4JY8A 1UIOA 3T4WA 1DV7A 1LL7A 2HS8A 5E0CA 4AZBA 1FFQA 2DZVA 1W6TA 1FWJC 3WLKX 3F7JA 5ECVA 3WJWA 2A3AA 2AQVA 1DYSA 4PTWA 2YX0A 3T1GA 1FXQA 4S3KA 1F4HA 4CQBA 2QUVA 1QO5A 3MCMA 3ZSSA 3AXHA 1D2KA 5CSRA 2J77A 2XPKA 3FJ4A 3F4VA 4FLSA 3IACA 1TQXA 3NOEA 1I0BA 1GW1A 1FHLA 4AD2A 2GJXB 3THUA 3BAIA 1TB3A 3S5SA 2CCRA 4C1NA 5HUOA 1MW3A 2NQ5A 3M5VA 2V5DA 1KRMA 2VZVA 3GHSA 1GJUA 2EG7A 4HA3A 3W26A 4TTUA 4HZ6A 4LV4A 2UY5A 2CXEA 4MKVA 1WDPA 5AYZA 4O4VA 4IPPA 4JTCA 5LA0A 2G3MA 3VC5A 3KX6A 3OBAA 4Z2IA 3G0SA 3TH6A 2E25A 4NF7A 4H9YA 3TTEA 3K8LA 5F2GA 2DIJA 1EL3A 1YBQB 2J8TA 2WPGA 1QPOA 4GA8A 4H8UA 3TK7A 3GG0A 2C14A 1SW0A 2PWFA 3H2AA 5IOBA 1NEYA 3LTPA 1Q6CA 1CGVA 1F3WA 3WQWA 3NQEA 1NIUA 3V3WA 4Q4PA 4DBDA 3VIPA 1FKWA 1PJ9A 5FEPA 5MKGA 1UR4A 1XFBA 5LYRA 1US3A 5MHBA 3T55A 2DZXA 2JIWA 1Y7VA 3NIYA 3B0VC 3OVRA 3EMCA 2GSHA 4FX7A 3CL8A 4IIGA 2DT1A 3LPOA 4LYKA 5BXSA 1QTWA 2AMXA 3JR2A 3S46A 2OYKA 5I02A 1ADOA 4ZOAA 2A1YA 3WEOA 1KRBC 3P0WA 4P7RA 2YBVA 2XFWA 3OYXA 3PPHA 3QY7A 1NDYA 3W22A 3WLQA 4J3TA 2EXOA 3CV7A 3ABOA 1YADA 1X38A 4JFTA 1FWFC 1EJTC 2JKEA 4WQ6A 1OCJA 3LI1A 3WQOA 5I23A 1ITXA 3WQGA 2X40A 3AZRA 3WQ6A 5F1VA 5A6MA 5IBXC 3FN9A 5KMYA 1VPYA 3LDVA 1LOSA 3QHMA 3R11A 1UD2A 5EU9A 3N2TA 4GIAA 1B54A 1KM6A 2FDSA 4C6DA 5A6SA 1QXLA 1YQ2A 1Q7MA 5DEZA 4YVVA 1DE6A 3CBWA 4F3HA 3RILA 1RUSA 2P3EA 4D6HA 4XD5A 1IYXA 1K70A 4L65A 2A3LA 2CFFA 5CZSA 4GCXA 1US2A 3OQ8A 4YIWA 3B3DA 4O8AA 3TYEA 2UBPC 1IT7A 5EBUA 4HOXA 3M43A