1QWKA

Structural genomics of caenorhabditis elegans: hypothetical 35.2 kda protein (aldose reductase family member)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
312
structure length
312
Chain Sequence
TASIKLSNGVEMPVIGLGTWQSSPAEVITAVKTAVKAGYRLIDTASVYQNEEAIGTAIKELLEEGVVKREELFITTKAWTHELAPGKLEGGLRESLKKLQLEYVDLYLAHMPAAFNDDMSEHIASPVEDVWRQFDAVYKAGLAKAVGVSNWNNDQISRALALGLTPVHNSQVELHLYFPQHDHVDFCKKHNISVTSYATLGSPGRVNFTLPTGQKLDWAPAPSDLQDQNVLALAEKTHKTPAQVLLRYALDRGCAILPKSIQENRIKENFEVFDFSLTEEDIAKLEESKNSQRLFLQDFMTGHPEDAFAAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aldo-keto reductase family 1 member C1
publication title Structural genomics of Caenorhabditis Elegans: Hypothetical 35.2 kDa protein (aldose reductase family member)
rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 107
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2003-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1qwkA00
3U2CA 4JQ4A 4DZ5A 3UG8A 4JQAA 2CLPA 5LIWX 3RX4A 1LQAA 2PDCA 1OG6A 1ZGDA 2FGBA 3V0TA 2PDGA 5HNTA 2IKJA 1Z89A 2C91A 4G5DA 3V36A 3UZXA 5JH2A 3CAVA 1IEIA 1MZRA 3COTA 4JQ3A 2PDQA 5LIYX 1Z3NA 2PZNA 3UYIA 4WDUA 4XZLX 4XZMX 4JIRA 2PDMA 4JTCA 3UWEA 4YVVA 4QXIA 1JEZA 3UZYA 4F40A 4JTRA 1K8CA 3O3RA 4ZFCA 2IKGA 1QWKA 2IKHA 3BCJA 5C7HA 2DUZA 3Q65A 4QX4A 3R43A 2HVNA 4JTAA 3M0IA 3LZ3A 3R8GA 2IPFA 3LQGA 4XO6A 1S2CA 2R24A 4OTKA 1SM9A 4QBXA 4PUWA 3P2VA 2HE5A 4QR6A 1HQTA 4DBUA 4WRHA 3H7RA 4XZHA 3DN5A 1QRQA 4JIHA 2HDJA 4DBSA 3EB3A 3V0SA 2PFHA 4XVDA 1X97A 3WBYA 3QKZA 1T40A 1RY0A 3ERPA 3UZZA 1X98A 4GQ0A 5LIXX 1FRBA 2I17A 1UR3M 4FZIA 2FZDA 1GVEA 3GHTA 3WBWA 4GQGA 1Q13A 4WEVX 2F2KA 3EAUA 5DANA 2DUXA 3BURA 1VP5A 3M64A 3R94A 2P5NA 2HVOA 4PR4A 4Q3MA 3NTYA 3FJNA 4YVPA 4JIIX 3GHRA 2PD5A 2IQ0A 4L1WA 1RALA 4IJRA 1Z8AA 4MHBA 2PD9A 5KETA 4XVEA 2IPGA 3N6QA 1ZSXA 2NVCA 1XF0A 3LD5A 1AH3A 3UFYA 5LIUX 4EXAA 4RPQA 1PYFA 4XZNX 3UGRA 1LWIA 3G5EA 2BGSA 4FALA 1EXBA 1X96A 2IQDA 4XK2A 1PZ0A 3MB9A 4XAPA 2IKIA 4YVXA 4H7CA 4FA3A 1EL3A 2VDGA 4WDTA 1T41A 3GHUA 3BUVA 1IHIA 4YU1A 4PMJA 3RX2A 3R58A 3B3DA 4GIEA 2PDFA 2IPWA 3WBXA 1XGDA 3GHSA 3ONBA 2ALRA 2PDWA 4LB4A 1R38A 4GCAA 2PDHA 3R6IA 2ACUA 1RY8A 2ISFA 3C3UA 3KRBA 3F7JA 2DV0A 3LQLA 1YE6A 3V35A 2PDIA 1VBJA 3CASA 1YE4A 2BGQA 3WG6A 5HA7A 1J96A 2PDLA 3R8HA 3CV7A 3RX3A 3FX4A 5LIKX 4AUBA 4FAMA 1YNPA 1MRQA 4IGSA 2I16A 4LAUA 4WDXA 1HW6A 3VXGA 1S2AA 5JH1A 2FZ8A 3CAQA 4GA8A 3LNMA 4JTQA 2PEVA 2IS7A 4L1XA 3G1RA 2HEJA 3LENA 2PDJA 4GABA 4HMNA 4LB3A 4WGHA 2PDPA 4JQ1A 1AH0A 5HNUA 3LN3A 4XO7A 2WZMA 5AZ1A 1AH4A 2R9RA 1Z9AA 1Q5MA 1ADSA 2PDYA 4YS1A 1AZ2A 2ACSA 2ACQA 1ZQ5A 1YNQA 2PDUA 3Q67A 2BP1A 3LUTA 3V0UA 4LBRA 4PRRA 4NKCA 1XJBA 3ONCA 1PWMA 3S3GA 3R7MA 3D3FA 2INEA 5M2FX 3O0KA 4ICCX 5AZ0A 2PF8A 3DOPA 3MC5A 2PDXA 3EB4A 4ASTA 1PZ1A 3CV6A 4EXBA 1S1RA 4PUUA 3H7UA 4R9OA 1A80A 2QXWA 2ACRA 2A79A 2FZBA 4JQ2A 3LEPA 2PDNA 1PWLA 4DBWA 2WZTA 3CMFA 4JTDA 4XZIA 1ZUAX 2J8TA 2PDKA 4HBKA 2IPJA 1EKOA 4PRTA 2INZA 3M4HA 3N2TA 4H8NA 1AZ1A 2FVLA 3UZWA 3H4GA 2PDBA 2NVDA 4LAZA 4GACA 4WDWA 3T42A 1C9WA 1M9HA 3UP8A 1EF3A 4I5XA 4LBSA 3WCZA 3LBOA 3GUGA 1S1PA 2FZ9A 2HE8A 3BV7A 2F38A 3LZ5A 1MI3A 4Q7BA 1AFSA 2HV5A 2AGTA 4IJCA 1US0A
chains in the Genus database with same CATH superfamily
3R2GA 4A35A 3G77A 4W89A 4JQAA 5K4XA 1W5QA 2OCZA 4AF0A 4FX6M 3UY8A 3QN3A 1NAL1 1YLVA 3EX4A 2JKEA 3BQ6A 1J0HA 5M17A 1KFKA 2QVHA 1J9YA 1V77A 1KCZA 4GISA 3QSTA 1OF8A 3RIKA 3TNOA 1CEOA 3F5KA 1CXEA 1MYRA 4MY9A 3SJ3A 3RU6A 3DIPA 5LIYX 1O68A 1TZ7A 5C9RA 3UR2A 4FXRA 3NQ6A 4CNUA 1XL9A 1QPQA 2X7VA 2FJUB 1O1ZA 3FW6A 4AH7A 2VGIA 5D02A 3QZ6A 2IKHA 3BARA 3IVTA 1WBHA 3TN5A 4J7RA 1EDQA 5DBTA 3QGAC 2E0PA 1XXXA 5GVJA 6REQA 2PS2A 4O53A 4IIHA 2TRSA 3NQ2A 5K9XA 3DYMA 1V3MA 3GXTA 4X3ZA 1K9DA 1Q6DA 1CXHA 4J4KA 3E9AA 1POKA 4QTGA 4Q32A 2P10A 4MB1A 4H9XA 3RF9A 3RN6A 2CLFA 4AFYA 3BK0A 3PTDA 1O6IA 3KL0A 3DN5A 4JFTA 4G7EB 1I2PA 5CGTA 3MMTA 3GH5A 3KBSA 4HVXA 4CVUA 1MFUA 1UB3A 1T7LA 3RO8A 5E6ZA 5MHBA 3RJYA 3V0SA 3W86A 3NVTA 4GQBA 4JNMA 4JX4A 5DXYA 4R7WA 5CAHA 3WO8A 3BJTA 2NW0A 4GCXA 4ZQCA 4S3BA 3ARSA 4HMDA 3C52A 2FZDA 3VNDA 4O14A 1F5ZA 3W1RA 3DYPA 3GIQA 2PU0A 4JTLA 4TOQA 4S38A 1UD3A 2V0TA 1YYAA 2YIHA 1ZJBA 1QR7A 5F7UA 4X60A 2ZCGA 3S2JA 4LUTB 1M1BA 4L1WA 3VD9A 1TVLA 3BAKA 4DN1A 3TN6A 4XAZA 1DJYA 4EANA 3PK7A 4P7OA 3TQ0A 4B9YA 3TR9A 1XYBA 3C8FA 5CSSA 3DEQA 4HOWA 1LQ2A 2W66A 2VHLA 1XFCA 1V02E 4LALA 4OZOA 2GZXA 2OZ8A 1DJXA 1TV5A 4DM2A 1PYMA 2VC6A 1UKTA 2B81A 4JN7A 5K3VA 3WFZA 1M7OA 1X6LA 3IGXA 3TV8A 1UP2A 4FLSA 4HA0A 5I3FA 3CIXA 1Q6CA 1WO2A 1PZ2A 4NZ1A 4XISA 3V4BA 4JAWA 4H7CA 1EL3A 1R47A 2D0GA 2XVGA 5CSRA 4YMZA 2HQAA 2OYMA 1T41A 4YU1A 3S2NA 2BY3A 1JZ6A 4UMBA 1KR0A 4UQEA 1ZCOA 2BOEX 4HPGA 1BXNA 1RQBA 4BF7A 2XVNA 4FNSA 5LYRA 2IPWA 3WBXA 1OFBA 2GGGA 4AZIA 3LCLA 2ESCA 2FDMA 4NRRA 5JUVA 4OVXA 5F4WA 2PWEA 2YCJA 3RU8X 4RLIA 2D22A 5J8LA 1KD0A 1UPPA 4WIWA 5JBDA 2PDLA 5K2ZA 2FTYA 1W3HA 2O9TA 1SJBA 4XX6A 2CZFA 2I5QA 1TMLA 3IIXA 4LAUA 1M7PA 1UZDA 3HQ1A 3HQPA 3PJUA 1EJRC 4ZSUA 4JS3A 1K3UA 5T9CE 2QCGA 1XLBA 3MU7A 3BLEA 1MEIA 4I5RA 1FWFC 2PDJA 1TPB1 4HMNA 4UTFA 2CNCA 7TAAA 1UYQA 1AH0A 4OT7A 1WDWA 4QCFA 3DESA 2WZMA 1Q2SA 4HPXA 2NXGA 1GUVA 5IBXC 3UWZA 3WF2A 3ABXA 1REQA 4JDYA 2VXNA 1OZMA 3MT1A 4OFCA 4BQ5A 4NNBA 1J0IA 2QAPA 5C2CA 2QJMA 2WVSA 3VUPA 1WX0A 3ARTA 4NZ3A 1J01A 3ONCA 1V08A 2WVUA 4WLCA 3W70A 1XLJA 2ZRUA 2Y61A 2XM2A 3Q45A 5JQ9A 5BU6A 3LMZA 1O5KA 4J3SA 1ZPTA 2Q01A 2PTXA 2Z1BA 2VUNA 1JZ5A 4AHQA 1PZ1A 4ZO8A 4TUFA 2QYGA 2QIWA 2X7WA 4Q4SA 4IMDA 1TPH1 4J40A 2P50A 3GLCA 4PUDA 3P0WA 4CNOA 2QXWA 3P80A 3MHGA 3PZMA 4MNLA 1Q6FA 3F4WA 2NQJA 4B16A 2J7FA 1V3JA 1HKIA 4F0SA 4GQQA 1UMYA 5KSWA 3B0XA 4RV8A 1RQEA 2FKPA 2C1HA 2HISA 4PBGA 4AZBA 4AWUA 4H8NA 1RP9A 3KTCA 2VR2A 1NELA 1XLIA 1HN1A 4D2JA 2OT0A 4K38A 3WLJA 2NVDA 4HZ8A 2FTPA 2CBIA 4FHAA 1Z7AA 3C0JA 3M7WA 1IEXA 4H41A 1EF3A 1R3TA 1QBAA 1VBHA 4H3DA 5FESA 4LV9A 4U10A 3LBOA 4W4QA 5AC8A 4PEKA 2Y7GA 1BG4A 2X1RA 3UNDA 1H7RA 3MO4A 3GX9A 1DJWA 3RMJA 2ZRYA 5D03A 2Q6ZA 5REQA 4F48A 4DZ5A 1JDDA 2AGKA 4KEMA 4S23A 3IPWA 3C2VA 3PZGA 4MJ2A 3WD3A 3W27A 2YXOA 3QF0A 1SJAA 4AIBA 3T44A 4AZ6A 3G1VA 2PDGA 5CZ0A 2WAGA 4IICA 4IL0A 4JFUA 5C0QA 5DMMA 1A0CA 4GFIA 3ABQA 2HRWA 3JZUA 4JQ3A 3PBGA 4RNJA 3M1ZA 3B06A 5G4EA 2X05A 4D8AA 1HZYA 1TREA 1F61A 3MZNA 1X6UA 1DTNA 3P3BA 4NZCA 4TXEA 4LC8A 2QCMA 4D6HA 1XPGA 2NZLA 2WNQA 2NT1A 4Z2IA 1X1ZA 2FZMA 4UTWC 3K30A 2E6AA 4UUIA 2YA1A 1LWHA 4XAGA 3W84A 3BAXA 5M3WA 3PZIA 1DIKA 2SFPA 3E3HA 1SM9A 4US5A 3BOLA 3NDZA 5HUOA 3KOZA 1EBGA 3RFAA 2OQYA 4OV4A 1XLKA 5FSEC 1R0MA 4Y8FA 1H41A 2XFWA 1FCVA 4JL2A 4FOJA 1VR6A 4RJEA 1US3A 4E5TA 2OXNA 3MP3A 3LYEA 2W4XA 5IDIA 1UD2A 1L2UA 4TU1A 3STCA 1XM3A 2W0UA 4W84A 3CPUA 1AK5A 2HBVA 4YPJA 2A3HA 3L2IA 1JNEA 2FB2A 2VWSA 2HPMA 1V5XA 4BQ4A 2YL6A 1UR3M 5BOFA 4JNYA 2YZ5A 4RV3A 3HGOA 4UFJA 2QZRA 1Q13A 2Z1KA 1A5BA 1ZCCA 2A3LA 3EAUA 4AZCA 5FEXA 4J2PA 2PAJA 5IOBA 1EWDA 3KVMA 2FH6A 5CBJA 2INFA 5FEPA 1SZFA 3NTYA 3FVDA 3L4VA 2J4GA 4DPPA 4JX5A 4A8IA 4NI3A 3WQGA 3B04A 2WWCA 2WCSA 2VM8A 1UH3A 3EWWA 3MDWA 1GOOA 2G3MA 2OZ3A 3ZSSA 3ITYA 3SM0A 1S5WA 2D23A 4PN2A 5HK4A 1E9IA 3E38A 2EPHA 2BHUA 1PS9A 1PXGA 4O19A 3HMJG 1BXCA 1R30A 1C3FA 2QCLA 2V5LA 1E4IA 2A4AA 3AALA 3S1WA 4IPLA 4RE3A 2QUVA 4JTJA 1I0BA 3W7HA 1XIMA 1PZ0A 1WNOA 4S1FA 1A3HA 1OQFA 3CO8A 3FKKA 1OEPA 2Q8XA 4UTTC 1Q3NA 1Y65A 4KH2A 3VGDA 4LTSA 3TX9A 4K6AA 2Y5SA 4LV4A 3CQKA 1TWWA 1S38A 2FIQA 1XBXA 3GHSA 3ONBA 4AMCA 4HHMA 1FDYA 2X1SA 4LB4A 3A21A 4Z2JA 3ABSA 3CHCA 4B15A 1TSIA 2R82A 1PO9A 3S1UA 3WK3A 3NXFA 2C79A 4HA1A 4HN8A 4A2RA 4O16A 4LXFA 2PMQA 3S5YA 3VM7A 1EO7A 3FY1A 1EX5A 2HS6A 4HNLA 3T40A 1C29A 3O2LA 2FTWA 3DHDA 3EA1A 3EWZA 3SQLA 3CH9A 2P53A 3ATYA 4M0XA 3VGEA 4IG2B 1FWAC 3BMVA 1XGEA 3C86A 3VNLA 2OFJA 4U5IA 3G1RA 3GAYA 1UKSA 1X38A 3IAPA 4IP4A 1K9TA 1V3LA 4MPKA 1W56A 4UZUA 1OZQA 3BLFA 2C18A 3BLIA 3CQ0A 2VQUA 3VNMA 4PUMA 4GZIA 4DO7A 1ML1A 3GIPA 5D30A 2ACSA 4FNUA 1ONXA 2RDTA 7REQA 1NOFA 3V0UA 4KEVA 1Q6OA 3S42A 3CJPA 1UOZA 4XKYA 5BU9A 3DZ1A 1JD7A 4OUIA 1FH9A 3O05A 2OQLA 4HNOA 4XIMA 2PTZA 4N02A 3NQBA 3S3GA 1ZNNA 3PJWA 4CQ8A 3H2AA 4TVCA 3UG5A 3QR0A 1QO2A 4E2DA 1OFQA 1LTDA 3SRDA 2JFEX 1XINA 3U7BA 4JKKA 3EB4A 1GQJA 5XINA 4TV5A 4JTFA 4I7VA 2D20A 2UY4A 1S1RA 1D3HA 1Z32X 4PFHA 3W28A 4GHRA 3HJZA 1RUSA 2PWVA 4S3FA 4HPHA 4YHGA 1O66A 3ZVHB 2A79A 2FZBA 4ICNA 1WV2A 1PTAA 3GU1A 2PDNA 4GGBA 4Q8NA 6TIMA 1V03A 4AD1A 4AHPA 5EMYA 3LPGA 4A2SA 1EGZA 4UC5A 3QW4B 1AJZA 1KNWA 1UCWA 4OGZA 1NOWA 1VYPX 4LCSA 1GG0A 4FK9A 3WF3A 2BODX 1W54A 2WANA 3U7VA 4GWEA 2JK2A 3E0IA 2XHYA 4JXCA 5AHIA 3BDKA 3L0GA 3WCZA 4K68A 5CJMA 2GUUA 1SZGA 3LZ5A 2NXHA 3G0SA 1ZAIA 3ARWA 4RR4A 1S46A 4LQ1A 5G4WA 4YTQA 3W88A 5ECVA 3ITGA 3ICJA 2PP0A 2QUTA 4KWOA 1CI1A 3V5OA 4LRSA 2KAUC 2NSOA 1ICQA 4GZ7A 2O9OA 3VZXA 3FAXA 3E12A 4RX0A 2Y8VA 3MTWA 3W7OA 1QI4A 1GJUA 2AMXA 2RGLA 3E0WA 2EG7A 4R53A 1QJWA 2V8ZA 4DZHA 4C6OA 1TV3A 4QS6A 2XTKA 4ERGA 3MCOA 1OD0A 3UPMA 1R3SA 2AQWA 3STFA 1V8EA 4F40A 2FHCA 2CWNA 1K8CA 1PTGA 4MMWA 5EFDA 2PGFA 4K8GA 4DYJA 1LG2A 5I24A 4UFHA 4C6JA 1QDSA 4QG6A 3W7DA 3WLSA 2VTFA 4GKTA 3GSMA 3RPMA 3SGUA 4ZMGA 4CCEA 1JPDX 3E5BA 3QEZA 1EUAA 1RA5A 2GSHA 3QKEA 2X42A 3MKKA 3EXTA 2DT0A 4QJ3B 2A2IA 3W53A 4OTKA 1YTKA 1DV7A 3H2CA 3P2VA 5D37A 1PJ9A 4UR9A 2V3EA 4BI5A 1O5RA 3TTQA 5AC5A 3OGRA 2BFGA 2QDGA 2YB1A 1CLKA 4LANA 5KITA 2B7OA 4E8DA 1Q6RA 3T78A 2NWRA 3TTYA 1DL3A 2P1FA 4JTHA 1XLDA 1KFJA 3UJRA 3SSJA 4V1XA 3M5VA 1V51A 3GZ3A 3WBYA 2BX7A 3SAZA 1EEXA 2C8NA 4AG0A 1ZL1A 4HNNA 4GJIA 3MP5A 4BEUA 2E8ZA 1PKYA 1Q6EA 1W5OA 4LUSA 3EX1A 5DCEA 3GO2A 4DWSB 1KC7A 1IXQA 1DJHA 1CXLA 2DUXA 3BURA 2YYUA 3PY2A 3QMSA 3MSDA 2HNHA 1OCQA 4YVPA 3W02A 2E5CA 3URAA 2GVJA 2JIWA 3APTA 1VBUA 1TCMA 4GH1A 1LM1A 1X8FA 1UUOA 4ADSA 4QE5A 4JTKA 4QDMA 1K1DA 3AFBA 3EOEA 3K46A 5JVLA 4K1GA 4ZO9A 3R25A 1VRXA 1XKYA 4GXPA 1CXIA 4FXJA 1IWBA 4DO6A 4DM1A 4NY2A 3ITVA 3LPFA 1H1NA 1E40A 5G2IA 2CLKA 1W3TA 3BQ5A 2VENA 5KZMA 3WQCA 1F7BA 5D2YA 1A53A 1I2OA 3BVJA 4ADTA 1VS1A 4NXSA 5XIMA 4ZB0A 4M1RA 1J0ZA 2Y1HA 3L5MA 1Q7ZA 2GWGA 4Q4PA 5HULA 5HJXA 2WBKA 3R12A 4AF0B 2ASHA 1E72M 3PTMA 4LS2A 3GG1A 4QAIA 3G0XA 1ZJAA 2V3GA 2A3CA 3HGRA 1E43A 5ABHA 2C0HA 3PUGA 4EK7A 3A5VA 1Q65A 3ELFA 3R5EA 1OFEA 1FUYA 4FOKA 2PDFA 3TSDA 4EPKA 1WKEA 2RFGA 4TX8A 3ANUA 4GZJA 1FWEC 2WXDM 3G8EA 3O0FA 3P82A 4BQ2A 3WDQA 3S1XA 3N9SA 1O95A 3GUWA 5CC5A 1ZB5A 2BGQA 1J96A 2A6LA 4DZAA 4DJEA 3BLKA 3GG8A 3BJSA 4WD0A 4C6LA 4B3KA 2A1YA 1XUZA 6REQB 3HPSA 2QUMA 3QC3A 4MY8A 1KTCA 4L6HA 3WLHA 4L1XA 1NJJA 4RPPA 4QJ5B 2W61A 2IQTA 1KA9F 1ENUA 4O1DA 2XVPA 4YWIA 4HNCA 1UD8A 4KEUA 4MAVA 2R9RA 4O4VA 3IJ9A 4PMOA 4L4OA 4L4MA 3W25A 8CGTA 2O92A 4AZ5A 3GVGA 2ACQA 3IWPA 4WJ8A 3R0DA 2OODA 3ZJ7A 3TK7A 2YCKX 1JIBA 3LUTA 4LBRA 1J4EA 4FOUA 3EDEA 1D7FA 2E9MA 2Q09A 2B0MA 5A5WA 4Q4KA 2WSRA 2ZZ3A 1B54A 4LF2A 4CD5A 2DZPA 4TV6A 5A8PA 4MB4A 4DJDA 3XIMA 1XS2A 1SVDA 4WHBA 1S2UA 4EPEC 3N4FA 2RDXA 4RE4A 1GK8A 1OX6A 2EPNA 2ZRXA 2YBVA 3IK4A 4DO4A 3SCWA 1KXVA 1JZ2A 2E8YA 1BTCA 1YTEA 3W7EA 1QOPA 4X0NA 4IFOA 4V1YA 5CEWA 2YFNA 1EGMA 5DO8A 1GORA 1XD0A 3MVIA 1RBOB 3VD5A 1TCDA 3GH4A 3PS7A 2C3ZA 3CV2A 5F4XA 1TTPA 2WQDA 4AD0A 3S9IA 2VFIA 3H2NA 2HROA 3S2CA 4HBKA 2OEKA 3P5YA 1VIWA 2INZA 4HMEA 1KRCC 3QOMA 3AHZA 3NG3A 1EP3A 2VX5A 3MP4A 3N73A 1IYXA 3Q37A 1NQ6A 1TUXA 2HJPA 4EP8C 1RSCA 3KUMA 5C2XA 1P0NA 2CWXA 2VZUA 4KEZA 4N4QA 4M82A 2CCRA 3E2QA 4KS0A 1PX3A 1XDJA 3W6LA 3MY9A 1CLVA 4KCWA 4Y9AA 4YTUA 3RHGA 4MWAE 1MO0A 2TMDA 5I3KA 4LVGA 2HE8A 1FWSA 3LTPA 3UU0A 1FHLA 4L9XA 4I7WA 4U3CA 2YA2A 1A5UA 4H9UA 1G4SA 2E9LA 4MYAA 4JQ4A 4JD4A 5GNYA 3PJTA 3WLIA 4ZE4A 2Z7KA 4W7VA 1K4HA 4B2DD 3WYZA 4M6UA 2EJAA 5EBUA 3RXZA 1S3TC 3BJFA 3P60A 1UZ4A 4HYVA 3KWXA 4PYSA 3TCEA 3LI0A 4EACA 4P8VA 3UYIA 4R7JA 3TYEA 3SFWA 3ZSTA 3BMXA 2YXGA 2V5DA 4P7QA 4RDZA 4XUGA 3H2EA 1JXJA 3BAWA 2JEPA 1GKQA 4I90A 1RVKA 1KM1A 4DWSD 3RLUA 2DUAA 1NP0A 2OSWA 1KB3A 1P5BA 4TVUA 1TE6A 4ROPA 1YDNA 1TJ1A 4MWAB 1O60A 1OM0A 2FB3A 5G1YA 4DZIA 2WZEA 5ABTA 3VTRA 1S2CA 4IPPA 1J0JA 1RJRA 1EBHA 3CS2A 1OGGA 4K3ZA 3UZ5A 4AC1X 5C7VA 2BLEA 1UR4A 4B5UA 3WQ4A 3N18A 2WHMA 2NVAA 1HJXA 2ZXQA 2CKSA 4IGHA 2ZVRA 4LVBA 2PSNA 3VE9A 1GQNA 6PTDA 4Q8OA 1E56A 3AXMA 5CZTA 4DWDA 1NFBA 4NNCA 7ENLA 1RY0A 3ERPA 1UP0A 3W00A 2WMHA 3LV6A 4PC8A 2ZUNA 4BI6A 2QPUA 4NJKA 3MHUA 4UTIA 1OT1A 5DY2A 1GZ1A 1JPMA 3H26A 1H5VA 2X2YA 3E0LA 1OFOA 5DANA 5A69A 3SCSA 3R94A 4D72A 3STEA 3CLMA 4IIDA 1EJVC 1F6PA 1AQMA 4KMQA 3V7PA 1LCOA 4PCPA 1XIFA 4IIFA 1IQ8A 5G5IA 3CEUA 1O4UA 2IQ0A 3U3HA 4QNWA 3BXWA 5A8MA 1H1YA 2DQWA 2WC4A 1TWZA 1TZZA 2VZTA 1XUUA 2OX1A 1NDZA 2IPGA 2JGYA 3W23A 3F5LA 3EA3A 2BVDA 3RR1A 3OYXA 4V33A 1E6NA 4WK9A 1YPIA 1PIFA 1MNZA 4TQTA 1W1TA 4S39A 3NAVA 2VCCA 2VOTA 4JOMA 4UQDA 5PTDA 5CJNA 1HP5A 1E4NA 1LWIA 3LCWA 4FALA 3T55A 1RPXA 5REQB 4ATDA 1DE5A 4Q6XA 3BG5A 3WK1A 4DNHA 1BPLB 1GQIA 3N15A 2HXTA 3VM5A 1FWNA 1FX6A 2JKAA 3WLNA 1DIOA 1TWDA 1I2QA 3PNUA 3W87A 3B0VC 2BHZA 4Y9OA 1M41A 2VR5A 4AC7C 1DHKA 3A3XA 3PUEA 3R58A 1A5AA 4L61A 3M0XA 5G4HC 4EE9A 3CUIA 1IF2A 3GR8A 1LWJA 1E1FA 1Z69A 2EBNA 3CIVA 5B80A 3BG3A 1FWIC 3FA4A 3K1DA 3K4DA 3A22A 4WKHA 2D24A 3GNOA 1QK0A 1VBJA 5AB3A 1KM5A 1JCXA 4GFSA 4CQDA 1W5PA 4IQDA 2NUXA 4Z2HA 5E1QA 4FAMA 4UWMA 4AEFA 5TNVA 4IMFA 2Y2WA 3MS8A 2X0YA 2VX6A 2VEMA 3G18A 2NUYA 3VMPA 3WFAA 4O8AA 1ITQA 1BQGA 4AEOA 4IOTA 3RRXA 1A50A 3WN6A 1KCKA 5CLWA 2H3DA 1F3XA 2BY2A 3I68A 3LN3A 1MWOA 3N2CA 1OYCA 4XZBA 5AZ1A 2VURA 3EWXA 2NQ9A 4S3AA 2HBXA 3O16A 5KEZA 5E0FA 2X1IA 5LGXA 1FHVA 4ZQPA 3W1PA 3A23A 2X1UA 5C70A 3VGGA 1QI3A 2J27A 1EC8A 3P61A 3PJXA 3GC4A 3RCNA 3VDHA 3M47A 2CESA 3LHWA 4CD6A 3MJYA 3L7RA 3NQFA 3W2LA 4Q7IA 2RDUA 2E25A 3R10A 3B8WA 2UY2A 1UWUA 3PWIA 1BD0A 1LBMA 5HQEA 3W1QA 4MFEA 4AZCB 1EGVA 2J8FA 2VFFA 4JHOA 1DQWA 2EXOA 1LYXA 3E74A 3PG9A 5BOOA 2YX0A 1VQTA 3TP4A 1ADOA 1L2QA 2BXYA 4QP0A 3N4AA 4Y2WA 1F05A 3VGFA 4DBWA 3SEPA 2QCFA 1WUFA 1NDVA 1NQKA 2PDKA 2VRQA 4FR6A 1GVFA 3GC5A 4FS9A 2C7FA 3BOXA 4WVXA 5LXXA 1AZ1A 2C1IA 3P8IA 4HCDA 1SUXA 4PUKA 2D2HA 3BLDA 3IK2A 2A3EA 4GYPA 4WJXA 4D6IA 1XYAA 2A3AA 4H6RA 3ZLGA 3CLWA 3I10A 3P84A 4MWAD 5DLCA 3NVDA 4E4PA 1EHAA 1NF0A 5A8NA 4RDWA 2LLEA 3G8RA 3AC0A 2P8CA 5B7ZA 1H7OA 3B03A 3OBAA 1X6NA 1KCXA 3GDLA 1HJVA 1Q6QA 1A4MA 2G0WA 3AYRA 3PM6A 2CHNA 1V4YA 3OHMB 3VKBA 3OTRA 4HHLA 4IZGA 1Q2RA 3CUGA 3USZA 3WQEA 3AS3A 3H54A 5EMMA 2REQB 5FF3A 1VB9A 2IKJA 4HJWA 1M6JA 3RPDA 3S6TA 1TRDA 4I7UA 4DYEA 1I60A 4US6A 3VGBA 3PZQA 2YW4A 3TW6A 4Z0SA 2FZNA 1KXHA 4FLOA 1SZNA 4HNTA 2PC8A 3GU2A 1EIXA 4IXXA 4GI8A 3OEXA 1U33A 4F8XA 2ODOA 1G7UA 3H23A 5FAGA 4WXZA 1GW1A 4KBXA 4GLEA 2C16A 2C0AA 4NI8A 5LA1A 1XYFA 2YCLA 1WDRA 2WLYA 2QULA 1QPRA 3H6OA 3HPAA 1XIEA 3ABRA 3F4DA 4WY0B 1OK6A 3H4WA 1E6ZA 1BWKA 3CYJA 3G1AA 1YBQA 4K36A 3TJLA 4RNIA 3EPMA 3D5HA 1MXDA 4DJFC 4S3GA 5C9WA 2VZSA 1G9HA 4XBJA 5EPDA 5EMLA 2HXUA 4C1LA 5GNXA 3WD1A 3F03K 1TV2A 5K9DA 4XKYB 4R27A 1CNVA 1H3GA 4P8UA 3IIZA 1JD9A 4F2BA 1GZJA 4FLQA 5A6BD 1ISWA 5CPQA 3BZJA 4HA4A 4LW7A 1ZALA 3BC9A 1OFAA 4XIAA 1W8SA 2ZWYA 4FPSA 4RZBA 1OBAA 2YBUA 4LJ3A 1XX1A 3KOXA 3Q2DA 3KHDA 4AXNA 1XBYA 4HZ7A 3I6EA 3KWSA 3H12A 4GI9A 1TG7A 3CT7A 2C13A 3AIQA 2YL9A 2I17A 3IGUA 1F4AA 5EA9A 4U3AA 4N0RA 3R0UA 4WEVX 3AWNA 3KLKA 2F2KA 3AIBA 3JZEA 4QQ3A 4DAIA 2QCNA 3OQ8A 4RZ4A 2I14A 2Z6JA 3LPPA 3FJNA 1A47A 1MZHA 4E4FA 3BCDA 3PBVA 4M24A 4PUEA 3P93A 5U4NA 1WZLA 2CZVA 3I7SA 2ZA3A 4IM4A 2ZKMX 5ENLA 5CLTA 3DDMA 2WBGA 4BFAA 4XVEA 3NUKA 3U2OA 1XF0A 3QHMA 1AH3A 3OA5A 2ZX8A 4EAMA 5E0KA 3EEGA 4TVDA 4O13A 8XIAA 1KM2A 1HKKA 1JCLA 1U5HA 3TTOA 4G7EA 3L2MA 3W74A 1JCNA 1UD6A 3BICA 3VIKA 1X96A 1NU5A 1O5XA 4DBDA 2VEIA 5IRPA 1BG9A 4F9JA 3MZ2A 4INFA 3ITCA 4K8EA 1MEWA 3UCCA 2WV8A 1DYSA 1S3HA 4ZQOA 1EO5A 2PLCA 5JBEA 3BL3A 2VCAA 4XBKA 2UBPC 4L65A 1UWAA 2G8ZA 4GI6A 2IMRA 1EWEA 5CC3A 4QJ1A 1XH0A 2ATSA 3N9RA 1FWRA 2YYTA 1G4PA 4M81A 4I8YA 2QMJA 3QBUA 1I6NA 4NP7A 1CGUA 3WDIA 4GYKA 2GDVA 4PCFA 2GK1B 1UH2A 2DV0A 5H8MA 2E7FA 1PKMA 3NDOA 4LUTA 3AMGA 1JJKA 1HO4A 3TFCA 3UWVA 4D1IA 3RX3A 3TSBA 4W88A 3GFXA 5LIKX 4AUBA 3S1GA 3EGJA 2I16A 1E4LA 3CMGA 3BE7A 4Z1CA 4J28A 2DP3A 1FXQA 3I6RA 4JTQA 2GDQA 1KGWA 1BSIA 2OOFA 3LENA 3R8RA 2GJPA 4WGHA 1UMLA 3RUBL 4PTDA 3LSCA 4WUIA 2NX3A 4DF0A 1QATA 4GC4A 1I75A 1Q8AA 1XC6A 2AQVA 1JYVA 3L0KA 3Q67A 1R9XA 4J3ZA 2G4JA 1F6YA 4P7LA 3M9YA 2FGZA 1JDEA 2ZADA 3CWOX 4O15A 3TOYA 4PMYA 2GJLA 2AL2A 5FKYA 1UZ1A 2EPMX 2J13A 1GG1A 5M2FX 5FEWA 3VOGA 1TV7A 2C1GA 3MANA 2VQTA 3B9OA 2WM0A 2P88A 2DSWA 3NO3A 4H4IA 3QPZA 1QXLA 5JMUA 2XVLA 3MSYA 4GVGA 2QPSA 4B5XA 4AAJA 1TTIA 5LNRA 4AIUA 2DSKA 1V0KA 1M3UA 2D2GA 4ZFMA 1V02A 4I3GA 2G3IA 1R9YA 2PZ0A 1JCJA 2XN0A 2J7DA 4P7NA 4JTDA 3QQ0A 3H4XA 5I02A 3AIEA 3PWGA 2XUCA 1BWVA 1CCWB 3IV3A 5AVHA 3SY5A 1BKSA 4LF1A 5LZLA 1SO3A 4DEFA 1RLCL 3NQ8A 4DLFA 3SUTA 3NQGA 2DGAA 2O4MA 3GDTA 1JYXA 1M9HA 4RZ5A 3P0XA 5A2AA 3N6JA 3U5UA 1MW0A 4CN1A 1CTNA 1BLIA 3GUGA 3VI2A 4BY3A 4G1KA 5D2WA 1QCWA 1YDOA 4JTTA 3G22A 4R7OA 2ZA1A 3A13A 1EIBA 3W37A 1W1VA 2IXUA 3GNDA 2Y89A 1S5NA 1AJ0A 3L4YA 4CU6A 3T2PA 3NO1A 4AD4A 2DH3A 1UROA 1LQ0A 3K1GA 1ISVA 1XH1A 3CL6A 5IDZA 4LVAA 3LU2A 3MI2A 1YDYA 5JH2A 1HL8A 1MZRA 2EG6A 5AFDA 1XHGA 1B1YA 3UWUA 4LGXA 1K6AA 2VZOA 1E0XA 4HD5A 1SYTA 4U33A 2PWHA 1GTHA 5C2GA 4GZEA 1R6WA 2DU2A 3DG7A 2B7PA 1KFWA 3GB6A 4A29A 3EWBX 2J25A 4PFMA 3WL0A 3FCPA 3GNRA 5J5DA 2TSYA 3LZ3A 3T0CA 2BSLA 3CZ8A 1GHRA 4NZFA 3B40A 2E40A 2ZDSA 2H6RA 1PCWA 2HMCA 1G01A 2ZUUA 2PGEA 3BOFA 3UJ2A 4J9JA 3E96A 1YPFA 3QY7A 1GPWA 3VIGA 2DVTA 2FVKA 1XBZA 1FQ0A 1AW5A 1BEUA 2QUNA 4DUXA 3EB3A 1JNDA 3GYEA 3L5AA 3KLLA 3PB2A 4DQWA 3B0YA 1A5MC 3VAVA 1GOIA 3VU2A 1V0NA 3ZM8A 1ECEA 3T08A 3MYOA 3CZKA 4YNGA 1GVEA 3GHTA 4WGXA 1QNVA 1O94A 2J6XA 1P0KA 2A7PA 3TW9A 3LHTA 1ZP3A 3ARYA 4D6EA 4QROA 1KV8A 3RMEA 3W7KA 5T8GA 4AWTA 4BJHA 3OZOA 2YDRA 3N2MA 5CAKA 3RITA 2PRLA 1TWIA 1R2SA 2KX9A 3LTSA 4L4PA 3GHRA 1LG1A 4JTGA 3VFLA 2FMOA 3DENA 3TJXA 3QW3A 1GEHA 5LXEA 2YR1A 1Z44A 1JPHA 2VMFA 2Z1XA 3HG4A 4NQ1A 3GNNA 3GZAA 1HGYA 4AX7A 3PZNA 4GXMA 4FF5A 4PSPA 2B7NA 1IWPA 3OG3A 3U0HA 3K8LA 3IS4A 1KW1A 3TTSA 3EKZA 3SQSA 2VNCA 1ZBWA 4MPQA 2WYSA 3EKGA 2QDDA 3BSMA 4U4MA 4HZ6A 1B2YA 1P0EA 4QE4A 5HMSA 3RPTA 5AYBA 3FNDA 4I6KA 4B4FA 3GBEA 1BF6A 3GKAA 3WH6A 3LPOA 3NM3A 1IWAA 3AICA 5I3JA 2PRMA 4QIUA 2OU4A 3OQEA 1MNSA 4PL1A 3SCUA 4UTJA 5AVNA 5CC7A 2PDHA 1KBKA 1M03A 1RY8A 1XG4A 3PB0A 3WKZA 1Y5XA 3KRBA 1NOUA 2OSXA 1LJYA 2VWTA 3T4WA 1FCBA 3CASA 4MGGA 1NDWA 3FJ4A 5F1UA 1GVIA 3R8HA 2B31A 1I9CB 5TAOA 4JYDA 3B8TA 2OWWA 3H2OA 3VIPA 3AUOA 1OSEA 4MSSA 2ATMA 4XB3A 1XBVA 5H91A 3AU6A 1RR2A 3KOFA 6A3HA 1EQPA 3ANYA 4LCQA 5CPLA 3O6AA 4ZO7A 3LXCA 4UTUA 1SQ7A 4KFPA 2J7BA 3A4XA 2ALDA 4UQBA 4CNSA 1FCUA 5I5RA 3HG3A 3SCRA 3ARQA 4KCUA 2G96A 4WF7A 2J79A 3M0VA 3E49A 3N4EA 4MOZA 3TA9A 3HGJA 2CBJA 4DUVA 1FHDA 2V5BA 4N2YA 1W37A 4L9YA 3RJXA 1DQUA 4Q4OA 2RAGA 5ABFB 1HF6A 1MDRA 1EDTA 2XJ7A 4K1WA 4A05A 2QMKA 2W6RA 3NPUA 4IMEA 2RUSA 4GUIA 3DBPA 3CZEA 1QO5A 1ZS2A 2NT0A 4C6MA 1VIZA 3B0UX 2WK2A 4DBEA 4RCXA 3O0KA 1HKWA 3OOQA 3CO4A 3OZMA 3WK0A 4JICA 1VFMA 2WMIB 3HFYA 1WQ5A 2R14A 2WSQA 5GJMA 3QR3A 1EJXC 1VJSA 3SN4A 2ZRZA 1QPKA 4QLKA 2Z24A 3QPYA 4H9TA 3MWAA 3RAOA 3VGHA 1KFBA 5U7SA 3HA1A 1OB0A 2XYLA 4E38A 4E4UA 1VFSA 4ERAA 1HFBA 5EMUA 3QLLA 5HQMA 4IG2A 1SPQA 5BOEA 1ZUAX 4JN6A 4TR9A 3CNYA 1R3WA 3KRUA 3I7RA 4HHHA 4Z1BA 4DJEC 3CL7A 2XFFA 1LT7A 4LUYA 5CKSA 2OYLA 3CL8A 1FTXA 2PC4A 4F0HA 3PHAA 1C9DA 3IIOA 3TZNA 2JQXA 1DP0A 4JCMA 5D2XA 6CGTA 4DELA 2ZX6A 2QT3A 3WBAA 4FR1A 5E9AA 1W6TA 2F7FA 2CLLA 4CD8A 1ZTVA 4BF9A 5CG0A 8XIMA 1E5NA 2WNNA 3AMDA 1WDDA 4P5UA 3TMQA 1ZGDA 2FGBA 4Z1DA 3M0ZA 5I00A 5EKYA 4E2OA 5BRQA 3S47A 3NZQA 5HMEA 1TIMA 3V5CA 2PWUA 4IMAA 4NHVA 2ISDA 3ZVHA 3J7HA 3DH7A 1NTHA 4WJEA 4PL2A 4DJDC 1VLWA 4W86A 1EP2A 4XZMX 2WLZA 5H6HA 2FPYA 5AKQA 4MUZA 4A8RA 3KE0A 1KBIA 4YVVA 4QDWA 7PTDA 1ISXA 1E9ZB 3GD6A 3N11A 4M80A 2F2HA 2ZZ1A 4RL3A 3UG3A 3W85A 4HU8A 3VNZA 4IPJA 2XN1A 1UR0A 4RUBA 2MUCA 1P43A 1P0BA 3CWNA 2POZA 4UQ9A 1FHUA 4UXDA 3WUEA 4ZZ9A 1SR0A 1UR1A 4ML9A 4C6BA 2CKRA 2C15A 3NYZA 2V5KA 2V30A 3LMYA 2VGGA 4DB7A 2QJGA 3N13A 4XO6A 5A6MA 3T7VA 2E1DA 4QBXA 1E73M 2X41A 1YXCA 1BGAA 4HTYA 2I9UA 5E5CA 3VMNA 2J88A 2WHJA 4HPJA 1UKPA 4WRHA 1XWYA 5A3HA 3SCQA 1OIFA 4FXSA 4WY0F 4JIHA 5CZKA 1EP1A 3AQUA 3HURA 4MNJA 1A5OC 1EJWC 4MJMA 3ARPA 1XQLA 3NA8A 4IJBA 4D8LA 1D8WA 2VKZG 1VYRA 4AISA 4FB7A 3PC0A 3T09A 3Q94A 3EA2A 4OE7A 5LIXX 3EDKA 1XDLA 4ZB5A 3IUHA 4E6MA 4ECLA 3CQHA 5FF4A 1VPXA 5LSMA 2TODA 1H2JA 2POTA 2R1LA 1VP5A 4N9BA 4Z1AA 2HZGA 5AC4A 2F8QA 2ZE3A 2PLJA 3AS1A 4PCNA 1R86A 4HQVA 5CPMA 1O7AA 4FNTA 4AVFA 1P4CA 2BV9A 3QZEA 1S2WA 5KETA 2Q3OA 2J6VA 4PMQA 4KFOA 1OC5A 1JCYA 3I4KA 3OJGA 1TMHA 5BRBA 4C6EA 1U83A 3UVIA 4B2DA 1F74A 3AISA 4AD5A 4WSKA 1XIDA 1R3YA 3WF0A 4KQNA 4XZNX 2XIQA 4GX8A 2KZHA 1V93A 1OGBA 4LYQA 4LYPA 1XIHA 2OMAA 4MUPA 1EXBA 2YOCA 4HU0A 1VYSX 2DIKA 3WH5A 3AMKA 3AJ7A 3LB0A 4CCDA 5A8OA 4HHPA 4LSBA 3DFPA 4ZXLA 5IFPA 3Q58A 2QVNA 1XKJA 3W26A 3W73A 9XIAA 3GHUA 4NSBA 1TPC1 2VD8A 5KMYA 1KFEA 2VL4A 3SGGA 2UY5A 2GLKA 4HJFA 4KFNA 4DWSA 3FAWA 1SSDA 3LLXA 2CYGA 4C65A 1BVZA 2DZWA 1V3IA 1OK4A 3IIPA 1QNOA 3VE7A 3W7CA 1EPXA 1GOQA 3DGRA 1E0TA 1I2NA 4CN6A 4ZL1A 1Q63A 2OB3A 3TYZA 4UB9A 1TKKA 1DWIM 3L4TA 2X1TA 3WG6A 4AXKA 1XRVA 3GW3A 2G4FA 3CAWA 1MDLA 1W31A 1AQ0A 1MRQA 3G1YA 3DKJA 2YCLB 3A3HA 4KIEA 5A94A 1J8VA 3MPGA 5BMXA 1VCFA 3NO5A 2CETA 4GA8A 1IZKA 3TA6A 4A8NA 1F2JA 4AD2A 2CHRA 5GPRA 1IEWA 4IT1A 1YBQB 5FI8A 1RV8A 3S46A 1W3IA 1NSJA 2CLMA 1F3EA 1OYAA 5I79A 3KBJA 4G56A 4O10A 3DKLA 3LCIA 3WFLA 4A22A 5A6JA 3MJMA 3S6OA 3SGZA 3CC1A 4M5PA 4IIBA 2XSBA 3WH7A 3ZVIA 1UR2A 2Z27A 3ZWTA 4CQAA 5CG7A 5IBXA 1UKQA 3AIUA 1AL7A 1Z42A 5DCDA 4GVHA 4PH6A 3KP0A 4O0QA 1TUFA 5MF5A 5H8UA 1JXKA 4LU0A 1DWJM 3PZVA 2Z25A 1NF7A 1ZZMA 4BA0A 5CH9A 1ONEA 4FSAA 5F2MA 4N6FA 4FF7A 2WKJA 2ISWA 4DJFD 1OJXA 1CGWA 3QY6A 2XWDA 4WCJA 2XU2A 1CGXA 3C2RA 4GIRA 2E09A 4D6DA 2OGJA 2CBVA 3E5PA 3PBWA 3UJFA 3NNTA 2D69A 3SY8A 4GIAA 2NV2A 1K7XA 1W1B1 3EKLA 5GJPA 3WH8A 4DY1A 4BKNA 4PTVA 1OT2A 4HNUA 3BAYA 2Z7GA 3M4HA 3IV8A 4NL1A 2PURA 1ITUA 3D3AA 3DERA 3ITLA 1A3XA 3H4GA 4ZXOA 2DZUA 4L7ZA 2XGZA 4QITA 1W3NA 1GVYA 5FJOA 4AZHA 2VFDA 1EYEA 3KM8A 3QV6A 2QJIA 4MTVA 4K39A 2WPGA 3GXMA 2OWXA 2PWDA 4W7WA 3ZWSA 3NGJA 1XICA 3GE7A 1IEQA 1IE7C 1K4GA 3ARUA 4OBRA 3U5YA 5HWMA 4Y90A 4ZOBA 3PVFA 1DORA 3UCQA 2HV5A 1E5JA 4C7GA 1ICSA 4AB4A 4GQRA 2PB1A 2QKFA 3N34A 1XLHA 3PANA 2ZVIA 3KCLA 3MSGA 3PSVA 3IRDA 5H8PA 3N6HA 2GYIA 3EB2A 2W9MA 3N1AA 3P6LA 2YDSA 1OX4B 3ZR5A 1BYBA 1OC7A 3M0MA 4ALDA 3QJAA 2VC7A 4PMVA 3GK0A 3E02A 2PZNA 3PNZA 4XZLX 4QDPA 4O0KA 3TU9A 3FSTA 3W7PA 2PTYA 1CB7B 3JR2A 4K7YA 1IGWA 1IR1A 2I7GA 4TX9A 4A21A 2PCQA 2ZUVA 3OZPA 2ZFAA 3CU2A 2YKKA 1H0IA 3T8QA 2D73A 4O4WA 3ZO9A 4HGXA 2C71A 3Q65A 4QX4A 5DMNA 3NZRA 3NQCA 2E68A 3P5ZA 2XWEA 3T2OA 4KWSA 2IXVA 4UTWA 1DIDA 3N14A 2H3BA 4NZ4A 4EXQA 3U48A 5CC6A 3I65A 1JYWA 4XD6A 3LV5A 3NQMA 2J62A 2XG9A 2J7CA 3PZTA 3F2CA 4XTIA 1AD1A 2OPJA 5HQLA 5DMYA 1L8NA 1A5NC 4GYPC 3KVKA 3B9EA 3AXXA 3L0NA 3WLOA 5FJPA 1TRIA 4L80A 2AL2B 3L66A 3HM7A 1N2VA 4HIBA 3WENA 3OGVA 1IZCA 3IJ6A 1OFRA 1WCGA 2F6KA 3TE9A 3CMJA 3SCNA 2PFHA 4LPCA 3DXIA 1BSLA 3OO2A 1WDQA 3UXKA 1VGAA 1UA7A 2XPKA 1AD4A 1X98A 3CXOA 2I56A 3NDYA 2GPTA 5FD0A 3STPA 3IJ7A 5HMDA 4GBDA 2D0FA 3W22A 1P6BA 1G5AA 3C0LA 4ZQRA 2VD9A 3OGSA 1XSJA 4WKFA 1YQ2A 2YCIX 1C8QA 2OEJA 3MW7A 3WDPP 3NSXA 3HF3A 5DRCA 3TQVA 3CGTA 3MI6A 4MKSA 4OOZA 2J8GA 4ORMA 5AHFA 3IGHX 4MWAA 3CBWA 4YCPA 1ISZA 3FGCB 3WNOA 3TVAA 3EOOA 5A2BA 2E6FA 4HSOA 1TVPA 4W5ZA 4MHBA 3UWQA 2Z2BA 2NX1A 5I7GA 3IJQA 2GQAA 1B90A 1AVAA 3EMQA 1OF6A 3WF4A 3TLLA 1FWBC 1J12A 4F2TA 3L21A 4CEUC 4ZO6A 3VD7A 2FJKA 4B5NA 4NJGA 2VDHA 2VYOA 3B8SA 3W7JA 3RM9A 1PYFA 2TYSA 3QGVA 1JZ4A 1U22A 2DQXA 2BGSA 1MQPA 3M6DA 4LVDA 5FIPA 3B8UA 3BTNA 1WKYA 1ZJHA 5EBAA 3F1QA 3NPVA 1A0EA 2F9RA 2R6OA 1EOKA 3KTSA 1FWCC 5GQBA 4A8LA 3VCCA 4MJ4A 2GWNA 4UTTA 1LUCB 3THCA 4GIEA 1Y0EA 3BG9A 8A3HA 5BYWA 5D9OA 4YIWA 1GPFA 4JIPA 3R6IA 4XQ6A 3B4UA 1WZMA 3FA5A 1Q8JA 2DW6A 3VNYA 4DNMA 5C9UA 1V3KA 1ISYA 1JR1A 5G1TA 4OBSA 3TQKA 4X9SA 4O1AA 1UWQA 3GQYA 3PPCA 4Z2GA 3RCMA 3TC7A 1S2VA 3LBMA 4GUFA 3NQVA 4H00A 3UXIA 1FFRA 4LAOA 3L4UA 4R9XA 5FF7A 2V3FA 3WEOA 3GXNA 4NUWA 3H22A 4C60A 3LOTA 1B9ZA 1VCGA 1KQYA 3IUIA 2X2GA 3KCJA 1X1OA 3EPOA 2I5GA 1QNRA 2J24A 2UZ9A 5A6BA 1QOQA 1QNPA 1VRDA 2NWSA 4UTKA 1N8IA 1G94A 3MKVA 3EDJA 4M8UA 1BFNA 1X39A 2Y70A 1FOBA 3T9PA 2IUZA 1OINA 4WOZA 1ADSA 2JE8A 3WEMA 3SCTA 1EOMA 3MWCA 4L1GA 4X2PA 1RCOB 5AECA 4XD3A 3TR2A 1M68A 4L6OA 4P7RA 1ELSA 1ZBVA 5XIAA 2PWFA 4HN4A 1TB3A 2PLMA 3GVRA 2OLAA 5A1AA 4DI9A 3JS3A 1UBSA 4OBTA 3BSHA 3CAKA 1U5VA 2WMFA 3DOPA 4ES4A 2FMNA 3ARXA 1TO3A 1GYMA 1A5SA 2F61A 3AIRA 5FF0A 2Z1WA 2ZZ4A 1UG6A 4PUUA 3RGTA 5DN1A 1RAKA 4RW3A 3WELA 5BXSA 3T8LA 5CSUA 2YGYA 3WNKA 1N8WA 3HPXA 4GI4A 2ACRA 5HJLA 4FLRA 3AZRA 3HV8A 3DFTA 4NYYA 3TYCA 1J0YA 2G50A 3BLLA 3W76A 4L56A 2WZTA 1CPUA 1QWGA 4NYUA 1XIGA 3UXAA 3OLEA 1QK2A 3I7QA 3LGGA 4CCZA 2XFYA 3KW3A 4NAFB 3BW4A 3OA3A 2ZZ5A 2H8ZA 2O0TA 5K9CA 2PDBA 1VZWA 4XWUA 1EC7A 2VFEA 3SCPA 5LA0A 3B97A 4V27A 1FWWA 3UJSA 3SY1A 2DFAA 4PUJA 2PU1A 4GINA 1EC9A 2F38A 2DZAA 4DYKA 3WJZA 3EOUA 3FHAA 4PMRA 3WQ8A 3SUWA 2XISA 1W5MA 2AGTA 1HKJA 5FJUA 3OLGA 1JQXA 2D1ZA 5EGRA 5JU6A 2ZA2A 3UG8A 2BOGX 1DEDA 1KXQA 3KL3A 1SO4A 3KBVA 3QV9A 2HS8A 3RO6A 3W1XA 3L5LA 4GH3A 4GY0A 2BY1A 3F4VA 1GVOA 3PP7A 3W6MA 1V7YA 4W8AA 3NCOA 4CQ9A 3TLQA 3W83A 2CPUA 2OR2A 3R11A 4Q8QA 3KDNA 1XRSA 2V81A 2O55A 5KZDA 2R91A 2XGIA 4IH3A 3HZ3A 3EWYA 5FJJA 4JYEA 4H19A 3AMCA 5D38A 3DFQA 4ATLA 4AMAA 1VEPA 1G6CA 3O63A 1C8YA 3LCGA 1HUVA 1M53A 1XIIA 3O8AA 4PB5A 1KBJA 1NWUA 3HJEA 3VNIA 3EMCA 4I9MA 2WWDA 3U2EA 3WUFA 1TA3B 1X7IA 3A4JA 3IJDA 5D32A 3WJXA 4IGMA 1TPEA 2BOFX 1A5CA 1H7WA 2OO0A 3TUUA 2GGJA 4XSMA 4Q8MA 5G2HA 1PSCA 3AXIA 1FVPA 1Q66A 1LOQA 3VYLA 5BXPA 3E1F1 3DFSA 3TSMA 5I3GA 3IRSA 2PA6A 1H49A 1RQHA 1PBGA 1QRQA 2REQA 4EKJA 3KXQA 4GNKB 2OLHA 2W3ZA 1RCXB 4PEEA 2G5WA 2VC5A 4OUEA 3RLGA 3VIMA 3VNJA 4JHZA 4JFVA 1NARA 1G1YA 1LLZA 4TO8A 1OVDA 1C7TA 4U31A 3MUCA 3TROA 2X0SA 5I3HA 2Z29A 1CZ1A 3LHZA 4FX7A 3W4RA 2G3JA 4QLJA 2CLEA 2ZC1A 2NLIA 1W9UA 4B91A 2XINA 4WY0A 3W1NA 2XN2A 4GYFA 4KESA 6ENLA 1Y5VA 3KBMA 1XYZA 4IJRA 3NEHA 4D8ZA 1XRTA 1P1XA 3W1AA 3NWRA 2BS9A 1W17A 4UNLA 4IX2A 1EQCA 3VD3A 2XFRA 3JVAA 3FV9A 2CXGA 4AD3A 1H61A 4MKVA 4IIGA 1WDSA 3H24A 1NWRA 1RCQA 2YZRA 2XSXA 3C0QA 1Q4WA 1SFSA 1H62A 3OVQA 4F0RA 3IAQA 4C6PA 5I03A 3ZMRA 3FYYA 3FN9A 1AW2A 3ZOAA 3LRMA 3DG6A 3F4NA 2X0HA 3PTKA 4AW7A 3GXDA 2DVUA 3PAOA 4FP1A 3LCHA 4KGJA 3DX5A 3MCNA 2OT1A 4C6IA 4Z0JA 1F76A 2NUWA 1LRQA 3A5FA 2ACUA 1IR2A 3N3TA 5KINA 2D2OA 3AS0A 3FK4A 3MA8A 4M6PA 4HNVA 1JRCA 1YE6A 4QEEA 4YHEA 2HWGA 2QAFA 2XZ9A 4S3KA 3FX4A 1JYNA 2JALA 4R85A 1QTWA 3U6WA 4O11A 1ZENA 2GVYA 4NIRA 4J27A 1P0DA 1ONWA 4WDXA 3TQPA 1QW7A 2FZ8A 1W32A 3CAQA 4CKQA 4B9ZA 4HCHA 2QCEA 4OV9A 1VEMA 4E8CA 3E0FA 3H2MA 4Y96A 5AHMA 5L6UA 2VC9A 2PRHA 4XBSA 1ONRA 2W79A 3BGGA 2UWFA 1NY1A 3WX7A 2XDFA 1R5YA 3M0LA 4PTNA 4XO7A 4AHOA 5EL1A 3FDKA 4PBFA 1AH4A 3UYCA 1UD5A 1Q5MA 1H0GA 4MG4A 3W1MA 1YNQA 4EWJA 1LRNA 2BP1A 3OG2A 4Q22A 4LS1A 1DPMA 3W2UA 3WQOA 1FXPA 3PSWA 3W01A 4JX6A 1FWTA 3AWOA 4O12A 3WJYA 3UXLA 2W5FA 2Z1SA 4O57A 1ZAHA 4EAYA 2DT1A 1B4KA 2GK1A 3NR0A 3O06A 3KHJA 1W91A 2Y7FA 4FNQA 3LLFA 2JBMA 2WZIA 3H70A 3G1DA 3GTFA 1W2PA 4M56A 3LCXA 4ORIA 4C7DA 3GFYA 1GVQA 2BHYA 3IARA 2GUYA 2QNEA 1XSIA 2AAMA 3SSZA 1VEOA 1CT5A 2VFGA 5BXRA 3N9KA 3GXPA 1GCYA 2WJFA 3KP1A 3C56A 3T05A 5D9PA 1KRAC 3A47A 3FIGA 1EKOA 1WKFA 5HXMA 1TPUA 5CGQA 1NH6A 5LHFA 4G1NA 3KAOA 4LYKA 5C54A 5MKGB 4WDWA 4GACA 3DGBA 4JPGA 1YNYA 1W5NA 3T6CA 4D9PA 4HK5A 2VX4A 1NM9A 3U4AA 1UHVA 3TXVA 5M5DA 1B3ZA 3W1LA 3EEZA 2RKXA 2QR6A 1L6GA 4P61A 1EYWA 3BW3A 3CYVA 3P62A 2Y62A 3OU8A 5T26A 1UZHA 2E5BA 3FYOA 3NQDA 1CGVA 3GWQA 3TONA 1AA1B 1S5TA 2GUBA 3HOJA 4UMAA 1XCXA 3Q4DA 2OG9A 1S5MA 2ZZ6A 3VIJA 2QCDA 1Z89A 2EPOA 2VVSA 4BEQA 2DZXA 1HT6A 3KL5A 3G2GA 3W07A 3CAVA 2P76A 1D3GA 3LM3A 3ALFA 1W0MA 3VOHA 2WQPA 3PZOA 4I6VA 3LA4A 1J5TA 3HMCA 3TC6A 3GDKA 1QHPA 4WX2A 1KFLA 3YPIA 4QG8A 1PEZA 1QT1A 3W2NA 1HVQA 4IGNA 1QMLA 1VENA 1V6TA 8RUCA 1PZ3A 5D9MA 1FCQA 5H2ZA 1O12A 4ZEPA 4M51A 3S2MA 5C7HA 3VILA 4PMUA 3LS9A 3MVTA 2ZICA 3CHDA 4QM1A 2HVNA 5I06A 3D46A 2OVLA 2DSVA 3MUZ1 4CCCA 2OZ0A 3ES8A 1SFJA 5CBBA 2V69A 3U9IA 1LROA 1TPFA 3WLRA 3BAJA 1AJ2A 3ATZA 4X2RA 3E2RA 4LCRA 3K5XA 1FDJA 1OFDA 3IEBA 3P8JA 3LERA 3VA8A 3G1FA 1CXFA 2WMGA 3DFYA 2YLLA 3UPWA 3V1HA 3QC0A 5BRPA 3C2OA 3NQEA 4ZVJA 2ZIDA 4KIRA 4IXHA 1HIZA 3OPSA 2DJLA 4IL2A 2CXEA 1X97A 2WOQA 3WLKX 2WW5A 1F73A 4J35A 5C6MA 2WZHA 1GOMA 1FH8A 1GWJA 1X1NA 4GX9A 1HL2A 1PX8A 5CPNA 4NZ5A 1CENA 1BF2A 1FRBA 3DUGA 3W7RA 1CGTA 1PUDA 4YL2A 2J7EA 2X16A 3VVGA 3UWYA 3A9IA 2AMGA 2ZE0A 1RK6A 4H8HA 3TEVA 3W9ZA 2VUYA 2ZZ7A 1FY6A 1NFPA 1OCBA 4LEFA 4YTRA 3CQIA 1AODA 5SWUA 3RYSA 3CIWA 1OX5A 4IIEA 4JDBA 1R7AA 1QI2A 3CQJA 1JF6A 1KFCA 2YA0A 4A4AA 1JDFA 3IACA 4D6JA 2XH7A 1XLMA 1JULA 2PD9A 1HJWA 3SUVA 4RXFA 1AUSL 4FX8A 4DUWA 4OU1A 2EF9A 3N2XA 3AHYA 2OZTA 3CB8A 3UXDA 4BI7A 4EXAA 3APYA 2QS8A 4IWWA 3KCOA 3UGRA 1Z41A 3ZQ9A 1DVJA 3G5EA 3G3MA 5TF0A 3GRIA 5LKYA 3VKKA 2VX7A 1OABA 4O54A 1VJIA 1SFLA 5FACA 4JY9A 3A9BA 2GSJA 4WZHA 3ABZA 2P0OA 1SW0A 3GDBA 4GUHA 3BUVA 4JEJA 4MM1A 4GXWA 3DFHA 5FCZA 1LDCA 4UCFA 1R3VA 2J66A 1K70A 1XGDA 3T0AA 3IJ8A 4CQBA 1E70M 2JKPA 2FHFA 4Q8VA 7A3HA 2BXVA 4CNNA 3AZTA 3A4AA 2F6UA 2BG5A 5BXTA 1YX1A 5F2IA 3LQLA 3WLTA 1E9LA 6TAAA 1YE4A 1HX0A 1FWJC 3WDJA 1DWAM 1L6FA 3P67A 1JZ7A 3M07A 3M5ZA 3FEMA 1WZAA 3T2QA 4F79A 2RH9A 3TWBA 5CPOA 5AHEA 3QV8A 1S2AA 3FXYA 3R89A 4H8UA 5TBOA 2ZX7A 3W7GA 1TX2A 1KRMA 1IT0A 5DBUA 4QAWA 4JEQA 5A2CA 5DT7A 4GABA 2E67A 1W1A1 3BGAA 1KWGA 1E55A 3ZT5A 3ZT7A 2NV9A 3CZLA 2A3BA 3M16A 3S5SA 2DY3A 5D2VA 4A3HA 1XYLA 2E6YA 1H09A 4W9TA 3O6CA 3GTXA 1JL8A 1A3WA 2CITA 4AY8A 4R5EA 4GUGA 1KM6A 2GL5A 4C5ZA 5F2LA 3O07A 1MW2A 4DLMA 3IVUA 5E09A 4H01A 4MNMA 2ZOXA 3P7YA 2G3NA 9XIMA 1JFXA 2ZWZA 4OECA 3THAA 1W2VA 1N55A 1G0CA 1FP9A 3W6YA 4C7FA 4X63A 2XH0A 1CX9A 2Y24A 1W3JA 4DWSC 2DPEA 1B3YA 3H7UA 4O18A 5A8GA 4R9OA 3DECA 3KRSA 3AJXA 1WA3A 3CUFA 2O56A 3OW1A 1P7TA 4RW5A 4FIQA 1ITXA 1F8IA 1S2TA 1T99A 1VKFA 3CMFA 1D7KA 4J3UA 2IPJA 4PRTA 4LT9A 1XDMA 5LNSA 5EB8A 4H6QA 1XCFA 4Z2LA 5L9FA 3QZAA 4H6KA 4OHQA 2X09A 2OX4A 1KTBA 3KZSA 4JHMA 1SZRA 4UCGA 1SGJA 2Z6IA 3FXGA 3TKFA 3CV1A 1XISA 5ABFA 4J1OA 3UR7A 1M04A 3B9AA 2V5CA 4NRSA 1US2A 4YYFA 5CPSA 3C2EA 2JEQA 3VC5A 2PF0A 3WL1A 4EVZA 2G37A 3OLIA 4S3CA 1M7JA 5AN7A 3EX3A 4KRUA 2VT0A 3POCA 5D09A 1BYAA 1XQKA 4Q8TA 2HSAA 2WMIA 3UVAA 5LIWX 3SCOA 1GTEA 4ZQMA 1RJPA 3QVQA 3ZJKA 4ACZA 2V38A 2QF7A 1GQLA 4WQ6A 3V0TA 1QASA 5ABGA 4O1EA 5TIMA 1V6VA 4H6EA 2C19A 2HNEA 3LRLA 1BGGA 4YYCA 1KM0A 1I8JA 4Y9PA 4Y6GA 5DELA 4WR3A 2VRKA 1J5SA 1RLDA 4ACYA 2W27A 1W1IE 1B9BA 3SIZA 1KV5A 3DHFA 3PBMA 3SDOA 3UZYA 2ZXDA 1WYIA 1F8MA 3TIMA 5B7YA 1BYDA 1J6PA 1TFVA 1IV8A 5M1TA 4MF4A 1EFZA 2I9EA 5IFTA 3NSNA 3QFEA 1UWIA 1WP6A 1SO6A 1DXEA 3UA4A 3GKFA 4TIMA 3AIWA 1T8XA 3DG3A 2VEPA 1K7EA 4L9ZA 4YWSA 4DJFA 4DVOA 4YCOA 4A3YA 2RGMA 4S2CA 4WKAA 1GYNA 2ZBTA 3R13A 4F0KA 2PGWA 4MKNA 3TC3A 1Y8BA 5DEZA 2GOUA 3NYDA 3VINA 4W87A 3CZJA 4MB5A 4KKXA 1C8XA 1KM4A 2DVXA 2JGQA 3WZ0E 3AROA 1OGSA 1GKRA 2OSYA 1F4HA 3EDDA 4QEHA 1HTIA 4LEQA 1BYCA 4GQGA 3L4XA 3NFUA 2A85A 3NZ1A 4IPIA 2AKMA 4LWWA 4H83A 1B30A 3KOYA 5AYXA 4IP7A 1CDGA 1VPYA 1LP6A 3MUIA 3NQ7A 4X0VA 4D6GA 3F4CA 3U4FA 2WJEA 1UBPC 3FEQA 3LGDA 2I5IA 2PD5A 3BH4A 2HVMA 2VI0A 4LAKA 3WNNA 3M5XA 2XIBA 2C6QA 1K7FA 4MY1A 5CJ5A 1I0DA 3VOCA 2CLHA 5AC6A 1DJQA 4NJJA 2GVEA 3LD5A 5CBIA 3UPBA 4ROQA 2Y85A 3UFYA 5LIUX 2WSKA 3FYPA 4PRWA 1B31A 1WE5A 1YADA 1HP4A 3AIVA 4IQLA 4NXKA 3WQWA 2A21A 3NL3A 1KCLA 1ZFJA 4P2VA 1WXYA 4EWND 3KDOA 4OOUA 5J04A 3GFZA 4WDTA 1CB2A 1MEHA 1ALDA 5E9XA 1M65A 1Y5WA 2BB0A 1XIJA 1XI3A 4HOXA 4M7TA 3B9NA 2NQ5A 1ME7A 5C71A 3MQTA 3REQB 4CD4A 2XIOA 3N04A 4CN4A 3VX1A 2NV1A 1JAEA 1BWLA 3M6YA 6XIMA 1HVXA 4W8LA 3F7JA 2Z4GA 1B57A 3HN3A 3NZGA 3M43A 3OODA 4REQB 5D04C 3W38A 1WBJA 4J5NA 1RP8A 2ZXBA 1YNPA 4ZCWA 7XIMA 3B8VA 2FDSA 3M0KA 3VXGA 4KCVA 3GNPA 1SJDA 2QIIA 2ZZ2A 4MWAC 1DWGM 2BVYA 3ENLA 2IS7A 3MUY1 3ME3A 1DJZA 4I9TA 4M7SA 4N4PA 1NDYA 1SFTA 5HNUA 2F84A 3WIJA 3ZLHA 5RUBA 1QAPA 3I3BA 1UPMB 2V9DA 1L6YA 2ZUMA 3I6TA 1XV8A 3KX6A 2QCHA 3BANA 2E6DA 1ZQ5A 2HK0A 4JFSA 3DC8A 1YPXA 1EJUC 1V79A 4NKCA 5AYIA 3CUZA 4IMCA 1KLYA 1Q4NX 3OB8A 3WNMA 1THFD 4BF5A 1VFUA 5D2TA 3VKAA 1UH4A 2P3EA 3D3FA 2INEA 1QU4A 5EYWA 4E3VA 2FHBA 4FNRA 3UW6A 3VC6A 2PPGA 2OQHA 3D47A 4HSNA 2V68A 1PVNA 2QV5A 1UR9A 2VJXA 4Q8WA 3WQPA 1H7NA 3T81A 2RJGA 3L23A 3S1VA 4UR7A 1OFPA 3DFNA 1DQXA 3RLHA 1MUCA 2QJNA 3L4ZA 4AZGA 1BHGA 5I2UA 1RBLA 2VCBA 3OYZA 1FBAA 3RNDA 1RZMA 3WUBA 2FVLA 2PODA 4LAMA 3ZFHA 2QLYA 3ZIZA 3T42A 2BBFA 1QNQA 3U8GA 5H1WA 2Z00A 1CECA 1PV8A 3UP8A 1YTDA 2GGIA 2D3LA 2V6AA 4ZQNA 3CHFA 4DI8A 2A6NA 1UC5A 1O5QA 1S1PA 3MUXA 1RVGA 1W1YA 1MI3A 4UZSA 3VPLA 3VDGA 1ODUA 3HPZA 4NG3A 3WH9A 4Y9MA 4RK8A 3S83A 4ENLA 1J18A 1DIEA 2X40A 1JRBA 1U1JA 2BGNE 1JVNA 1SO5A 3LSBA 3WBEA 1QPNA 5HOSA 3SRHA 3ZZ1A 2ONEA 3G3DA 2FQIA 3HG2A 4B3ZA 1OIMA 3PWAA 4GMEA 5ECUA 3TNBA 3NQAA 3UD6A 3URQA 2C91A 3UZXA 1LL4A 3VOFA 4B5VA 1IEIA 1VFFA 2CIPA 3MHFA 3NURA 1UD4A 2PBGA 4PCSA 1AL8A 3EZ4A 2QCCA 4QSFA 5JIWA 4V2XA 1MUWA 1D2KA 5AYZA 4JZ5A 2OTDA 3S5NA 2R8WA 3UWEA 3C0SA 2QDHA 4GJJA 2WCGA 4JTRA 3WSUA 3O3RA 2VELA 1K9EA 1UKOA 4OWGA 4DXVA 2HPIA 2YSWA 1JGIA 2ANUA 3DAQA 2JIEA 2NLYA 3R43A 1Z48A 1B3OA 4WSHA 3SUSA 1LL7A 1EUNA 1XP3A 4QS5A 4C6NA 1XYMA 1PKNA 2W62A 3LX9A 3WNLA 3ECQA 3F2BA 3WF1A 3C6CA 4HYRA 4UFIA 3GVVA 3FSUA 3G6LA 1OHLA 4NT0A 4FEZA 3VMOA 2AKZA 3WK2A 4QFUA 1HQTA 4CEXC 1GEQA 3V75A 4LBUA 4DBUA 4DX3A 5FOOA 2PE4A 2OKTA 5EU9A 2VO5A 3N19B 5C9XA 3PAJA 3GS6A 4NZJA 2DEPA 1OX4A 3G24A 2AQOA 3ORWA 1VFLA 3W7IA 1TQJA 2EPLX 4ZA0A 3TAOA 3DC0A 1KBLA 2DZVA 1DBTA 3OLDA 4KRZA 1SR9A 3OZYA 4XVDA 4B4HA 1D8CA 3AXKA 5K4ZA 3UZZA 1ZLPA 2DDXA 4NASA 1H63A 1IGSA 4UOQA 1JI1A 3QR1A 2XH2A 4X9YA 3V18A 1AMYA 3HQNA 1T5AA 4DIAA 4FZIA 2X30A 1TPVA 4KT2A 2Z26A 2FPTA 3NL6A 2DW7A 4OQVA 2OKOA 2BZNA 2J7GA 3THUA 1W9VA 4ZTXA 1TTJA 2B7QA 2PCEA 2YPIA 2XIJA 5BWAA 3QQ1A 4PR4A 3T0BA 4Q3MA 1UIOA 4KWWA 3NM1A 1EA9C 2YDQA 1Q6GA 1HL9A 5HR7A 3H21A 1E6QM 1KQZA 3HU7A 1N82A 1UR8A 3V5FA 3A3WA 4QHRA 1Z8AA 4RZ6A 2OLSA 3O15A 3C5QA 4KRTA 1WUEA 3JRKA 4JKMA 4HMCA 2H8XA 2E28A 4H7VA 3TN3A 4R88A 4NVTA 5HNNA 2BXZA 1SU5A 5EMKA 3NPXA 3T0DA 3SN1A 3AYTA 4O1BA 1TPDA 2V63A 5FF2A 1SMAA 4QG9A 2DT3A 4KW2A 4XK2A 3LRKA 2V2CA 2IKIA 4FA3A 3E2SA 3PTQA 4YLWA 4BZYA 4YTTA 1YEYA 2O9PA 3CUHA 2O4QA 4F66A 3OVGA 1YRRA 1N7KA 5AHLA 2ZUTA 1H7XA 2NSXA 5C9ZA 2QCDB 3CPRA 1JCTA 1QFEA 3S0CA 3VKDA 2W92A 1H4PA 2Q71A 4GO9A 3C4UA 1WAUA 4OIFA 3WEZA 2OOGA 2H9AB 3THQA 2D3NA 3PBUA 3W1TA 4F3HA 1WXZA 2EHHA 1D9EA 1WPCA 4O1FA 4GOAA 3NZPA 5CZJA 3FGCA 3R4IA 5EY5A 1YDVA 4X61A 3G1SA 1XLLA 1K8XA 3GVWA 2V67A 4NILA 1NWTA 2AAAA 1RJQA 1XYCA 1LT8A 4F0MA 2BASA 1A0DA 5JH1A 4J3VA 1LORA 4G2DA 2PEVA 4KGLA 3CUJA 3K4WA 1K8ZA 4N7QA 3FFSA 4TTUA 2J9XA 3UEQA 3TH6A 3A24A 1CGYA 1OCJA 3SRKA 1Q7QA 3RCYA 4ZE5A 4BQ3A 4AYGA 2Z2UA 1EF2A 5HPOA 4UQCA 1T96A 4IPNB 4RE2A 1WAWA 1VD6A 2WJDA 2I1OA 1LUCA 5A6SA 1U2YA 2ZDRA 4DHGA 1GW9A 1POJA 4PCTA 4JTUA 4PRRA 1VFHA 3PFMA 1KBBA 4K8HA 5A6KA 1QI0A 4ONVA 4A3UA 3ITTA 3W24A 2E9BA 1V0LA 1GZGA 5AZ0A 3T1GA 1LBLA 4ASTA 4JN8A 2VVNA 3CV6A 2BTMA 3ZXWA 2E1WA 3DCPA 4ZOCA 4GNJA 4MB3A 2FH8A 1GYLA 5I6SA 4FNPA 1R3RA 2XH4A 1KTNA 1PPIA 2DT2A 3UZJA 3V16A 3RM8A 1EHNA 1V3HA 1OYBA 3NGFA 2YCEA 3VUSA 4ATWA 1MQRA 3CTTA 3WMCA 3WDHA 4E2BA 3FKRA 3G1XA 1XIBA 3HQOA 5HWJA 2YDAA 2PLKA 1ESWA 3GDRA 2GDUA 4WSJA 4ZSTA 3CM4A 3VFCA 4HU4A 4JR5A 4QJ4B 5BZAA 3MMWA 4F0LA 3EYPA 1YIXA 4PTXA 1QBBA 1TVNA 3QLDA 4LBSA 1UIPA 2E3ZA 5BWFA 4M1BA 3GC2A 5CSYA 5BCAA 2V82A 4Q7BA 1G67A 1GONA 3P74A 2FFIA 4AVNA 2Y4SA 3AXHA 2O7SA 4W8BA 2GQ3A 4TX6A 1UP3A 4JTEA 4BWLA 3TW7A 4DAFA 4Q4QA 3QQWA 3RX4A 1LQAA 4A6GA 3JUGA 3IJIA 5HNTA 1XR2A 3MI3A 2WO5A 5HWNA 1E3XA 1ICPA 1U30A 3W75A 1EX1A 3VIFA 2PDQA 2FVMA 4LNCA 3BCFA 2H90A 4KWVA 1EDGA 4I8DA 1EZ2A 3INPA 2CHOA 1BQCA 2GJXA 2W91A 4QXIA 3TYAA 3NSMA 1JEZA 2NQHA 4NAFA 3QSRA 2HK1A 1H5YA 1BXBA 4PB3A 1RHCA 2J75A 4KF1A 3BCJA 4EOUA 1J79A 2BNJA 3GTNA 2Q8ZA 4H9YA 4NNAA 1OD8A 2JF6A 1W8GA 3M0IA 4LY4A 5F2GA 3R8GA 1NFGA 3AUJA 2IPFA 4C6CA 1M01A 1U1UA 3SURA 2YL8A 1ZHAA 3WMBA 5KZEA 3RG6A 4RE0A 1G69A 2G41A 5ABEA 3ARVA 4IMGA 3LY0A 3B8IA 4N9DA 5HJYA 3HV9A 5FEZA 3ARRA 3TJIA 3WQVA 1L0PA 1CWYA 2WKGA 2HDJA 1V7AA 3EDFA 4Z42C 1E1CA 4BR1A 4H9ZA 3UCDA 3GH7A 3TWAA 2XVKA 4HYWA 1VLIA 5LA2A 2CLIA 4M6QA 3B8DA 3QKZA 4S3DA 1I1XA 4XV0A 3WQDA 3XINA 3NIYA 1JZ3A 3UF9A 3VIIA 1WZKA 4AYSA 1KGUA 3LDVA 4FIRA 2WMJA 2YL5A 3M5YA 3A64A 4IF2A 1P7TB 1FFQA 4LVFA 3M64A 1MQQA 2QDEA 3JU2A 3KVLA 4AY1A 3V3WA 3T0TA 1VFTA 2G95A 5HANA 1TA3A 3S9ZA 1ME9A 4JIQA 3AAMA 2DSUA 5LNUA 4R3UA 3UQNA 1JCMP 4PUNA 1XCWA 2B4GA 3TFXA 2XZ7A 4ZOAA 9RUBA 1K6WA 1QI5A 1P48A 1XW8A 3MV11 1Q7MA 3L12A 1TYGA 1ZU8A 4J2MA 3QFWA 1QOXA 1VBRA 4C1NA 2GJRA 3FJLA 5C8BB 2ZC8A 3HG5A 2EQDA 5HBFA 4D6FA 3LI1A 3MB9A 3QGKC 4YVXA 1JQVA 4ACZB 3FDGA 1F9CA 2O7QA 1BRLA 2QV4A 3OIHA 4GK8A 3U2ZA 1V0MA 3LHYA 3DU0A 1VJZA 1REQB 3M0JA 5C5YA 3CWHA 4G6CA 3LNPA 1T8QA 1ADDA 1O1HA 4O17A 3WJWA 4DF1A 3GG0A 4AVOA 2PTDA 3E0VA 3GIYA 3KBWA 7ODCA 2P3ZA 3QH2A 2V2HA 2QHAA 1L6SA 2GSEA 2P0IA 4M3PA 3AOFA 3UETA 3N2BA 2PI6A 3CK5A 2WJZA 5HA7A 1RXOB 1CYGA 3PG8A 3LTYA 3WQ5A 2WHKA 4H2CA 1V6UA 1WOBA 1B4EA 1JGMA 4LUJA 3AHXA 4QNEA 3ISIX 1VHNA 6ALDA 3LXBA 5AHNA 2VGFA 3BMWA 5J5RA 3IIVA 3BGJA 1F07A 4K37A 4JQ1A 3USBA 1GGOA 3PPFA 1JG9A 1DJIA 5GNZA 3VDCA 3W29A 3UR8A 3PUOA 3K2GA 1FDZA 3KBNA 2Y88A 4AWSA 1DTUA 1P1MA 3W72A 3UESA 4B5SA 1JAKA 2DZSA 3MDUA 3QMRA 4ZR8A 4Z2KA 1W9PA 1XJBA 1DOSA 1UUMA 2WC3A 3S5ZA 1KRBC 4KETA 3I3EA 1HKVA 4O8RA 5DT5A 1TIWA 5LNWA 3NJ3A 2QPXA 4GG9A 2QJJA 2PF8A 3BSGA 3NL5A 2FPVA 2Q02A 1T6MA 4RNFA 1LZOA 5FL1A 3EXRA 1QUMA 4BCEA 5HPCA 2OWCA 1E71M 1OCNA 4DUOA 4I5UA 1LOLA 3SECA 2OGYA 2Z0IA 3LXAA 4IP5A 1IIGA 3ARZA 3UGVA 3GG7A 3NEVA 1XLGA 1UQYA 4JQ2A 1AQHA 1PWLA 1KM3A 3O9NA 4UNIA 3BLOA 3MMDA 4A3RA 3PZ9A 1VAHA 1RD5A 4XKMA 4GGHA 4IFKA 1H50A 1FKWA 2WVVA 3RLVA 1YW1A 3ITOA 1J11A 3EWCA 2XM1A 3HIJA 4ZODA 4KWUA 1EJTC 4BS0A 2D0HA 1VPQA 1WOAA 5HDRA 4PULA 4PSRA 3VNKA 3IANA 1UWTA 3CT2A 1MFVA 4MNKA 4UBPC 5D8WA 1TR9A 4V28A 2WNZA 1PHQA 2QGHA 3MUAA 3WD0A 2XSAA 4UFKA 1FKXA 1US0A 3TOPA 3ZJ6A 4KPLA 1Q85A 4C6QA 5D33A 3ES7A 3HO8A 3QHOA 3HPFA 2R1PA 3AMLA 3CTLA 3QRHA 5DF0A 4LS0A 1E6RA 4G5DA 2V2DA 5HAOA 4C1KA 1Q45A 3MBFA 3T07A 1JF5A 1EZWA 4O1CA 1Z3NA 5G1MA 2Z28A 1DHPA 3DI1A 1R8LA 2QQ6A 4XZWA 2V3DA 3H8AA 3O6DA 4GVIA 1M5WA 4RXGA 3PZUA 3E2VA 2DH2A 1N8FA 3A6OA 4ADUA 2F6XA 3DHUA 4GPNA 3CUXA 3K13A 5MKGA 2IKGA 5K7JA 3W0KA 2GGHA 1HO1A 4LRTA 4EX4A 4M29A 2DZTA 3S5OA 5I3DA 4S3EA 4JYFA 2ZRVA 4L64A 1EJ7L 1A4LA 5I78A 3VOJA 2WVTA 3KRZA 3LQGA 4B90A 2ZTJA 8TIMA 3POHA 3PN8A 2DIJA 4PUWA 1TZ9A 1S5VA 5FJIA 2HE5A 4QR6A 4XG1A 3UT0A 4HPNA 1R87A 1U5JA 2BVWA 2VEGA 3I4EA 4QLLA 4XZHA 5E70A 3VCRA 4Y7EA 5D9NA 2HCVA 1TTQA 3UA3A 1UJPA 1B3XA 5C55A 3AHVA 1MMFA 3QPEA 3WQFA 3FA3A 4QCEA 1E6PA 3QMTA 2Y8UA 5E0CA 2QF8A 4RNHA 1R3QA 3F5JA 4LY8A 2GVLA 1W3LA 3GM8A 2L5HA 3T4CA 5IHRA 3S4TA 4TTGA 4GBUA 3EWUA 1C8VA 1W1ZA 3AZSA 3VZYA 1CXKA 4FMVA 3L2LA 5HINA 3WBWA 3RDKA 4W7UA 1RPKA 1TQXA 2WC7A 5BROA 3DFOA 5D05A 5CGMA 3TYUA 4PODA 4NAEA 2P5NA 2W67A 4OJYA 2BY0A 2A5HA 2BVTA 2XGBA 3TYBA 1VCVA 3SW6A 3WLPA 6XIAA 1HXJA 2ZUSA 4Z1YA 2FFCA 3C8NA 1Y7VA 1MXSA 2Y0FA 2EG8A 2GFTA 1CLXA 1ZP4A 2GVGA 3GNXA 1I2RA 1OC6A 4LX4A 3GR4A 3N6QA 1ZSXA 2NVCA 2PGRA 7CGTA 5IM51 1R46A 3APGA 3W71A 2OEMA 1RK5A 1H11A 4FO4A 4GY7A 5A8QA 2Y63A 2A7RA 4RPQA 3OHIA 4OKDA 3N3MA 1C91A 2R1MA 4UOZA 4PBEA 4GO8A 4IX0A 5IHSA 4XAPA 1OG0A 4CU7A 4J3TA 1UA3A 2CZDA 1YHTA 3N17A 2VDGA 4WOQA 1PB0A 3IGSA 2ZYFA 3PUDA 5FA5A 4E0CA 1EJSC 3HTWA 1X7FA 3S2LA 4PMJA 1WXJA 3RX2A 1A5LC 4AIOA 7REQB 3OBKA 3B3DA 5A6LA 1GOXA 2QJHA 2ON3A 1IT8A 1RH9A 3VOIA 2TAAA 3CPGA 4CNTA 1CIUA 1NIUA 4GCAA 3L4WA 3PULA 4S2BA 2YJQA 5FJRA 4MIMA 4Z08A 1V6YA 4XZ9A 3C61A 3WDRA 1J93A 1OADA 2AOSA 3WQ6A 5LHEA 4PTWA 4IISA 1SSGA 1WKDA 1UJQA 3VDBA 4M19A 3GXFA 4URIA 3LNMA 1E0WA 3AYVA 3UR5A 4H7ZA 4CLMA 4MFDA 5CZSA 3S9YA 3W3OA 1PIGA 4E3TA 5F1VA 3JW7A 4D1JA 3WMSA 3MCMA 2PDPA 4KCTA 2EEXA 3UERA 3ZR4A 1PL9A 5TD4A 4O52A 3EX2A 2CFFA 4MDOA 2CLOA 1MUMA 4B5TA 4DF2A 4NJHA 4NU7A 1ZBKA 2PDUA 4ZENA 2GQ8A 4AZ7A 4JL1A 1F6KA 4PMXA 2CEQA 2Q3RA 1PWMA 4IUOA 4JNZA 1E6SM 3W81A 4IUGA 4K2SA 3KS5A 4MZYA 1UOKA 4US5D 3O1NA 1QPOA 3G1HA 5A95A 1HG3A 5KTLA 4NX0A 3WMLA 1NVMA 3TDFA 1KKOA 4C6FA 2J74A 5CCZA 4HP5A 3VCNA 3OP2A 3FHQA 4GJ1A 1HNYA 1A80A 1ME8A 1VHCA 3DHPA 4P8XA 1GVSA 4H1ZA 4QSHA 1IEVA 1XRFA 3LEPA 1IXPA 1I1WA 1XLFA 3TN4A 4CGTA 3WD2A 3PFRA 1KO0A 1CBGA 2J9ZA 4RDVA 4YN5A 1BVNP 1P6CA 4C6DA 3GAKA 3N2TA 3W7NA 4U5KA 4AQLA 5G2WA 1SW7A 4ZGYA 3ZJ8A 4D71A 4LAZA 4QISA 3R1ZA 4J3XA 2C14A 2PUZA 3CH0A 2OELA 2NQZA 2CERA 4HSHA 5JBFA 4U2ZA 3K8KA 1ZJIA 3FVMA 3MO7A 3ANVA 1VBGA 4UR8A 4X22A 1XLCA 3HGSA 3TCSA 3UG4A 1AFSA 3SCVA 2DJXA 2J9YA 1QVBA 5CXPA 2PBOA 3M44A 4N9CA 4IJCA 1W3KA 7TIMA 4W5UA 3U2CA 3H55A 1UQZA 2IW0A 4BHYA 3TZFA 1BTMA 1MSSA 1QW8A 2RHGA 2EKCA 2DSZA 1OG6A 4PB4A 1S39A 5AC7A 3VABA 3PPGA 3NOYA 5T9BG 5I23A 1XC4A 4HT3A 4V15A 4CNPA 4H8VA 1IXNA 3EPNA 3COTA 4N42A 3KVJA 1GNXA 2PP1A 2VP8A 2PDMA 4JTCA 5DQPA 4DXXA 1FA2A 4HTBA 3K8MA 4QE1A 4LUSB 1R2TA 1FWGC 5M03A 4ZFCA 1R2RA 4O50A 4UOJA 3WY1A 3CZGA 3