1QX8A

Crystal structure of a five-residue deletion mutant of the rop protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
47
structure length
47
Chain Sequence
b'EKTALNMARFIRSQTLTLLEKLNELADICESLHDHADELYRSCLARF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein ROP
publication title Loopless Rop: structure and dynamics of an engineered homotetrameric variant of the repressor of primer protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 21
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Regulatory protein rop 1qx8A00
1QX8A
chains in the Genus database with same CATH superfamily
1YTZT 5CJ0A 1QEXA 2BCCJ 2PRRA 1KFMA 3FWLA 3T97A 3RK3B 1M1KQ 1JY3P 3L71E 1VQKP 1NU1D 3MGNA 3VMAA 3CX5H 1OIPA 1N7SA 1EDIA 1NWQA 4C7NB 2Y9YA 1LTJC 5AVQB 2WPVB 3L71G 1BDCA 2C0WA 2KK7A 2KUBA 2O3JA 2FYNC 2IZ0A 1GL2B 1PP9D 4DZOA 4GODA 2W90A 4RO0A 4K3AA 1PPJG 2ZYAA 3BVHA 1N86A 1YI2P 1KB9E 5BU8B 1NTMK 1VQPP 3N7NA 2RH0A 5C39A 1NTKD 3CWBD 1MZ9A 2NRGA 5KLVE 1LTBC 1SQVE 2MKVA 1KQFB 2OYIC 2XNDH 4DCKA 2QJPB 3L73E 2IFNA 2JWDA 4HH2A 4EYYQ 3H1KD 2WITA 1M1JC 1FZAA 1NKZB 4W7YA 2AXTE 1KB9H 2UWJE 2H8PD 3E7KA 1SQVG 1G1JA 1IFJA 2WPSA 4IL6H 1SQBJ 2QIWA 3RBXA 2I1KA 2W83C 3L73G 3V2NA 3CCEP 3BCCJ 1SQXJ 3L74J 3RGUA 1NTZJ 1SQQD 1T8ZA 3N4XA 1RQVA 2K9JA 3JSVC 3CCRP 1FDOA 1RE3C 2AXTH 1T3JA 2ITAA 5APWA 3AE8C 2YXQB 4PD4E 2E76D 1ZRTD 1A02J 1S5LE 2PGDA 4OVNF 1BE3G 1FJPA 1ZR2A 2E76C 1BCCE 1KILE 1W5CE 1L0LE 1ZXGA 2OYIB 1Q82Q 2Y0EA 2QRXA 1FJKA 1N8RQ 2Q3EA 3PLNA 1Q81Q 3AE2C 4K35A 4PD4H 4C7RA 1IFMA 3USSA 4IL6X 1K9MQ 3VOPA 3L75E 2KOGA 1M57D 3ABVC 1LWUB 1S5LH 1BCCG 1NAYA 2QM7A 4B86A 1M56D 1MFZA 5CJ4A 1CI6B 1NVOA 1P84E 1GL2A 3H6PA 3WUTA 3B5NB 1N7LA 1GK6A 3H1JE 2K1AA 2FYUD 4Y99B 3L75G 3D70A 1JCDA 3MD0A 5APXA 3H1LD 2GM4A 2C9NY 3O8ZA 3AE7C 4Z1MH 2JKVA 4WWIA 3B4SA 1OW8A 4R4LA 5APUA 5AW6B 4JF7A 4U3FD 1URQC 1FDMA 2J58A 1X22A 1P84H 1SP4A 2O01N 3H1JG 4LC1A 3HTKB 3EFGA 3AEAC 3CC4P 5KKZC 1S72P 4M3LA 4W80A 2OQQA 2E74D 3GW6A 1KC8Q 2QSIA 3I5CA 2Y0CA 3ZDMA 1BDDA 1L2PA 3RL0B 3IFMA 1OVUA 2OYHB 1RHZB 2E74C 1MUUA 4KHXA 2R5BA 1JMMA 2QJYC 4XE5B 1G2CA 1ZR4A 1JOCA 2E43A 1X9VA 1LTIC 1SQBE 1E5WA 4TLFA 1EC5A 5B66E 2A06E 3CX5D 4WY4B 1SFCD 3H1HG 1DD3A 2M3BA 1NTZE 3CX5I 3F89A 1AFOA 3TSIA 1VQOP 3PRJA 1VQ8P 1SFCC 2A45G 1ZN5A 2ZYDA 1N73C 4LLHA 1NU1E 2A45H 4GOFA 4ASVA 1AVOA 5B66H 2FYZA 3HUSB 3L4FA 2JEEA 2CK3H 4EIJA 2YIUC 1OVVA 1NU1G 3NXSA 1DD4A 5AVXB 4GKGA 2W6BA 3GG2A 3CMEP 3W67A 4RKUJ 5KLIC 3H32B 2QVAA 1OW7A 1FBMA 3B5NA 5APQA 2O01H 3CWBE 2IDBA 1OWAA 3C8VA 3R4YA 1KB9I 1PP9G 5KLVD 1IK9A 1VQ4P 1JY2P 1K8AQ 1FU1A 2P58A 3HD7A 1S1CX 5BVZA 3RK2B 1XTGB 3IAOA 1NTKG 3CWBG 3HTKA 3Q5PA 4I7ZC 3C1LA 2YO3A 2FXMA 4MN4C 1U7JA 1IK7A 3TYYA 3VP8A 1WRGA 3H1KG 5GTHE 2OYHA 3SWFA 1SQQE 3KQGA 3L35A 2IFMA 3C9IA 2YIUB 3AE9C 1Z56A 3G6EP 3CCUP 1J2JB 2SPZA 4WY4A 2ZXXA 3A7OA 3TGUJ 3CCVP 1ZRTE 1GTWA 5KLIB 4PD4D 1RE4A 1JEKA 1SQQG 2E75D 3CC7P 3H1IJ 3HE4B 4N6JA 5GTHH 4PD4I 5AVRB 2Q1KA 3Q3DA 3M91A 5CCGD 1SQPD 1M8OB 2E75C 1FZCA 1KILD 1CZQA 1L0LD 5CCHD 1HVVA 3QWOC 2BCCD 5CCGC 1RF0A 2N9YB 2KNCB 2P67A 1H89A 4PV1B 1KILC 3P32A 2KS1B 1EQ7A 1VPCA 5CCHC 4OH8B 4HYTB 3CXHE 3AEGC 1JM0A 1KD1Q 2WZ7A 2P2UA 2E5YA 3SFDC 3MUDA 4GT1A 3NTNA 1NO4A 1LTGC 5K5GB 4JPZB 1P84I 2FYUE 2XKMA 1USDA 2HPCA 5AVWB 1IC2A 1HF9A 2I1JA 1LTSC 2J59M 3LIDA 3CXHH 4U3FE 2W6JH 2KP8A 3A5TA 2KIKA 1T3UA 3SWKA 4HJGH 1BGYJ 1VF5D 2FYUG 3FXEA 2NPSD 3H1LG 1H0TB 2AEJA 4U3FG 2E75B 3GHGB 2NPSC 4R4MA 4C46A 2R3CA 2H43A 2B87B 2WMMA 5AW3B 1S9KD 3P8MC 1KILB 1YBKA 1LT9A 1QVGO 2RN0A 3P8CD 3AEFC 1KQLA 5E79E 3PP5A 1SQBD 2A45I 2L91A 1PGPA 3IR9A 1VL2A 3BCCD 1SQXD 2A06D 2M8RA 3A2AA 3L70J 3L74D 2YKQA 1NTZD 1NTKK 4AUWA 2YNYA 3HE4A 2OTJP 3FGAD 1KTMA 2WSFH 1VQ9P 1EZVD 3TGUE 2PP6A 5E79H 2WVRA 4LGDE 2N1TA 5KTBA 3U59A 1RY3A 2FBWC 4ZKPA 3VMYA 2QE7H 4RESB 2WPQA 2M5AA 1R5LA 4L73A 2B9BA 1YHQP 1OZHA 1DX7A 1DEBA 3V6IA 1USEA 1VF5B 2NPSB 4AYCA 5AW2B 1RF1C 2D2CD 1VDFA 4L75A 3AE5C 2HODB 1KFNA 1PV3A 2BEZF 4IL6E 1L0NK 2YO2A 3A0HE 1GD2E 2VRSA 1FC2C 2D2CC 3QH9A 5AW7B 4TT3H 1EDKA 1KQGB 2Z5IA 3KPEA 1NKNA 2YKOA 1VQMP 1R5SA 1W2BO 3MIWA 1AVYA 3EFFK 5KLVG 3D6ZA 4U7JA 1H0TA 2RMZA 3A0HH 4GOEA 2ZYGA 4W7ZA 3LIEA 1BGYE 1MV8A 3S1KA 1ZW0A 1LTJB 2FFDA 4HKZH 1JY3O 5EFWB 5AW9B 1JTHB 2V7QH 2FYNB 3P7KA 1LT1A 5KJ7D 3PJSK 2DW3A 4N3YB 3MZWB 1L4AD 3HD7D 1LP1B 1FZFA 5KJ7C 1SQPE 1L4AC 3HD7C 3GF7A 2BCCE 1BSNA 1PZQA 2WSEJ 2Z5HA 1YQ3C 4ZMDA 1IJDB 2K88A 4C7NA 1QLED 1M1JB 1SQPG 1RQUA 3OJAB 3VN0A 1L0LG 1JMBA 3CXHD 1HJBA 3PH0A 2E42A 2GUVA 3OA7A 3CXHI 2Y9ZA 2BCCG 4GDOA 2O1JA 5APSA 4EI2A 1URQD 2HFED 2BASA 2XDJA 4UB6E 2W27A 3G9RA 2WQYC 3MTUE 2E5TA 3CD6P 1HH0A 2LXCB 1KORA 1QVFO 1Y47A 2IX7C 1FZCC 3RL0g 1HGZA 2WT7B 2POHA 1NYHA 1PGJA 3CCSP 1K04A 2E76B 3OW2O 4UB6H 3K5BA 5APTA 2FKWB 1S9KE 4JQ0D 1QX8A 1D7MA 1LTJA 3P8CE 1NTMJ 3CLQA 3BCCE 3S9OA 1SQXE 1JTHA 1YIJP 2YMYA 2FXOA 2PFXA 3L74E 1L0NJ 2KLUA 1YQ4C 4D6TJ 5AW8B 4H0LC 1FOSE 3CCMP 5KLVK 1SQVK 4DOJA 3G3ZA 1EZVE 1SQBG 2RKLA 3BCCG 1SQXG 2A06G 2ZVOB 3L74G 3SFEC 3TGUD 2YXRB 1NTZG 2QA4P 2OYIA 2ZAEB 2KB7P 1URQB 3GMAA 3H1ID 1SLQA 3M0AA 1FS0E 4AQRD 1U57A 2JDIH 5KKZB 1AQ5A 1EZVG 5H2FE 1M1JA 4N78D 1LWUA 4IFFA 2V4HA 5CBOA 1OW6A 4NPFX 1J1EC 1CI6A 3V4WA 1JCCA 2E74B 1FZBA 2QJYB 1GDTA 3KYQA 1NHLA 4OGQD 3II6A 4H13D 3D6YA 1OMIA 4YXDC 1YTZI 5H2FH 1VQ6P 4OGQC 4H13C 4WVZA 1N7SD 3SWYA 2IYOA 1SFCB 1L0LK 1HTLC 1N7SC 2N1TC 1N73B 1EXJA 3G4SP 2ZJSE 3WMM0 2HR3A 1BGYD 2KZJA 2WSSH 2CPBA 2ZT9C 3V2PA 3L72J 1HBWA 1FZEA 3HRNA 1NOHA 3E1RA 3HE5B 3A0BE 3W68A 3B71A 3Q5RA 3TK1A 2OYOA 1J1DC 2W8ZA 3M0DA 3CMAP 1GW3A 5L8RJ 3L71J 4D6TE 3L70D 1AJYA 2FXPA 1JNMA 3T97B 4L74A 1YITP 5KAFE 2H89C 4H13B 1PGQA 1YJNP 3A0BH 2WPRA 3MP7B 3HUSA 4JYCA 3V2RA 5APYA 1N7SB 3U1AA 1JY2O 4I7ZB 1A02F 1PFIA 2IBZD 1Q90D 2FFDC 1GZLA 4I2LC 3H32A 1X8YA 5KAFH 2C0XA 1SQBK 4I6MC 4L76A 3Q2YA 2J5UA 3VYIA 1NTZK 1SQVJ 2KI7B 3AEBC 1SVFA 1S4XA 3L73J 5CHXA 1BSHA 1NGMB 3RK3C 1SS1A 1QGKB 1ZLLA 2WWWA 1NU1K 1HUCA 3CPWO 1ZP0C 3M9HA 4BWNA 1WMKA 1KN7A 3WUUA 2O1KA 2JJLA 3UIAA 4BXLA 2R3SA 3KXDA 4DT0A 1GL2D 1FAVA 4GIFA 1MFTA 1PGOA 3BRVB 5BU5A 1BE3J 3CCLP 1JY3N 1GL2C 3KZIE 2ZXEB 2K9YA 3CC2P 3M9BA 1Q86Q 1CSBA 4KT0J 2B89A 4XFJA 3M06A 1YJWP 5AVVB 2Q6QA 3L72E 3CI9A 2R44A 4H44D 1X0TA 1UIIA 3F5HA 3E1IA 1H8AA 1KYOD 5AVSB 5B5EE 2QJPC 2QG4A 1BCCJ 4H44C 2KYVA 1EXIA 1EZVI 3KZIH 3RBZA 4A7PA 3H1IE 4ZKUA 3L72G 3FWNA 1KV4A 1IZNB 1HWTC 2KNCA 1IFNA 2KS1A 3JC22 3L75J 1LTAC 4N78E 3AE4C 1OVRA 1PIXA 1IFDA 2WTYA 3TGUG 2PAJA 4BRYB 5B5EH 2CPSA 1SQQK 3H1IG 1PPJE 3U1CA 1QL2A 1VQ7P 2M0BA 3L36A 5CBNA 3Q1MA 3O6QB 3LW5J 2Q5UA 3H1JJ 2AEMA 2Q3IA 3G71P 4ASWA 1S3JA 2NZ2A 2G3AA 1LJ2A 4O9BA 2QJKC 3TNUB 2P10A 3H25A 1KZUB 3NFQA 4H44B 1K05A 2AXCA 3H1HJ 3GHGA 2B87A 2QEXP 1M7LA 1W2EA 5CCGA 1LWUC 3B5ND 4NPDA 1KILA 1GU4A 5CCHA 1TU3F 2JWAA 2XNXA 1NAFA 1G2CB 2QM8A 3B5NC 1VQ5P 1BGYG 5AVZB 2FYUK 1IFPA 4Y99C 1RF1B 1BE3E 5AVUB 2R32A 4ZNCA 1FZGA 3FXDA 1N2DC 3NMDA 2HG5D 3V2QA 4Y28J 1NTMD 1MKMA 1DIPA 2FY8A 1JO5A 1NU1J 3L70E 1L0ND 2D2CB 2K3RA 4D6TD 2KSEA 3D71A 3PHLA 1T2KD 2I8DA 3RL0D 3V4QA 2O01J 2Z4EA 3VMXA 2MJZA 4EOTA 5TISE 2QJKB 4I1LA 2XV5A 1U7MA 1PL5A 2GA1A 1QL1A 1T2KC 3RL0C 3AE3C 3L70G 3TF5A 3M9QA 2OYHC 2IBZE 1PP9J 2LR2A 4BRYA 1GW4A 5CMZA 4WY4D 1Q7YQ 1R8EA 2NPSA 3BASA 1G1IA 3IF4A 1T6AA 1YYCA 2HODA 1AV1A 3O6QA 1NTKJ 3CWBJ 4WY4C 5TISH 3RK3E 3GF3A 2IBZG 1RE4C 3M0DC 5AVTB 2JP3A 3H1KJ 2JR8A 1RH5B 4IFMA 3TNUA 5GTIE 1LNQA 1RF0C 2OTLP 3AE1C 1L4AB 3HD7B 5AVYB 3CL3D 5AW5B 1Y8AA 3Q5SA 3HUSC 1IO4A 1UIXA 3OAKA 3PTZA 5M1BA 1SQQJ 3AE6C 3LW5H 4NPEA 1EDLA 4H0LD 5AW4B 3MUDC 3H1HE 5GTIH 3KHUA 3SSUA 2KXPB 1S5LX 3WU2E 1NJIQ 3L72D 4OWFA 1Y9BA 1RF1A 1VQNP 1KYOE 1LP1A 3RK2D 5DJTB 1FE6A 1NH4A 2IYPA 3RK2C 2KSJA 5TJHA 4UB8E 4DJGA 3WU2H 1FZCB 3L71D 1X79B 3FX0A 1KYOH 5KAIE 1JY2N 2YMKA 2YKPA 2WSCJ 1ZV8A 3I56P 3IN6A 4IOIH 2OARA 1LT9C 3AEDC 1PPJD 3R2PA 2LXBA 1E79H 4EDFA 2FYUJ 5AW0B 4UB8H 3H1LJ 1PP9E 2M3EA 1HGVA 4WBAA 1XTCC 4RJTA 1KMIZ 4U3FJ 1RE3A 5KAIH 1OX3A 2WSEH 2N1TD 2HPCB 2IZ1A 4IFDK 4H0LB 2OGUA 1KB9D 1NTKE 2Y0DA 1SQPK 2KZIA 2XZRA 1DH3A 1S2EA 4PV1D 1AA0A 1SQVD 2WT7A 5KJ7A 2ZT9D 3L37A 4WB4A 3L73D 1HJ0A 5APVA 3H1KE 1IFIA 1L4AA 4PV1C 3JCUE 1GK4A 4QMAA 1Q2NA 3V5BA 2GUSA 2WSFJ 3ITKA 2B88A 2H88C 3I55P 3KDPB 2BEQD 1J1EB 4CPGA 4XA4A 1DEEG 3VP9A 1LT9B 2P1JA 3WUVA 3JCUH 1BE3D 1NTME 1ZMEC 2W6AA 3BRTB 1L0NE 1K73Q 1OFCX 3TDKA 3GLMA 2H7HA 1FOSF 4OGQB 3VTPC 4JBZA 2LKMA 4KJMA 3A3YB 1URQA 4YPCA 1GU5A 1NTMG 1ZOYC 2N9BA 4JYBA 1L0NG 1BCCD 2P7JA 3GHGC 2N1TB 2HYNA 2R5DA 4D6TG 1JUNA 4PJ0E 2KLVA 4HB1A 2IBZI 2M5AB 2AEFA 3VMZA 2ZT9B 4YXWH 3CCJP 3L75D 3B8EB 1SQXK 2Q7CA 1FDIA 1KQSO 3RK3D 5DJUB 5KLVJ 2ZVNB 1GMJA 1P84D 1AQTA 4PJ0H 1CW5A 3H1JD 3H1LE 2G8YA 1J1DB 2V7QJ 1VQLP 2XU6A 1SFCA 2HLOA 3S4RA 1N73A 3CCQP 3EQ2A 2C9LY 1WT6A 1EDJA 2WSCH 2K37A 2Q9IA 3BATA 2OTKE 2JO1A 1H88A 1YJ9P 4YTPC 2ZFCA 1VF5C 1M90Q 2IPPA 1LGHB 1LTTC 1OXZA 3AECC 3H1HD 2FFDB 3HE5A 3MHVA 2K9JB 3AEEC 3EWKA 2L5GB 3CX5E 5AW1B 1SQPJ 1JB0J 1KYOI 1L0LJ
chains in the Genus database with same CATH topology
1QX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX8 A; 
#chains in the Genus database with same CATH topology
 1YTZ T;  5CJ0 A;  1QEX A;  2BCC J;  2PRR A;  1KFM A;  3FWL A;  3T97 A;  3RK3 B;  1M1K Q;  1JY3 P;  3L71 E;  1VQK P;  1NU1 D;  3MGN A;  3VMA A;  3CX5 H;  1OIP A;  1N7S A;  1EDI A;  1NWQ A;  4C7N B;  2Y9Y A;  1LTJ C;  5AVQ B;  2WPV B;  3L71 G;  1BDC A;  2C0W A;  2KK7 A;  2KUB A;  2O3J A;  2FYN C;  2IZ0 A;  1GL2 B;  1PP9 D;  4DZO A;  4GOD A;  2W90 A;  4RO0 A;  4K3A A;  1PPJ G;  2ZYA A;  3BVH A;  1N86 A;  1YI2 P;  1KB9 E;  5BU8 B;  1NTM K;  1VQP P;  3N7N A;  2RH0 A;  5C39 A;  1NTK D;  3CWB D;  1MZ9 A;  2NRG A;  5KLV E;  1LTB C;  1SQV E;  2MKV A;  1KQF B;  2OYI C;  2XND H;  4DCK A;  2QJP B;  3L73 E;  2IFN A;  2JWD A;  4HH2 A;  4EYY Q;  3H1K D;  2WIT A;  1M1J C;  1FZA A;  1NKZ B;  4W7Y A;  2AXT E;  1KB9 H;  2UWJ E;  2H8P D;  3E7K A;  1SQV G;  1G1J A;  1IFJ A;  2WPS A;  4IL6 H;  1SQB J;  2QIW A;  3RBX A;  2I1K A;  2W83 C;  3L73 G;  3V2N A;  3CCE P;  3BCC J;  1SQX J;  3L74 J;  3RGU A;  1NTZ J;  1SQQ D;  1T8Z A;  3N4X A;  1RQV A;  2K9J A;  3JSV C;  3CCR P;  1FDO A;  1RE3 C;  2AXT H;  1T3J A;  2ITA A;  5APW A;  3AE8 C;  2YXQ B;  4PD4 E;  2E76 D;  1ZRT D;  1A02 J;  1S5L E;  2PGD A;  4OVN F;  1BE3 G;  1FJP A;  1ZR2 A;  2E76 C;  1BCC E;  1KIL E;  1W5C E;  1L0L E;  1ZXG A;  2OYI B;  1Q82 Q;  2Y0E A;  2QRX A;  1FJK A;  1N8R Q;  2Q3E A;  3PLN A;  1Q81 Q;  3AE2 C;  4K35 A;  4PD4 H;  4C7R A;  1IFM A;  3USS A;  4IL6 X;  1K9M Q;  3VOP A;  3L75 E;  2KOG A;  1M57 D;  3ABV C;  1LWU B;  1S5L H;  1BCC G;  1NAY A;  2QM7 A;  4B86 A;  1M56 D;  1MFZ A;  5CJ4 A;  1CI6 B;  1NVO A;  1P84 E;  1GL2 A;  3H6P A;  3WUT A;  3B5N B;  1N7L A;  1GK6 A;  3H1J E;  2K1A A;  2FYU D;  4Y99 B;  3L75 G;  3D70 A;  1JCD A;  3MD0 A;  5APX A;  3H1L D;  2GM4 A;  2C9N Y;  3O8Z A;  3AE7 C;  4Z1M H;  2JKV A;  4WWI A;  3B4S A;  1OW8 A;  4R4L A;  5APU A;  5AW6 B;  4JF7 A;  4U3F D;  1URQ C;  1FDM A;  2J58 A;  1X22 A;  1P84 H;  1SP4 A;  2O01 N;  3H1J G;  4LC1 A;  3HTK B;  3EFG A;  3AEA C;  3CC4 P;  5KKZ C;  1S72 P;  4M3L A;  4W80 A;  2OQQ A;  2E74 D;  3GW6 A;  1KC8 Q;  2QSI A;  3I5C A;  2Y0C A;  3ZDM A;  1BDD A;  1L2P A;  3RL0 B;  3IFM A;  1OVU A;  2OYH B;  1RHZ B;  2E74 C;  1MUU A;  4KHX A;  2R5B A;  1JMM A;  2QJY C;  4XE5 B;  1G2C A;  1ZR4 A;  1JOC A;  2E43 A;  1X9V A;  1LTI C;  1SQB E;  1E5W A;  4TLF A;  1EC5 A;  5B66 E;  2A06 E;  3CX5 D;  4WY4 B;  1SFC D;  3H1H G;  1DD3 A;  2M3B A;  1NTZ E;  3CX5 I;  3F89 A;  1AFO A;  3TSI A;  1VQO P;  3PRJ A;  1VQ8 P;  1SFC C;  2A45 G;  1ZN5 A;  2ZYD A;  1N73 C;  4LLH A;  1NU1 E;  2A45 H;  4GOF A;  4ASV A;  1AVO A;  5B66 H;  2FYZ A;  3HUS B;  3L4F A;  2JEE A;  2CK3 H;  4EIJ A;  2YIU C;  1OVV A;  1NU1 G;  3NXS A;  1DD4 A;  5AVX B;  4GKG A;  2W6B A;  3GG2 A;  3CME P;  3W67 A;  4RKU J;  5KLI C;  3H32 B;  2QVA A;  1OW7 A;  1FBM A;  3B5N A;  5APQ A;  2O01 H;  3CWB E;  2IDB A;  1OWA A;  3C8V A;  3R4Y A;  1KB9 I;  1PP9 G;  5KLV D;  1IK9 A;  1VQ4 P;  1JY2 P;  1K8A Q;  1FU1 A;  2P58 A;  3HD7 A;  1S1C X;  5BVZ A;  3RK2 B;  1XTG B;  3IAO A;  1NTK G;  3CWB G;  3HTK A;  3Q5P A;  4I7Z C;  3C1L A;  2YO3 A;  2FXM A;  4MN4 C;  1U7J A;  1IK7 A;  3TYY A;  3VP8 A;  1WRG A;  3H1K G;  5GTH E;  2OYH A;  3SWF A;  1SQQ E;  3KQG A;  3L35 A;  2IFM A;  3C9I A;  2YIU B;  3AE9 C;  1Z56 A;  3G6E P;  3CCU P;  1J2J B;  2SPZ A;  4WY4 A;  2ZXX A;  3A7O A;  3TGU J;  3CCV P;  1ZRT E;  1GTW A;  5KLI B;  4PD4 D;  1RE4 A;  1JEK A;  1SQQ G;  2E75 D;  3CC7 P;  3H1I J;  3HE4 B;  4N6J A;  5GTH H;  4PD4 I;  5AVR B;  2Q1K A;  3Q3D A;  3M91 A;  5CCG D;  1SQP D;  1M8O B;  2E75 C;  1FZC A;  1KIL D;  1CZQ A;  1L0L D;  5CCH D;  1HVV A;  3QWO C;  2BCC D;  5CCG C;  1RF0 A;  2N9Y B;  2KNC B;  2P67 A;  1H89 A;  4PV1 B;  1KIL C;  3P32 A;  2KS1 B;  1EQ7 A;  1VPC A;  5CCH C;  4OH8 B;  4HYT B;  3CXH E;  3AEG C;  1JM0 A;  1KD1 Q;  2WZ7 A;  2P2U A;  2E5Y A;  3SFD C;  3MUD A;  4GT1 A;  3NTN A;  1NO4 A;  1LTG C;  5K5G B;  4JPZ B;  1P84 I;  2FYU E;  2XKM A;  1USD A;  2HPC A;  5AVW B;  1IC2 A;  1HF9 A;  2I1J A;  1LTS C;  2J59 M;  3LID A;  3CXH H;  4U3F E;  2W6J H;  2KP8 A;  3A5T A;  2KIK A;  1T3U A;  3SWK A;  4HJG H;  1BGY J;  1VF5 D;  2FYU G;  3FXE A;  2NPS D;  3H1L G;  1H0T B;  2AEJ A;  4U3F G;  2E75 B;  3GHG B;  2NPS C;  4R4M A;  4C46 A;  2R3C A;  2H43 A;  2B87 B;  2WMM A;  5AW3 B;  1S9K D;  3P8M C;  1KIL B;  1YBK A;  1LT9 A;  1QVG O;  2RN0 A;  3P8C D;  3AEF C;  1KQL A;  5E79 E;  3PP5 A;  1SQB D;  2A45 I;  2L91 A;  1PGP A;  3IR9 A;  1VL2 A;  3BCC D;  1SQX D;  2A06 D;  2M8R A;  3A2A A;  3L70 J;  3L74 D;  2YKQ A;  1NTZ D;  1NTK K;  4AUW A;  2YNY A;  3HE4 A;  2OTJ P;  3FGA D;  1KTM A;  2WSF H;  1VQ9 P;  1EZV D;  3TGU E;  2PP6 A;  5E79 H;  2WVR A;  4LGD E;  2N1T A;  5KTB A;  3U59 A;  1RY3 A;  2FBW C;  4ZKP A;  3VMY A;  2QE7 H;  4RES B;  2WPQ A;  2M5A A;  1R5L A;  4L73 A;  2B9B A;  1YHQ P;  1OZH A;  1DX7 A;  1DEB A;  3V6I A;  1USE A;  1VF5 B;  2NPS B;  4AYC A;  5AW2 B;  1RF1 C;  2D2C D;  1VDF A;  4L75 A;  3AE5 C;  2HOD B;  1KFN A;  1PV3 A;  2BEZ F;  4IL6 E;  1L0N K;  2YO2 A;  3A0H E;  1GD2 E;  2VRS A;  1FC2 C;  2D2C C;  3QH9 A;  5AW7 B;  4TT3 H;  1EDK A;  1KQG B;  2Z5I A;  3KPE A;  1NKN A;  2YKO A;  1VQM P;  1R5S A;  1W2B O;  3MIW A;  1AVY A;  3EFF K;  5KLV G;  3D6Z A;  4U7J A;  1H0T A;  2RMZ A;  3A0H H;  4GOE A;  2ZYG A;  4W7Z A;  3LIE A;  1BGY E;  1MV8 A;  3S1K A;  1ZW0 A;  1LTJ B;  2FFD A;  4HKZ H;  1JY3 O;  5EFW B;  5AW9 B;  1JTH B;  2V7Q H;  2FYN B;  3P7K A;  1LT1 A;  5KJ7 D;  3PJS K;  2DW3 A;  4N3Y B;  3MZW B;  1L4A D;  3HD7 D;  1LP1 B;  1FZF A;  5KJ7 C;  1SQP E;  1L4A C;  3HD7 C;  3GF7 A;  2BCC E;  1BSN A;  1PZQ A;  2WSE J;  2Z5H A;  1YQ3 C;  4ZMD A;  1IJD B;  2K88 A;  4C7N A;  1QLE D;  1M1J B;  1SQP G;  1RQU A;  3OJA B;  3VN0 A;  1L0L G;  1JMB A;  3CXH D;  1HJB A;  3PH0 A;  2E42 A;  2GUV A;  3OA7 A;  3CXH I;  2Y9Z A;  2BCC G;  4GDO A;  2O1J A;  5APS A;  4EI2 A;  1URQ D;  2HFE D;  2BAS A;  2XDJ A;  4UB6 E;  2W27 A;  3G9R A;  2WQY C;  3MTU E;  2E5T A;  3CD6 P;  1HH0 A;  2LXC B;  1KOR A;  1QVF O;  1Y47 A;  2IX7 C;  1FZC C;  3RL0 g;  1HGZ A;  2WT7 B;  2POH A;  1NYH A;  1PGJ A;  3CCS P;  1K04 A;  2E76 B;  3OW2 O;  4UB6 H;  3K5B A;  5APT A;  2FKW B;  1S9K E;  4JQ0 D;  1QX8 A;  1D7M A;  1LTJ A;  3P8C E;  1NTM J;  3CLQ A;  3BCC E;  3S9O A;  1SQX E;  1JTH A;  1YIJ P;  2YMY A;  2FXO A;  2PFX A;  3L74 E;  1L0N J;  2KLU A;  1YQ4 C;  4D6T J;  5AW8 B;  4H0L C;  1FOS E;  3CCM P;  5KLV K;  1SQV K;  4DOJ A;  3G3Z A;  1EZV E;  1SQB G;  2RKL A;  3BCC G;  1SQX G;  2A06 G;  2ZVO B;  3L74 G;  3SFE C;  3TGU D;  2YXR B;  1NTZ G;  2QA4 P;  2OYI A;  2ZAE B;  2KB7 P;  1URQ B;  3GMA A;  3H1I D;  1SLQ A;  3M0A A;  1FS0 E;  4AQR D;  1U57 A;  2JDI H;  5KKZ B;  1AQ5 A;  1EZV G;  5H2F E;  1M1J A;  4N78 D;  1LWU A;  4IFF A;  2V4H A;  5CBO A;  1OW6 A;  4NPF X;  1J1E C;  1CI6 A;  3V4W A;  1JCC A;  2E74 B;  1FZB A;  2QJY B;  1GDT A;  3KYQ A;  1NHL A;  4OGQ D;  3II6 A;  4H13 D;  3D6Y A;  1OMI A;  4YXD C;  1YTZ I;  5H2F H;  1VQ6 P;  4OGQ C;  4H13 C;  4WVZ A;  1N7S D;  3SWY A;  2IYO A;  1SFC B;  1L0L K;  1HTL C;  1N7S C;  2N1T C;  1N73 B;  1EXJ A;  3G4S P;  2ZJS E;  3WMM 0;  2HR3 A;  1BGY D;  2KZJ A;  2WSS H;  2CPB A;  2ZT9 C;  3V2P A;  3L72 J;  1HBW A;  1FZE A;  3HRN A;  1NOH A;  3E1R A;  3HE5 B;  3A0B E;  3W68 A;  3B71 A;  3Q5R A;  3TK1 A;  2OYO A;  1J1D C;  2W8Z A;  3M0D A;  3CMA P;  1GW3 A;  5L8R J;  3L71 J;  4D6T E;  3L70 D;  1AJY A;  2FXP A;  1JNM A;  3T97 B;  4L74 A;  1YIT P;  5KAF E;  2H89 C;  4H13 B;  1PGQ A;  1YJN P;  3A0B H;  2WPR A;  3MP7 B;  3HUS A;  4JYC A;  3V2R A;  5APY A;  1N7S B;  3U1A A;  1JY2 O;  4I7Z B;  1A02 F;  1PFI A;  2IBZ D;  1Q90 D;  2FFD C;  1GZL A;  4I2L C;  3H32 A;  1X8Y A;  5KAF H;  2C0X A;  1SQB K;  4I6M C;  4L76 A;  3Q2Y A;  2J5U A;  3VYI A;  1NTZ K;  1SQV J;  2KI7 B;  3AEB C;  1SVF A;  1S4X A;  3L73 J;  5CHX A;  1BSH A;  1NGM B;  3RK3 C;  1SS1 A;  1QGK B;  1ZLL A;  2WWW A;  1NU1 K;  1HUC A;  3CPW O;  1ZP0 C;  3M9H A;  4BWN A;  1WMK A;  1KN7 A;  3WUU A;  2O1K A;  2JJL A;  3UIA A;  4BXL A;  2R3S A;  3KXD A;  4DT0 A;  1GL2 D;  1FAV A;  4GIF A;  1MFT A;  1PGO A;  3BRV B;  5BU5 A;  1BE3 J;  3CCL P;  1JY3 N;  1GL2 C;  3KZI E;  2ZXE B;  2K9Y A;  3CC2 P;  3M9B A;  1Q86 Q;  1CSB A;  4KT0 J;  2B89 A;  4XFJ A;  3M06 A;  1YJW P;  5AVV B;  2Q6Q A;  3L72 E;  3CI9 A;  2R44 A;  4H44 D;  1X0T A;  1UII A;  3F5H A;  3E1I A;  1H8A A;  1KYO D;  5AVS B;  5B5E E;  2QJP C;  2QG4 A;  1BCC J;  4H44 C;  2KYV A;  1EXI A;  1EZV I;  3KZI H;  3RBZ A;  4A7P A;  3H1I E;  4ZKU A;  3L72 G;  3FWN A;  1KV4 A;  1IZN B;  1HWT C;  2KNC A;  1IFN A;  2KS1 A;  3JC2 2;  3L75 J;  1LTA C;  4N78 E;  3AE4 C;  1OVR A;  1PIX A;  1IFD A;  2WTY A;  3TGU G;  2PAJ A;  4BRY B;  5B5E H;  2CPS A;  1SQQ K;  3H1I G;  1PPJ E;  3U1C A;  1QL2 A;  1VQ7 P;  2M0B A;  3L36 A;  5CBN A;  3Q1M A;  3O6Q B;  3LW5 J;  2Q5U A;  3H1J J;  2AEM A;  2Q3I A;  3G71 P;  4ASW A;  1S3J A;  2NZ2 A;  2G3A A;  1LJ2 A;  4O9B A;  2QJK C;  3TNU B;  2P10 A;  3H25 A;  1KZU B;  3NFQ A;  4H44 B;  1K05 A;  2AXC A;  3H1H J;  3GHG A;  2B87 A;  2QEX P;  1M7L A;  1W2E A;  5CCG A;  1LWU C;  3B5N D;  4NPD A;  1KIL A;  1GU4 A;  5CCH A;  1TU3 F;  2JWA A;  2XNX A;  1NAF A;  1G2C B;  2QM8 A;  3B5N C;  1VQ5 P;  1BGY G;  5AVZ B;  2FYU K;  1IFP A;  4Y99 C;  1RF1 B;  1BE3 E;  5AVU B;  2R32 A;  4ZNC A;  1FZG A;  3FXD A;  1N2D C;  3NMD A;  2HG5 D;  3V2Q A;  4Y28 J;  1NTM D;  1MKM A;  1DIP A;  2FY8 A;  1JO5 A;  1NU1 J;  3L70 E;  1L0N D;  2D2C B;  2K3R A;  4D6T D;  2KSE A;  3D71 A;  3PHL A;  1T2K D;  2I8D A;  3RL0 D;  3V4Q A;  2O01 J;  2Z4E A;  3VMX A;  2MJZ A;  4EOT A;  5TIS E;  2QJK B;  4I1L A;  2XV5 A;  1U7M A;  1PL5 A;  2GA1 A;  1QL1 A;  1T2K C;  3RL0 C;  3AE3 C;  3L70 G;  3TF5 A;  3M9Q A;  2OYH C;  2IBZ E;  1PP9 J;  2LR2 A;  4BRY A;  1GW4 A;  5CMZ A;  4WY4 D;  1Q7Y Q;  1R8E A;  2NPS A;  3BAS A;  1G1I A;  3IF4 A;  1T6A A;  1YYC A;  2HOD A;  1AV1 A;  3O6Q A;  1NTK J;  3CWB J;  4WY4 C;  5TIS H;  3RK3 E;  3GF3 A;  2IBZ G;  1RE4 C;  3M0D C;  5AVT B;  2JP3 A;  3H1K J;  2JR8 A;  1RH5 B;  4IFM A;  3TNU A;  5GTI E;  1LNQ A;  1RF0 C;  2OTL P;  3AE1 C;  1L4A B;  3HD7 B;  5AVY B;  3CL3 D;  5AW5 B;  1Y8A A;  3Q5S A;  3HUS C;  1IO4 A;  1UIX A;  3OAK A;  3PTZ A;  5M1B A;  1SQQ J;  3AE6 C;  3LW5 H;  4NPE A;  1EDL A;  4H0L D;  5AW4 B;  3MUD C;  3H1H E;  5GTI H;  3KHU A;  3SSU A;  2KXP B;  1S5L X;  3WU2 E;  1NJI Q;  3L72 D;  4OWF A;  1Y9B A;  1RF1 A;  1VQN P;  1KYO E;  1LP1 A;  3RK2 D;  5DJT B;  1FE6 A;  1NH4 A;  2IYP A;  3RK2 C;  2KSJ A;  5TJH A;  4UB8 E;  4DJG A;  3WU2 H;  1FZC B;  3L71 D;  1X79 B;  3FX0 A;  1KYO H;  5KAI E;  1JY2 N;  2YMK A;  2YKP A;  2WSC J;  1ZV8 A;  3I56 P;  3IN6 A;  4IOI H;  2OAR A;  1LT9 C;  3AED C;  1PPJ D;  3R2P A;  2LXB A;  1E79 H;  4EDF A;  2FYU J;  5AW0 B;  4UB8 H;  3H1L J;  1PP9 E;  2M3E A;  1HGV A;  4WBA A;  1XTC C;  4RJT A;  1KMI Z;  4U3F J;  1RE3 A;  5KAI H;  1OX3 A;  2WSE H;  2N1T D;  2HPC B;  2IZ1 A;  4IFD K;  4H0L B;  2OGU A;  1KB9 D;  1NTK E;  2Y0D A;  1SQP K;  2KZI A;  2XZR A;  1DH3 A;  1S2E A;  4PV1 D;  1AA0 A;  1SQV D;  2WT7 A;  5KJ7 A;  2ZT9 D;  3L37 A;  4WB4 A;  3L73 D;  1HJ0 A;  5APV A;  3H1K E;  1IFI A;  1L4A A;  4PV1 C;  3JCU E;  1GK4 A;  4QMA A;  1Q2N A;  3V5B A;  2GUS A;  2WSF J;  3ITK A;  2B88 A;  2H88 C;  3I55 P;  3KDP B;  2BEQ D;  1J1E B;  4CPG A;  4XA4 A;  1DEE G;  3VP9 A;  1LT9 B;  2P1J A;  3WUV A;  3JCU H;  1BE3 D;  1NTM E;  1ZME C;  2W6A A;  3BRT B;  1L0N E;  1K73 Q;  1OFC X;  3TDK A;  3GLM A;  2H7H A;  1FOS F;  4OGQ B;  3VTP C;  4JBZ A;  2LKM A;  4KJM A;  3A3Y B;  1URQ A;  4YPC A;  1GU5 A;  1NTM G;  1ZOY C;  2N9B A;  4JYB A;  1L0N G;  1BCC D;  2P7J A;  3GHG C;  2N1T B;  2HYN A;  2R5D A;  4D6T G;  1JUN A;  4PJ0 E;  2KLV A;  4HB1 A;  2IBZ I;  2M5A B;  2AEF A;  3VMZ A;  2ZT9 B;  4YXW H;  3CCJ P;  3L75 D;  3B8E B;  1SQX K;  2Q7C A;  1FDI A;  1KQS O;  3RK3 D;  5DJU B;  5KLV J;  2ZVN B;  1GMJ A;  1P84 D;  1AQT A;  4PJ0 H;  1CW5 A;  3H1J D;  3H1L E;  2G8Y A;  1J1D B;  2V7Q J;  1VQL P;  2XU6 A;  1SFC A;  2HLO A;  3S4R A;  1N73 A;  3CCQ P;  3EQ2 A;  2C9L Y;  1WT6 A;  1EDJ A;  2WSC H;  2K37 A;  2Q9I A;  3BAT A;  2OTK E;  2JO1 A;  1H88 A;  1YJ9 P;  4YTP C;  2ZFC A;  1VF5 C;  1M90 Q;  2IPP A;  1LGH B;  1LTT C;  1OXZ A;  3AEC C;  3H1H D;  2FFD B;  3HE5 A;  3MHV A;  2K9J B;  3AEE C;  3EWK A;  2L5G B;  3CX5 E;  5AW1 B;  1SQP J;  1JB0 J;  1KYO I;  1L0L J; 
#chains in the Genus database with same CATH homology
 1QX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...