1QX8A

Crystal structure of a five-residue deletion mutant of the rop protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
47
structure length
47
Chain Sequence
EKTALNMARFIRSQTLTLLEKLNELADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein ROP
publication title Loopless Rop: structure and dynamics of an engineered homotetrameric variant of the repressor of primer protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 21
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Regulatory protein rop 1qx8A00
1QX8A
chains in the Genus database with same CATH superfamily
1AV1A 3KZIH 1VF5B 1KN7A 4D6TD 1JY2P 2M8RA 1IFPA 1BE3J 1KB9I 3W68A 1GD2E 4C7RA 3I55P 2C9NY 4WY4D 2BASA 2IZ1A 2K9JA 5K5GB 4KT0J 1H8AA 2NPSB 2WZ7A 3AEBC 4I7ZB 1NAYA 3FXEA 2A45H 4PV1C 1SQXK 3FWNA 3CCVP 3RBXA 1M7LA 4UB8H 3PRJA 2E75D 1K8AQ 1URQD 2FYUJ 4IFDK 2ZXEB 2XV5A 3V2PA 2O1KA 2P10A 1NJIQ 3PP5A 2I1JA 2H88C 3VMXA 2P1JA 2CPBA 1OMIA 2A06D 4CPGA 2OYIB 3CC4P 1RF0C 4U3FE 3HE4B 3VN0A 1AFOA 3SFEC 1SQQK 5KLIB 5CHXA 1PV3A 3JC22 5KLVK 3TF5A 1M1JB 2QJYC 3M0DC 1FDOA 5AW0B 1EZVD 3H1LD 2E76D 3UIAA 3CCMP 1ZP0C 1GL2B 3P8MC 3RL0B 2W8ZA 3AE5C 1ZOYC 2E43A 1T8ZA 3H1ID 1ZLLA 1EXJA 3AE7C 2IFMA 1BDDA 1PIXA 3PJSK 2WQYC 3U1CA 1RE4A 1NTZG 2W6JH 4YXWH 3A2AA 2NRGA 3CCRP 3L4FA 3KPEA 3GLMA 3G71P 1Q82Q 3C8VA 2Z4EA 2G3AA 3P8CE 1SQQJ 2OQQA 3A0HH 3GMAA 1LTJC 1RE4C 3KHUA 5AVQB 2OYHB 2ZYAA 1YYCA 4PD4H 1JTHA 1IK9A 2K3RA 3AE1C 2B89A 1CW5A 2QSIA 2HLOA 5TISE 3SWFA 1W5CE 1SFCC 4OGQC 1KYOD 4UB6H 4HKZH 2JDIH 2FYNC 5CCGA 2IX7C 3FWLA 3L75D 2Y0DA 3HD7B 1IK7A 4NPFX 1L0LK 1LP1B 1ZR2A 3B71A 4C46A 2YXRB 3BATA 3RL0g 4Y99B 1U7JA 1AVYA 5B66H 2O01N 4WY4C 2AXTH 1KFNA 1LNQA 2OYIA 5APSA 4BRYB 3HE4A 1QVFO 3L71E 1G1JA 1UIXA 1N8RQ 1M1JA 2KS1B 3Q1MA 2ZVOB 5KJ7D 4DCKA 1GL2A 2E75C 2L5GB 1FC2C 3TSIA 4IFMA 3AE9C 2ZYDA 4AUWA 3I56P 3G3ZA 1Q86Q 3N7NA 1J1DC 3H25A 1JUNA 3LIEA 4BWNA 1BSNA 3HUSC 3H1LJ 5E79H 1EC5A 1NH4A 1DEBA 3QWOC 1L0LJ 4B86A 2YNYA 1WRGA 3L72G 3A5TA 3CCJP 1QL1A 3CD6P 1LJ2A 1J1EB 2E74B 1VQLP 2E76C 3GF7A 5KKZC 2QE7H 1SQBE 3F5HA 3FXDA 1KTMA 1VQKP 3B5ND 1NTKD 1ZRTD 3OAKA 4HYTB 1L2PA 2OYHA 3CWBD 5CJ0A 3M9HA 1MZ9A 1Q81Q 2WVRA 1JB0J 3MUDA 1XTGB 4Z1MH 3WMM0 2KYVA 1JY2N 1VQ4P 5APYA 3L74D 2IBZE 2N1TD 1BE3E 4N6JA 1W2BO 4N78E 2J5UA 3L73J 1SQBG 2GUSA 3P7KA 1TU3F 2FXOA 4W7ZA 5AW6B 1FZBA 1NU1K 3HD7A 1PP9J 1YIJP 1LP1A 1HVVA 1D7MA 1DIPA 2E42A 4JPZB 3RK3E 2BEZF 1FAVA 1HF9A 1MFZA 1FZCB 1LWUC 1NTMK 3Q5SA 4HJGH 4BRYA 3IF4A 1BE3G 2QRXA 2N9BA 2YKPA 2OTKE 3V2QA 1K73Q 2KS1A 2AEJA 3BVHA 2H89C 2IBZD 1SS1A 2K88A 1NKNA 3H1KD 1VDFA 2OARA 4N78D 4PV1B 4PJ0E 1T3JA 5B5EH 3CI9A 2QJKC 3NXSA 1PPJG 2KNCB 2JEEA 3D71A 3CX5I 3WUUA 5B66E 3IR9A 3MIWA 3CCLP 2JWAA 4PD4D 5AVTB 1LTIC 3KDPB 3TK1A 3E1IA 3D6YA 2FYUD 4H44B 3JCUH 5KAIH 2ZVNB 5KJ7C 2C0WA 2PAJA 5CCHD 1GMJA 4WVZA 1PGJA 2HODB 3Q2YA 2QJYB 1SQPK 1GTWA 3OW2O 2MKVA 3ZDMA 1SQQE 5AVVB 1HJBA 1E79H 3F89A 5EFWB 1LGHB 2QM7A 1HBWA 4TT3H 1KC8Q 4Y28J 1NTKJ 4EI2A 2QA4P 1SQXD 3V6IA 3CWBJ 4GDOA 4MN4C 2IFNA 1RE3A 5APQA 1RH5B 2LXBA 2ZT9D 4LLHA 2Y9ZA 1X22A 3MHVA 3B5NC 3M91A 1A02F 3L74J 2YMYA 3VMYA 1FDMA 1L0ND 1FZCA 4K3AA 2OYOA 1SQVK 2W6AA 1LTJB 2R5BA 3M9QA 2ZXXA 3CMAP 5KAFH 4O9BA 2QM8A 3BASA 2K37A 5KLVD 4HH2A 1BGYD 3CL3D 4IFFA 1SFCB 4OGQB 2AEFA 5GTIE 3L70J 2KSJA 3G6EP 4U7JA 5AVZB 4D6TG 2AEMA 2KNCA 4IL6E 1MV8A 2FYNB 5AW5B 5CJ4A 1ZR4A 1G2CA 2A06E 3HRNA 4EOTA 1KQFB 3H1KJ 1RQVA 1JTHB 1VF5D 4W80A 3H1JJ 1H0TA 1QVGO 3CMEP 2W90A 1EZVE 3H1LE 2QIWA 3U59A 1JY3O 2R3SA 1RF0A 2NPSD 3RGUA 1L0LE 1KV4A 5APVA 1SQVJ 3H6PA 5AW9B 2HODA 1P84I 3QH9A 3H1IE 2AXCA 2WT7B 3GG2A 3M0DA 4GKGA 1NGMB 3MD0A 4L75A 1UIIA 1MFTA 2E75B 2YKQA 1HGVA 1L0NK 3V4WA 1JY3P 3RK3C 2G8YA 2FXPA 1J1DB 1JO5A 5KAIE 3S1KA 1CZQA 3AEEC 1EZVG 3H1LG 3SSUA 3Q5PA 2QEXP 5CCHC 5H2FH 2KLVA 2B88A 3H1IG 2JJLA 1S2EA 1VQMP 1L0LD 3MTUE 1PGQA 2E76B 5KKZB 1WMKA 1SQXJ 3P32A 2Y0EA 1FZEA 2GM4A 1IFIA 1PFIA 1OVUA 1LTJA 2K1AA 3E1RA 3AEDC 4U3FG 3CCEP 3EQ2A 1KYOE 1USEA 3CX5H 1N86A 1NO4A 4EYYQ 1GDTA 1L0NJ 4H13C 3L75E 5BU8B 1S1CX 2ZT9C 1SFCA 2YO2A 3A0BH 2K9YA 1R5LA 4RESB 3AE8C 1CI6A 2KI7B 2Y0CA 4H0LB 3KYQA 5KLVJ 3D6ZA 1H89A 2OGUA 1BGYJ 1IZNB 2VRSA 3L73D 2WSCH 1PP9D 2PRRA 2O3JA 2V4HA 3T97B 3E7KA 1N7SD 2Q1KA 3L37A 3Q3DA 4WY4A 1AA0A 3TNUA 3L75G 1T3UA 1LT9C 2BEQD 1FZGA 3BCCJ 2WT7A 1GW3A 3PHLA 1L4AD 3KZIE 3S9OA 2ZAEB 1MUUA 1URQA 3G4SP 1KILD 3RK2D 1VF5C 1VQ7P 3HUSA 1EDJA 2HFED 3O6QA 2NPSC 2C9LY 3AE3C 4I7ZC 5C39A 4UB8E 1R5SA 2ZFCA 1NTKE 1ZRTE 2YO3A 1FOSE 1NU1D 1URQC 2FKWB 1VL2A 2R32A 3CWBE 1IFNA 2ZJSE 1FS0E 3LIDA 1S9KD 1YJ9P 1NTZK 3BRVB 1YBKA 4LC1A 1KD1Q 1NTMD 3L74E 4OWFA 2O1JA 2A45G 1S5LX 2N9YB 3L71G 4JBZA 1HH0A 1YI2P 1LTAC 3HTKB 1K04A 5CMZA 5H2FE 1W2EA 4IOIH 2KK7A 1KB9H 2XKMA 3NTNA 5KLIC 3CXHI 1S5LH 1NTKG 3CCSP 2D2CD 4JQ0D 4K35A 1DD3A 3M0AA 3CWBG 2E74D 2FFDA 1OX3A 1N73A 3L70E 3L74G 3B5NB 4DT0A 2O01H 1K9MQ 1P84H 4AYCA 3AE2C 1JMMA 3IFMA 2B9BA 3T97A 2RKLA 1AQTA 1LWUA 2BCCD 1NTZJ 1HJ0A 3H1KE 1HUCA 2FFDC 1R8EA 3H1JE 5CBOA 3V2RA 1YQ3C 3LW5H 3A0HE 1N73C 1RHZB 1SQPD 4R4MA 2FBWC 1M1KQ 1QX8A 2KZJA 3I5CA 1SQVE 4RJTA 3NFQA 4PD4E 1VQ8P 2JWDA 1MKMA 2FYUE 1ZW0A 2YIUC 4AQRD 1BSHA 1BCCD 4BXLA 1IO4A 3L70D 2IBZG 4HB1A 1HWTC 1JY3N 1N7SC 1YQ4C 4OH8B 3H1KG 3GHGC 3CX5D 4UB6E 4JF7A 2KZIA 1QL2A 1KZUB 3B4SA 3C9IA 5CBNA 5KJ7A 1IFJA 1S72P 1M57D 1L4AC 2Z5IA 3K5BA 3H1JD 3WUTA 1AJYA 3ITKA 3OJAB 3EFFK 2FYUG 5AVXB 3PH0A 4XFJA 2WSFJ 1KILC 1G2CB 2PP6A 3RK2C 2AXTE 5M1BA 1N7LA 1SQVD 3V2NA 2W6BA 1NU1J 1GZLA 1OFCX 1X9VA 2RH0A 1SQXE 3WU2H 2PGDA 1OIPA 2OTJP 3V5BA 1H0TB 3RK3B 1FJKA 3HTKA 1FDIA 2L91A 2I8DA 2IBZI 4H44D 2WITA 1NTMJ 1K05A 1PL5A 4DOJA 2B87A 5AW3B 3AE6C 3MP7B 3TDKA 2Q3EA 1L0NE 1NWQA 2Y9YA 1EDIA 2HPCA 2KLUA 4YXDC 2FXMA 5E79E 3B5NA 4KHXA 2QG4A 1BDCA 1RQUA 2FY8A 1SQXG 5KLVE 5GTHH 1SLQA 1VQNP 1SQBK 1BGYE 1KB9E 1JM0A 1NKZB 2RN0A 2D2CC 2N1TA 3L72J 2XZRA 3TGUD 1YJNP 4H13B 2ZT9B 2XU6A 1VQPP 4NPEA 5AVSB 2BCCJ 5APTA 2Q3IA 3BCCE 4WWIA 3D70A 2R44A 1SQQG 2QJPC 2C0XA 1NYHA 2YKOA 5KLVG 2E5YA 3PLNA 1WT6A 3H1HD 2JP3A 2N1TC 1SQPJ 2R3CA 3PTZA 3H32A 2WSFH 2W27A 4R4LA 1GK6A 1EXIA 2FYZA 1KB9D 4GIFA 1BCCJ 1LTGC 2CPSA 1JCDA 1LT9B 4RKUJ 1GW4A 5TISH 2WWWA 1CI6B 1DEEG 2KSEA 4JYBA 3CXHH 4L76A 2J58A 1JOCA 1P84D 3BCCD 1T6AA 5APUA 3JSVC 4W7YA 2E5TA 2KP8A 1YJWP 1VQ5P 4XE5B 4WY4B 3TNUB 2M3EA 3C1LA 1OVRA 5B5EE 3W67A 3HE5A 2JKVA 2WSCJ 1RF1C 2P2UA 5CCHA 4ZMDA 1FU1A 4GOFA 5AW1B 5CCGD 2A06G 4NPDA 1URQB 5AVYB 3CC2P 2M5AB 1KMIZ 3CCQP 3WU2E 3JCUE 1FE6A 2H8PD 2WSSH 3HUSB 3O8ZA 1KFMA 3U1AA 3O6QB 1QGKB 4H44C 1L0LG 1IJDB 5AVUB 3R4YA 1KORA 5DJTB 1KQLA 1LT1A 1FBMA 2WPVB 3EWKA 1NTZE 2P58A 1G1IA 1SVFA 4C7NB 3L73E 1GL2D 2OTLP 3RL0D 1FZFA 2IYOA 1PP9E 5BU5A 3OA7A 1VQOP 3TGUJ 5GTHE 4TLFA 1T2KD 1RY3A 2Q7CA 1PGPA 2V7QH 3RBZA 1EQ7A 1YITP 1IC2A 1GK4A 1EZVI 3GF3A 4XA4A 5L8RJ 3SFDC 1LT9A 2Z5HA 2FFDB 3H1HJ 3L73G 5BVZA 4OVNF 1EDLA 1KILE 1NTZD 4U3FD 3V4QA 1PP9G 2Q6QA 1N73B 3SWKA 4H0LD 4L73A 5KAFE 3CC7P 3GW6A 2HG5D 3G9RA 3FGAD 1LWUB 2YIUB 4YTPC 1VPCA 5AVWB 4YPCA 1NU1E 1N7SB 3B8EB 2O01J 3GHGB 2NPSA 1S9KE 2CK3H 3CXHE 1X79B 1KQSO 2WTYA 1Y9BA 1JCCA 1NTME 3VMZA 3HD7D 4D6TJ 1LTSC 1L4AB 2M5AA 3WUVA 5APXA 2QJKB 3M06A 2HR3A 3A3YB 4I1LA 1KILB 3LW5J 4PJ0H 3RK2B 1IFMA 1Y47A 3P8CD 1YHQP 1CSBA 1NU1G 1KYOI 4I6MC 1Q2NA 3VTPC 3KXDA 2W83C 1VQ9P 2XNDH 2I1KA 2R5DA 1NTMG 3L72E 5CCGC 4C7NA 3VP8A 1HTLC 1EDKA 3CXHD 2J59M 1NVOA 2Q9IA 1S3JA 1NAFA 1FZAA 1Y8AA 2BCCE 2ITAA 3L36A 2H43A 2OYIC 2M0BA 2WPSA 1YTZT 2XNXA 3AE4C 1SQPE 1JNMA 1M1JC 1OVVA 4I2LC 2KXPB 1GU5A 3VYIA 2P7JA 2B87B 1PGOA 3NMDA 1JEKA 2D2CB 4QMAA 1XTCC 3H1IJ 2HPCB 1GL2C 3RL0C 4RO0A 2WSEJ 3AECC 1BCCE 2IDBA 3L71D 2GUVA 3L72D 2KIKA 1DX7A 3MZWB 1J2JB 1N2DC 2BCCG 1T2KC 3CX5E 2MJZA 4KJMA 2QJPB 4GT1A 1M56D 2GA1A 4JYCA 4U3FJ 2A45I 1N7SA 3A0BE 1SQPG 4GOEA 2N1TB 3GHGA 2Q5UA 5AW8B 3CPWO 3VOPA 1X0TA 2JO1A 1PZQA 4ZNCA 2IYPA 1BCCG 4ZKPA 3L70G 4WB4A 3MGNA 1L4AA 2SPZA 3FX0A 4H0LC 1Q90D 5KTBA 4IL6X 1S4XA 4WBAA 2OYHC 5GTIH 1KILA 3N4XA 2KB7P 2KUBA 3USSA 1SQBD 3H32B 1Q7YQ 1PPJE 3MUDC 1OXZA 4IL6H 3H1JG 5TJHA 3BRTB 5AW4B 2IPPA 1NOHA 1OW6A 4A7PA 3L75J 4ZKUA 1Z56A 1SQVG 1GU4A 3CCUP 1USDA 2POHA 3HD7C 1OWAA 1DD4A 4PV1D 1RF1B 1HGZA 1BE3D 3VMAA 2LXCB 2RMZA 4Y99C 3IN6A 1NTKK 1OW8A 2WSEH 3TGUE 3TYYA 4EIJA 4L74A 1PPJD 3RK3D 1ZV8A 2NZ2A 3EFGA 1E5WA 2K9JB 2KOGA 3Q5RA 1FOSF 3HE5B 2XDJA 2UWJE 3AEAC 3R2PA 2P67A 3CLQA 3H1HE 3M9BA 1OW7A 4PD4I 1OZHA 5AW7B 2PFXA 2WPQA 3VP9A 1SP4A 2IZ0A 3IAOA 1M8OB 2ZYGA 1NHLA 3TGUG 4ASVA 1U57A 1ZN5A 1S5LE 3L71J 1H88A 2DW3A 4N3YB 4DZOA 1ZXGA 5AVRB 2YXQB 4GODA 4DJGA 1J1EC 2E74C 1L0NG 2JR8A 3AEFC 1KYOH 1AVOA 1P84E 1X8YA 3H1HG 4H13D 3S4RA 2WPRA 5APWA 2H7HA 1VQ6P 1YTZI 5DJUB 2WMMA 5AW2B 2YMKA 1JMBA 1BGYG 4D6TE 1KQGB 1DH3A 1FJPA 1LTBC 1LTTC 1QEXA 4M3LA 1M90Q 3AEGC 2M3BA 3KQGA 4LGDE 2FYUK 4ASWA 1IFDA 1SQQD 1RE3C 1SQBJ 3ABVC 1SFCD 4OGQD 2V7QJ 1A02J 3BCCG 1JY2O 3A7OA 1RF1A 3SWYA 2LKMA 1QLED 1ZMEC 1AQ5A 2LR2A 1U7MA 3L35A 2QVAA 1FZCC 4EDFA 2HYNA 3II6A
chains in the Genus database with same CATH topology
1QX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX8 A; 
#chains in the Genus database with same CATH topology
 1AV1 A;  3KZI H;  1VF5 B;  1KN7 A;  4D6T D;  1JY2 P;  2M8R A;  1IFP A;  1BE3 J;  1KB9 I;  3W68 A;  1GD2 E;  4C7R A;  3I55 P;  2C9N Y;  4WY4 D;  2BAS A;  2IZ1 A;  2K9J A;  5K5G B;  4KT0 J;  1H8A A;  2NPS B;  2WZ7 A;  3AEB C;  4I7Z B;  1NAY A;  3FXE A;  2A45 H;  4PV1 C;  1SQX K;  3FWN A;  3CCV P;  3RBX A;  1M7L A;  4UB8 H;  3PRJ A;  2E75 D;  1K8A Q;  1URQ D;  2FYU J;  4IFD K;  2ZXE B;  2XV5 A;  3V2P A;  2O1K A;  2P10 A;  1NJI Q;  3PP5 A;  2I1J A;  2H88 C;  3VMX A;  2P1J A;  2CPB A;  1OMI A;  2A06 D;  4CPG A;  2OYI B;  3CC4 P;  1RF0 C;  4U3F E;  3HE4 B;  3VN0 A;  1AFO A;  3SFE C;  1SQQ K;  5KLI B;  5CHX A;  1PV3 A;  3JC2 2;  5KLV K;  3TF5 A;  1M1J B;  2QJY C;  3M0D C;  1FDO A;  5AW0 B;  1EZV D;  3H1L D;  2E76 D;  3UIA A;  3CCM P;  1ZP0 C;  1GL2 B;  3P8M C;  3RL0 B;  2W8Z A;  3AE5 C;  1ZOY C;  2E43 A;  1T8Z A;  3H1I D;  1ZLL A;  1EXJ A;  3AE7 C;  2IFM A;  1BDD A;  1PIX A;  3PJS K;  2WQY C;  3U1C A;  1RE4 A;  1NTZ G;  2W6J H;  4YXW H;  3A2A A;  2NRG A;  3CCR P;  3L4F A;  3KPE A;  3GLM A;  3G71 P;  1Q82 Q;  3C8V A;  2Z4E A;  2G3A A;  3P8C E;  1SQQ J;  2OQQ A;  3A0H H;  3GMA A;  1LTJ C;  1RE4 C;  3KHU A;  5AVQ B;  2OYH B;  2ZYA A;  1YYC A;  4PD4 H;  1JTH A;  1IK9 A;  2K3R A;  3AE1 C;  2B89 A;  1CW5 A;  2QSI A;  2HLO A;  5TIS E;  3SWF A;  1W5C E;  1SFC C;  4OGQ C;  1KYO D;  4UB6 H;  4HKZ H;  2JDI H;  2FYN C;  5CCG A;  2IX7 C;  3FWL A;  3L75 D;  2Y0D A;  3HD7 B;  1IK7 A;  4NPF X;  1L0L K;  1LP1 B;  1ZR2 A;  3B71 A;  4C46 A;  2YXR B;  3BAT A;  3RL0 g;  4Y99 B;  1U7J A;  1AVY A;  5B66 H;  2O01 N;  4WY4 C;  2AXT H;  1KFN A;  1LNQ A;  2OYI A;  5APS A;  4BRY B;  3HE4 A;  1QVF O;  3L71 E;  1G1J A;  1UIX A;  1N8R Q;  1M1J A;  2KS1 B;  3Q1M A;  2ZVO B;  5KJ7 D;  4DCK A;  1GL2 A;  2E75 C;  2L5G B;  1FC2 C;  3TSI A;  4IFM A;  3AE9 C;  2ZYD A;  4AUW A;  3I56 P;  3G3Z A;  1Q86 Q;  3N7N A;  1J1D C;  3H25 A;  1JUN A;  3LIE A;  4BWN A;  1BSN A;  3HUS C;  3H1L J;  5E79 H;  1EC5 A;  1NH4 A;  1DEB A;  3QWO C;  1L0L J;  4B86 A;  2YNY A;  1WRG A;  3L72 G;  3A5T A;  3CCJ P;  1QL1 A;  3CD6 P;  1LJ2 A;  1J1E B;  2E74 B;  1VQL P;  2E76 C;  3GF7 A;  5KKZ C;  2QE7 H;  1SQB E;  3F5H A;  3FXD A;  1KTM A;  1VQK P;  3B5N D;  1NTK D;  1ZRT D;  3OAK A;  4HYT B;  1L2P A;  2OYH A;  3CWB D;  5CJ0 A;  3M9H A;  1MZ9 A;  1Q81 Q;  2WVR A;  1JB0 J;  3MUD A;  1XTG B;  4Z1M H;  3WMM 0;  2KYV A;  1JY2 N;  1VQ4 P;  5APY A;  3L74 D;  2IBZ E;  2N1T D;  1BE3 E;  4N6J A;  1W2B O;  4N78 E;  2J5U A;  3L73 J;  1SQB G;  2GUS A;  3P7K A;  1TU3 F;  2FXO A;  4W7Z A;  5AW6 B;  1FZB A;  1NU1 K;  3HD7 A;  1PP9 J;  1YIJ P;  1LP1 A;  1HVV A;  1D7M A;  1DIP A;  2E42 A;  4JPZ B;  3RK3 E;  2BEZ F;  1FAV A;  1HF9 A;  1MFZ A;  1FZC B;  1LWU C;  1NTM K;  3Q5S A;  4HJG H;  4BRY A;  3IF4 A;  1BE3 G;  2QRX A;  2N9B A;  2YKP A;  2OTK E;  3V2Q A;  1K73 Q;  2KS1 A;  2AEJ A;  3BVH A;  2H89 C;  2IBZ D;  1SS1 A;  2K88 A;  1NKN A;  3H1K D;  1VDF A;  2OAR A;  4N78 D;  4PV1 B;  4PJ0 E;  1T3J A;  5B5E H;  3CI9 A;  2QJK C;  3NXS A;  1PPJ G;  2KNC B;  2JEE A;  3D71 A;  3CX5 I;  3WUU A;  5B66 E;  3IR9 A;  3MIW A;  3CCL P;  2JWA A;  4PD4 D;  5AVT B;  1LTI C;  3KDP B;  3TK1 A;  3E1I A;  3D6Y A;  2FYU D;  4H44 B;  3JCU H;  5KAI H;  2ZVN B;  5KJ7 C;  2C0W A;  2PAJ A;  5CCH D;  1GMJ A;  4WVZ A;  1PGJ A;  2HOD B;  3Q2Y A;  2QJY B;  1SQP K;  1GTW A;  3OW2 O;  2MKV A;  3ZDM A;  1SQQ E;  5AVV B;  1HJB A;  1E79 H;  3F89 A;  5EFW B;  1LGH B;  2QM7 A;  1HBW A;  4TT3 H;  1KC8 Q;  4Y28 J;  1NTK J;  4EI2 A;  2QA4 P;  1SQX D;  3V6I A;  3CWB J;  4GDO A;  4MN4 C;  2IFN A;  1RE3 A;  5APQ A;  1RH5 B;  2LXB A;  2ZT9 D;  4LLH A;  2Y9Z A;  1X22 A;  3MHV A;  3B5N C;  3M91 A;  1A02 F;  3L74 J;  2YMY A;  3VMY A;  1FDM A;  1L0N D;  1FZC A;  4K3A A;  2OYO A;  1SQV K;  2W6A A;  1LTJ B;  2R5B A;  3M9Q A;  2ZXX A;  3CMA P;  5KAF H;  4O9B A;  2QM8 A;  3BAS A;  2K37 A;  5KLV D;  4HH2 A;  1BGY D;  3CL3 D;  4IFF A;  1SFC B;  4OGQ B;  2AEF A;  5GTI E;  3L70 J;  2KSJ A;  3G6E P;  4U7J A;  5AVZ B;  4D6T G;  2AEM A;  2KNC A;  4IL6 E;  1MV8 A;  2FYN B;  5AW5 B;  5CJ4 A;  1ZR4 A;  1G2C A;  2A06 E;  3HRN A;  4EOT A;  1KQF B;  3H1K J;  1RQV A;  1JTH B;  1VF5 D;  4W80 A;  3H1J J;  1H0T A;  1QVG O;  3CME P;  2W90 A;  1EZV E;  3H1L E;  2QIW A;  3U59 A;  1JY3 O;  2R3S A;  1RF0 A;  2NPS D;  3RGU A;  1L0L E;  1KV4 A;  5APV A;  1SQV J;  3H6P A;  5AW9 B;  2HOD A;  1P84 I;  3QH9 A;  3H1I E;  2AXC A;  2WT7 B;  3GG2 A;  3M0D A;  4GKG A;  1NGM B;  3MD0 A;  4L75 A;  1UII A;  1MFT A;  2E75 B;  2YKQ A;  1HGV A;  1L0N K;  3V4W A;  1JY3 P;  3RK3 C;  2G8Y A;  2FXP A;  1J1D B;  1JO5 A;  5KAI E;  3S1K A;  1CZQ A;  3AEE C;  1EZV G;  3H1L G;  3SSU A;  3Q5P A;  2QEX P;  5CCH C;  5H2F H;  2KLV A;  2B88 A;  3H1I G;  2JJL A;  1S2E A;  1VQM P;  1L0L D;  3MTU E;  1PGQ A;  2E76 B;  5KKZ B;  1WMK A;  1SQX J;  3P32 A;  2Y0E A;  1FZE A;  2GM4 A;  1IFI A;  1PFI A;  1OVU A;  1LTJ A;  2K1A A;  3E1R A;  3AED C;  4U3F G;  3CCE P;  3EQ2 A;  1KYO E;  1USE A;  3CX5 H;  1N86 A;  1NO4 A;  4EYY Q;  1GDT A;  1L0N J;  4H13 C;  3L75 E;  5BU8 B;  1S1C X;  2ZT9 C;  1SFC A;  2YO2 A;  3A0B H;  2K9Y A;  1R5L A;  4RES B;  3AE8 C;  1CI6 A;  2KI7 B;  2Y0C A;  4H0L B;  3KYQ A;  5KLV J;  3D6Z A;  1H89 A;  2OGU A;  1BGY J;  1IZN B;  2VRS A;  3L73 D;  2WSC H;  1PP9 D;  2PRR A;  2O3J A;  2V4H A;  3T97 B;  3E7K A;  1N7S D;  2Q1K A;  3L37 A;  3Q3D A;  4WY4 A;  1AA0 A;  3TNU A;  3L75 G;  1T3U A;  1LT9 C;  2BEQ D;  1FZG A;  3BCC J;  2WT7 A;  1GW3 A;  3PHL A;  1L4A D;  3KZI E;  3S9O A;  2ZAE B;  1MUU A;  1URQ A;  3G4S P;  1KIL D;  3RK2 D;  1VF5 C;  1VQ7 P;  3HUS A;  1EDJ A;  2HFE D;  3O6Q A;  2NPS C;  2C9L Y;  3AE3 C;  4I7Z C;  5C39 A;  4UB8 E;  1R5S A;  2ZFC A;  1NTK E;  1ZRT E;  2YO3 A;  1FOS E;  1NU1 D;  1URQ C;  2FKW B;  1VL2 A;  2R32 A;  3CWB E;  1IFN A;  2ZJS E;  1FS0 E;  3LID A;  1S9K D;  1YJ9 P;  1NTZ K;  3BRV B;  1YBK A;  4LC1 A;  1KD1 Q;  1NTM D;  3L74 E;  4OWF A;  2O1J A;  2A45 G;  1S5L X;  2N9Y B;  3L71 G;  4JBZ A;  1HH0 A;  1YI2 P;  1LTA C;  3HTK B;  1K04 A;  5CMZ A;  5H2F E;  1W2E A;  4IOI H;  2KK7 A;  1KB9 H;  2XKM A;  3NTN A;  5KLI C;  3CXH I;  1S5L H;  1NTK G;  3CCS P;  2D2C D;  4JQ0 D;  4K35 A;  1DD3 A;  3M0A A;  3CWB G;  2E74 D;  2FFD A;  1OX3 A;  1N73 A;  3L70 E;  3L74 G;  3B5N B;  4DT0 A;  2O01 H;  1K9M Q;  1P84 H;  4AYC A;  3AE2 C;  1JMM A;  3IFM A;  2B9B A;  3T97 A;  2RKL A;  1AQT A;  1LWU A;  2BCC D;  1NTZ J;  1HJ0 A;  3H1K E;  1HUC A;  2FFD C;  1R8E A;  3H1J E;  5CBO A;  3V2R A;  1YQ3 C;  3LW5 H;  3A0H E;  1N73 C;  1RHZ B;  1SQP D;  4R4M A;  2FBW C;  1M1K Q;  1QX8 A;  2KZJ A;  3I5C A;  1SQV E;  4RJT A;  3NFQ A;  4PD4 E;  1VQ8 P;  2JWD A;  1MKM A;  2FYU E;  1ZW0 A;  2YIU C;  4AQR D;  1BSH A;  1BCC D;  4BXL A;  1IO4 A;  3L70 D;  2IBZ G;  4HB1 A;  1HWT C;  1JY3 N;  1N7S C;  1YQ4 C;  4OH8 B;  3H1K G;  3GHG C;  3CX5 D;  4UB6 E;  4JF7 A;  2KZI A;  1QL2 A;  1KZU B;  3B4S A;  3C9I A;  5CBN A;  5KJ7 A;  1IFJ A;  1S72 P;  1M57 D;  1L4A C;  2Z5I A;  3K5B A;  3H1J D;  3WUT A;  1AJY A;  3ITK A;  3OJA B;  3EFF K;  2FYU G;  5AVX B;  3PH0 A;  4XFJ A;  2WSF J;  1KIL C;  1G2C B;  2PP6 A;  3RK2 C;  2AXT E;  5M1B A;  1N7L A;  1SQV D;  3V2N A;  2W6B A;  1NU1 J;  1GZL A;  1OFC X;  1X9V A;  2RH0 A;  1SQX E;  3WU2 H;  2PGD A;  1OIP A;  2OTJ P;  3V5B A;  1H0T B;  3RK3 B;  1FJK A;  3HTK A;  1FDI A;  2L91 A;  2I8D A;  2IBZ I;  4H44 D;  2WIT A;  1NTM J;  1K05 A;  1PL5 A;  4DOJ A;  2B87 A;  5AW3 B;  3AE6 C;  3MP7 B;  3TDK A;  2Q3E A;  1L0N E;  1NWQ A;  2Y9Y A;  1EDI A;  2HPC A;  2KLU A;  4YXD C;  2FXM A;  5E79 E;  3B5N A;  4KHX A;  2QG4 A;  1BDC A;  1RQU A;  2FY8 A;  1SQX G;  5KLV E;  5GTH H;  1SLQ A;  1VQN P;  1SQB K;  1BGY E;  1KB9 E;  1JM0 A;  1NKZ B;  2RN0 A;  2D2C C;  2N1T A;  3L72 J;  2XZR A;  3TGU D;  1YJN P;  4H13 B;  2ZT9 B;  2XU6 A;  1VQP P;  4NPE A;  5AVS B;  2BCC J;  5APT A;  2Q3I A;  3BCC E;  4WWI A;  3D70 A;  2R44 A;  1SQQ G;  2QJP C;  2C0X A;  1NYH A;  2YKO A;  5KLV G;  2E5Y A;  3PLN A;  1WT6 A;  3H1H D;  2JP3 A;  2N1T C;  1SQP J;  2R3C A;  3PTZ A;  3H32 A;  2WSF H;  2W27 A;  4R4L A;  1GK6 A;  1EXI A;  2FYZ A;  1KB9 D;  4GIF A;  1BCC J;  1LTG C;  2CPS A;  1JCD A;  1LT9 B;  4RKU J;  1GW4 A;  5TIS H;  2WWW A;  1CI6 B;  1DEE G;  2KSE A;  4JYB A;  3CXH H;  4L76 A;  2J58 A;  1JOC A;  1P84 D;  3BCC D;  1T6A A;  5APU A;  3JSV C;  4W7Y A;  2E5T A;  2KP8 A;  1YJW P;  1VQ5 P;  4XE5 B;  4WY4 B;  3TNU B;  2M3E A;  3C1L A;  1OVR A;  5B5E E;  3W67 A;  3HE5 A;  2JKV A;  2WSC J;  1RF1 C;  2P2U A;  5CCH A;  4ZMD A;  1FU1 A;  4GOF A;  5AW1 B;  5CCG D;  2A06 G;  4NPD A;  1URQ B;  5AVY B;  3CC2 P;  2M5A B;  1KMI Z;  3CCQ P;  3WU2 E;  3JCU E;  1FE6 A;  2H8P D;  2WSS H;  3HUS B;  3O8Z A;  1KFM A;  3U1A A;  3O6Q B;  1QGK B;  4H44 C;  1L0L G;  1IJD B;  5AVU B;  3R4Y A;  1KOR A;  5DJT B;  1KQL A;  1LT1 A;  1FBM A;  2WPV B;  3EWK A;  1NTZ E;  2P58 A;  1G1I A;  1SVF A;  4C7N B;  3L73 E;  1GL2 D;  2OTL P;  3RL0 D;  1FZF A;  2IYO A;  1PP9 E;  5BU5 A;  3OA7 A;  1VQO P;  3TGU J;  5GTH E;  4TLF A;  1T2K D;  1RY3 A;  2Q7C A;  1PGP A;  2V7Q H;  3RBZ A;  1EQ7 A;  1YIT P;  1IC2 A;  1GK4 A;  1EZV I;  3GF3 A;  4XA4 A;  5L8R J;  3SFD C;  1LT9 A;  2Z5H A;  2FFD B;  3H1H J;  3L73 G;  5BVZ A;  4OVN F;  1EDL A;  1KIL E;  1NTZ D;  4U3F D;  3V4Q A;  1PP9 G;  2Q6Q A;  1N73 B;  3SWK A;  4H0L D;  4L73 A;  5KAF E;  3CC7 P;  3GW6 A;  2HG5 D;  3G9R A;  3FGA D;  1LWU B;  2YIU B;  4YTP C;  1VPC A;  5AVW B;  4YPC A;  1NU1 E;  1N7S B;  3B8E B;  2O01 J;  3GHG B;  2NPS A;  1S9K E;  2CK3 H;  3CXH E;  1X79 B;  1KQS O;  2WTY A;  1Y9B A;  1JCC A;  1NTM E;  3VMZ A;  3HD7 D;  4D6T J;  1LTS C;  1L4A B;  2M5A A;  3WUV A;  5APX A;  2QJK B;  3M06 A;  2HR3 A;  3A3Y B;  4I1L A;  1KIL B;  3LW5 J;  4PJ0 H;  3RK2 B;  1IFM A;  1Y47 A;  3P8C D;  1YHQ P;  1CSB A;  1NU1 G;  1KYO I;  4I6M C;  1Q2N A;  3VTP C;  3KXD A;  2W83 C;  1VQ9 P;  2XND H;  2I1K A;  2R5D A;  1NTM G;  3L72 E;  5CCG C;  4C7N A;  3VP8 A;  1HTL C;  1EDK A;  3CXH D;  2J59 M;  1NVO A;  2Q9I A;  1S3J A;  1NAF A;  1FZA A;  1Y8A A;  2BCC E;  2ITA A;  3L36 A;  2H43 A;  2OYI C;  2M0B A;  2WPS A;  1YTZ T;  2XNX A;  3AE4 C;  1SQP E;  1JNM A;  1M1J C;  1OVV A;  4I2L C;  2KXP B;  1GU5 A;  3VYI A;  2P7J A;  2B87 B;  1PGO A;  3NMD A;  1JEK A;  2D2C B;  4QMA A;  1XTC C;  3H1I J;  2HPC B;  1GL2 C;  3RL0 C;  4RO0 A;  2WSE J;  3AEC C;  1BCC E;  2IDB A;  3L71 D;  2GUV A;  3L72 D;  2KIK A;  1DX7 A;  3MZW B;  1J2J B;  1N2D C;  2BCC G;  1T2K C;  3CX5 E;  2MJZ A;  4KJM A;  2QJP B;  4GT1 A;  1M56 D;  2GA1 A;  4JYC A;  4U3F J;  2A45 I;  1N7S A;  3A0B E;  1SQP G;  4GOE A;  2N1T B;  3GHG A;  2Q5U A;  5AW8 B;  3CPW O;  3VOP A;  1X0T A;  2JO1 A;  1PZQ A;  4ZNC A;  2IYP A;  1BCC G;  4ZKP A;  3L70 G;  4WB4 A;  3MGN A;  1L4A A;  2SPZ A;  3FX0 A;  4H0L C;  1Q90 D;  5KTB A;  4IL6 X;  1S4X A;  4WBA A;  2OYH C;  5GTI H;  1KIL A;  3N4X A;  2KB7 P;  2KUB A;  3USS A;  1SQB D;  3H32 B;  1Q7Y Q;  1PPJ E;  3MUD C;  1OXZ A;  4IL6 H;  3H1J G;  5TJH A;  3BRT B;  5AW4 B;  2IPP A;  1NOH A;  1OW6 A;  4A7P A;  3L75 J;  4ZKU A;  1Z56 A;  1SQV G;  1GU4 A;  3CCU P;  1USD A;  2POH A;  3HD7 C;  1OWA A;  1DD4 A;  4PV1 D;  1RF1 B;  1HGZ A;  1BE3 D;  3VMA A;  2LXC B;  2RMZ A;  4Y99 C;  3IN6 A;  1NTK K;  1OW8 A;  2WSE H;  3TGU E;  3TYY A;  4EIJ A;  4L74 A;  1PPJ D;  3RK3 D;  1ZV8 A;  2NZ2 A;  3EFG A;  1E5W A;  2K9J B;  2KOG A;  3Q5R A;  1FOS F;  3HE5 B;  2XDJ A;  2UWJ E;  3AEA C;  3R2P A;  2P67 A;  3CLQ A;  3H1H E;  3M9B A;  1OW7 A;  4PD4 I;  1OZH A;  5AW7 B;  2PFX A;  2WPQ A;  3VP9 A;  1SP4 A;  2IZ0 A;  3IAO A;  1M8O B;  2ZYG A;  1NHL A;  3TGU G;  4ASV A;  1U57 A;  1ZN5 A;  1S5L E;  3L71 J;  1H88 A;  2DW3 A;  4N3Y B;  4DZO A;  1ZXG A;  5AVR B;  2YXQ B;  4GOD A;  4DJG A;  1J1E C;  2E74 C;  1L0N G;  2JR8 A;  3AEF C;  1KYO H;  1AVO A;  1P84 E;  1X8Y A;  3H1H G;  4H13 D;  3S4R A;  2WPR A;  5APW A;  2H7H A;  1VQ6 P;  1YTZ I;  5DJU B;  2WMM A;  5AW2 B;  2YMK A;  1JMB A;  1BGY G;  4D6T E;  1KQG B;  1DH3 A;  1FJP A;  1LTB C;  1LTT C;  1QEX A;  4M3L A;  1M90 Q;  3AEG C;  2M3B A;  3KQG A;  4LGD E;  2FYU K;  4ASW A;  1IFD A;  1SQQ D;  1RE3 C;  1SQB J;  3ABV C;  1SFC D;  4OGQ D;  2V7Q J;  1A02 J;  3BCC G;  1JY2 O;  3A7O A;  1RF1 A;  3SWY A;  2LKM A;  1QLE D;  1ZME C;  1AQ5 A;  2LR2 A;  1U7M A;  3L35 A;  2QVA A;  1FZC C;  4EDF A;  2HYN A;  3II6 A; 
#chains in the Genus database with same CATH homology
 1QX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...