1QX8A

Crystal structure of a five-residue deletion mutant of the rop protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
47
structure length
47
Chain Sequence
EKTALNMARFIRSQTLTLLEKLNELADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Loopless Rop: structure and dynamics of an engineered homotetrameric variant of the repressor of primer protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Regulatory protein ROP
total genus 21
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Regulatory protein rop 1qx8A00
1QX8A
chains in the Genus database with same CATH superfamily
1LWUC 3CC4P 1U57A 2P67A 2PAJA 4GOFA 2A45I 1P84H 4GOEA 1YYCA 3EFFK 2ZJSE 3RK3D 3OJAB 2AXTE 3Q5RA 3B71A 1KYOI 3H1HD 3VTPC 1CZQA 2FKWB 1H0TA 1RE4A 3V2QA 2KK7A 4IFMA 3RGUA 1VF5D 2D2CD 3O6QB 3TNUB 3V6IA 1G1IA 2OTKE 1NKZB 3JCUH 1FE6A 5AVQB 5KLVJ 3M0DA 4AQRD 1K04A 1Y8AA 2WQYC 3L70D 2AXTH 3L4FA 1FOSE 1SQQJ 5E79E 5AW8B 2XZRA 2ZYGA 1ZLLA 5KKZB 1K9MQ 1GL2C 2N1TA 3OA7A 5KLIB 3E7KA 1JO5A 2RN0A 2WT7A 1GU4A 3BVHA 1PGPA 1NTZG 1NTZK 4UB8E 2I8DA 5H2FH 2FFDA 1BGYJ 1JMMA 2OYOA 3AEEC 4U3FE 4U3FG 3B4SA 3WU2E 5CMZA 2M5AA 2NPSB 5AW0B 1WT6A 1LTTC 3P7KA 1SQXD 1UIIA 1KILB 3RK2B 1JY2P 1LTGC 2A06D 1BCCE 2HODB 3H32B 3AE8C 1R8EA 3S9OA 2M0BA 1ZRTE 4PD4H 2QSIA 4KHXA 3G4SP 3SWFA 4MN4C 5CJ0A 1HBWA 4C7NA 1KYOD 2JO1A 1M7LA 2WSCH 1L0NE 2AEMA 3BCCD 3PLNA 1G1JA 2HR3A 1PGJA 5AVRB 3TDKA 3CX5I 5KAIH 1GW4A 1QVGO 2HG5D 3L74G 4WVZA 4YPCA 4RJTA 3CLQA 1FC2C 1NKNA 1OW8A 1KMIZ 2QE7H 4EDFA 1PFIA 3CWBE 1HGZA 1BDDA 4HKZH 4PD4E 3I55P 2PGDA 1SQBK 1SQBG 2Z5IA 2Y0EA 5APUA 1LTIC 1S4XA 1SQVK 1SQVG 1VPCA 2RH0A 5CHXA 2R3CA 4NPDA 3USSA 3CMAP 3L75G 4K3AA 1NTKG 1NTKK 2PRRA 1SP4A 2ZT9D 2IBZI 3HE5A 3FXEA 2FYNB 2E75C 3LIEA 5APQA 1L0LE 2O01H 1JCDA 1VQPP 1M57D 3CXHE 2K37A 1PP9E 4UB6H 3VMYA 2C0WA 1FOSF 1LTBC 1SQPG 1SQPK 2IFNA 3M0AA 5B66H 1YTZT 2KI7B 3I5CA 5BU5A 5BU8B 3L71G 1VF5B 1N73A 1RH5B 3VOPA 2OYHC 3NMDA 3BATA 3T97B 4DZOA 1NAFA 4EI2A 3CCJP 4BRYB 3L75J 3L71E 3CCRP 1EZVE 1BSHA 3II6A 2OARA 3CCLP 2B88A 1L4AC 5KJ7A 2FYUD 5B66E 3CX5D 1K8AQ 1YIJP 3M9QA 1X9VA 2JWDA 2QJPC 2HFED 2BCCJ 2K9JB 5L8RJ 3RL0D 1VQ5P 1BE3D 3HE4A 1LTJC 1N8RQ 1EDJA 1KYOH 3R4YA 1W2BO 2OYIA 3L71J 1MFZA 3L75E 1JCCA 2WSFJ 2E76C 1S5LE 1NU1D 1GL2D 2I1KA 3L72D 1NTKD 1Z56A 3NFQA 1H8AA 3L35A 1VQNP 4WY4A 1FZCB 3H1HJ 2IBZD 3L73G 5KAFE 3U59A 1PZQA 2N1TD 1J1DB 5CBOA 4H13B 4H44D 2W8ZA 2NRGA 1ZXGA 1W5CE 1EC5A 2CPBA 2XU6A 4JF7A 4LGDE 4PJ0H 2I1JA 4XA4A 4YTPC 3RBZA 1IFJA 1SQPD 1XTGB 4N78E 3SWYA 3Q3DA 4RESB 1L0LJ 4AYCA 1S5LH 3TNUA 1NTME 3KDPB 3GMAA 5EFWB 3TF5A 2V7QH 1NH4A 2P10A 3D71A 4UB8H 3I56P 3D70A 1IK7A 2K9YA 2N9YB 3RK3C 4I6MC 1BCCG 1BDCA 5KJ7C 2IPPA 2IZ0A 3OW2O 2M8RA 3CCSP 3HUSB 4RKUJ 3MP7B 2O01N 5APXA 1T3UA 5CCHC 1DD4A 4L76A 3CWBJ 3HTKB 1OVRA 1J2JB 4OWFA 5AVVB 1QL2A 2HYNA 1GD2E 1LTJA 1GDTA 1Q81Q 1ZOYC 2ZVNB 2BCCD 1JM0A 2XDJA 1YJWP 2OYIC 5AVXB 1M8OB 1IFMA 3PHLA 1U7MA 1IZNB 3GG2A 3JCUE 2CPSA 4WY4D 4OGQB 2KSEA 1IFIA 2H8PD 2ZT9C 2H88C 1BCCJ 1GK4A 1S5LX 3L73D 5APWA 5E79H 1KZUB 2AEJA 1JY2N 2J58A 3UIAA 2KZIA 1N7LA 3B8EB 4YXDC 5CJ4A 3RK2D 1URQB 1DD3A 2RKLA 2YMYA 1S72P 3CI9A 3E1RA 1YQ3C 4ASWA 1VQ8P 1NOHA 4U3FJ 3V2RA 1VQ6P 3A7OA 3CXHI 1M1JB 1NHLA 1KC8Q 1OVVA 2E74C 4I7ZB 3VN0A 3EQ2A 3NTNA 1FJPA 2R5BA 1Q2NA 1QLED 1NTZE 3WUUA 3RL0C 2A06E 3M9BA 3EFGA 2QJYB 3U1CA 1AVYA 3AEBC 3CCUP 3AEAC 1SQQE 5AVZB 1AQ5A 2B87A 2JEEA 3HD7B 2Q5UA 2Q3IA 1S9KD 1L0ND 4R4MA 3TSIA 2C9NY 1OX3A 1KORA 1LWUB 1LT9C 2BCCG 4PJ0E 1JOCA 1E5WA 1RE4C 1X22A 1YHQP 3ITKA 3H32A 3W68A 5CBNA 1FS0E 1FZBA 1NAYA 4GDOA 3D6ZA 1IFNA 2W27A 1PPJD 3H1KG 1NWQA 2J59M 4YXWH 1KFMA 3AEFC 5AVYB 2KIKA 2FXPA 3SWKA 5DJTB 4N6JA 4ZNCA 2J5UA 4LC1A 1BE3G 3O8ZA 3H25A 1QVFO 2H7HA 2WPSA 4L74A 1FZGA 1OWAA 2YXQB 1VQ4P 1SQPJ 3CXHD 1HTLC 2W83C 1FU1A 1PP9D 4IL6X 3V4QA 1GTWA 3BASA 1MZ9A 5KLIC 3GW6A 2QJKC 3GHGB 4R4LA 3TK1A 3VP8A 1NJIQ 4B86A 1SFCC 4Y99C 3PH0A 4H0LC 2Q6QA 3H1KJ 3MD0A 3Q1MA 1J1EB 2R44A 2IYPA 1EXJA 1YI2P 2BASA 1LT9A 3A3YB 3MHVA 4WBAA 2JP3A 2WSEH 4PV1B 4WY4B 1VQMP 1KD1Q 2ZAEB 1BE3J 2FYUE 2ZFCA 3CXHH 3L70J 4UB6E 3VMXA 2OQQA 5KLVD 1Q86Q 3B5NA 2GM4A 2W6JH 3AE1C 3VMZA 1ZN5A 2KP8A 1JY3P 3IF4A 1YITP 1JY3O 4RO0A 1N7SA 3L74E 2OTJP 1GZLA 2FXMA 1MKMA 4QMAA 5B5EH 1PPJG 1KB9E 3H1KD 3M91A 3L75D 3IFMA 2CK3H 3V4WA 2SPZA 3K5BA 3H1LJ 2HODA 1N86A 3VYIA 3TGUE 1CW5A 3VMAA 2ZXEB 3V5BA 2Y0CA 4OVNF 1PV3A 1JNMA 1SQXJ 1N7SD 2QA4P 1SQVJ 1CI6B 2M3BA 3G6EP 1RE3A 3BRVB 3H1IE 1AVOA 2K3RA 5KLVK 3Q2YA 1LNQA 2N1TB 2R5DA 3P32A 1CI6A 1USEA 3H1LD 2LXBA 1YJNP 1YQ4C 1T8ZA 2A45G 3QWOC 1RHZB 3RK3E 1N73C 1KV4A 5AW3B 4JBZA 3S1KA 2B9BA 2OYHA 4DCKA 2Q9IA 4GKGA 2YKQA 3B5NC 1H89A 2QM8A 3HE5B 2M5AB 2NPSA 1URQA 3KPEA 3IAOA 3H1JE 4ZKPA 1N7SC 1HVVA 1KB9H 2D2CB 2WSSH 2P7JA 4PD4I 3GLMA 4BWNA 2YIUC 3L36A 1R5SA 4JPZB 2WT7B 1ZW0A 4D6TE 2KZJA 1Y9BA 2LR2A 1JEKA 2UWJE 1NYHA 4HH2A 2QJPB 1G2CA 2GUVA 2LXCB 3CC2P 4IFFA 1LJ2A 2FXOA 1LTJB 3VP9A 1S2EA 3FXDA 4GIFA 3H1IJ 3PTZA 1KQSO 2XKMA 4U3FD 4WWIA 1GW3A 5CCGC 1PGOA 3EWKA 3S4RA 2JDIH 5KKZC 5AVTB 4JYBA 1SQXE 3HRNA 4NPEA 3AE7C 3WUTA 1L0NG 1L0NK 1FJKA 4IFDK 3HE4B 1A02J 1BCCD 3L73J 1DEEG 3BCCG 1OXZA 5TISE 2XV5A 4LLHA 1EZVI 1SFCD 3H1LG 2QM7A 4K35A 3U1AA 2NPSC 3KZIH 5AW1B 2BEQD 3C8VA 4HB1A 1KILC 3RK2C 1Q7YQ 5APTA 4BRYA 1IFDA 1PGQA 3C9IA 1GL2B 1X79B 2PP6A 1FAVA 4OH8B 5CCHA 2KOGA 3P8CE 2BEZF 4PD4D 3P8MC 3A0BE 2A45H 3L70E 5KAIE 1KFNA 2WITA 3CD6P 2MJZA 3KXDA 1Q90D 2PFXA 3F89A 1R5LA 1KQGB 2WZ7A 3L70G 1LTAC 2KSJA 2OGUA 5AVUB 5M1BA 4EOTA 1KILD 1IJDB 1YTZI 5AW9B 5BVZA 5CCGA 1L0LD 1OZHA 3KQGA 4W7YA 5CCHD 2NPSD 4TLFA 2E5YA 1BGYG 1XTCC 1A02F 1LTSC 1SS1A 2KYVA 3Q5SA 3ZDMA 4PV1D 5GTHH 5GTIH 2FYNC 2E75B 1AV1A 2FYUG 2FYUK 1NTKJ 3KZIE 3L72J 4JYCA 1NU1J 1YJ9P 1RF0C 1EZVD 1HGVA 2Q7CA 1FZFA 1RF1B 1AJYA 2KNCA 2W6AA 3A0HH 2WVRA 3AE5C 5AW6B 1K05A 3BCCE 5H2FE 4H44C 5K5GB 1FBMA 4N3YB 5APYA 1Q82Q 1OW6A 2OYHB 4IOIH 3M06A 5TISH 1NGMB 1AFOA 3AE9C 3SFEC 1JTHB 5TJHA 1EDIA 1JUNA 1U7JA 1M1KQ 2HPCB 2IBZG 3JSVC 1SQBJ 2K1AA 3L74D 2WWWA 4L75A 2YNYA 1HWTC 4D6TG 1VQLP 1GU5A 2FFDB 2IBZE 2WMMA 2YO3A 2QRXA 3RBXA 1SQVD 1ZV8A 1IFPA 3B5ND 1DH3A 4U7JA 4EIJA 3MTUE 1NTZJ 1VQOP 1M90Q 2L5GB 2ZXXA 1P84D 5GTHE 1L0LK 1L0LG 3MZWB 2Z5HA 1LWUA 5GTIE 3TYYA 3PRJA 1DX7A 3R2PA 1QL1A 3OAKA 1BGYD 2E5TA 3JC22 3W67A 1J1DC 1URQD 5APVA 1RF0A 1QEXA 1LGHB 3H1ID 3L37A 2P58A 3N4XA 1EDLA 1EZVG 1T6AA 2ZYAA 5KJ7D 4ASVA 1AA0A 1SQBE 2AEFA 1MFTA 3L71D 1SQQK 1SQQG 2GA1A 1SFCA 3CWBG 3QH9A 2W6BA 1T2KC 2E75D 2E76B 4L73A 5DJUB 1M1JA 2KLUA 3CX5E 2C0XA 5KLVG 1IC2A 2WSEJ 2H89C 1FZAA 2KUBA 2FY8A 2JKVA 3IR9A 3RK3B 4EYYQ 1FZCC 4H0LB 3BCCJ 2K88A 2O01J 2WPRA 2C9LY 3TGUG 1FZEA 1ZMEC 1HH0A 2Q3EA 2K9JA 1NU1E 3L72E 1NTKE 1S1CX 2YXRB 3L72G 2QVAA 4OGQD 2AXCA 3FGAD 3GF3A 3D6YA 2O3JA 2H43A 3NXSA 2QIWA 1EDKA 1S3JA 2KLVA 1ZR2A 2KB7P 2YKPA 4OGQC 2OTLP 1ZR4A 1P84I 2ZT9B 1FZCA 2NZ2A 1NTMJ 1KTMA 1KN7A 5AW4B 3O6QA 5AVWB 2YMKA 2JWAA 1ZRTD 2Q1KA 1LT1A 1FDIA 3CPWO 3LW5J 1H0TB 2RMZA 1G2CB 3AE3C 3FWLA 1BSNA 2OYIB 1SQQD 1RE3C 1HF9A 2LKMA 2KS1A 1KQLA 3H1HE 1M1JC 3CCEP 1RY3A 2POHA 1T2KD 2QEXP 3PJSK 1S9KE 1HJBA 2Y9ZA 4TT3H 1IO4A 3G9RA 3MIWA 1USDA 3CCQP 1MV8A 4Y28J 4A7PA 2QJYC 1LP1B 2BCCE 2HLOA 4C46A 4XE5B 5AVSB 1N73B 4BXLA 1IK9A 4KJMA 3P8CD 3PP5A 1URQC 1VL2A 3C1LA 1JMBA 3AE2C 1OVUA 4M3LA 3T97A 4C7RA 1PL5A 1DEBA 2IYOA 2FYZA 1SLQA 4GT1A 1NVOA 3A2AA 4HJGH 3F5HA 1QGKB 4GODA 2HPCA 3L73E 1AQTA 1N7SB 2V7QJ 4I7ZC 4NPFX 1Y47A 2D2CC 1VF5C 3WUVA 1KILE 3RL0B 1RQUA 4XFJA 1M56D 4I1LA 4C7NB 4DT0A 5KTBA 3SFDC 2JJLA 3Q5PA 1PP9G 2YKOA 3LW5H 2YO2A 4W7ZA 2VRSA 3IN6A 3RL0g 1L4AB 1PP9J 3CCMP 2IFMA 2P2UA 1FDOA 1JY3N 1LT9B 1NTZD 4CPGA 2FBWC 3MUDC 1MUUA 1L4AA 1EQ7A 3HD7D 1JY2O 3HTKA 4H0LD 5AW7B 2ITAA 2WSFH 1TU3F 3FX0A 1KYOE 2MKVA 3KHUA 3WU2H 1OFCX 3CC7P 1EXIA 4IL6E 1WRGA 3GHGC 3H1JJ 3KYQA 3GF7A 4O9BA 4W80A 2B87B 4I2LC 4Y99B 5CCGD 3CWBD 3H1JG 1KILA 2JR8A 1J1EC 2B89A 4H13C 1N2DC 3A5TA 3G71P 1VQ9P 4WY4C 3MGNA 4PV1C 1KB9D 1VDFA 1ZP0C 1L0NJ 4D6TJ 2ZVOB 1RF1A 2W90A 1PPJE 1PIXA 1NU1K 1NU1G 2L91A 3AEDC 3SSUA 3WMM0 3TGUD 4AUWA 1GK6A 2XNDH 1YBKA 3AE6C 3AECC 2A06G 2QJKB 5AW5B 3ABVC 3H1IG 1SQVE 1K73Q 1JB0J 1NTMG 1NTMK 1SFCB 4DJGA 1DIPA 1VQKP 3A0HE 1P84E 3V2NA 1D7MA 3HUSC 3CL3D 3V2PA 3MUDA 3G3ZA 1BGYE 1L2PA 3AEGC 1RQVA 3TGUJ 1L4AD 1OIPA 3HD7A 2IZ1A 2IX7C 2ZYDA 3H1LE 1VQ7P 2R3SA 1X0TA 3H1HG 4KT0J 2G8YA 1UIXA 2KXPB 2WPQA 2WSCJ 4IL6H 4ZMDA 3GHGA 2E42A 1SQBD 3L74J 3N7NA 5KAFH 3BRTB 4Z1MH 4HYTB 2E74D 1H88A 1NO4A 1X8YA 2KS1B 2IDBA 3A0BH 3H1JD 3FWNA 5KLVE 5APSA 1WMKA 3CMEP 1BE3E 2FYUJ 2E76D 4JQ0D 2V4HA 2GUSA 1RF1C 1GMJA 3CCVP 1HUCA 1KB9I 2G3AA 3B5NB 2WPVB 3M9HA 4D6TD 1E79H 1OMIA 2DW3A 3H1KE 3M0DC 4H13D 4H44B 2Z4EA 2E43A 2O1JA 2QG4A 2N9BA 1T3JA 2E74B 5AW2B 3AE4C 2O1KA 4ZKUA 2YIUB 2R32A 1GL2A 1OW7A 2N1TC 3CX5H 3E1IA 3HUSA 2KNCB 3LIDA 1SQPE 4N78D 1HJ0A 3H6PA 2WTYA 1SQXK 1NTMD 1SQXG 5C39A 4DOJA 2Y0DA 1FDMA 3HD7C 2FFDC 1QX8A 2M3EA 1W2EA 2P1JA 2Y9YA 1LP1A 4WB4A 5B5EE 1CSBA 2XNXA 1JTHA 1KQFB 1SVFA
chains in the Genus database with same CATH topology
1QX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX8 A; 
#chains in the Genus database with same CATH topology
 1LWU C;  3CC4 P;  1U57 A;  2P67 A;  2PAJ A;  4GOF A;  2A45 I;  1P84 H;  4GOE A;  1YYC A;  3EFF K;  2ZJS E;  3RK3 D;  3OJA B;  2AXT E;  3Q5R A;  3B71 A;  1KYO I;  3H1H D;  3VTP C;  1CZQ A;  2FKW B;  1H0T A;  1RE4 A;  3V2Q A;  2KK7 A;  4IFM A;  3RGU A;  1VF5 D;  2D2C D;  3O6Q B;  3TNU B;  3V6I A;  1G1I A;  2OTK E;  1NKZ B;  3JCU H;  1FE6 A;  5AVQ B;  5KLV J;  3M0D A;  4AQR D;  1K04 A;  1Y8A A;  2WQY C;  3L70 D;  2AXT H;  3L4F A;  1FOS E;  1SQQ J;  5E79 E;  5AW8 B;  2XZR A;  2ZYG A;  1ZLL A;  5KKZ B;  1K9M Q;  1GL2 C;  2N1T A;  3OA7 A;  5KLI B;  3E7K A;  1JO5 A;  2RN0 A;  2WT7 A;  1GU4 A;  3BVH A;  1PGP A;  1NTZ G;  1NTZ K;  4UB8 E;  2I8D A;  5H2F H;  2FFD A;  1BGY J;  1JMM A;  2OYO A;  3AEE C;  4U3F E;  4U3F G;  3B4S A;  3WU2 E;  5CMZ A;  2M5A A;  2NPS B;  5AW0 B;  1WT6 A;  1LTT C;  3P7K A;  1SQX D;  1UII A;  1KIL B;  3RK2 B;  1JY2 P;  1LTG C;  2A06 D;  1BCC E;  2HOD B;  3H32 B;  3AE8 C;  1R8E A;  3S9O A;  2M0B A;  1ZRT E;  4PD4 H;  2QSI A;  4KHX A;  3G4S P;  3SWF A;  4MN4 C;  5CJ0 A;  1HBW A;  4C7N A;  1KYO D;  2JO1 A;  1M7L A;  2WSC H;  1L0N E;  2AEM A;  3BCC D;  3PLN A;  1G1J A;  2HR3 A;  1PGJ A;  5AVR B;  3TDK A;  3CX5 I;  5KAI H;  1GW4 A;  1QVG O;  2HG5 D;  3L74 G;  4WVZ A;  4YPC A;  4RJT A;  3CLQ A;  1FC2 C;  1NKN A;  1OW8 A;  1KMI Z;  2QE7 H;  4EDF A;  1PFI A;  3CWB E;  1HGZ A;  1BDD A;  4HKZ H;  4PD4 E;  3I55 P;  2PGD A;  1SQB K;  1SQB G;  2Z5I A;  2Y0E A;  5APU A;  1LTI C;  1S4X A;  1SQV K;  1SQV G;  1VPC A;  2RH0 A;  5CHX A;  2R3C A;  4NPD A;  3USS A;  3CMA P;  3L75 G;  4K3A A;  1NTK G;  1NTK K;  2PRR A;  1SP4 A;  2ZT9 D;  2IBZ I;  3HE5 A;  3FXE A;  2FYN B;  2E75 C;  3LIE A;  5APQ A;  1L0L E;  2O01 H;  1JCD A;  1VQP P;  1M57 D;  3CXH E;  2K37 A;  1PP9 E;  4UB6 H;  3VMY A;  2C0W A;  1FOS F;  1LTB C;  1SQP G;  1SQP K;  2IFN A;  3M0A A;  5B66 H;  1YTZ T;  2KI7 B;  3I5C A;  5BU5 A;  5BU8 B;  3L71 G;  1VF5 B;  1N73 A;  1RH5 B;  3VOP A;  2OYH C;  3NMD A;  3BAT A;  3T97 B;  4DZO A;  1NAF A;  4EI2 A;  3CCJ P;  4BRY B;  3L75 J;  3L71 E;  3CCR P;  1EZV E;  1BSH A;  3II6 A;  2OAR A;  3CCL P;  2B88 A;  1L4A C;  5KJ7 A;  2FYU D;  5B66 E;  3CX5 D;  1K8A Q;  1YIJ P;  3M9Q A;  1X9V A;  2JWD A;  2QJP C;  2HFE D;  2BCC J;  2K9J B;  5L8R J;  3RL0 D;  1VQ5 P;  1BE3 D;  3HE4 A;  1LTJ C;  1N8R Q;  1EDJ A;  1KYO H;  3R4Y A;  1W2B O;  2OYI A;  3L71 J;  1MFZ A;  3L75 E;  1JCC A;  2WSF J;  2E76 C;  1S5L E;  1NU1 D;  1GL2 D;  2I1K A;  3L72 D;  1NTK D;  1Z56 A;  3NFQ A;  1H8A A;  3L35 A;  1VQN P;  4WY4 A;  1FZC B;  3H1H J;  2IBZ D;  3L73 G;  5KAF E;  3U59 A;  1PZQ A;  2N1T D;  1J1D B;  5CBO A;  4H13 B;  4H44 D;  2W8Z A;  2NRG A;  1ZXG A;  1W5C E;  1EC5 A;  2CPB A;  2XU6 A;  4JF7 A;  4LGD E;  4PJ0 H;  2I1J A;  4XA4 A;  4YTP C;  3RBZ A;  1IFJ A;  1SQP D;  1XTG B;  4N78 E;  3SWY A;  3Q3D A;  4RES B;  1L0L J;  4AYC A;  1S5L H;  3TNU A;  1NTM E;  3KDP B;  3GMA A;  5EFW B;  3TF5 A;  2V7Q H;  1NH4 A;  2P10 A;  3D71 A;  4UB8 H;  3I56 P;  3D70 A;  1IK7 A;  2K9Y A;  2N9Y B;  3RK3 C;  4I6M C;  1BCC G;  1BDC A;  5KJ7 C;  2IPP A;  2IZ0 A;  3OW2 O;  2M8R A;  3CCS P;  3HUS B;  4RKU J;  3MP7 B;  2O01 N;  5APX A;  1T3U A;  5CCH C;  1DD4 A;  4L76 A;  3CWB J;  3HTK B;  1OVR A;  1J2J B;  4OWF A;  5AVV B;  1QL2 A;  2HYN A;  1GD2 E;  1LTJ A;  1GDT A;  1Q81 Q;  1ZOY C;  2ZVN B;  2BCC D;  1JM0 A;  2XDJ A;  1YJW P;  2OYI C;  5AVX B;  1M8O B;  1IFM A;  3PHL A;  1U7M A;  1IZN B;  3GG2 A;  3JCU E;  2CPS A;  4WY4 D;  4OGQ B;  2KSE A;  1IFI A;  2H8P D;  2ZT9 C;  2H88 C;  1BCC J;  1GK4 A;  1S5L X;  3L73 D;  5APW A;  5E79 H;  1KZU B;  2AEJ A;  1JY2 N;  2J58 A;  3UIA A;  2KZI A;  1N7L A;  3B8E B;  4YXD C;  5CJ4 A;  3RK2 D;  1URQ B;  1DD3 A;  2RKL A;  2YMY A;  1S72 P;  3CI9 A;  3E1R A;  1YQ3 C;  4ASW A;  1VQ8 P;  1NOH A;  4U3F J;  3V2R A;  1VQ6 P;  3A7O A;  3CXH I;  1M1J B;  1NHL A;  1KC8 Q;  1OVV A;  2E74 C;  4I7Z B;  3VN0 A;  3EQ2 A;  3NTN A;  1FJP A;  2R5B A;  1Q2N A;  1QLE D;  1NTZ E;  3WUU A;  3RL0 C;  2A06 E;  3M9B A;  3EFG A;  2QJY B;  3U1C A;  1AVY A;  3AEB C;  3CCU P;  3AEA C;  1SQQ E;  5AVZ B;  1AQ5 A;  2B87 A;  2JEE A;  3HD7 B;  2Q5U A;  2Q3I A;  1S9K D;  1L0N D;  4R4M A;  3TSI A;  2C9N Y;  1OX3 A;  1KOR A;  1LWU B;  1LT9 C;  2BCC G;  4PJ0 E;  1JOC A;  1E5W A;  1RE4 C;  1X22 A;  1YHQ P;  3ITK A;  3H32 A;  3W68 A;  5CBN A;  1FS0 E;  1FZB A;  1NAY A;  4GDO A;  3D6Z A;  1IFN A;  2W27 A;  1PPJ D;  3H1K G;  1NWQ A;  2J59 M;  4YXW H;  1KFM A;  3AEF C;  5AVY B;  2KIK A;  2FXP A;  3SWK A;  5DJT B;  4N6J A;  4ZNC A;  2J5U A;  4LC1 A;  1BE3 G;  3O8Z A;  3H25 A;  1QVF O;  2H7H A;  2WPS A;  4L74 A;  1FZG A;  1OWA A;  2YXQ B;  1VQ4 P;  1SQP J;  3CXH D;  1HTL C;  2W83 C;  1FU1 A;  1PP9 D;  4IL6 X;  3V4Q A;  1GTW A;  3BAS A;  1MZ9 A;  5KLI C;  3GW6 A;  2QJK C;  3GHG B;  4R4L A;  3TK1 A;  3VP8 A;  1NJI Q;  4B86 A;  1SFC C;  4Y99 C;  3PH0 A;  4H0L C;  2Q6Q A;  3H1K J;  3MD0 A;  3Q1M A;  1J1E B;  2R44 A;  2IYP A;  1EXJ A;  1YI2 P;  2BAS A;  1LT9 A;  3A3Y B;  3MHV A;  4WBA A;  2JP3 A;  2WSE H;  4PV1 B;  4WY4 B;  1VQM P;  1KD1 Q;  2ZAE B;  1BE3 J;  2FYU E;  2ZFC A;  3CXH H;  3L70 J;  4UB6 E;  3VMX A;  2OQQ A;  5KLV D;  1Q86 Q;  3B5N A;  2GM4 A;  2W6J H;  3AE1 C;  3VMZ A;  1ZN5 A;  2KP8 A;  1JY3 P;  3IF4 A;  1YIT P;  1JY3 O;  4RO0 A;  1N7S A;  3L74 E;  2OTJ P;  1GZL A;  2FXM A;  1MKM A;  4QMA A;  5B5E H;  1PPJ G;  1KB9 E;  3H1K D;  3M91 A;  3L75 D;  3IFM A;  2CK3 H;  3V4W A;  2SPZ A;  3K5B A;  3H1L J;  2HOD A;  1N86 A;  3VYI A;  3TGU E;  1CW5 A;  3VMA A;  2ZXE B;  3V5B A;  2Y0C A;  4OVN F;  1PV3 A;  1JNM A;  1SQX J;  1N7S D;  2QA4 P;  1SQV J;  1CI6 B;  2M3B A;  3G6E P;  1RE3 A;  3BRV B;  3H1I E;  1AVO A;  2K3R A;  5KLV K;  3Q2Y A;  1LNQ A;  2N1T B;  2R5D A;  3P32 A;  1CI6 A;  1USE A;  3H1L D;  2LXB A;  1YJN P;  1YQ4 C;  1T8Z A;  2A45 G;  3QWO C;  1RHZ B;  3RK3 E;  1N73 C;  1KV4 A;  5AW3 B;  4JBZ A;  3S1K A;  2B9B A;  2OYH A;  4DCK A;  2Q9I A;  4GKG A;  2YKQ A;  3B5N C;  1H89 A;  2QM8 A;  3HE5 B;  2M5A B;  2NPS A;  1URQ A;  3KPE A;  3IAO A;  3H1J E;  4ZKP A;  1N7S C;  1HVV A;  1KB9 H;  2D2C B;  2WSS H;  2P7J A;  4PD4 I;  3GLM A;  4BWN A;  2YIU C;  3L36 A;  1R5S A;  4JPZ B;  2WT7 B;  1ZW0 A;  4D6T E;  2KZJ A;  1Y9B A;  2LR2 A;  1JEK A;  2UWJ E;  1NYH A;  4HH2 A;  2QJP B;  1G2C A;  2GUV A;  2LXC B;  3CC2 P;  4IFF A;  1LJ2 A;  2FXO A;  1LTJ B;  3VP9 A;  1S2E A;  3FXD A;  4GIF A;  3H1I J;  3PTZ A;  1KQS O;  2XKM A;  4U3F D;  4WWI A;  1GW3 A;  5CCG C;  1PGO A;  3EWK A;  3S4R A;  2JDI H;  5KKZ C;  5AVT B;  4JYB A;  1SQX E;  3HRN A;  4NPE A;  3AE7 C;  3WUT A;  1L0N G;  1L0N K;  1FJK A;  4IFD K;  3HE4 B;  1A02 J;  1BCC D;  3L73 J;  1DEE G;  3BCC G;  1OXZ A;  5TIS E;  2XV5 A;  4LLH A;  1EZV I;  1SFC D;  3H1L G;  2QM7 A;  4K35 A;  3U1A A;  2NPS C;  3KZI H;  5AW1 B;  2BEQ D;  3C8V A;  4HB1 A;  1KIL C;  3RK2 C;  1Q7Y Q;  5APT A;  4BRY A;  1IFD A;  1PGQ A;  3C9I A;  1GL2 B;  1X79 B;  2PP6 A;  1FAV A;  4OH8 B;  5CCH A;  2KOG A;  3P8C E;  2BEZ F;  4PD4 D;  3P8M C;  3A0B E;  2A45 H;  3L70 E;  5KAI E;  1KFN A;  2WIT A;  3CD6 P;  2MJZ A;  3KXD A;  1Q90 D;  2PFX A;  3F89 A;  1R5L A;  1KQG B;  2WZ7 A;  3L70 G;  1LTA C;  2KSJ A;  2OGU A;  5AVU B;  5M1B A;  4EOT A;  1KIL D;  1IJD B;  1YTZ I;  5AW9 B;  5BVZ A;  5CCG A;  1L0L D;  1OZH A;  3KQG A;  4W7Y A;  5CCH D;  2NPS D;  4TLF A;  2E5Y A;  1BGY G;  1XTC C;  1A02 F;  1LTS C;  1SS1 A;  2KYV A;  3Q5S A;  3ZDM A;  4PV1 D;  5GTH H;  5GTI H;  2FYN C;  2E75 B;  1AV1 A;  2FYU G;  2FYU K;  1NTK J;  3KZI E;  3L72 J;  4JYC A;  1NU1 J;  1YJ9 P;  1RF0 C;  1EZV D;  1HGV A;  2Q7C A;  1FZF A;  1RF1 B;  1AJY A;  2KNC A;  2W6A A;  3A0H H;  2WVR A;  3AE5 C;  5AW6 B;  1K05 A;  3BCC E;  5H2F E;  4H44 C;  5K5G B;  1FBM A;  4N3Y B;  5APY A;  1Q82 Q;  1OW6 A;  2OYH B;  4IOI H;  3M06 A;  5TIS H;  1NGM B;  1AFO A;  3AE9 C;  3SFE C;  1JTH B;  5TJH A;  1EDI A;  1JUN A;  1U7J A;  1M1K Q;  2HPC B;  2IBZ G;  3JSV C;  1SQB J;  2K1A A;  3L74 D;  2WWW A;  4L75 A;  2YNY A;  1HWT C;  4D6T G;  1VQL P;  1GU5 A;  2FFD B;  2IBZ E;  2WMM A;  2YO3 A;  2QRX A;  3RBX A;  1SQV D;  1ZV8 A;  1IFP A;  3B5N D;  1DH3 A;  4U7J A;  4EIJ A;  3MTU E;  1NTZ J;  1VQO P;  1M90 Q;  2L5G B;  2ZXX A;  1P84 D;  5GTH E;  1L0L K;  1L0L G;  3MZW B;  2Z5H A;  1LWU A;  5GTI E;  3TYY A;  3PRJ A;  1DX7 A;  3R2P A;  1QL1 A;  3OAK A;  1BGY D;  2E5T A;  3JC2 2;  3W67 A;  1J1D C;  1URQ D;  5APV A;  1RF0 A;  1QEX A;  1LGH B;  3H1I D;  3L37 A;  2P58 A;  3N4X A;  1EDL A;  1EZV G;  1T6A A;  2ZYA A;  5KJ7 D;  4ASV A;  1AA0 A;  1SQB E;  2AEF A;  1MFT A;  3L71 D;  1SQQ K;  1SQQ G;  2GA1 A;  1SFC A;  3CWB G;  3QH9 A;  2W6B A;  1T2K C;  2E75 D;  2E76 B;  4L73 A;  5DJU B;  1M1J A;  2KLU A;  3CX5 E;  2C0X A;  5KLV G;  1IC2 A;  2WSE J;  2H89 C;  1FZA A;  2KUB A;  2FY8 A;  2JKV A;  3IR9 A;  3RK3 B;  4EYY Q;  1FZC C;  4H0L B;  3BCC J;  2K88 A;  2O01 J;  2WPR A;  2C9L Y;  3TGU G;  1FZE A;  1ZME C;  1HH0 A;  2Q3E A;  2K9J A;  1NU1 E;  3L72 E;  1NTK E;  1S1C X;  2YXR B;  3L72 G;  2QVA A;  4OGQ D;  2AXC A;  3FGA D;  3GF3 A;  3D6Y A;  2O3J A;  2H43 A;  3NXS A;  2QIW A;  1EDK A;  1S3J A;  2KLV A;  1ZR2 A;  2KB7 P;  2YKP A;  4OGQ C;  2OTL P;  1ZR4 A;  1P84 I;  2ZT9 B;  1FZC A;  2NZ2 A;  1NTM J;  1KTM A;  1KN7 A;  5AW4 B;  3O6Q A;  5AVW B;  2YMK A;  2JWA A;  1ZRT D;  2Q1K A;  1LT1 A;  1FDI A;  3CPW O;  3LW5 J;  1H0T B;  2RMZ A;  1G2C B;  3AE3 C;  3FWL A;  1BSN A;  2OYI B;  1SQQ D;  1RE3 C;  1HF9 A;  2LKM A;  2KS1 A;  1KQL A;  3H1H E;  1M1J C;  3CCE P;  1RY3 A;  2POH A;  1T2K D;  2QEX P;  3PJS K;  1S9K E;  1HJB A;  2Y9Z A;  4TT3 H;  1IO4 A;  3G9R A;  3MIW A;  1USD A;  3CCQ P;  1MV8 A;  4Y28 J;  4A7P A;  2QJY C;  1LP1 B;  2BCC E;  2HLO A;  4C46 A;  4XE5 B;  5AVS B;  1N73 B;  4BXL A;  1IK9 A;  4KJM A;  3P8C D;  3PP5 A;  1URQ C;  1VL2 A;  3C1L A;  1JMB A;  3AE2 C;  1OVU A;  4M3L A;  3T97 A;  4C7R A;  1PL5 A;  1DEB A;  2IYO A;  2FYZ A;  1SLQ A;  4GT1 A;  1NVO A;  3A2A A;  4HJG H;  3F5H A;  1QGK B;  4GOD A;  2HPC A;  3L73 E;  1AQT A;  1N7S B;  2V7Q J;  4I7Z C;  4NPF X;  1Y47 A;  2D2C C;  1VF5 C;  3WUV A;  1KIL E;  3RL0 B;  1RQU A;  4XFJ A;  1M56 D;  4I1L A;  4C7N B;  4DT0 A;  5KTB A;  3SFD C;  2JJL A;  3Q5P A;  1PP9 G;  2YKO A;  3LW5 H;  2YO2 A;  4W7Z A;  2VRS A;  3IN6 A;  3RL0 g;  1L4A B;  1PP9 J;  3CCM P;  2IFM A;  2P2U A;  1FDO A;  1JY3 N;  1LT9 B;  1NTZ D;  4CPG A;  2FBW C;  3MUD C;  1MUU A;  1L4A A;  1EQ7 A;  3HD7 D;  1JY2 O;  3HTK A;  4H0L D;  5AW7 B;  2ITA A;  2WSF H;  1TU3 F;  3FX0 A;  1KYO E;  2MKV A;  3KHU A;  3WU2 H;  1OFC X;  3CC7 P;  1EXI A;  4IL6 E;  1WRG A;  3GHG C;  3H1J J;  3KYQ A;  3GF7 A;  4O9B A;  4W80 A;  2B87 B;  4I2L C;  4Y99 B;  5CCG D;  3CWB D;  3H1J G;  1KIL A;  2JR8 A;  1J1E C;  2B89 A;  4H13 C;  1N2D C;  3A5T A;  3G71 P;  1VQ9 P;  4WY4 C;  3MGN A;  4PV1 C;  1KB9 D;  1VDF A;  1ZP0 C;  1L0N J;  4D6T J;  2ZVO B;  1RF1 A;  2W90 A;  1PPJ E;  1PIX A;  1NU1 K;  1NU1 G;  2L91 A;  3AED C;  3SSU A;  3WMM 0;  3TGU D;  4AUW A;  1GK6 A;  2XND H;  1YBK A;  3AE6 C;  3AEC C;  2A06 G;  2QJK B;  5AW5 B;  3ABV C;  3H1I G;  1SQV E;  1K73 Q;  1JB0 J;  1NTM G;  1NTM K;  1SFC B;  4DJG A;  1DIP A;  1VQK P;  3A0H E;  1P84 E;  3V2N A;  1D7M A;  3HUS C;  3CL3 D;  3V2P A;  3MUD A;  3G3Z A;  1BGY E;  1L2P A;  3AEG C;  1RQV A;  3TGU J;  1L4A D;  1OIP A;  3HD7 A;  2IZ1 A;  2IX7 C;  2ZYD A;  3H1L E;  1VQ7 P;  2R3S A;  1X0T A;  3H1H G;  4KT0 J;  2G8Y A;  1UIX A;  2KXP B;  2WPQ A;  2WSC J;  4IL6 H;  4ZMD A;  3GHG A;  2E42 A;  1SQB D;  3L74 J;  3N7N A;  5KAF H;  3BRT B;  4Z1M H;  4HYT B;  2E74 D;  1H88 A;  1NO4 A;  1X8Y A;  2KS1 B;  2IDB A;  3A0B H;  3H1J D;  3FWN A;  5KLV E;  5APS A;  1WMK A;  3CME P;  1BE3 E;  2FYU J;  2E76 D;  4JQ0 D;  2V4H A;  2GUS A;  1RF1 C;  1GMJ A;  3CCV P;  1HUC A;  1KB9 I;  2G3A A;  3B5N B;  2WPV B;  3M9H A;  4D6T D;  1E79 H;  1OMI A;  2DW3 A;  3H1K E;  3M0D C;  4H13 D;  4H44 B;  2Z4E A;  2E43 A;  2O1J A;  2QG4 A;  2N9B A;  1T3J A;  2E74 B;  5AW2 B;  3AE4 C;  2O1K A;  4ZKU A;  2YIU B;  2R32 A;  1GL2 A;  1OW7 A;  2N1T C;  3CX5 H;  3E1I A;  3HUS A;  2KNC B;  3LID A;  1SQP E;  4N78 D;  1HJ0 A;  3H6P A;  2WTY A;  1SQX K;  1NTM D;  1SQX G;  5C39 A;  4DOJ A;  2Y0D A;  1FDM A;  3HD7 C;  2FFD C;  1QX8 A;  2M3E A;  1W2E A;  2P1J A;  2Y9Y A;  1LP1 A;  4WB4 A;  5B5E E;  1CSB A;  2XNX A;  1JTH A;  1KQF B;  1SVF A; 
#chains in the Genus database with same CATH homology
 1QX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...