1QX8A

Crystal structure of a five-residue deletion mutant of the rop protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
47
structure length
47
Chain Sequence
EKTALNMARFIRSQTLTLLEKLNELADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Loopless Rop: structure and dynamics of an engineered homotetrameric variant of the repressor of primer protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Regulatory protein ROP
total genus 21
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Regulatory protein rop 1qx8A00
1QX8A
chains in the Genus database with same CATH superfamily
1XTGB 1BE3G 1M1KQ 1L4AC 1KMIZ 1SQXJ 1N2DC 1JY2O 3IN6A 4TLFA 4UB8E 3CWBE 1J1EB 3QWOC 3RBXA 2ZT9C 2RN0A 2D2CB 3CXHH 1KQFB 1NHLA 4D6TD 3CCRP 1QVGO 1NWQA 1OW7A 1L0LE 3H1KG 1RHZB 4WBAA 1KQSO 4N6JA 1SQPK 3U1AA 4ZKUA 3V2NA 2K1AA 2FXOA 1NU1J 2N9BA 1IFNA 3CCLP 1OZHA 1PGOA 1GL2C 1KILB 1M1JA 1N7SC 2IZ0A 1QX8A 2KK7A 2KSJA 4DJGA 1YI2P 4IOIH 2FY8A 5AW4B 3E1IA 2IPPA 3SWFA 4WVZA 3LW5H 1FJKA 5AVVB 1R5LA 2E76B 3D71A 5B66H 2JKVA 2PGDA 1SQBJ 2Q3IA 4OGQC 1FE6A 1QEXA 1SQBD 3A0BH 1GU5A 2QJPB 2H43A 2E42A 2YO2A 2OTLP 3TF5A 4DZOA 1YQ3C 1L0ND 1RE4C 2ZVOB 2OYHC 4YTPC 2O01H 4U3FD 1FU1A 4HH2A 2IYOA 1SQQE 1JMBA 3B4SA 1P84H 1KC8Q 3HD7B 3S4RA 5AW9B 4OGQD 1HJ0A 1DEBA 1NU1G 3L72E 4EOTA 2QG4A 4H44D 3EQ2A 1MKMA 1GZLA 2GUVA 2KIKA 1EXJA 3P32A 1J1DB 4BWNA 1PGPA 2CK3H 5KAIH 3TGUE 1WRGA 2FYZA 4D6TG 5AVYB 3CXHI 2P58A 4WY4B 1K9MQ 1VQ9P 1VQ8P 3HE4A 1MV8A 3HTKA 2BCCG 3JC22 3AE5C 1RH5B 3G6EP 5KLVD 2XDJA 4AQRD 4B86A 1NKNA 1SP4A 2IBZG 1S5LH 1HBWA 1W5CE 1ZP0C 1OW8A 1T8ZA 5APXA 3MP7B 1RE3C 3CX5D 1L0NK 1KYOI 2KSEA 1ZLLA 2QJYC 4GKGA 3HD7A 4L74A 5AVXB 1PL5A 3SFDC 3TDKA 3V4QA 1NU1E 1R5SA 1NTZG 2NPSB 3O8ZA 5AVUB 4C46A 1LTJB 2QVAA 5GTIH 5AW7B 1S9KD 5APWA 1MUUA 3HUSB 3NTNA 1T3JA 2QRXA 3Q5PA 4NPDA 2W27A 2L5GB 5M1BA 3L75E 2LXCB 1HWTC 3CC4P 1NTZE 2WSEH 3OA7A 3T97B 2Q6QA 5B66E 2YKQA 1CI6A 3BRTB 3HE4B 3HTKB 2XKMA 1ZR2A 2GUSA 5AVZB 3USSA 2IBZE 3BVHA 1GD2E 2W6JH 3P8CE 5KKZB 4UB6H 3M91A 4ZKPA 1N7LA 3CI9A 1LTGC 1S9KE 2R3SA 1LT9C 4EDFA 1NGMB 1Q2NA 2Q3EA 1EZVD 2ZXXA 4K3AA 2H8PD 3VMXA 4OWFA 5CBOA 2FYUG 3KZIE 1PP9D 1KD1Q 1N73C 3AE8C 3AEEC 3CWBJ 3M0DA 1FZBA 2WMMA 3PJSK 2FFDA 3H1LD 3H1ID 2WSSH 3L71D 3LIEA 3PH0A 5AW8B 5KJ7D 1J2JB 2Y9YA 3I5CA 4GDOA 1RE4A 3WU2E 2OYHA 2BCCD 4IL6E 4A7PA 1YIJP 1N86A 1MFTA 2KB7P 4PJ0E 3RK3E 1RF0C 1NTKD 3BCCJ 5CCGD 5CJ0A 4PJ0H 2ZT9D 2B87B 1PGJA 5KLIB 1PFIA 4WWIA 2I8DA 3H1JE 2WPRA 4GOEA 2E74C 3CCEP 2KYVA 2P67A 4Y99B 4I7ZB 3FX0A 1S5LX 3RL0g 1OVRA 3M9BA 2N1TA 1KILD 2YIUC 3AE3C 4IFFA 3RGUA 4GIFA 1NJIQ 2IBZI 4GODA 1EXIA 4IFDK 3V5BA 3QH9A 3L74G 2NZ2A 1RY3A 2O1JA 3GHGA 4Z1MH 1JM0A 1IK9A 4UB6E 1JY3P 1YTZI 2MKVA 2HYNA 1OWAA 3KXDA 5CCHD 1FJPA 2YO3A 4WY4C 1H0TB 1VQLP 2Z5HA 2B87A 1W2BO 2KXPB 2R5BA 3H1IG 1NO4A 3H1LG 4DOJA 3CCMP 1PIXA 1LWUA 2E5YA 4K35A 2FFDB 1UIIA 3L37A 3P7KA 1EZVG 3PTZA 4CPGA 1LNQA 1JY3N 3D70A 4KT0J 1IFDA 2XNDH 1PGQA 2WVRA 1YHQP 1JY2P 1LTSC 3G3ZA 4LGDE 2PRRA 4W7YA 1N7SB 3AEAC 1W2EA 5BVZA 3U1CA 3CX5H 1KV4A 1HF9A 1Y47A 4O9BA 1DD4A 2YMKA 4PV1C 1FZEA 1NVOA 3H6PA 4H0LB 2G3AA 2ZAEB 3OAKA 1FOSF 1NAYA 2HODB 2YNYA 3L70G 3WUUA 1S5LE 1USDA 3CMAP 1EZVI 3AEFC 2KNCB 3IR9A 3RK3C 4H13B 1JCCA 1SQQJ 2AXCA 4EI2A 3OW2O 3MZWB 4R4MA 1Q81Q 2N1TB 4BRYB 2R5DA 4PV1D 5L8RJ 2IZ1A 2E75D 1KB9I 1LTIC 1OW6A 2NPSD 1BE3D 3K5BA 3AE4C 3VTPC 1GK6A 2IDBA 4H0LC 1L0LG 2WSFH 3H1KE 1H88A 1USEA 1FZCA 3RK3D 1KB9H 1BCCE 1YYCA 5AVSB 2RKLA 3WU2H 4L76A 3CCVP 1KB9D 1CZQA 1JTHB 1K04A 2AEJA 2CPBA 4HYTB 4JPZB 1GU4A 3D6YA 2HODA 4MN4C 3H1JG 1SQVE 2IFNA 2R44A 2M5AA 2WSEJ 1NH4A 4W7ZA 3L75J 1NTMK 3KPEA 5APQA 2C9NY 2W8ZA 3A7OA 1EQ7A 1NYHA 1KILE 3BRVB 3G4SP 3SSUA 1KN7A 2A06G 2OYOA 1IC2A 3FXEA 5APUA 3H1IJ 1JMMA 1U7MA 3H1LJ 1FZCB 1SQXE 1Y9BA 3CLQA 3M9HA 1A02J 1QVFO 1ZN5A 3L73G 2QJKC 1RF1A 1LTJA 1BCCG 1OVVA 1VDFA 2ZXEB 2BASA 3BATA 3GHGC 2KOGA 4I7ZC 5AVRB 1L0NE 1D7MA 1L4AA 1S3JA 1SFCC 1BE3J 2XV5A 3L74J 1SQXG 5H2FE 1H8AA 3L74D 4JF7A 3C1LA 1JY2N 1BDCA 5B5EH 1SVFA 3CXHE 3BASA 1VQ6P 1CI6B 5B5EE 2FYUK 5CCGC 2IFMA 2P7JA 2C0XA 3RK2B 2Y0CA 3C9IA 5DJUB 3LW5J 1HGVA 4OGQB 1VQ7P 1FDOA 1L0NJ 1GL2A 1M1JC 3A2AA 3L72G 4L75A 3RBZA 3RK2D 3G71P 3FXDA 3I56P 3M9QA 2E43A 5GTIE 3B5NA 1LWUB 1EC5A 1P84D 2AEMA 1PPJD 1EDKA 2LR2A 2D2CD 3CWBD 3L71J 3L75G 4DCKA 1FDMA 4JYBA 2Y9ZA 1KILA 3CCUP 4RESB 3R2PA 3KHUA 1T2KC 1LP1B 1QLED 1SQPJ 1DD3A 3AEGC 2BCCJ 3GHGB 1ZR4A 3H1HD 2PP6A 3FWLA 5CCHC 4AUWA 2ITAA 2FYUJ 3L73D 1FS0E 5BU5A 1K8AQ 1OX3A 3AE6C 2ZYAA 2D2CC 2RMZA 4AYCA 2AXTE 3H1KD 2WITA 3MUDC 2AXTH 2Q5UA 1T2KD 1LGHB 1MZ9A 2YKOA 1SQQG 1IFIA 3GW6A 4JBZA 2WQYC 2YXRB 1DEEG 5KJ7A 1M1JB 1OFCX 1PP9G 1SLQA 2B89A 2WT7A 1BSNA 1L0LD 1SQVJ 5KLIC 3VMAA 1VQNP 1N7SA 2FYNC 2H7HA 1DH3A 1M57D 3H32A 1SQPD 4JYCA 1NOHA 1T3UA 1SQBG 1K05A 3VOPA 4BXLA 4DT0A 2GA1A 2K88A 1NTMD 2V7QJ 2FKWB 1KYOE 2J5UA 1JOCA 1E5WA 1ZRTE 3GMAA 3HE5A 4IFMA 4OVNF 4PD4E 3WUVA 1YQ4C 2N9YB 2RH0A 1E79H 1FDIA 1NTZJ 2KLVA 2OTKE 3L72D 3WUTA 5APSA 3TNUB 1LJ2A 3O6QB 1Q86Q 2J59M 1RF1C 1URQD 2E75B 3JCUH 1L0NG 4XFJA 4H0LD 5DJTB 3L4FA 1G1IA 5EFWB 1YBKA 2KLUA 1RQVA 3B5NB 1L4AB 1FC2C 1IJDB 1SQVK 2NPSA 4QMAA 5APTA 3B71A 5KAFE 2W6BA 3V2QA 1R8EA 1NAFA 1NTME 2K9JB 1GMJA 3AE7C 3L70J 3NMDA 1ZRTD 3B5ND 5CCGA 3W68A 5KLVE 1GTWA 1Q82Q 1GW3A 1URQC 1IFPA 3HE5B 3PLNA 1IFJA 2MJZA 1SQXK 2WPQA 2IX7C 3M0AA 1LWUC 1U57A 2P2UA 2FXPA 2SPZA 1X8YA 3VMZA 1AQ5A 3TGUJ 1BE3E 1PPJE 1ZOYC 3M0DC 4PV1B 1N73A 1JO5A 2E76C 1RF0A 1HH0A 2JR8A 3L72J 5CHXA 1BGYE 4LLHA 1H89A 2FYUE 3RK3B 4H44B 1AVOA 3Q2YA 3D6ZA 2Z5IA 4IL6H 2R3CA 5BU8B 1L2PA 1TU3F 2ZYGA 2N1TC 2Y0DA 1KFNA 1M56D 3M06A 3H1HE 4R4LA 1KB9E 1JY3O 2E76D 2QJPC 3LIDA 4N78D 3VP9A 1P84I 2W83C 5AW2B 1DX7A 1N7SD 4WY4D 2JEEA 1S72P 1JEKA 1VL2A 2QEXP 3EFFK 4GT1A 2OYIC 1WMKA 3F5HA 4U3FG 1EZVE 1FAVA 1SQXD 2H89C 3L35A 2PFXA 4XA4A 1N73B 3RL0B 3W67A 2WSFJ 3AEBC 3E7KA 1JNMA 1DIPA 1M8OB 2YMYA 1SQQD 3HD7D 2FFDC 2BEQD 3KYQA 1LT1A 3GF3A 3GG2A 3SFEC 2A45G 1AJYA 1SFCB 3T97A 4YPCA 2HFED 2IBZD 3CPWO 2WZ7A 3CX5E 5H2FH 2WSCJ 2QJKB 2QA4P 3CXHD 1U7JA 1YJ9P 4GOFA 4WY4A 1FOSE 3CC7P 1A02F 1KQGB 1VQPP 3L74E 2E5TA 3Q5RA 1KYOH 2LKMA 2YXQB 2JJLA 4H44C 1FZCC 3VMYA 3MHVA 1LT9A 2YKPA 5KLVG 1RF1B 2O3JA 4Y99C 1EDLA 1HGZA 1NTKJ 1ZW0A 3BCCD 2POHA 3G9RA 3L36A 3L75D 3L71G 4TT3H 3N7NA 4YXDC 5C39A 1YITP 3JSVC 4I6MC 5KTBA 3RL0C 1L0LJ 2FBWC 2KUBA 1CSBA 4U7JA 1LTJC 5CBNA 3TGUG 4RJTA 2R32A 4D6TE 2YIUB 3F89A 1RQUA 4N3YB 2JWAA 3P8MC 1NTMJ 2W6AA 1NTKE 2GM4A 1YJWP 4HJGH 3EWKA 2B88A 2PAJA 4N78E 2AEFA 1PV3A 3H32B 1ZXGA 2QIWA 3MD0A 4D6TJ 4WB4A 2QE7H 2L91A 2K9JA 3H1HJ 5K5GB 1LP1A 5AW0B 2Z4EA 2O1KA 2KNCA 4NPEA 3PRJA 1G2CB 2I1KA 3SWKA 3U59A 3H25A 1PP9E 1VF5B 3GF7A 1BDDA 1MFZA 2JP3A 1GK4A 1S1CX 5AW3B 3WMM0 1SQBK 1QGKB 3O6QA 2G8YA 1LTBC 1M7LA 1QL1A 2WPVB 3UIAA 4KHXA 5GTHE 3CCSP 4ZMDA 1JUNA 2JWDA 4L73A 3C8VA 1KQLA 2XZRA 3P8CD 4ZNCA 1NTKG 2A45H 2OARA 3HUSA 3KDPB 2ZVNB 2P10A 3FWNA 3V4WA 1X22A 1T6AA 5AVQB 3ZDMA 4C7RA 3H1JJ 1L0LK 3ITKA 4IL6X 1HUCA 1VF5C 2HR3A 1SQPE 2M3EA 3KZIH 3R4YA 3V2PA 3OJAB 2OTJP 2A45I 3H1HG 3TGUD 3NFQA 2M5AB 4OH8B 2P1JA 5AVTB 5CJ4A 3CX5I 4M3LA 1OIPA 1HJBA 1SQVG 3CWBG 3N4XA 2C9LY 1Q7YQ 1IK7A 2V4HA 4ASVA 2FYNB 1BGYD 3Q1MA 4EIJA 1FBMA 1VQOP 1KZUB 1ZV8A 5AW1B 1FZGA 1KORA 1GL2B 1VF5D 3FGAD 1AVYA 2A06E 5KAFH 3PHLA 3PP5A 1IZNB 2QJYB 2HG5D 2VRSA 1HTLC 3AE2C 3H1KJ 4HB1A 4KJMA 4JQ0D 4XE5B 4PD4D 3VP8A 2WTYA 1YTZT 2V7QH 2M0BA 2Q1KA 2E74D 1AA0A 1GW4A 1LTAC 2BEZF 1SQPG 2O01N 2OGUA 2UWJE 1X0TA 2WSCH 5AW5B 1K73Q 1JTHA 5AW6B 1H0TA 3KQGA 2WWWA 1KILC 4PD4H 1SS1A 2HLOA 1QL2A 5AVWB 2JO1A 1S2EA 3V6IA 3IFMA 1SFCD 2QM7A 5KLVK 1VQMP 3TNUA 1PP9J 1KTMA 1RE3A 1HVVA 2H88C 4I2LC 4Y28J 3CCQP 3Q5SA 1M90Q 2HPCB 5KKZC 1IO4A 3CL3D 3HD7C 3ABVC 1J1DC 2WPSA 1GL2D 5GTHH 1AFOA 1N8RQ 1JB0J 1OMIA 2JDIH 1URQA 2DW3A 5E79E 1JCDA 5TJHA 3RK2C 5KJ7C 2OYIB 1NU1K 4EYYQ 5TISE 2BCCE 1G1JA 3H1IE 3H1LE 3MGNA 5CMZA 3MUDA 3L70D 1AQTA 3VYIA 2IYPA 3MTUE 3HRNA 1EDJA 3AE1C 1OXZA 2ZT9B 4I1LA 1P84E 4RKUJ 2QSIA 3RL0D 3TYYA 2LXBA 3EFGA 1GDTA 2I1JA 3JCUE 2C0WA 4U3FJ 2Q7CA 2E74B 1PPJG 3H1JD 3L73E 1EDIA 4NPFX 1NKZB 3CC2P 2NRGA 4PD4I 1SQQK 3A3YB 3MIWA 4LC1A 3S1KA 3TSIA 1FZAA 1LT9B 1VPCA 3B8EB 4HKZH 1X79B 2J58A 2KP8A 2NPSC 1NTZD 2K3RA 2OYIA 3E1RA 4RO0A 3Q3DA 3L71E 2CPSA 1Q90D 2KS1B 1XTCC 1BCCD 1FZFA 2HPCA 1AV1A 2QM8A 3IAOA 4UB8H 5APYA 2A06D 2XNXA 3I55P 1VQ4P 4BRYA 1BSHA 3AE9C 2W90A 1YJNP 1UIXA 2ZYDA 4U3FE 3S9OA 1SFCA 2M8RA 5E79H 5APVA 3VN0A 1ZMEC 1WT6A 2M3BA 1IFMA 1OVUA 2O01J 3BCCE 5KAIE 3A5TA 1KYOD 2N1TD 3GLMA 1CW5A 1PZQA 2ZFCA 4ASWA 3A0HE 4H13D 1NTMG 5TISH 3V2RA 3TK1A 1BGYJ 2KI7B 2K37A 2FYUD 3L73J 4C7NA 2KS1A 4W80A 1NTKK 1BCCJ 1NTZK 1S4XA 3II6A 3AECC 3CMEP 3NXSA 4C7NB 2XU6A 2Y0EA 1VQ5P 3CD6P 1Z56A 3HUSC 1G2CA 3B5NC 2KZIA 2WT7B 1Y8AA 1X9VA 4YXWH 1KFMA 1NU1D 1L4AD 2E75C 4H13C 1J1EC 1LTTC 3A0BE 2K9YA 2B9BA 2KZJA 1SQVD 3BCCG 2FXMA 2ZJSE 3IF4A 3SWYA 2OQQA 1URQB 3CCJP 3A0HH 1BGYG 3AEDC 3L70E 5KLVJ 5CCHA 1SQBE 2Q9IA 2OYHB 1VQKP
chains in the Genus database with same CATH topology
1QX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX8 A; 
#chains in the Genus database with same CATH topology
 1XTG B;  1BE3 G;  1M1K Q;  1L4A C;  1KMI Z;  1SQX J;  1N2D C;  1JY2 O;  3IN6 A;  4TLF A;  4UB8 E;  3CWB E;  1J1E B;  3QWO C;  3RBX A;  2ZT9 C;  2RN0 A;  2D2C B;  3CXH H;  1KQF B;  1NHL A;  4D6T D;  3CCR P;  1QVG O;  1NWQ A;  1OW7 A;  1L0L E;  3H1K G;  1RHZ B;  4WBA A;  1KQS O;  4N6J A;  1SQP K;  3U1A A;  4ZKU A;  3V2N A;  2K1A A;  2FXO A;  1NU1 J;  2N9B A;  1IFN A;  3CCL P;  1OZH A;  1PGO A;  1GL2 C;  1KIL B;  1M1J A;  1N7S C;  2IZ0 A;  1QX8 A;  2KK7 A;  2KSJ A;  4DJG A;  1YI2 P;  4IOI H;  2FY8 A;  5AW4 B;  3E1I A;  2IPP A;  3SWF A;  4WVZ A;  3LW5 H;  1FJK A;  5AVV B;  1R5L A;  2E76 B;  3D71 A;  5B66 H;  2JKV A;  2PGD A;  1SQB J;  2Q3I A;  4OGQ C;  1FE6 A;  1QEX A;  1SQB D;  3A0B H;  1GU5 A;  2QJP B;  2H43 A;  2E42 A;  2YO2 A;  2OTL P;  3TF5 A;  4DZO A;  1YQ3 C;  1L0N D;  1RE4 C;  2ZVO B;  2OYH C;  4YTP C;  2O01 H;  4U3F D;  1FU1 A;  4HH2 A;  2IYO A;  1SQQ E;  1JMB A;  3B4S A;  1P84 H;  1KC8 Q;  3HD7 B;  3S4R A;  5AW9 B;  4OGQ D;  1HJ0 A;  1DEB A;  1NU1 G;  3L72 E;  4EOT A;  2QG4 A;  4H44 D;  3EQ2 A;  1MKM A;  1GZL A;  2GUV A;  2KIK A;  1EXJ A;  3P32 A;  1J1D B;  4BWN A;  1PGP A;  2CK3 H;  5KAI H;  3TGU E;  1WRG A;  2FYZ A;  4D6T G;  5AVY B;  3CXH I;  2P58 A;  4WY4 B;  1K9M Q;  1VQ9 P;  1VQ8 P;  3HE4 A;  1MV8 A;  3HTK A;  2BCC G;  3JC2 2;  3AE5 C;  1RH5 B;  3G6E P;  5KLV D;  2XDJ A;  4AQR D;  4B86 A;  1NKN A;  1SP4 A;  2IBZ G;  1S5L H;  1HBW A;  1W5C E;  1ZP0 C;  1OW8 A;  1T8Z A;  5APX A;  3MP7 B;  1RE3 C;  3CX5 D;  1L0N K;  1KYO I;  2KSE A;  1ZLL A;  2QJY C;  4GKG A;  3HD7 A;  4L74 A;  5AVX B;  1PL5 A;  3SFD C;  3TDK A;  3V4Q A;  1NU1 E;  1R5S A;  1NTZ G;  2NPS B;  3O8Z A;  5AVU B;  4C46 A;  1LTJ B;  2QVA A;  5GTI H;  5AW7 B;  1S9K D;  5APW A;  1MUU A;  3HUS B;  3NTN A;  1T3J A;  2QRX A;  3Q5P A;  4NPD A;  2W27 A;  2L5G B;  5M1B A;  3L75 E;  2LXC B;  1HWT C;  3CC4 P;  1NTZ E;  2WSE H;  3OA7 A;  3T97 B;  2Q6Q A;  5B66 E;  2YKQ A;  1CI6 A;  3BRT B;  3HE4 B;  3HTK B;  2XKM A;  1ZR2 A;  2GUS A;  5AVZ B;  3USS A;  2IBZ E;  3BVH A;  1GD2 E;  2W6J H;  3P8C E;  5KKZ B;  4UB6 H;  3M91 A;  4ZKP A;  1N7L A;  3CI9 A;  1LTG C;  1S9K E;  2R3S A;  1LT9 C;  4EDF A;  1NGM B;  1Q2N A;  2Q3E A;  1EZV D;  2ZXX A;  4K3A A;  2H8P D;  3VMX A;  4OWF A;  5CBO A;  2FYU G;  3KZI E;  1PP9 D;  1KD1 Q;  1N73 C;  3AE8 C;  3AEE C;  3CWB J;  3M0D A;  1FZB A;  2WMM A;  3PJS K;  2FFD A;  3H1L D;  3H1I D;  2WSS H;  3L71 D;  3LIE A;  3PH0 A;  5AW8 B;  5KJ7 D;  1J2J B;  2Y9Y A;  3I5C A;  4GDO A;  1RE4 A;  3WU2 E;  2OYH A;  2BCC D;  4IL6 E;  4A7P A;  1YIJ P;  1N86 A;  1MFT A;  2KB7 P;  4PJ0 E;  3RK3 E;  1RF0 C;  1NTK D;  3BCC J;  5CCG D;  5CJ0 A;  4PJ0 H;  2ZT9 D;  2B87 B;  1PGJ A;  5KLI B;  1PFI A;  4WWI A;  2I8D A;  3H1J E;  2WPR A;  4GOE A;  2E74 C;  3CCE P;  2KYV A;  2P67 A;  4Y99 B;  4I7Z B;  3FX0 A;  1S5L X;  3RL0 g;  1OVR A;  3M9B A;  2N1T A;  1KIL D;  2YIU C;  3AE3 C;  4IFF A;  3RGU A;  4GIF A;  1NJI Q;  2IBZ I;  4GOD A;  1EXI A;  4IFD K;  3V5B A;  3QH9 A;  3L74 G;  2NZ2 A;  1RY3 A;  2O1J A;  3GHG A;  4Z1M H;  1JM0 A;  1IK9 A;  4UB6 E;  1JY3 P;  1YTZ I;  2MKV A;  2HYN A;  1OWA A;  3KXD A;  5CCH D;  1FJP A;  2YO3 A;  4WY4 C;  1H0T B;  1VQL P;  2Z5H A;  2B87 A;  1W2B O;  2KXP B;  2R5B A;  3H1I G;  1NO4 A;  3H1L G;  4DOJ A;  3CCM P;  1PIX A;  1LWU A;  2E5Y A;  4K35 A;  2FFD B;  1UII A;  3L37 A;  3P7K A;  1EZV G;  3PTZ A;  4CPG A;  1LNQ A;  1JY3 N;  3D70 A;  4KT0 J;  1IFD A;  2XND H;  1PGQ A;  2WVR A;  1YHQ P;  1JY2 P;  1LTS C;  3G3Z A;  4LGD E;  2PRR A;  4W7Y A;  1N7S B;  3AEA C;  1W2E A;  5BVZ A;  3U1C A;  3CX5 H;  1KV4 A;  1HF9 A;  1Y47 A;  4O9B A;  1DD4 A;  2YMK A;  4PV1 C;  1FZE A;  1NVO A;  3H6P A;  4H0L B;  2G3A A;  2ZAE B;  3OAK A;  1FOS F;  1NAY A;  2HOD B;  2YNY A;  3L70 G;  3WUU A;  1S5L E;  1USD A;  3CMA P;  1EZV I;  3AEF C;  2KNC B;  3IR9 A;  3RK3 C;  4H13 B;  1JCC A;  1SQQ J;  2AXC A;  4EI2 A;  3OW2 O;  3MZW B;  4R4M A;  1Q81 Q;  2N1T B;  4BRY B;  2R5D A;  4PV1 D;  5L8R J;  2IZ1 A;  2E75 D;  1KB9 I;  1LTI C;  1OW6 A;  2NPS D;  1BE3 D;  3K5B A;  3AE4 C;  3VTP C;  1GK6 A;  2IDB A;  4H0L C;  1L0L G;  2WSF H;  3H1K E;  1H88 A;  1USE A;  1FZC A;  3RK3 D;  1KB9 H;  1BCC E;  1YYC A;  5AVS B;  2RKL A;  3WU2 H;  4L76 A;  3CCV P;  1KB9 D;  1CZQ A;  1JTH B;  1K04 A;  2AEJ A;  2CPB A;  4HYT B;  4JPZ B;  1GU4 A;  3D6Y A;  2HOD A;  4MN4 C;  3H1J G;  1SQV E;  2IFN A;  2R44 A;  2M5A A;  2WSE J;  1NH4 A;  4W7Z A;  3L75 J;  1NTM K;  3KPE A;  5APQ A;  2C9N Y;  2W8Z A;  3A7O A;  1EQ7 A;  1NYH A;  1KIL E;  3BRV B;  3G4S P;  3SSU A;  1KN7 A;  2A06 G;  2OYO A;  1IC2 A;  3FXE A;  5APU A;  3H1I J;  1JMM A;  1U7M A;  3H1L J;  1FZC B;  1SQX E;  1Y9B A;  3CLQ A;  3M9H A;  1A02 J;  1QVF O;  1ZN5 A;  3L73 G;  2QJK C;  1RF1 A;  1LTJ A;  1BCC G;  1OVV A;  1VDF A;  2ZXE B;  2BAS A;  3BAT A;  3GHG C;  2KOG A;  4I7Z C;  5AVR B;  1L0N E;  1D7M A;  1L4A A;  1S3J A;  1SFC C;  1BE3 J;  2XV5 A;  3L74 J;  1SQX G;  5H2F E;  1H8A A;  3L74 D;  4JF7 A;  3C1L A;  1JY2 N;  1BDC A;  5B5E H;  1SVF A;  3CXH E;  3BAS A;  1VQ6 P;  1CI6 B;  5B5E E;  2FYU K;  5CCG C;  2IFM A;  2P7J A;  2C0X A;  3RK2 B;  2Y0C A;  3C9I A;  5DJU B;  3LW5 J;  1HGV A;  4OGQ B;  1VQ7 P;  1FDO A;  1L0N J;  1GL2 A;  1M1J C;  3A2A A;  3L72 G;  4L75 A;  3RBZ A;  3RK2 D;  3G71 P;  3FXD A;  3I56 P;  3M9Q A;  2E43 A;  5GTI E;  3B5N A;  1LWU B;  1EC5 A;  1P84 D;  2AEM A;  1PPJ D;  1EDK A;  2LR2 A;  2D2C D;  3CWB D;  3L71 J;  3L75 G;  4DCK A;  1FDM A;  4JYB A;  2Y9Z A;  1KIL A;  3CCU P;  4RES B;  3R2P A;  3KHU A;  1T2K C;  1LP1 B;  1QLE D;  1SQP J;  1DD3 A;  3AEG C;  2BCC J;  3GHG B;  1ZR4 A;  3H1H D;  2PP6 A;  3FWL A;  5CCH C;  4AUW A;  2ITA A;  2FYU J;  3L73 D;  1FS0 E;  5BU5 A;  1K8A Q;  1OX3 A;  3AE6 C;  2ZYA A;  2D2C C;  2RMZ A;  4AYC A;  2AXT E;  3H1K D;  2WIT A;  3MUD C;  2AXT H;  2Q5U A;  1T2K D;  1LGH B;  1MZ9 A;  2YKO A;  1SQQ G;  1IFI A;  3GW6 A;  4JBZ A;  2WQY C;  2YXR B;  1DEE G;  5KJ7 A;  1M1J B;  1OFC X;  1PP9 G;  1SLQ A;  2B89 A;  2WT7 A;  1BSN A;  1L0L D;  1SQV J;  5KLI C;  3VMA A;  1VQN P;  1N7S A;  2FYN C;  2H7H A;  1DH3 A;  1M57 D;  3H32 A;  1SQP D;  4JYC A;  1NOH A;  1T3U A;  1SQB G;  1K05 A;  3VOP A;  4BXL A;  4DT0 A;  2GA1 A;  2K88 A;  1NTM D;  2V7Q J;  2FKW B;  1KYO E;  2J5U A;  1JOC A;  1E5W A;  1ZRT E;  3GMA A;  3HE5 A;  4IFM A;  4OVN F;  4PD4 E;  3WUV A;  1YQ4 C;  2N9Y B;  2RH0 A;  1E79 H;  1FDI A;  1NTZ J;  2KLV A;  2OTK E;  3L72 D;  3WUT A;  5APS A;  3TNU B;  1LJ2 A;  3O6Q B;  1Q86 Q;  2J59 M;  1RF1 C;  1URQ D;  2E75 B;  3JCU H;  1L0N G;  4XFJ A;  4H0L D;  5DJT B;  3L4F A;  1G1I A;  5EFW B;  1YBK A;  2KLU A;  1RQV A;  3B5N B;  1L4A B;  1FC2 C;  1IJD B;  1SQV K;  2NPS A;  4QMA A;  5APT A;  3B71 A;  5KAF E;  2W6B A;  3V2Q A;  1R8E A;  1NAF A;  1NTM E;  2K9J B;  1GMJ A;  3AE7 C;  3L70 J;  3NMD A;  1ZRT D;  3B5N D;  5CCG A;  3W68 A;  5KLV E;  1GTW A;  1Q82 Q;  1GW3 A;  1URQ C;  1IFP A;  3HE5 B;  3PLN A;  1IFJ A;  2MJZ A;  1SQX K;  2WPQ A;  2IX7 C;  3M0A A;  1LWU C;  1U57 A;  2P2U A;  2FXP A;  2SPZ A;  1X8Y A;  3VMZ A;  1AQ5 A;  3TGU J;  1BE3 E;  1PPJ E;  1ZOY C;  3M0D C;  4PV1 B;  1N73 A;  1JO5 A;  2E76 C;  1RF0 A;  1HH0 A;  2JR8 A;  3L72 J;  5CHX A;  1BGY E;  4LLH A;  1H89 A;  2FYU E;  3RK3 B;  4H44 B;  1AVO A;  3Q2Y A;  3D6Z A;  2Z5I A;  4IL6 H;  2R3C A;  5BU8 B;  1L2P A;  1TU3 F;  2ZYG A;  2N1T C;  2Y0D A;  1KFN A;  1M56 D;  3M06 A;  3H1H E;  4R4L A;  1KB9 E;  1JY3 O;  2E76 D;  2QJP C;  3LID A;  4N78 D;  3VP9 A;  1P84 I;  2W83 C;  5AW2 B;  1DX7 A;  1N7S D;  4WY4 D;  2JEE A;  1S72 P;  1JEK A;  1VL2 A;  2QEX P;  3EFF K;  4GT1 A;  2OYI C;  1WMK A;  3F5H A;  4U3F G;  1EZV E;  1FAV A;  1SQX D;  2H89 C;  3L35 A;  2PFX A;  4XA4 A;  1N73 B;  3RL0 B;  3W67 A;  2WSF J;  3AEB C;  3E7K A;  1JNM A;  1DIP A;  1M8O B;  2YMY A;  1SQQ D;  3HD7 D;  2FFD C;  2BEQ D;  3KYQ A;  1LT1 A;  3GF3 A;  3GG2 A;  3SFE C;  2A45 G;  1AJY A;  1SFC B;  3T97 A;  4YPC A;  2HFE D;  2IBZ D;  3CPW O;  2WZ7 A;  3CX5 E;  5H2F H;  2WSC J;  2QJK B;  2QA4 P;  3CXH D;  1U7J A;  1YJ9 P;  4GOF A;  4WY4 A;  1FOS E;  3CC7 P;  1A02 F;  1KQG B;  1VQP P;  3L74 E;  2E5T A;  3Q5R A;  1KYO H;  2LKM A;  2YXQ B;  2JJL A;  4H44 C;  1FZC C;  3VMY A;  3MHV A;  1LT9 A;  2YKP A;  5KLV G;  1RF1 B;  2O3J A;  4Y99 C;  1EDL A;  1HGZ A;  1NTK J;  1ZW0 A;  3BCC D;  2POH A;  3G9R A;  3L36 A;  3L75 D;  3L71 G;  4TT3 H;  3N7N A;  4YXD C;  5C39 A;  1YIT P;  3JSV C;  4I6M C;  5KTB A;  3RL0 C;  1L0L J;  2FBW C;  2KUB A;  1CSB A;  4U7J A;  1LTJ C;  5CBN A;  3TGU G;  4RJT A;  2R32 A;  4D6T E;  2YIU B;  3F89 A;  1RQU A;  4N3Y B;  2JWA A;  3P8M C;  1NTM J;  2W6A A;  1NTK E;  2GM4 A;  1YJW P;  4HJG H;  3EWK A;  2B88 A;  2PAJ A;  4N78 E;  2AEF A;  1PV3 A;  3H32 B;  1ZXG A;  2QIW A;  3MD0 A;  4D6T J;  4WB4 A;  2QE7 H;  2L91 A;  2K9J A;  3H1H J;  5K5G B;  1LP1 A;  5AW0 B;  2Z4E A;  2O1K A;  2KNC A;  4NPE A;  3PRJ A;  1G2C B;  2I1K A;  3SWK A;  3U59 A;  3H25 A;  1PP9 E;  1VF5 B;  3GF7 A;  1BDD A;  1MFZ A;  2JP3 A;  1GK4 A;  1S1C X;  5AW3 B;  3WMM 0;  1SQB K;  1QGK B;  3O6Q A;  2G8Y A;  1LTB C;  1M7L A;  1QL1 A;  2WPV B;  3UIA A;  4KHX A;  5GTH E;  3CCS P;  4ZMD A;  1JUN A;  2JWD A;  4L73 A;  3C8V A;  1KQL A;  2XZR A;  3P8C D;  4ZNC A;  1NTK G;  2A45 H;  2OAR A;  3HUS A;  3KDP B;  2ZVN B;  2P10 A;  3FWN A;  3V4W A;  1X22 A;  1T6A A;  5AVQ B;  3ZDM A;  4C7R A;  3H1J J;  1L0L K;  3ITK A;  4IL6 X;  1HUC A;  1VF5 C;  2HR3 A;  1SQP E;  2M3E A;  3KZI H;  3R4Y A;  3V2P A;  3OJA B;  2OTJ P;  2A45 I;  3H1H G;  3TGU D;  3NFQ A;  2M5A B;  4OH8 B;  2P1J A;  5AVT B;  5CJ4 A;  3CX5 I;  4M3L A;  1OIP A;  1HJB A;  1SQV G;  3CWB G;  3N4X A;  2C9L Y;  1Q7Y Q;  1IK7 A;  2V4H A;  4ASV A;  2FYN B;  1BGY D;  3Q1M A;  4EIJ A;  1FBM A;  1VQO P;  1KZU B;  1ZV8 A;  5AW1 B;  1FZG A;  1KOR A;  1GL2 B;  1VF5 D;  3FGA D;  1AVY A;  2A06 E;  5KAF H;  3PHL A;  3PP5 A;  1IZN B;  2QJY B;  2HG5 D;  2VRS A;  1HTL C;  3AE2 C;  3H1K J;  4HB1 A;  4KJM A;  4JQ0 D;  4XE5 B;  4PD4 D;  3VP8 A;  2WTY A;  1YTZ T;  2V7Q H;  2M0B A;  2Q1K A;  2E74 D;  1AA0 A;  1GW4 A;  1LTA C;  2BEZ F;  1SQP G;  2O01 N;  2OGU A;  2UWJ E;  1X0T A;  2WSC H;  5AW5 B;  1K73 Q;  1JTH A;  5AW6 B;  1H0T A;  3KQG A;  2WWW A;  1KIL C;  4PD4 H;  1SS1 A;  2HLO A;  1QL2 A;  5AVW B;  2JO1 A;  1S2E A;  3V6I A;  3IFM A;  1SFC D;  2QM7 A;  5KLV K;  1VQM P;  3TNU A;  1PP9 J;  1KTM A;  1RE3 A;  1HVV A;  2H88 C;  4I2L C;  4Y28 J;  3CCQ P;  3Q5S A;  1M90 Q;  2HPC B;  5KKZ C;  1IO4 A;  3CL3 D;  3HD7 C;  3ABV C;  1J1D C;  2WPS A;  1GL2 D;  5GTH H;  1AFO A;  1N8R Q;  1JB0 J;  1OMI A;  2JDI H;  1URQ A;  2DW3 A;  5E79 E;  1JCD A;  5TJH A;  3RK2 C;  5KJ7 C;  2OYI B;  1NU1 K;  4EYY Q;  5TIS E;  2BCC E;  1G1J A;  3H1I E;  3H1L E;  3MGN A;  5CMZ A;  3MUD A;  3L70 D;  1AQT A;  3VYI A;  2IYP A;  3MTU E;  3HRN A;  1EDJ A;  3AE1 C;  1OXZ A;  2ZT9 B;  4I1L A;  1P84 E;  4RKU J;  2QSI A;  3RL0 D;  3TYY A;  2LXB A;  3EFG A;  1GDT A;  2I1J A;  3JCU E;  2C0W A;  4U3F J;  2Q7C A;  2E74 B;  1PPJ G;  3H1J D;  3L73 E;  1EDI A;  4NPF X;  1NKZ B;  3CC2 P;  2NRG A;  4PD4 I;  1SQQ K;  3A3Y B;  3MIW A;  4LC1 A;  3S1K A;  3TSI A;  1FZA A;  1LT9 B;  1VPC A;  3B8E B;  4HKZ H;  1X79 B;  2J58 A;  2KP8 A;  2NPS C;  1NTZ D;  2K3R A;  2OYI A;  3E1R A;  4RO0 A;  3Q3D A;  3L71 E;  2CPS A;  1Q90 D;  2KS1 B;  1XTC C;  1BCC D;  1FZF A;  2HPC A;  1AV1 A;  2QM8 A;  3IAO A;  4UB8 H;  5APY A;  2A06 D;  2XNX A;  3I55 P;  1VQ4 P;  4BRY A;  1BSH A;  3AE9 C;  2W90 A;  1YJN P;  1UIX A;  2ZYD A;  4U3F E;  3S9O A;  1SFC A;  2M8R A;  5E79 H;  5APV A;  3VN0 A;  1ZME C;  1WT6 A;  2M3B A;  1IFM A;  1OVU A;  2O01 J;  3BCC E;  5KAI E;  3A5T A;  1KYO D;  2N1T D;  3GLM A;  1CW5 A;  1PZQ A;  2ZFC A;  4ASW A;  3A0H E;  4H13 D;  1NTM G;  5TIS H;  3V2R A;  3TK1 A;  1BGY J;  2KI7 B;  2K37 A;  2FYU D;  3L73 J;  4C7N A;  2KS1 A;  4W80 A;  1NTK K;  1BCC J;  1NTZ K;  1S4X A;  3II6 A;  3AEC C;  3CME P;  3NXS A;  4C7N B;  2XU6 A;  2Y0E A;  1VQ5 P;  3CD6 P;  1Z56 A;  3HUS C;  1G2C A;  3B5N C;  2KZI A;  2WT7 B;  1Y8A A;  1X9V A;  4YXW H;  1KFM A;  1NU1 D;  1L4A D;  2E75 C;  4H13 C;  1J1E C;  1LTT C;  3A0B E;  2K9Y A;  2B9B A;  2KZJ A;  1SQV D;  3BCC G;  2FXM A;  2ZJS E;  3IF4 A;  3SWY A;  2OQQ A;  1URQ B;  3CCJ P;  3A0H H;  1BGY G;  3AED C;  3L70 E;  5KLV J;  5CCH A;  1SQB E;  2Q9I A;  2OYH B;  1VQK P; 
#chains in the Genus database with same CATH homology
 1QX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...