1QXKA

Monoacid-based, cell permeable, selective inhibitors of protein tyrosine phosphatase 1b
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
282
structure length
282
Chain Sequence
EMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a Monoacid-Based, Cell Permeable, Selective Inhibitor of Protein Tyrosine Phosphatase 1B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Protein-tyrosine phosphatase, non-receptor type 1
total genus 98
structure length 282
sequence length 282
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00102 Y_phosphatase Protein-tyrosine phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 1qxkA00
2RF6A 1OEUA 2FJMA 3QKQA 1BZHA 1C87A 4OHEA 2MBCA 3MOZA 5HDEA 2DXPA 2WGPA 3B7OA 4RI4A 2CNEA 4WU2A 1XBOA 1NNYA 5KA4A 2H02A 4H34A 3ZV2A 4I8NA 4H1OA 2CNFA 4GRYA 3H2XA 3QCEA 2GP0A 1YTWA 3AWEA 3V0JA 2VEXA 1LQFA 1NL9A 1KAVA 2CFVA 1YZ4A 1Q1MA 1U26A 3F81A 2B07A 4QBEA 4KI9A 2OOQA 2NZ6A 4NYHA 2CM2A 1Q6PA 2VEUA 3QKPA 2CNIA 2F6ZA 4B04A 1XXPA 2QBQA 2I6PA 4R0TA 5GTJA 2I42A 1NZ7A 3QCMA 2H04A 2BV5A 1NWLA 2NT2A 4OHLA 3N0AA 3D44A 3V0IA 4D3RA 4Y14A 2B4UA 1Q6TA 3QCIA 3I7ZA 1JF7A 1V3AA 2AZRA 3V0FA 2P4DA 2F71A 1M3GA 3SR9A 5BX1A 1L8KA 1U24A 3ZM2A 5KADA 1G1FA 4YAAA 2IMGA 1GFYA 1KAKA 3QCHA 5KA9A 2CMAA 2I6MA 1YTNA 2CM7A 2FH7A 1C84A 5K22A 4PYHA 4DGXA 3O4UA 2B4OA 3OLRA 4GS0A 2Q47A 2BIJA 1C83A 1OHCA 5K9VA 4KYRA 3S4OA 1WAXA 1EEOA 3A5JA 1YPTA 2QDCA 3QCJA 3S4EA 2B4PA 3RGOA 1T49A 1T48A 5I6VA 5K23A 2NT7A 1PH0A 5KAAA 3NMEA 2CNGA 1LARA 5KA0A 2HC1A 4QUNA 2I3UA 2QBSA 4QAHA 4ZN5A 2OZ5A 1ONYA 4OHIA 3ZM1A 5KA8A 4J51A 2BZLA 4R0SA 3M4UA 1GWZA 1PTUA 3EZZA 3LJ8A 3BM8A 4HJPA 3S3HA 2CMBA 1LYVA 4D3QA 2GWOA 4QBWA 1XRIA 3BRHA 4RH5A 1G1GA 1I57A 1Q6JA 3CM3A 2Q05A 4RHGA 4OHDA 3O3LA 3EMUA 1ZC0A 4QUMA 3QCLA 2HVLA 3SMEA 3OMHA 4IKCA 3MOWA 4GRZA 1RPMA 2F46A 1AAXA 3V0DA 4HJQA 4BPCA 4AZ1A 2F6VA 2HCMA 1XXVA 5IBSA 1WRMA 1PA9A 3I36A 1OHDA 3V0EA 2HY3A 3S3FA 4NWGA 1OHEA 1OEOX 5KA2A 2PQ5A 2VEWA 3QCGA 2PSZA 2HB1A 2J16B 2Y96A 2Y2FA 4DGPA 5BZZA 5EHPA 2B3OA 2M3VA 1G4WR 2C46A 2G6ZA 2F70A 1Q6MA 1ZCKA 2PT0A 5K25A 2QEPA 1PTTA 4D3PA 5KABA 1X24A 4Z6BA 2H03A 3ZM3A 1SUGA 4NNDA 1YGRA 3ZMQA 3S3KA 1OETA 2I4EA 5KA7A 4NX8A 3F99A 3RGQA 4RI5A 2AHSA 1YTSA 2FJNA 3QCFA 4GE6A 1ECVA 1I9SA 1PTYA 2I4GA 4WOHA 3RO1A 3BLTA 1MKPA 2CM8A 5KA1A 1D5RA 4RDDA 1OEVA 3D42A 2HXPA 3D9CA 2I3RA 3F41A 5BZXA 3O4SA 1RXDA 2PI7A 2OUDA 4GFUA 1R6HA 1T4JA 1L8GA 1EENA 2VEVA 1YGUA 1OEMX 4WTYA 2J17A 2GJTA 3D1HA 4GE2A 2F6WA 2QBPA 1YWFA 2HNQA 2ESBA 4R30A 1NWEA 3QCNA 2H4VA 3ZM0A 1C85A 2BGEA 4MBBA 4KYQA 3S3EA 4BJOA 4NWFA 2JJDA 1A5YA 2SHPA 4Y2EA 2QCJA 2I4HA 3F9AA 3I80A 3U96A 5KA3A 2A8BA 1J4XA 4ICZA 2NV5A 4HRFA 1YFOA 1BZCA 5J8RA 3MMJA 4RKKA 1OESA 2QCTA 3AWGA 4WU3A 3ZMPA 1ZZWA 2I6IA 2HC2A 2B49A 4PVGA 1NO6A 1QZ0A 3EB1A 4OHHA 4RH9A 2P6XA 3QCKA 2QDPA 1G7FA 4ZRTA 2B4SA 5M43A 3PS5A 2E0TA 5K24A 2HNPA 5KACA 5LXQB 5IBMA 1FPRA 2PBNA 2YDUA 3F9BA 5MMZB 2ZMMA 5EHRA 3O4TA 2A3KA 2PA5A 3QCDA 3D1QA 3GXHA 3GXGA 2G59A 1G4US 1PTVA 2I5XA 4JMKA 2OC3A 4GWFA 1Q6NA 3V0GA 1C86A 2I1YA 1PA1A 4ERCA 1G1HA 1U25A 2I6JA 4TVVA 4JBCA 3QCCA 1BZJA 2F6FA 2F6TA 1ZCLA 3QCBA 1JLNA 1YN9A 5K9WA 4JMJA 2NTAA 2NLKA 2CMCA 2CJZA 3CWEA 4JNBA 1I9TA 2H4GA 1WCHA 3EAXA 4GFVA 1QXKA 5AWXA 1ONZA 2H4KA 4QAPA 2CM3A 2I75A 1PXHA 1C88A 3AWFA 3RZ2A 1XM2A 1VHRA 3EU0A 1P15A 1Q6SA 3BLUA 2F6YA 4GE5A 2QDMA 4S0GA 1PYNA 2BGDA 1FPZA 2J16A 2R0BA 1G7GA 2CNHA 1FQ1A 5BUGA 4YR8B 2ZN7A 3V0HA 2C7SA 2I6OA 3A5KA 3D1OA 3O5XA 2VEYA 4ZI4A 2QBRA
chains in the Genus database with same CATH superfamily
2RF6A 1OEUA 2FJMA 2X5OA 1BZHA 1C87A 3QKQA 4OHEA 2MBCA 3MOZA 5HDEA 2DXPA 1UAGA 2WGPA 4CVLA 3B7OA 4RI4A 2CNEA 4WU2A 1XBOA 2JFHA 1NNYA 5KA4A 2H02A 4H34A 3ZV2A 4I8NA 4H1OA 2CNFA 4GRYA 3H2XA 3QCEA 2GP0A 1YTWA 3AWEA 3V0JA 2VEXA 1LQFA 1NL9A 1KAVA 2CFVA 1YZ4A 1Q1MA 3MVNA 1U26A 3F81A 2B07A 4QBEA 4KI9A 2OOQA 2GCAA 2NZ6A 4NYHA 2CM2A 1Q6PA 2VEUA 3QKPA 2CNIA 2F6ZA 4B04A 1E8CA 1XXPA 2QBQA 2I6PA 4R0TA 5GTJA 2I42A 2VTEA 1W78A 1NZ7A 3QCMA 4UAGA 1P3DA 2H04A 2BV5A 1NWLA 2NT2A 2Y67A 4OHLA 3N0AA 3D44A 3V0IA 2GC5A 4D3RA 4Y14A 1J6UA 2B4UA 1Q6TA 3QCIA 3I7ZA 1JF7A 1V3AA 2AZRA 3V0FA 2P4DA 2F71A 1E0DA 1M3GA 3SR9A 4QF5A 2Y68A 5BX1A 1L8KA 1U24A 1EEHA 3ZM2A 5KADA 1G1FA 4YAAA 2IMGA 1GFYA 1KAKA 3QCHA 5KA9A 2CMAA 2I6MA 1YTNA 2CM7A 2FH7A 1C84A 5K22A 4PYHA 4DGXA 2JFFA 5A5FA 3O4UA 2B4OA 3OLRA 4GS0A 2Q47A 2BIJA 1C83A 1JBWA 1OHCA 5K9VA 4KYRA 3S4OA 1WAXA 1EEOA 3A5JA 1YPTA 2QDCA 3QCJA 3S4EA 2B4PA 4ZIYA 3RGOA 1T49A 1T48A 5I6VA 5K23A 2NT7A 1PH0A 5KAAA 3NMEA 2CNGA 1LARA 5KA0A 2HC1A 4QUNA 3QCZA 2I3UA 2QBSA 4QAHA 4ZN5A 2OZ5A 1ONYA 4OHIA 3ZM1A 5KA8A 4J51A 2BZLA 4R0SA 3M4UA 1GWZA 1PTUA 3EZZA 3LJ8A 3BM8A 4HJPA 3S3HA 2CMBA 1LYVA 4D3QA 2GWOA 4QBWA 1XRIA 3BRHA 4RH5A 1G1GA 1I57A 1Q6JA 3CM3A 2Q05A 2VOSA 4RHGA 4OHDA 3O3LA 3EMUA 1ZC0A 1W7KA 4QUMA 3QCLA 2HVLA 3SMEA 3OMHA 4IKCA 3MOWA 4GRZA 1RPMA 2F46A 1AAXA 3V0DA 4HJQA 4BPCA 4AZ1A 2F6VA 2HCMA 2F00A 1XXVA 5IBSA 1WRMA 1PA9A 3I36A 1OHDA 3V0EA 2HY3A 3S3FA 3NRSA 4NWGA 1OHEA 1OEOX 5KA2A 2VORA 2PQ5A 2VEWA 2PSZA 2HB1A 2Y96A 2J16B 2VTDA 2Y2FA 3QCGA 4DGPA 5BZZA 1P31A 5EHPA 2B3OA 3LK7A 2M3VA 1G4WR 2C46A 2G6ZA 2F70A 1Q6MA 1ZCKA 2PT0A 5K25A 2WJPA 2QEPA 3UAGA 1PTTA 4D3PA 5KABA 1X24A 4Z6BA 2H03A 3ZM3A 1SUGA 4NNDA 1YGRA 3ZMQA 3S3KA 1OETA 2UAGA 2I4EA 5KA7A 4NX8A 3F99A 3RGQA 4RI5A 2AHSA 1YTSA 2UUPA 2FJNA 3QCFA 4GE6A 4CVKA 1ECVA 1I9SA 1PTYA 2I4GA 4WOHA 3RO1A 3BLTA 3PYZA 1MKPA 2CM8A 5KA1A 1D5RA 4RDDA 1OEVA 3D42A 2HXPA 3D9CA 1GQQA 2I3RA 3F41A 5BZXA 3ZL8A 3O4SA 1RXDA 2PI7A 2JFGA 2OUDA 4GFUA 1R6HA 1T4JA 1L8GA 1EENA 2VEVA 1YGUA 1OEMX 4WTYA 2J17A 2GJTA 3D1HA 4GE2A 2F6WA 2QBPA 1YWFA 4C12A 2HNQA 2ESBA 4R30A 1NWEA 3QCNA 2H4VA 3ZM0A 1C85A 2BGEA 4MBBA 4KYQA 3S3EA 4BJOA 4NWFA 2JJDA 1A5YA 2SHPA 4Y2EA 2QCJA 1O5ZA 2I4HA 3F9AA 2Y1OA 3I80A 3U96A 5KA3A 2A8BA 1J4XA 4ICZA 2NV5A 4HRFA 1YFOA 3HN7A 1BZCA 5J8RA 3MMJA 4RKKA 1OESA 2QCTA 3AWGA 3ZM5A 4WU3A 3ZMPA 1ZZWA 2I6IA 2HC2A 2B49A 4PVGA 1NO6A 1QZ0A 3EB1A 4OHHA 2AM1A 4RH9A 2P6XA 2Y66A 3QCKA 2QDPA 1G7FA 4ZRTA 2B4SA 5M43A 2XPCA 3PS5A 2E0TA 5K24A 2HNPA 2GCBA 5KACA 1FGSA 5LXQB 5IBMA 1FPRA 2PBNA 2YDUA 3F9BA 5MMZB 2ZMMA 2UUOA 5EHRA 3O4TA 2A3KA 2PA5A 3QCDA 3D1QA 3GXHA 3GXGA 2G59A 1G4US 1PTVA 2I5XA 4JMKA 2OC3A 4GWFA 1Q6NA 3V0GA 1C86A 4BUCA 2I1YA 1PA1A 4ERCA 1G1HA 1GG4A 4C13A 1U25A 4BUBA 2I6JA 4HV4A 4TVVA 4JBCA 3QCCA 1BZJA 2F6FA 2F6TA 1ZCLA 3QCBA 1JBVA 1JLNA 1YN9A 5K9WA 4JMJA 2NTAA 2NLKA 2CMCA 2CJZA 3CWEA 4JNBA 1I9TA 2H4GA 1WCHA 3EAXA 4GFVA 4QDIA 1QXKA 5AWXA 1ONZA 2H4KA 4QAPA 2CM3A 2I75A 1PXHA 1C88A 5A5EA 3AWFA 3RZ2A 1XM2A 1VHRA 3EU0A 2XJAA 1P15A 4CVMA 1Q6SA 3BLUA 2F6YA 4GE5A 2QDMA 4S0GA 1PYNA 2BGDA 1FPZA 2J16A 2R0BA 1G7GA 1GQYA 2CNHA 1FQ1A 2AM2A 5BUGA 3ZM6A 4YR8B 3N2AA 2ZN7A 3V0HA 2C7SA 2GC6A 2WTZA 2I6OA 3A5KA 3D1OA 3O5XA 2VEYA 4ZI4A 2QBRA
chains in the Genus database with same CATH topology
2RF6A 1OEUA 2FJMA 3QKQA 1BZHA 1C87A 4OHEA 2MBCA 3MOZA 5HDEA 2DXPA 2WGPA 3B7OA 4RI4A 2CNEA 4WU2A 1XBOA 1NNYA 5KA4A 2H02A 4H34A 3ZV2A 4I8NA 4H1OA 2CNFA 4GRYA 3H2XA 3QCEA 2GP0A 1YTWA 3AWEA 3V0JA 2VEXA 1LQFA 1NL9A 1KAVA 2CFVA 1YZ4A 1Q1MA 1U26A 3F81A 2B07A 4QBEA 4KI9A 2OOQA 2NZ6A 4NYHA 2CM2A 1Q6PA 2VEUA 3QKPA 2CNIA 2F6ZA 4B04A 1XXPA 2QBQA 2I6PA 4R0TA 5GTJA 2I42A 1NZ7A 3QCMA 2H04A 2BV5A 1NWLA 2NT2A 4OHLA 3N0AA 3D44A 3V0IA 4D3RA 4Y14A 2B4UA 1Q6TA 3QCIA 3I7ZA 1JF7A 1V3AA 2AZRA 3V0FA 2P4DA 2F71A 1M3GA 3SR9A 5BX1A 1L8KA 1U24A 3ZM2A 5KADA 1G1FA 4YAAA 2IMGA 1GFYA 1KAKA 3QCHA 5KA9A 2CMAA 2I6MA 1YTNA 2CM7A 2FH7A 1C84A 5K22A 4PYHA 4DGXA 3O4UA 2B4OA 3OLRA 4GS0A 2Q47A 2BIJA 1C83A 1OHCA 5K9VA 4KYRA 3S4OA 1WAXA 1EEOA 3A5JA 1YPTA 2QDCA 3QCJA 3S4EA 2B4PA 3RGOA 1T49A 1T48A 5I6VA 5K23A 2NT7A 1PH0A 5KAAA 3NMEA 2CNGA 1LARA 5KA0A 2HC1A 4QUNA 2I3UA 2QBSA 4QAHA 4ZN5A 2OZ5A 1ONYA 4OHIA 3ZM1A 5KA8A 4J51A 2BZLA 4R0SA 3M4UA 1GWZA 1PTUA 3EZZA 3LJ8A 3BM8A 4HJPA 3S3HA 2CMBA 1LYVA 4D3QA 2GWOA 4QBWA 1XRIA 3BRHA 4RH5A 1G1GA 1I57A 1Q6JA 3CM3A 2Q05A 4RHGA 4OHDA 3O3LA 3EMUA 1ZC0A 4QUMA 3QCLA 2HVLA 3SMEA 3OMHA 4IKCA 3MOWA 4GRZA 1RPMA 2F46A 1AAXA 3V0DA 4HJQA 4BPCA 4AZ1A 2F6VA 2HCMA 1XXVA 5IBSA 1WRMA 1PA9A 3I36A 1OHDA 3V0EA 2HY3A 3S3FA 4NWGA 1OHEA 1OEOX 5KA2A 2PQ5A 2VEWA 3QCGA 2PSZA 2HB1A 2J16B 2Y96A 2Y2FA 4DGPA 5BZZA 5EHPA 2B3OA 2M3VA 1G4WR 2C46A 2G6ZA 2F70A 1Q6MA 1ZCKA 2PT0A 5K25A 2QEPA 1PTTA 4D3PA 5KABA 1X24A 4Z6BA 2H03A 3ZM3A 1SUGA 4NNDA 1YGRA 3ZMQA 3S3KA 1OETA 2I4EA 5KA7A 4NX8A 3F99A 3RGQA 4RI5A 2AHSA 1YTSA 2FJNA 3QCFA 4GE6A 1ECVA 1I9SA 1PTYA 2I4GA 4WOHA 3RO1A 3BLTA 1MKPA 2CM8A 5KA1A 1D5RA 4RDDA 1OEVA 3D42A 2HXPA 3D9CA 2I3RA 3F41A 5BZXA 3O4SA 1RXDA 2PI7A 2OUDA 4GFUA 1R6HA 1T4JA 1L8GA 1EENA 2VEVA 1YGUA 1OEMX 4WTYA 2J17A 2GJTA 3D1HA 4GE2A 2F6WA 2QBPA 1YWFA 2HNQA 2ESBA 4R30A 1NWEA 3QCNA 2H4VA 3ZM0A 1C85A 2BGEA 4MBBA 4KYQA 3S3EA 4BJOA 4NWFA 2JJDA 1A5YA 2SHPA 4Y2EA 2QCJA 2I4HA 3F9AA 3I80A 3U96A 5KA3A 2A8BA 1J4XA 4ICZA 2NV5A 4HRFA 1YFOA 1BZCA 5J8RA 3MMJA 4RKKA 1OESA 2QCTA 3AWGA 4WU3A 3ZMPA 1ZZWA 2I6IA 2HC2A 2B49A 4PVGA 1NO6A 1QZ0A 3EB1A 4OHHA 4RH9A 2P6XA 3QCKA 2QDPA 1G7FA 4ZRTA 2B4SA 5M43A 3PS5A 2E0TA 5K24A 2HNPA 5KACA 5LXQB 5IBMA 1FPRA 2PBNA 2YDUA 3F9BA 5MMZB 2ZMMA 5EHRA 3O4TA 2A3KA 2PA5A 3QCDA 3D1QA 3GXHA 3GXGA 2G59A 1G4US 1PTVA 2I5XA 4JMKA 2OC3A 4GWFA 1Q6NA 3V0GA 1C86A 2I1YA 1PA1A 4ERCA 1G1HA 1U25A 2I6JA 4TVVA 4JBCA 3QCCA 1BZJA 2F6FA 2F6TA 1ZCLA 3QCBA 1JLNA 1YN9A 5K9WA 4JMJA 2NTAA 2NLKA 2CMCA 2CJZA 3CWEA 4JNBA 1I9TA 2H4GA 1WCHA 3EAXA 4GFVA 1QXKA 5AWXA 1ONZA 2H4KA 4QAPA 2CM3A 2I75A 1PXHA 1C88A 3AWFA 3RZ2A 1XM2A 1VHRA 3EU0A 1P15A 1Q6SA 3BLUA 2F6YA 4GE5A 2QDMA 4S0GA 1PYNA 2BGDA 1FPZA 2J16A 2R0BA 1G7GA 2CNHA 1FQ1A 5BUGA 4YR8B 2ZN7A 3V0HA 2C7SA 2I6OA 3A5KA 3D1OA 3O5XA 2VEYA 4ZI4A 2QBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RF6 A;  1OEU A;  2FJM A;  3QKQ A;  1BZH A;  1C87 A;  4OHE A;  2MBC A;  3MOZ A;  5HDE A;  2DXP A;  2WGP A;  3B7O A;  4RI4 A;  2CNE A;  4WU2 A;  1XBO A;  1NNY A;  5KA4 A;  2H02 A;  4H34 A;  3ZV2 A;  4I8N A;  4H1O A;  2CNF A;  4GRY A;  3H2X A;  3QCE A;  2GP0 A;  1YTW A;  3AWE A;  3V0J A;  2VEX A;  1LQF A;  1NL9 A;  1KAV A;  2CFV A;  1YZ4 A;  1Q1M A;  1U26 A;  3F81 A;  2B07 A;  4QBE A;  4KI9 A;  2OOQ A;  2NZ6 A;  4NYH A;  2CM2 A;  1Q6P A;  2VEU A;  3QKP A;  2CNI A;  2F6Z A;  4B04 A;  1XXP A;  2QBQ A;  2I6P A;  4R0T A;  5GTJ A;  2I42 A;  1NZ7 A;  3QCM A;  2H04 A;  2BV5 A;  1NWL A;  2NT2 A;  4OHL A;  3N0A A;  3D44 A;  3V0I A;  4D3R A;  4Y14 A;  2B4U A;  1Q6T A;  3QCI A;  3I7Z A;  1JF7 A;  1V3A A;  2AZR A;  3V0F A;  2P4D A;  2F71 A;  1M3G A;  3SR9 A;  5BX1 A;  1L8K A;  1U24 A;  3ZM2 A;  5KAD A;  1G1F A;  4YAA A;  2IMG A;  1GFY A;  1KAK A;  3QCH A;  5KA9 A;  2CMA A;  2I6M A;  1YTN A;  2CM7 A;  2FH7 A;  1C84 A;  5K22 A;  4PYH A;  4DGX A;  3O4U A;  2B4O A;  3OLR A;  4GS0 A;  2Q47 A;  2BIJ A;  1C83 A;  1OHC A;  5K9V A;  4KYR A;  3S4O A;  1WAX A;  1EEO A;  3A5J A;  1YPT A;  2QDC A;  3QCJ A;  3S4E A;  2B4P A;  3RGO A;  1T49 A;  1T48 A;  5I6V A;  5K23 A;  2NT7 A;  1PH0 A;  5KAA A;  3NME A;  2CNG A;  1LAR A;  5KA0 A;  2HC1 A;  4QUN A;  2I3U A;  2QBS A;  4QAH A;  4ZN5 A;  2OZ5 A;  1ONY A;  4OHI A;  3ZM1 A;  5KA8 A;  4J51 A;  2BZL A;  4R0S A;  3M4U A;  1GWZ A;  1PTU A;  3EZZ A;  3LJ8 A;  3BM8 A;  4HJP A;  3S3H A;  2CMB A;  1LYV A;  4D3Q A;  2GWO A;  4QBW A;  1XRI A;  3BRH A;  4RH5 A;  1G1G A;  1I57 A;  1Q6J A;  3CM3 A;  2Q05 A;  4RHG A;  4OHD A;  3O3L A;  3EMU A;  1ZC0 A;  4QUM A;  3QCL A;  2HVL A;  3SME A;  3OMH A;  4IKC A;  3MOW A;  4GRZ A;  1RPM A;  2F46 A;  1AAX A;  3V0D A;  4HJQ A;  4BPC A;  4AZ1 A;  2F6V A;  2HCM A;  1XXV A;  5IBS A;  1WRM A;  1PA9 A;  3I36 A;  1OHD A;  3V0E A;  2HY3 A;  3S3F A;  4NWG A;  1OHE A;  1OEO X;  5KA2 A;  2PQ5 A;  2VEW A;  3QCG A;  2PSZ A;  2HB1 A;  2J16 B;  2Y96 A;  2Y2F A;  4DGP A;  5BZZ A;  5EHP A;  2B3O A;  2M3V A;  1G4W R;  2C46 A;  2G6Z A;  2F70 A;  1Q6M A;  1ZCK A;  2PT0 A;  5K25 A;  2QEP A;  1PTT A;  4D3P A;  5KAB A;  1X24 A;  4Z6B A;  2H03 A;  3ZM3 A;  1SUG A;  4NND A;  1YGR A;  3ZMQ A;  3S3K A;  1OET A;  2I4E A;  5KA7 A;  4NX8 A;  3F99 A;  3RGQ A;  4RI5 A;  2AHS A;  1YTS A;  2FJN A;  3QCF A;  4GE6 A;  1ECV A;  1I9S A;  1PTY A;  2I4G A;  4WOH A;  3RO1 A;  3BLT A;  1MKP A;  2CM8 A;  5KA1 A;  1D5R A;  4RDD A;  1OEV A;  3D42 A;  2HXP A;  3D9C A;  2I3R A;  3F41 A;  5BZX A;  3O4S A;  1RXD A;  2PI7 A;  2OUD A;  4GFU A;  1R6H A;  1T4J A;  1L8G A;  1EEN A;  2VEV A;  1YGU A;  1OEM X;  4WTY A;  2J17 A;  2GJT A;  3D1H A;  4GE2 A;  2F6W A;  2QBP A;  1YWF A;  2HNQ A;  2ESB A;  4R30 A;  1NWE A;  3QCN A;  2H4V A;  3ZM0 A;  1C85 A;  2BGE A;  4MBB A;  4KYQ A;  3S3E A;  4BJO A;  4NWF A;  2JJD A;  1A5Y A;  2SHP A;  4Y2E A;  2QCJ A;  2I4H A;  3F9A A;  3I80 A;  3U96 A;  5KA3 A;  2A8B A;  1J4X A;  4ICZ A;  2NV5 A;  4HRF A;  1YFO A;  1BZC A;  5J8R A;  3MMJ A;  4RKK A;  1OES A;  2QCT A;  3AWG A;  4WU3 A;  3ZMP A;  1ZZW A;  2I6I A;  2HC2 A;  2B49 A;  4PVG A;  1NO6 A;  1QZ0 A;  3EB1 A;  4OHH A;  4RH9 A;  2P6X A;  3QCK A;  2QDP A;  1G7F A;  4ZRT A;  2B4S A;  5M43 A;  3PS5 A;  2E0T A;  5K24 A;  2HNP A;  5KAC A;  5LXQ B;  5IBM A;  1FPR A;  2PBN A;  2YDU A;  3F9B A;  5MMZ B;  2ZMM A;  5EHR A;  3O4T A;  2A3K A;  2PA5 A;  3QCD A;  3D1Q A;  3GXH A;  3GXG A;  2G59 A;  1G4U S;  1PTV A;  2I5X A;  4JMK A;  2OC3 A;  4GWF A;  1Q6N A;  3V0G A;  1C86 A;  2I1Y A;  1PA1 A;  4ERC A;  1G1H A;  1U25 A;  2I6J A;  4TVV A;  4JBC A;  3QCC A;  1BZJ A;  2F6F A;  2F6T A;  1ZCL A;  3QCB A;  1JLN A;  1YN9 A;  5K9W A;  4JMJ A;  2NTA A;  2NLK A;  2CMC A;  2CJZ A;  3CWE A;  4JNB A;  1I9T A;  2H4G A;  1WCH A;  3EAX A;  4GFV A;  1QXK A;  5AWX A;  1ONZ A;  2H4K A;  4QAP A;  2CM3 A;  2I75 A;  1PXH A;  1C88 A;  3AWF A;  3RZ2 A;  1XM2 A;  1VHR A;  3EU0 A;  1P15 A;  1Q6S A;  3BLU A;  2F6Y A;  4GE5 A;  2QDM A;  4S0G A;  1PYN A;  2BGD A;  1FPZ A;  2J16 A;  2R0B A;  1G7G A;  2CNH A;  1FQ1 A;  5BUG A;  4YR8 B;  2ZN7 A;  3V0H A;  2C7S A;  2I6O A;  3A5K A;  3D1O A;  3O5X A;  2VEY A;  4ZI4 A;  2QBR A; 
#chains in the Genus database with same CATH topology
 2RF6 A;  1OEU A;  2FJM A;  2X5O A;  1BZH A;  1C87 A;  3QKQ A;  4OHE A;  2MBC A;  3MOZ A;  5HDE A;  2DXP A;  1UAG A;  2WGP A;  4CVL A;  3B7O A;  4RI4 A;  2CNE A;  4WU2 A;  1XBO A;  2JFH A;  1NNY A;  5KA4 A;  2H02 A;  4H34 A;  3ZV2 A;  4I8N A;  4H1O A;  2CNF A;  4GRY A;  3H2X A;  3QCE A;  2GP0 A;  1YTW A;  3AWE A;  3V0J A;  2VEX A;  1LQF A;  1NL9 A;  1KAV A;  2CFV A;  1YZ4 A;  1Q1M A;  3MVN A;  1U26 A;  3F81 A;  2B07 A;  4QBE A;  4KI9 A;  2OOQ A;  2GCA A;  2NZ6 A;  4NYH A;  2CM2 A;  1Q6P A;  2VEU A;  3QKP A;  2CNI A;  2F6Z A;  4B04 A;  1E8C A;  1XXP A;  2QBQ A;  2I6P A;  4R0T A;  5GTJ A;  2I42 A;  2VTE A;  1W78 A;  1NZ7 A;  3QCM A;  4UAG A;  1P3D A;  2H04 A;  2BV5 A;  1NWL A;  2NT2 A;  2Y67 A;  4OHL A;  3N0A A;  3D44 A;  3V0I A;  2GC5 A;  4D3R A;  4Y14 A;  1J6U A;  2B4U A;  1Q6T A;  3QCI A;  3I7Z A;  1JF7 A;  1V3A A;  2AZR A;  3V0F A;  2P4D A;  2F71 A;  1E0D A;  1M3G A;  3SR9 A;  4QF5 A;  2Y68 A;  5BX1 A;  1L8K A;  1U24 A;  1EEH A;  3ZM2 A;  5KAD A;  1G1F A;  4YAA A;  2IMG A;  1GFY A;  1KAK A;  3QCH A;  5KA9 A;  2CMA A;  2I6M A;  1YTN A;  2CM7 A;  2FH7 A;  1C84 A;  5K22 A;  4PYH A;  4DGX A;  2JFF A;  5A5F A;  3O4U A;  2B4O A;  3OLR A;  4GS0 A;  2Q47 A;  2BIJ A;  1C83 A;  1JBW A;  1OHC A;  5K9V A;  4KYR A;  3S4O A;  1WAX A;  1EEO A;  3A5J A;  1YPT A;  2QDC A;  3QCJ A;  3S4E A;  2B4P A;  4ZIY A;  3RGO A;  1T49 A;  1T48 A;  5I6V A;  5K23 A;  2NT7 A;  1PH0 A;  5KAA A;  3NME A;  2CNG A;  1LAR A;  5KA0 A;  2HC1 A;  4QUN A;  3QCZ A;  2I3U A;  2QBS A;  4QAH A;  4ZN5 A;  2OZ5 A;  1ONY A;  4OHI A;  3ZM1 A;  5KA8 A;  4J51 A;  2BZL A;  4R0S A;  3M4U A;  1GWZ A;  1PTU A;  3EZZ A;  3LJ8 A;  3BM8 A;  4HJP A;  3S3H A;  2CMB A;  1LYV A;  4D3Q A;  2GWO A;  4QBW A;  1XRI A;  3BRH A;  4RH5 A;  1G1G A;  1I57 A;  1Q6J A;  3CM3 A;  2Q05 A;  2VOS A;  4RHG A;  4OHD A;  3O3L A;  3EMU A;  1ZC0 A;  1W7K A;  4QUM A;  3QCL A;  2HVL A;  3SME A;  3OMH A;  4IKC A;  3MOW A;  4GRZ A;  1RPM A;  2F46 A;  1AAX A;  3V0D A;  4HJQ A;  4BPC A;  4AZ1 A;  2F6V A;  2HCM A;  2F00 A;  1XXV A;  5IBS A;  1WRM A;  1PA9 A;  3I36 A;  1OHD A;  3V0E A;  2HY3 A;  3S3F A;  3NRS A;  4NWG A;  1OHE A;  1OEO X;  5KA2 A;  2VOR A;  2PQ5 A;  2VEW A;  2PSZ A;  2HB1 A;  2Y96 A;  2J16 B;  2VTD A;  2Y2F A;  3QCG A;  4DGP A;  5BZZ A;  1P31 A;  5EHP A;  2B3O A;  3LK7 A;  2M3V A;  1G4W R;  2C46 A;  2G6Z A;  2F70 A;  1Q6M A;  1ZCK A;  2PT0 A;  5K25 A;  2WJP A;  2QEP A;  3UAG A;  1PTT A;  4D3P A;  5KAB A;  1X24 A;  4Z6B A;  2H03 A;  3ZM3 A;  1SUG A;  4NND A;  1YGR A;  3ZMQ A;  3S3K A;  1OET A;  2UAG A;  2I4E A;  5KA7 A;  4NX8 A;  3F99 A;  3RGQ A;  4RI5 A;  2AHS A;  1YTS A;  2UUP A;  2FJN A;  3QCF A;  4GE6 A;  4CVK A;  1ECV A;  1I9S A;  1PTY A;  2I4G A;  4WOH A;  3RO1 A;  3BLT A;  3PYZ A;  1MKP A;  2CM8 A;  5KA1 A;  1D5R A;  4RDD A;  1OEV A;  3D42 A;  2HXP A;  3D9C A;  1GQQ A;  2I3R A;  3F41 A;  5BZX A;  3ZL8 A;  3O4S A;  1RXD A;  2PI7 A;  2JFG A;  2OUD A;  4GFU A;  1R6H A;  1T4J A;  1L8G A;  1EEN A;  2VEV A;  1YGU A;  1OEM X;  4WTY A;  2J17 A;  2GJT A;  3D1H A;  4GE2 A;  2F6W A;  2QBP A;  1YWF A;  4C12 A;  2HNQ A;  2ESB A;  4R30 A;  1NWE A;  3QCN A;  2H4V A;  3ZM0 A;  1C85 A;  2BGE A;  4MBB A;  4KYQ A;  3S3E A;  4BJO A;  4NWF A;  2JJD A;  1A5Y A;  2SHP A;  4Y2E A;  2QCJ A;  1O5Z A;  2I4H A;  3F9A A;  2Y1O A;  3I80 A;  3U96 A;  5KA3 A;  2A8B A;  1J4X A;  4ICZ A;  2NV5 A;  4HRF A;  1YFO A;  3HN7 A;  1BZC A;  5J8R A;  3MMJ A;  4RKK A;  1OES A;  2QCT A;  3AWG A;  3ZM5 A;  4WU3 A;  3ZMP A;  1ZZW A;  2I6I A;  2HC2 A;  2B49 A;  4PVG A;  1NO6 A;  1QZ0 A;  3EB1 A;  4OHH A;  2AM1 A;  4RH9 A;  2P6X A;  2Y66 A;  3QCK A;  2QDP A;  1G7F A;  4ZRT A;  2B4S A;  5M43 A;  2XPC A;  3PS5 A;  2E0T A;  5K24 A;  2HNP A;  2GCB A;  5KAC A;  1FGS A;  5LXQ B;  5IBM A;  1FPR A;  2PBN A;  2YDU A;  3F9B A;  5MMZ B;  2ZMM A;  2UUO A;  5EHR A;  3O4T A;  2A3K A;  2PA5 A;  3QCD A;  3D1Q A;  3GXH A;  3GXG A;  2G59 A;  1G4U S;  1PTV A;  2I5X A;  4JMK A;  2OC3 A;  4GWF A;  1Q6N A;  3V0G A;  1C86 A;  4BUC A;  2I1Y A;  1PA1 A;  4ERC A;  1G1H A;  1GG4 A;  4C13 A;  1U25 A;  4BUB A;  2I6J A;  4HV4 A;  4TVV A;  4JBC A;  3QCC A;  1BZJ A;  2F6F A;  2F6T A;  1ZCL A;  3QCB A;  1JBV A;  1JLN A;  1YN9 A;  5K9W A;  4JMJ A;  2NTA A;  2NLK A;  2CMC A;  2CJZ A;  3CWE A;  4JNB A;  1I9T A;  2H4G A;  1WCH A;  3EAX A;  4GFV A;  4QDI A;  1QXK A;  5AWX A;  1ONZ A;  2H4K A;  4QAP A;  2CM3 A;  2I75 A;  1PXH A;  1C88 A;  5A5E A;  3AWF A;  3RZ2 A;  1XM2 A;  1VHR A;  3EU0 A;  2XJA A;  1P15 A;  4CVM A;  1Q6S A;  3BLU A;  2F6Y A;  4GE5 A;  2QDM A;  4S0G A;  1PYN A;  2BGD A;  1FPZ A;  2J16 A;  2R0B A;  1G7G A;  1GQY A;  2CNH A;  1FQ1 A;  2AM2 A;  5BUG A;  3ZM6 A;  4YR8 B;  3N2A A;  2ZN7 A;  3V0H A;  2C7S A;  2GC6 A;  2WTZ A;  2I6O A;  3A5K A;  3D1O A;  3O5X A;  2VEY A;  4ZI4 A;  2QBR A; 
#chains in the Genus database with same CATH homology
 2RF6 A;  1OEU A;  2FJM A;  3QKQ A;  1BZH A;  1C87 A;  4OHE A;  2MBC A;  3MOZ A;  5HDE A;  2DXP A;  2WGP A;  3B7O A;  4RI4 A;  2CNE A;  4WU2 A;  1XBO A;  1NNY A;  5KA4 A;  2H02 A;  4H34 A;  3ZV2 A;  4I8N A;  4H1O A;  2CNF A;  4GRY A;  3H2X A;  3QCE A;  2GP0 A;  1YTW A;  3AWE A;  3V0J A;  2VEX A;  1LQF A;  1NL9 A;  1KAV A;  2CFV A;  1YZ4 A;  1Q1M A;  1U26 A;  3F81 A;  2B07 A;  4QBE A;  4KI9 A;  2OOQ A;  2NZ6 A;  4NYH A;  2CM2 A;  1Q6P A;  2VEU A;  3QKP A;  2CNI A;  2F6Z A;  4B04 A;  1XXP A;  2QBQ A;  2I6P A;  4R0T A;  5GTJ A;  2I42 A;  1NZ7 A;  3QCM A;  2H04 A;  2BV5 A;  1NWL A;  2NT2 A;  4OHL A;  3N0A A;  3D44 A;  3V0I A;  4D3R A;  4Y14 A;  2B4U A;  1Q6T A;  3QCI A;  3I7Z A;  1JF7 A;  1V3A A;  2AZR A;  3V0F A;  2P4D A;  2F71 A;  1M3G A;  3SR9 A;  5BX1 A;  1L8K A;  1U24 A;  3ZM2 A;  5KAD A;  1G1F A;  4YAA A;  2IMG A;  1GFY A;  1KAK A;  3QCH A;  5KA9 A;  2CMA A;  2I6M A;  1YTN A;  2CM7 A;  2FH7 A;  1C84 A;  5K22 A;  4PYH A;  4DGX A;  3O4U A;  2B4O A;  3OLR A;  4GS0 A;  2Q47 A;  2BIJ A;  1C83 A;  1OHC A;  5K9V A;  4KYR A;  3S4O A;  1WAX A;  1EEO A;  3A5J A;  1YPT A;  2QDC A;  3QCJ A;  3S4E A;  2B4P A;  3RGO A;  1T49 A;  1T48 A;  5I6V A;  5K23 A;  2NT7 A;  1PH0 A;  5KAA A;  3NME A;  2CNG A;  1LAR A;  5KA0 A;  2HC1 A;  4QUN A;  2I3U A;  2QBS A;  4QAH A;  4ZN5 A;  2OZ5 A;  1ONY A;  4OHI A;  3ZM1 A;  5KA8 A;  4J51 A;  2BZL A;  4R0S A;  3M4U A;  1GWZ A;  1PTU A;  3EZZ A;  3LJ8 A;  3BM8 A;  4HJP A;  3S3H A;  2CMB A;  1LYV A;  4D3Q A;  2GWO A;  4QBW A;  1XRI A;  3BRH A;  4RH5 A;  1G1G A;  1I57 A;  1Q6J A;  3CM3 A;  2Q05 A;  4RHG A;  4OHD A;  3O3L A;  3EMU A;  1ZC0 A;  4QUM A;  3QCL A;  2HVL A;  3SME A;  3OMH A;  4IKC A;  3MOW A;  4GRZ A;  1RPM A;  2F46 A;  1AAX A;  3V0D A;  4HJQ A;  4BPC A;  4AZ1 A;  2F6V A;  2HCM A;  1XXV A;  5IBS A;  1WRM A;  1PA9 A;  3I36 A;  1OHD A;  3V0E A;  2HY3 A;  3S3F A;  4NWG A;  1OHE A;  1OEO X;  5KA2 A;  2PQ5 A;  2VEW A;  3QCG A;  2PSZ A;  2HB1 A;  2J16 B;  2Y96 A;  2Y2F A;  4DGP A;  5BZZ A;  5EHP A;  2B3O A;  2M3V A;  1G4W R;  2C46 A;  2G6Z A;  2F70 A;  1Q6M A;  1ZCK A;  2PT0 A;  5K25 A;  2QEP A;  1PTT A;  4D3P A;  5KAB A;  1X24 A;  4Z6B A;  2H03 A;  3ZM3 A;  1SUG A;  4NND A;  1YGR A;  3ZMQ A;  3S3K A;  1OET A;  2I4E A;  5KA7 A;  4NX8 A;  3F99 A;  3RGQ A;  4RI5 A;  2AHS A;  1YTS A;  2FJN A;  3QCF A;  4GE6 A;  1ECV A;  1I9S A;  1PTY A;  2I4G A;  4WOH A;  3RO1 A;  3BLT A;  1MKP A;  2CM8 A;  5KA1 A;  1D5R A;  4RDD A;  1OEV A;  3D42 A;  2HXP A;  3D9C A;  2I3R A;  3F41 A;  5BZX A;  3O4S A;  1RXD A;  2PI7 A;  2OUD A;  4GFU A;  1R6H A;  1T4J A;  1L8G A;  1EEN A;  2VEV A;  1YGU A;  1OEM X;  4WTY A;  2J17 A;  2GJT A;  3D1H A;  4GE2 A;  2F6W A;  2QBP A;  1YWF A;  2HNQ A;  2ESB A;  4R30 A;  1NWE A;  3QCN A;  2H4V A;  3ZM0 A;  1C85 A;  2BGE A;  4MBB A;  4KYQ A;  3S3E A;  4BJO A;  4NWF A;  2JJD A;  1A5Y A;  2SHP A;  4Y2E A;  2QCJ A;  2I4H A;  3F9A A;  3I80 A;  3U96 A;  5KA3 A;  2A8B A;  1J4X A;  4ICZ A;  2NV5 A;  4HRF A;  1YFO A;  1BZC A;  5J8R A;  3MMJ A;  4RKK A;  1OES A;  2QCT A;  3AWG A;  4WU3 A;  3ZMP A;  1ZZW A;  2I6I A;  2HC2 A;  2B49 A;  4PVG A;  1NO6 A;  1QZ0 A;  3EB1 A;  4OHH A;  4RH9 A;  2P6X A;  3QCK A;  2QDP A;  1G7F A;  4ZRT A;  2B4S A;  5M43 A;  3PS5 A;  2E0T A;  5K24 A;  2HNP A;  5KAC A;  5LXQ B;  5IBM A;  1FPR A;  2PBN A;  2YDU A;  3F9B A;  5MMZ B;  2ZMM A;  5EHR A;  3O4T A;  2A3K A;  2PA5 A;  3QCD A;  3D1Q A;  3GXH A;  3GXG A;  2G59 A;  1G4U S;  1PTV A;  2I5X A;  4JMK A;  2OC3 A;  4GWF A;  1Q6N A;  3V0G A;  1C86 A;  2I1Y A;  1PA1 A;  4ERC A;  1G1H A;  1U25 A;  2I6J A;  4TVV A;  4JBC A;  3QCC A;  1BZJ A;  2F6F A;  2F6T A;  1ZCL A;  3QCB A;  1JLN A;  1YN9 A;  5K9W A;  4JMJ A;  2NTA A;  2NLK A;  2CMC A;  2CJZ A;  3CWE A;  4JNB A;  1I9T A;  2H4G A;  1WCH A;  3EAX A;  4GFV A;  1QXK A;  5AWX A;  1ONZ A;  2H4K A;  4QAP A;  2CM3 A;  2I75 A;  1PXH A;  1C88 A;  3AWF A;  3RZ2 A;  1XM2 A;  1VHR A;  3EU0 A;  1P15 A;  1Q6S A;  3BLU A;  2F6Y A;  4GE5 A;  2QDM A;  4S0G A;  1PYN A;  2BGD A;  1FPZ A;  2J16 A;  2R0B A;  1G7G A;  2CNH A;  1FQ1 A;  5BUG A;  4YR8 B;  2ZN7 A;  3V0H A;  2C7S A;  2I6O A;  3A5K A;  3D1O A;  3O5X A;  2VEY A;  4ZI4 A;  2QBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...