1QXZA

Crystal structure of s. aureus methionine aminopeptidase in complex with a ketoheterocycle inhibitor 119
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of staphylococcusaureus methionine aminopeptidase complexed with keto heterocycle and aminoketone inhibitors reveal the formation of a tetrahedral intermediate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords methionyl aminopeptidase
total genus 81
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1qxzA00
4OOKA 3MR1A 2BWVA 4MATA 3MX6A 2BWUA 3RORA 5CDVA 4FO7A 1WY2A 2GGCA 1MATA 1QZYA 4FLJA 4RGZ1 2B3LA 2BWYA 4FUKA 4S01A 2V6CA 4IPAA 3PKAA 2BHBA 5CIKA 2GG9A 5CE6A 2OAZA 2GG3A 4PNCA 1KQ9A 3BITA 4KM3A 1WN1A 1YJ3A 2DFIA 4U71A 4FLIA 2IW2A 3RVAA 2BH3A 2Q93A 2P98A 1JAWA 4IKSA 4ZWUA 3BIPA 2Q8KA 2Q95A 4ZNGA 2BHCA 2GGBA 3TAVA 2EVCA 4IKRA 5CDEA 1XGNA 1C24A 1O0XA 2OKNA 5E5BA 3FMRA 4U6WA 3D27A 1CHMA 4S2TP 1C27A 2ZSGA 1WL6A 2BHDA 2BWTA 2P9AA 2GG2A 4RZZA 2GU4A 2NQ6A 2Q96A 3BIQA 4IDYA 2EA2A 4B28A 4U6ZA 3PKCA 1C21A 4U6EA 4U75A 1XNZA 4Z7MA 1R5HA 1XGSA 1C23A 1XGOA 4JUQA 4U70A 5JI6A 1A16A 1WLRA 4ZWPA 2B3KA 1N51A 1BN5A 2BN7A 2MATA 5D6FA 2Q94A 3IU8A 4U6JA 2EA4A 2GG8A 1M35A 1YW8A 4R60A 1XGMA 3CB6A 4RZYA 2GG5A 2GU7A 2G6PA 2NQ7A 5JFRA 3MATA 2V3XA 4HXXA 4A6WA 1YW9A 3PKBA 4PV4A 2BHAA 4U73A 1WBQA 1R58A 3L24A 5CNXA 4FLLA 4IU6A 4ZWOA 1YW7A 5JHUA 2EVMA 4IECA 1W7VA 1QXYA 5CLSA 2V3YA 3IU7A 4FKCA 2P99A 1PV9A 4IKUA 5D6EA 3TB5A 4U6CA 2GG7A 4QR8A 1QXWA 1Y1NA 2BB7A 2BWSA 1YVMA 2EVOA 5FCHA 2GA2A 5CDLA 3FMQA 1B59A 1WKMA 1WL9A 3FM3A 2HOWA 1KQ0A 3IG4A 2B3HA 1BOAA 2GU5A 1KP0A 3IU9A 3CB5A 1W2MA 2GTXA 4S00A 2GU6A 2ADUA 1QXZA 3CTZA 4IF7A 4U76A 4EGEA 4FO8A 3PKDA 1B6AA 3PKEA 4U69A 4IKTA 2GZ5A 2Q92A 5FCFA 4S2RP 2BWXA 4FLKA 1R5GA 1C22A 2V3ZA 3Q6DA 3S6BA 4U1BA 2GG0A 2BWWA 3L7GA 4A6VA
chains in the Genus database with same CATH superfamily
4OOKA 3MR1A 2BWVA 4MATA 3MX6A 2BWUA 3RORA 5CDVA 4FO7A 1WY2A 2GGCA 1MATA 1QZYA 4FLJA 4RGZ1 2B3LA 2BWYA 4FUKA 4S01A 2V6CA 4IPAA 3PKAA 2BHBA 5CIKA 2GG9A 5CE6A 2OAZA 2GG3A 4PNCA 1KQ9A 3BITA 4KM3A 1WN1A 1YJ3A 2DFIA 4U71A 4FLIA 2IW2A 3RVAA 2BH3A 2Q93A 2P98A 1JAWA 4IKSA 4ZWUA 3BIPA 2Q8KA 2Q95A 4ZNGA 2BHCA 2GGBA 3TAVA 2EVCA 4IKRA 5CDEA 1XGNA 1C24A 1O0XA 2OKNA 5E5BA 3FMRA 4U6WA 3D27A 1CHMA 4S2TP 1C27A 2ZSGA 1WL6A 2BHDA 2BWTA 2P9AA 2GG2A 4RZZA 2GU4A 2NQ6A 2Q96A 3BIQA 4IDYA 2EA2A 4B28A 4U6ZA 3PKCA 1C21A 4U6EA 4U75A 1XNZA 4Z7MA 1R5HA 1XGSA 1C23A 1XGOA 4JUQA 4U70A 5JI6A 1A16A 1WLRA 4ZWPA 2B3KA 1N51A 1BN5A 2BN7A 2MATA 5D6FA 2Q94A 3IU8A 4U6JA 2EA4A 2GG8A 1M35A 1YW8A 4R60A 1XGMA 3CB6A 4RZYA 2GG5A 2GU7A 2G6PA 2NQ7A 5JFRA 3MATA 2V3XA 4HXXA 4A6WA 1YW9A 3PKBA 4PV4A 2BHAA 4U73A 1WBQA 1R58A 3L24A 5CNXA 4FLLA 4IU6A 4ZWOA 1YW7A 5JHUA 2EVMA 4IECA 1W7VA 1QXYA 5CLSA 2V3YA 3IU7A 4FKCA 2P99A 1PV9A 4IKUA 5D6EA 3TB5A 4U6CA 2GG7A 4QR8A 1QXWA 1Y1NA 2BB7A 2BWSA 1YVMA 2EVOA 5FCHA 2GA2A 5CDLA 3FMQA 1B59A 1WKMA 1WL9A 3FM3A 2HOWA 1KQ0A 3IG4A 2B3HA 1BOAA 2GU5A 1KP0A 3IU9A 3CB5A 1W2MA 2GTXA 4S00A 2GU6A 2ADUA 1QXZA 3CTZA 4IF7A 4U76A 4EGEA 4FO8A 3PKDA 1B6AA 3PKEA 4U69A 4IKTA 2GZ5A 2Q92A 5FCFA 4S2RP 2BWXA 4FLKA 1R5GA 1C22A 2V3ZA 3Q6DA 3S6BA 4U1BA 2GG0A 2BWWA 3L7GA 4A6VA
chains in the Genus database with same CATH topology
4OOKA 3MR1A 2BWVA 4MATA 3MX6A 2BWUA 3RORA 5CDVA 4FO7A 1WY2A 2GGCA 1MATA 1QZYA 4FLJA 4RGZ1 2B3LA 2BWYA 4FUKA 4S01A 2V6CA 4IPAA 3PKAA 2BHBA 5CIKA 2GG9A 5CE6A 2OAZA 2GG3A 4PNCA 1KQ9A 3BITA 4KM3A 1WN1A 1YJ3A 2DFIA 4U71A 4FLIA 2IW2A 3RVAA 2BH3A 2Q93A 2P98A 1JAWA 4IKSA 4ZWUA 3BIPA 2Q8KA 2Q95A 4ZNGA 2BHCA 2GGBA 3TAVA 2EVCA 4IKRA 5CDEA 1XGNA 1C24A 1O0XA 2OKNA 5E5BA 3FMRA 4U6WA 3D27A 1CHMA 4S2TP 1C27A 2ZSGA 1WL6A 2BHDA 2BWTA 2P9AA 2GG2A 4RZZA 2GU4A 2NQ6A 2Q96A 3BIQA 4IDYA 2EA2A 4B28A 4U6ZA 3PKCA 1C21A 4U6EA 4U75A 1XNZA 4Z7MA 1R5HA 1XGSA 1C23A 1XGOA 4JUQA 4U70A 5JI6A 1A16A 1WLRA 4ZWPA 2B3KA 1N51A 1BN5A 2BN7A 2MATA 5D6FA 2Q94A 3IU8A 4U6JA 2EA4A 2GG8A 1M35A 1YW8A 4R60A 1XGMA 3CB6A 4RZYA 2GG5A 2GU7A 2G6PA 2NQ7A 5JFRA 3MATA 2V3XA 4HXXA 4A6WA 1YW9A 3PKBA 4PV4A 2BHAA 4U73A 1WBQA 1R58A 3L24A 5CNXA 4FLLA 4IU6A 4ZWOA 1YW7A 5JHUA 2EVMA 4IECA 1W7VA 1QXYA 5CLSA 2V3YA 3IU7A 4FKCA 2P99A 1PV9A 4IKUA 5D6EA 3TB5A 4U6CA 2GG7A 4QR8A 1QXWA 1Y1NA 2BB7A 2BWSA 1YVMA 2EVOA 5FCHA 2GA2A 5CDLA 3FMQA 1B59A 1WKMA 1WL9A 3FM3A 2HOWA 1KQ0A 3IG4A 2B3HA 1BOAA 2GU5A 1KP0A 3IU9A 3CB5A 1W2MA 2GTXA 4S00A 2GU6A 2ADUA 1QXZA 3CTZA 4IF7A 4U76A 4EGEA 4FO8A 3PKDA 1B6AA 3PKEA 4U69A 4IKTA 2GZ5A 2Q92A 5FCFA 4S2RP 2BWXA 4FLKA 1R5GA 1C22A 2V3ZA 3Q6DA 3S6BA 4U1BA 2GG0A 2BWWA 3L7GA 4A6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OOK A;  3MR1 A;  2BWV A;  4MAT A;  3MX6 A;  2BWU A;  3ROR A;  5CDV A;  4FO7 A;  1WY2 A;  2GGC A;  1MAT A;  1QZY A;  4FLJ A;  4RGZ 1;  2B3L A;  2BWY A;  4FUK A;  4S01 A;  2V6C A;  4IPA A;  3PKA A;  2BHB A;  5CIK A;  2GG9 A;  5CE6 A;  2OAZ A;  2GG3 A;  4PNC A;  1KQ9 A;  3BIT A;  4KM3 A;  1WN1 A;  1YJ3 A;  2DFI A;  4U71 A;  4FLI A;  2IW2 A;  3RVA A;  2BH3 A;  2Q93 A;  2P98 A;  1JAW A;  4IKS A;  4ZWU A;  3BIP A;  2Q8K A;  2Q95 A;  4ZNG A;  2BHC A;  2GGB A;  3TAV A;  2EVC A;  4IKR A;  5CDE A;  1XGN A;  1C24 A;  1O0X A;  2OKN A;  5E5B A;  3FMR A;  4U6W A;  3D27 A;  1CHM A;  4S2T P;  1C27 A;  2ZSG A;  1WL6 A;  2BHD A;  2BWT A;  2P9A A;  2GG2 A;  4RZZ A;  2GU4 A;  2NQ6 A;  2Q96 A;  3BIQ A;  4IDY A;  2EA2 A;  4B28 A;  4U6Z A;  3PKC A;  1C21 A;  4U6E A;  4U75 A;  1XNZ A;  4Z7M A;  1R5H A;  1XGS A;  1C23 A;  1XGO A;  4JUQ A;  4U70 A;  5JI6 A;  1A16 A;  1WLR A;  4ZWP A;  2B3K A;  1N51 A;  1BN5 A;  2BN7 A;  2MAT A;  5D6F A;  2Q94 A;  3IU8 A;  4U6J A;  2EA4 A;  2GG8 A;  1M35 A;  1YW8 A;  4R60 A;  1XGM A;  3CB6 A;  4RZY A;  2GG5 A;  2GU7 A;  2G6P A;  2NQ7 A;  5JFR A;  3MAT A;  2V3X A;  4HXX A;  4A6W A;  1YW9 A;  3PKB A;  4PV4 A;  2BHA A;  4U73 A;  1WBQ A;  1R58 A;  3L24 A;  5CNX A;  4FLL A;  4IU6 A;  4ZWO A;  1YW7 A;  5JHU A;  2EVM A;  4IEC A;  1W7V A;  1QXY A;  5CLS A;  2V3Y A;  3IU7 A;  4FKC A;  2P99 A;  1PV9 A;  4IKU A;  5D6E A;  3TB5 A;  4U6C A;  2GG7 A;  4QR8 A;  1QXW A;  1Y1N A;  2BB7 A;  2BWS A;  1YVM A;  2EVO A;  5FCH A;  2GA2 A;  5CDL A;  3FMQ A;  1B59 A;  1WKM A;  1WL9 A;  3FM3 A;  2HOW A;  1KQ0 A;  3IG4 A;  2B3H A;  1BOA A;  2GU5 A;  1KP0 A;  3IU9 A;  3CB5 A;  1W2M A;  2GTX A;  4S00 A;  2GU6 A;  2ADU A;  1QXZ A;  3CTZ A;  4IF7 A;  4U76 A;  4EGE A;  4FO8 A;  3PKD A;  1B6A A;  3PKE A;  4U69 A;  4IKT A;  2GZ5 A;  2Q92 A;  5FCF A;  4S2R P;  2BWX A;  4FLK A;  1R5G A;  1C22 A;  2V3Z A;  3Q6D A;  3S6B A;  4U1B A;  2GG0 A;  2BWW A;  3L7G A;  4A6V A; 
#chains in the Genus database with same CATH topology
 4OOK A;  3MR1 A;  2BWV A;  4MAT A;  3MX6 A;  2BWU A;  3ROR A;  5CDV A;  4FO7 A;  1WY2 A;  2GGC A;  1MAT A;  1QZY A;  4FLJ A;  4RGZ 1;  2B3L A;  2BWY A;  4FUK A;  4S01 A;  2V6C A;  4IPA A;  3PKA A;  2BHB A;  5CIK A;  2GG9 A;  5CE6 A;  2OAZ A;  2GG3 A;  4PNC A;  1KQ9 A;  3BIT A;  4KM3 A;  1WN1 A;  1YJ3 A;  2DFI A;  4U71 A;  4FLI A;  2IW2 A;  3RVA A;  2BH3 A;  2Q93 A;  2P98 A;  1JAW A;  4IKS A;  4ZWU A;  3BIP A;  2Q8K A;  2Q95 A;  4ZNG A;  2BHC A;  2GGB A;  3TAV A;  2EVC A;  4IKR A;  5CDE A;  1XGN A;  1C24 A;  1O0X A;  2OKN A;  5E5B A;  3FMR A;  4U6W A;  3D27 A;  1CHM A;  4S2T P;  1C27 A;  2ZSG A;  1WL6 A;  2BHD A;  2BWT A;  2P9A A;  2GG2 A;  4RZZ A;  2GU4 A;  2NQ6 A;  2Q96 A;  3BIQ A;  4IDY A;  2EA2 A;  4B28 A;  4U6Z A;  3PKC A;  1C21 A;  4U6E A;  4U75 A;  1XNZ A;  4Z7M A;  1R5H A;  1XGS A;  1C23 A;  1XGO A;  4JUQ A;  4U70 A;  5JI6 A;  1A16 A;  1WLR A;  4ZWP A;  2B3K A;  1N51 A;  1BN5 A;  2BN7 A;  2MAT A;  5D6F A;  2Q94 A;  3IU8 A;  4U6J A;  2EA4 A;  2GG8 A;  1M35 A;  1YW8 A;  4R60 A;  1XGM A;  3CB6 A;  4RZY A;  2GG5 A;  2GU7 A;  2G6P A;  2NQ7 A;  5JFR A;  3MAT A;  2V3X A;  4HXX A;  4A6W A;  1YW9 A;  3PKB A;  4PV4 A;  2BHA A;  4U73 A;  1WBQ A;  1R58 A;  3L24 A;  5CNX A;  4FLL A;  4IU6 A;  4ZWO A;  1YW7 A;  5JHU A;  2EVM A;  4IEC A;  1W7V A;  1QXY A;  5CLS A;  2V3Y A;  3IU7 A;  4FKC A;  2P99 A;  1PV9 A;  4IKU A;  5D6E A;  3TB5 A;  4U6C A;  2GG7 A;  4QR8 A;  1QXW A;  1Y1N A;  2BB7 A;  2BWS A;  1YVM A;  2EVO A;  5FCH A;  2GA2 A;  5CDL A;  3FMQ A;  1B59 A;  1WKM A;  1WL9 A;  3FM3 A;  2HOW A;  1KQ0 A;  3IG4 A;  2B3H A;  1BOA A;  2GU5 A;  1KP0 A;  3IU9 A;  3CB5 A;  1W2M A;  2GTX A;  4S00 A;  2GU6 A;  2ADU A;  1QXZ A;  3CTZ A;  4IF7 A;  4U76 A;  4EGE A;  4FO8 A;  3PKD A;  1B6A A;  3PKE A;  4U69 A;  4IKT A;  2GZ5 A;  2Q92 A;  5FCF A;  4S2R P;  2BWX A;  4FLK A;  1R5G A;  1C22 A;  2V3Z A;  3Q6D A;  3S6B A;  4U1B A;  2GG0 A;  2BWW A;  3L7G A;  4A6V A; 
#chains in the Genus database with same CATH homology
 4OOK A;  3MR1 A;  2BWV A;  4MAT A;  3MX6 A;  2BWU A;  3ROR A;  5CDV A;  4FO7 A;  1WY2 A;  2GGC A;  1MAT A;  1QZY A;  4FLJ A;  4RGZ 1;  2B3L A;  2BWY A;  4FUK A;  4S01 A;  2V6C A;  4IPA A;  3PKA A;  2BHB A;  5CIK A;  2GG9 A;  5CE6 A;  2OAZ A;  2GG3 A;  4PNC A;  1KQ9 A;  3BIT A;  4KM3 A;  1WN1 A;  1YJ3 A;  2DFI A;  4U71 A;  4FLI A;  2IW2 A;  3RVA A;  2BH3 A;  2Q93 A;  2P98 A;  1JAW A;  4IKS A;  4ZWU A;  3BIP A;  2Q8K A;  2Q95 A;  4ZNG A;  2BHC A;  2GGB A;  3TAV A;  2EVC A;  4IKR A;  5CDE A;  1XGN A;  1C24 A;  1O0X A;  2OKN A;  5E5B A;  3FMR A;  4U6W A;  3D27 A;  1CHM A;  4S2T P;  1C27 A;  2ZSG A;  1WL6 A;  2BHD A;  2BWT A;  2P9A A;  2GG2 A;  4RZZ A;  2GU4 A;  2NQ6 A;  2Q96 A;  3BIQ A;  4IDY A;  2EA2 A;  4B28 A;  4U6Z A;  3PKC A;  1C21 A;  4U6E A;  4U75 A;  1XNZ A;  4Z7M A;  1R5H A;  1XGS A;  1C23 A;  1XGO A;  4JUQ A;  4U70 A;  5JI6 A;  1A16 A;  1WLR A;  4ZWP A;  2B3K A;  1N51 A;  1BN5 A;  2BN7 A;  2MAT A;  5D6F A;  2Q94 A;  3IU8 A;  4U6J A;  2EA4 A;  2GG8 A;  1M35 A;  1YW8 A;  4R60 A;  1XGM A;  3CB6 A;  4RZY A;  2GG5 A;  2GU7 A;  2G6P A;  2NQ7 A;  5JFR A;  3MAT A;  2V3X A;  4HXX A;  4A6W A;  1YW9 A;  3PKB A;  4PV4 A;  2BHA A;  4U73 A;  1WBQ A;  1R58 A;  3L24 A;  5CNX A;  4FLL A;  4IU6 A;  4ZWO A;  1YW7 A;  5JHU A;  2EVM A;  4IEC A;  1W7V A;  1QXY A;  5CLS A;  2V3Y A;  3IU7 A;  4FKC A;  2P99 A;  1PV9 A;  4IKU A;  5D6E A;  3TB5 A;  4U6C A;  2GG7 A;  4QR8 A;  1QXW A;  1Y1N A;  2BB7 A;  2BWS A;  1YVM A;  2EVO A;  5FCH A;  2GA2 A;  5CDL A;  3FMQ A;  1B59 A;  1WKM A;  1WL9 A;  3FM3 A;  2HOW A;  1KQ0 A;  3IG4 A;  2B3H A;  1BOA A;  2GU5 A;  1KP0 A;  3IU9 A;  3CB5 A;  1W2M A;  2GTX A;  4S00 A;  2GU6 A;  2ADU A;  1QXZ A;  3CTZ A;  4IF7 A;  4U76 A;  4EGE A;  4FO8 A;  3PKD A;  1B6A A;  3PKE A;  4U69 A;  4IKT A;  2GZ5 A;  2Q92 A;  5FCF A;  4S2R P;  2BWX A;  4FLK A;  1R5G A;  1C22 A;  2V3Z A;  3Q6D A;  3S6B A;  4U1B A;  2GG0 A;  2BWW A;  3L7G A;  4A6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...