1QXZA

Crystal structure of s. aureus methionine aminopeptidase in complex with a ketoheterocycle inhibitor 119
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
b'MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methionyl aminopeptidase
publication title Crystal structures of staphylococcusaureus methionine aminopeptidase complexed with keto heterocycle and aminoketone inhibitors reveal the formation of a tetrahedral intermediate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 81
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1qxzA00
1WKMA 1WLRA 2EVMA 1YW9A 1B6AA 3RORA 2P98A 3PKAA 2GU5A 2NQ7A 3TAVA 2GG9A 2B3KA 2B3HA 4A6VA 2BWVA 2GTXA 2BHAA 1XGNA 2BWXA 5JHUA 1YW8A 3RVAA 1R58A 1N51A 2ADUA 2BWYA 4RZZA 4IECA 4U6ZA 2EVOA 5FCHA 1XNZA 3IU7A 1C22A 2Q95A 3L7GA 1C21A 3L24A 2BHCA 1QXZA 3PKDA 2IW2A 2GG2A 3MATA 1WL9A 2Q92A 2GG7A 2BHDA 4FO7A 4R60A 2EVCA 5JI6A 2GA2A 5D6FA 2GU6A 2V6CA 1YJ3A 4U6CA 1KP0A 4S00A 5CDEA 2OKNA 3FMQA 2EA2A 1XGOA 1KQ0A 5JFRA 4QR8A 1R5GA 2V3ZA 1A16A 3CB5A 4OOKA 3CTZA 4IKRA 4S01A 2GU7A 4U1BA 3BIPA 4FLKA 1YW7A 1MATA 1O0XA 4IF7A 4ZWUA 2GG8A 5CNXA 2GU4A 4U6JA 1JAWA 2BN7A 4IKTA 4U73A 4A6WA 4ZWPA 3D27A 1C23A 5FCFA 4FKCA 1C27A 4JUQA 3BIQA 2BWSA 3IG4A 1YVMA 4FLJA 2V3XA 2B3LA 2HOWA 2MATA 5CDVA 5CE6A 2DFIA 4PV4A 5D6EA 4FLLA 2GG5A 1WBQA 1BN5A 3Q6DA 4HXXA 4U69A 4FUKA 2BWWA 4IKUA 4ZNGA 4IU6A 3PKBA 4RZYA 3MR1A 4U6WA 2BHBA 2ZSGA 2P9AA 2BB7A 3FM3A 1WL6A 4U76A 2BWUA 2GG0A 2GG3A 4FO8A 3S6BA 2NQ6A 4U70A 4RGZ1 2Q93A 4S2TP 4U75A 5E5BA 4FLIA 3TB5A 2OAZA 1C24A 1QZYA 2GZ5A 3MX6A 2Q94A 4KM3A 3PKEA 2BWTA 4MATA 1XGSA 4Z7MA 3CB6A 2GGBA 1CHMA 1XGMA 2EA4A 5CLSA 1PV9A 4U6EA 3IU8A 4EGEA 1B59A 1W7VA 1QXYA 1R5HA 1WY2A 1Y1NA 4IKSA 1WN1A 4ZWOA 2Q8KA 4S2RP 1W2MA 2GGCA 1M35A 5CDLA 4B28A 1BOAA 4PNCA 5CIKA 1QXWA 2G6PA 3IU9A 4IDYA 3PKCA 2BH3A 2Q96A 3BITA 2P99A 4U71A 1KQ9A 4IPAA 2V3YA 3FMRA
chains in the Genus database with same CATH superfamily
1WKMA 1WLRA 2EVMA 1YW9A 1B6AA 3RORA 2P98A 3PKAA 2GU5A 2NQ7A 3TAVA 2GG9A 2B3KA 2B3HA 4A6VA 2BWVA 2GTXA 2BHAA 1XGNA 2BWXA 5JHUA 1YW8A 3RVAA 1R58A 1N51A 2ADUA 2BWYA 4RZZA 4IECA 4U6ZA 2EVOA 5FCHA 1XNZA 3IU7A 1C22A 2Q95A 3L7GA 1C21A 3L24A 2BHCA 1QXZA 3PKDA 2IW2A 2GG2A 3MATA 1WL9A 2Q92A 2GG7A 2BHDA 4FO7A 4R60A 2EVCA 5JI6A 2GA2A 5D6FA 2GU6A 2V6CA 1YJ3A 4U6CA 1KP0A 4S00A 5CDEA 2OKNA 3FMQA 2EA2A 1XGOA 1KQ0A 5JFRA 4QR8A 1R5GA 2V3ZA 1A16A 3CB5A 4OOKA 3CTZA 4IKRA 4S01A 2GU7A 4U1BA 3BIPA 4FLKA 1YW7A 1MATA 1O0XA 4IF7A 4ZWUA 2GG8A 5CNXA 2GU4A 4U6JA 1JAWA 2BN7A 4IKTA 4U73A 4A6WA 4ZWPA 3D27A 1C23A 5FCFA 4FKCA 1C27A 4JUQA 3BIQA 2BWSA 3IG4A 1YVMA 4FLJA 2V3XA 2B3LA 2HOWA 2MATA 5CDVA 5CE6A 2DFIA 4PV4A 5D6EA 4FLLA 2GG5A 1WBQA 1BN5A 3Q6DA 4HXXA 4U69A 4FUKA 2BWWA 4IKUA 4ZNGA 4IU6A 3PKBA 4RZYA 3MR1A 4U6WA 2BHBA 2ZSGA 2P9AA 2BB7A 3FM3A 1WL6A 4U76A 2BWUA 2GG0A 2GG3A 4FO8A 3S6BA 2NQ6A 4U70A 4RGZ1 2Q93A 4S2TP 4U75A 5E5BA 4FLIA 3TB5A 2OAZA 1C24A 1QZYA 2GZ5A 3MX6A 2Q94A 4KM3A 3PKEA 2BWTA 4MATA 1XGSA 4Z7MA 3CB6A 2GGBA 1CHMA 1XGMA 2EA4A 5CLSA 1PV9A 4U6EA 3IU8A 4EGEA 1B59A 1W7VA 1QXYA 1R5HA 1WY2A 1Y1NA 4IKSA 1WN1A 4ZWOA 2Q8KA 4S2RP 1W2MA 2GGCA 1M35A 5CDLA 4B28A 1BOAA 4PNCA 5CIKA 1QXWA 2G6PA 3IU9A 4IDYA 3PKCA 2BH3A 2Q96A 3BITA 2P99A 4U71A 1KQ9A 4IPAA 2V3YA 3FMRA
chains in the Genus database with same CATH topology
1WKMA 1WLRA 2EVMA 1YW9A 1B6AA 3RORA 2P98A 3PKAA 2GU5A 2NQ7A 3TAVA 2GG9A 2B3KA 2B3HA 4A6VA 2BWVA 2GTXA 2BHAA 1XGNA 2BWXA 5JHUA 1YW8A 3RVAA 1R58A 1N51A 2ADUA 2BWYA 4RZZA 4IECA 4U6ZA 2EVOA 5FCHA 1XNZA 3IU7A 1C22A 2Q95A 3L7GA 1C21A 3L24A 2BHCA 1QXZA 3PKDA 2IW2A 2GG2A 3MATA 1WL9A 2Q92A 2GG7A 2BHDA 4FO7A 4R60A 2EVCA 5JI6A 2GA2A 5D6FA 2GU6A 2V6CA 1YJ3A 4U6CA 1KP0A 4S00A 5CDEA 2OKNA 3FMQA 2EA2A 1XGOA 1KQ0A 5JFRA 4QR8A 1R5GA 2V3ZA 1A16A 3CB5A 4OOKA 3CTZA 4IKRA 4S01A 2GU7A 4U1BA 3BIPA 4FLKA 1YW7A 1MATA 1O0XA 4IF7A 4ZWUA 2GG8A 5CNXA 2GU4A 4U6JA 1JAWA 2BN7A 4IKTA 4U73A 4A6WA 4ZWPA 3D27A 1C23A 5FCFA 4FKCA 1C27A 4JUQA 3BIQA 2BWSA 3IG4A 1YVMA 4FLJA 2V3XA 2B3LA 2HOWA 2MATA 5CDVA 5CE6A 2DFIA 4PV4A 5D6EA 4FLLA 2GG5A 1WBQA 1BN5A 3Q6DA 4HXXA 4U69A 4FUKA 2BWWA 4IKUA 4ZNGA 4IU6A 3PKBA 4RZYA 3MR1A 4U6WA 2BHBA 2ZSGA 2P9AA 2BB7A 3FM3A 1WL6A 4U76A 2BWUA 2GG0A 2GG3A 4FO8A 3S6BA 2NQ6A 4U70A 4RGZ1 2Q93A 4S2TP 4U75A 5E5BA 4FLIA 3TB5A 2OAZA 1C24A 1QZYA 2GZ5A 3MX6A 2Q94A 4KM3A 3PKEA 2BWTA 4MATA 1XGSA 4Z7MA 3CB6A 2GGBA 1CHMA 1XGMA 2EA4A 5CLSA 1PV9A 4U6EA 3IU8A 4EGEA 1B59A 1W7VA 1QXYA 1R5HA 1WY2A 1Y1NA 4IKSA 1WN1A 4ZWOA 2Q8KA 4S2RP 1W2MA 2GGCA 1M35A 5CDLA 4B28A 1BOAA 4PNCA 5CIKA 1QXWA 2G6PA 3IU9A 4IDYA 3PKCA 2BH3A 2Q96A 3BITA 2P99A 4U71A 1KQ9A 4IPAA 2V3YA 3FMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKM A;  1WLR A;  2EVM A;  1YW9 A;  1B6A A;  3ROR A;  2P98 A;  3PKA A;  2GU5 A;  2NQ7 A;  3TAV A;  2GG9 A;  2B3K A;  2B3H A;  4A6V A;  2BWV A;  2GTX A;  2BHA A;  1XGN A;  2BWX A;  5JHU A;  1YW8 A;  3RVA A;  1R58 A;  1N51 A;  2ADU A;  2BWY A;  4RZZ A;  4IEC A;  4U6Z A;  2EVO A;  5FCH A;  1XNZ A;  3IU7 A;  1C22 A;  2Q95 A;  3L7G A;  1C21 A;  3L24 A;  2BHC A;  1QXZ A;  3PKD A;  2IW2 A;  2GG2 A;  3MAT A;  1WL9 A;  2Q92 A;  2GG7 A;  2BHD A;  4FO7 A;  4R60 A;  2EVC A;  5JI6 A;  2GA2 A;  5D6F A;  2GU6 A;  2V6C A;  1YJ3 A;  4U6C A;  1KP0 A;  4S00 A;  5CDE A;  2OKN A;  3FMQ A;  2EA2 A;  1XGO A;  1KQ0 A;  5JFR A;  4QR8 A;  1R5G A;  2V3Z A;  1A16 A;  3CB5 A;  4OOK A;  3CTZ A;  4IKR A;  4S01 A;  2GU7 A;  4U1B A;  3BIP A;  4FLK A;  1YW7 A;  1MAT A;  1O0X A;  4IF7 A;  4ZWU A;  2GG8 A;  5CNX A;  2GU4 A;  4U6J A;  1JAW A;  2BN7 A;  4IKT A;  4U73 A;  4A6W A;  4ZWP A;  3D27 A;  1C23 A;  5FCF A;  4FKC A;  1C27 A;  4JUQ A;  3BIQ A;  2BWS A;  3IG4 A;  1YVM A;  4FLJ A;  2V3X A;  2B3L A;  2HOW A;  2MAT A;  5CDV A;  5CE6 A;  2DFI A;  4PV4 A;  5D6E A;  4FLL A;  2GG5 A;  1WBQ A;  1BN5 A;  3Q6D A;  4HXX A;  4U69 A;  4FUK A;  2BWW A;  4IKU A;  4ZNG A;  4IU6 A;  3PKB A;  4RZY A;  3MR1 A;  4U6W A;  2BHB A;  2ZSG A;  2P9A A;  2BB7 A;  3FM3 A;  1WL6 A;  4U76 A;  2BWU A;  2GG0 A;  2GG3 A;  4FO8 A;  3S6B A;  2NQ6 A;  4U70 A;  4RGZ 1;  2Q93 A;  4S2T P;  4U75 A;  5E5B A;  4FLI A;  3TB5 A;  2OAZ A;  1C24 A;  1QZY A;  2GZ5 A;  3MX6 A;  2Q94 A;  4KM3 A;  3PKE A;  2BWT A;  4MAT A;  1XGS A;  4Z7M A;  3CB6 A;  2GGB A;  1CHM A;  1XGM A;  2EA4 A;  5CLS A;  1PV9 A;  4U6E A;  3IU8 A;  4EGE A;  1B59 A;  1W7V A;  1QXY A;  1R5H A;  1WY2 A;  1Y1N A;  4IKS A;  1WN1 A;  4ZWO A;  2Q8K A;  4S2R P;  1W2M A;  2GGC A;  1M35 A;  5CDL A;  4B28 A;  1BOA A;  4PNC A;  5CIK A;  1QXW A;  2G6P A;  3IU9 A;  4IDY A;  3PKC A;  2BH3 A;  2Q96 A;  3BIT A;  2P99 A;  4U71 A;  1KQ9 A;  4IPA A;  2V3Y A;  3FMR A; 
#chains in the Genus database with same CATH topology
 1WKM A;  1WLR A;  2EVM A;  1YW9 A;  1B6A A;  3ROR A;  2P98 A;  3PKA A;  2GU5 A;  2NQ7 A;  3TAV A;  2GG9 A;  2B3K A;  2B3H A;  4A6V A;  2BWV A;  2GTX A;  2BHA A;  1XGN A;  2BWX A;  5JHU A;  1YW8 A;  3RVA A;  1R58 A;  1N51 A;  2ADU A;  2BWY A;  4RZZ A;  4IEC A;  4U6Z A;  2EVO A;  5FCH A;  1XNZ A;  3IU7 A;  1C22 A;  2Q95 A;  3L7G A;  1C21 A;  3L24 A;  2BHC A;  1QXZ A;  3PKD A;  2IW2 A;  2GG2 A;  3MAT A;  1WL9 A;  2Q92 A;  2GG7 A;  2BHD A;  4FO7 A;  4R60 A;  2EVC A;  5JI6 A;  2GA2 A;  5D6F A;  2GU6 A;  2V6C A;  1YJ3 A;  4U6C A;  1KP0 A;  4S00 A;  5CDE A;  2OKN A;  3FMQ A;  2EA2 A;  1XGO A;  1KQ0 A;  5JFR A;  4QR8 A;  1R5G A;  2V3Z A;  1A16 A;  3CB5 A;  4OOK A;  3CTZ A;  4IKR A;  4S01 A;  2GU7 A;  4U1B A;  3BIP A;  4FLK A;  1YW7 A;  1MAT A;  1O0X A;  4IF7 A;  4ZWU A;  2GG8 A;  5CNX A;  2GU4 A;  4U6J A;  1JAW A;  2BN7 A;  4IKT A;  4U73 A;  4A6W A;  4ZWP A;  3D27 A;  1C23 A;  5FCF A;  4FKC A;  1C27 A;  4JUQ A;  3BIQ A;  2BWS A;  3IG4 A;  1YVM A;  4FLJ A;  2V3X A;  2B3L A;  2HOW A;  2MAT A;  5CDV A;  5CE6 A;  2DFI A;  4PV4 A;  5D6E A;  4FLL A;  2GG5 A;  1WBQ A;  1BN5 A;  3Q6D A;  4HXX A;  4U69 A;  4FUK A;  2BWW A;  4IKU A;  4ZNG A;  4IU6 A;  3PKB A;  4RZY A;  3MR1 A;  4U6W A;  2BHB A;  2ZSG A;  2P9A A;  2BB7 A;  3FM3 A;  1WL6 A;  4U76 A;  2BWU A;  2GG0 A;  2GG3 A;  4FO8 A;  3S6B A;  2NQ6 A;  4U70 A;  4RGZ 1;  2Q93 A;  4S2T P;  4U75 A;  5E5B A;  4FLI A;  3TB5 A;  2OAZ A;  1C24 A;  1QZY A;  2GZ5 A;  3MX6 A;  2Q94 A;  4KM3 A;  3PKE A;  2BWT A;  4MAT A;  1XGS A;  4Z7M A;  3CB6 A;  2GGB A;  1CHM A;  1XGM A;  2EA4 A;  5CLS A;  1PV9 A;  4U6E A;  3IU8 A;  4EGE A;  1B59 A;  1W7V A;  1QXY A;  1R5H A;  1WY2 A;  1Y1N A;  4IKS A;  1WN1 A;  4ZWO A;  2Q8K A;  4S2R P;  1W2M A;  2GGC A;  1M35 A;  5CDL A;  4B28 A;  1BOA A;  4PNC A;  5CIK A;  1QXW A;  2G6P A;  3IU9 A;  4IDY A;  3PKC A;  2BH3 A;  2Q96 A;  3BIT A;  2P99 A;  4U71 A;  1KQ9 A;  4IPA A;  2V3Y A;  3FMR A; 
#chains in the Genus database with same CATH homology
 1WKM A;  1WLR A;  2EVM A;  1YW9 A;  1B6A A;  3ROR A;  2P98 A;  3PKA A;  2GU5 A;  2NQ7 A;  3TAV A;  2GG9 A;  2B3K A;  2B3H A;  4A6V A;  2BWV A;  2GTX A;  2BHA A;  1XGN A;  2BWX A;  5JHU A;  1YW8 A;  3RVA A;  1R58 A;  1N51 A;  2ADU A;  2BWY A;  4RZZ A;  4IEC A;  4U6Z A;  2EVO A;  5FCH A;  1XNZ A;  3IU7 A;  1C22 A;  2Q95 A;  3L7G A;  1C21 A;  3L24 A;  2BHC A;  1QXZ A;  3PKD A;  2IW2 A;  2GG2 A;  3MAT A;  1WL9 A;  2Q92 A;  2GG7 A;  2BHD A;  4FO7 A;  4R60 A;  2EVC A;  5JI6 A;  2GA2 A;  5D6F A;  2GU6 A;  2V6C A;  1YJ3 A;  4U6C A;  1KP0 A;  4S00 A;  5CDE A;  2OKN A;  3FMQ A;  2EA2 A;  1XGO A;  1KQ0 A;  5JFR A;  4QR8 A;  1R5G A;  2V3Z A;  1A16 A;  3CB5 A;  4OOK A;  3CTZ A;  4IKR A;  4S01 A;  2GU7 A;  4U1B A;  3BIP A;  4FLK A;  1YW7 A;  1MAT A;  1O0X A;  4IF7 A;  4ZWU A;  2GG8 A;  5CNX A;  2GU4 A;  4U6J A;  1JAW A;  2BN7 A;  4IKT A;  4U73 A;  4A6W A;  4ZWP A;  3D27 A;  1C23 A;  5FCF A;  4FKC A;  1C27 A;  4JUQ A;  3BIQ A;  2BWS A;  3IG4 A;  1YVM A;  4FLJ A;  2V3X A;  2B3L A;  2HOW A;  2MAT A;  5CDV A;  5CE6 A;  2DFI A;  4PV4 A;  5D6E A;  4FLL A;  2GG5 A;  1WBQ A;  1BN5 A;  3Q6D A;  4HXX A;  4U69 A;  4FUK A;  2BWW A;  4IKU A;  4ZNG A;  4IU6 A;  3PKB A;  4RZY A;  3MR1 A;  4U6W A;  2BHB A;  2ZSG A;  2P9A A;  2BB7 A;  3FM3 A;  1WL6 A;  4U76 A;  2BWU A;  2GG0 A;  2GG3 A;  4FO8 A;  3S6B A;  2NQ6 A;  4U70 A;  4RGZ 1;  2Q93 A;  4S2T P;  4U75 A;  5E5B A;  4FLI A;  3TB5 A;  2OAZ A;  1C24 A;  1QZY A;  2GZ5 A;  3MX6 A;  2Q94 A;  4KM3 A;  3PKE A;  2BWT A;  4MAT A;  1XGS A;  4Z7M A;  3CB6 A;  2GGB A;  1CHM A;  1XGM A;  2EA4 A;  5CLS A;  1PV9 A;  4U6E A;  3IU8 A;  4EGE A;  1B59 A;  1W7V A;  1QXY A;  1R5H A;  1WY2 A;  1Y1N A;  4IKS A;  1WN1 A;  4ZWO A;  2Q8K A;  4S2R P;  1W2M A;  2GGC A;  1M35 A;  5CDL A;  4B28 A;  1BOA A;  4PNC A;  5CIK A;  1QXW A;  2G6P A;  3IU9 A;  4IDY A;  3PKC A;  2BH3 A;  2Q96 A;  3BIT A;  2P99 A;  4U71 A;  1KQ9 A;  4IPA A;  2V3Y A;  3FMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...