1QXZA

Crystal structure of s. aureus methionine aminopeptidase in complex with a ketoheterocycle inhibitor 119
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methionyl aminopeptidase
publication title Crystal structures of staphylococcusaureus methionine aminopeptidase complexed with keto heterocycle and aminoketone inhibitors reveal the formation of a tetrahedral intermediate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 81
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1qxzA00
4FLIA 3IU9A 4HXXA 1R5HA 4KM3A 1W2MA 1WBQA 4IF7A 1QZYA 1WKMA 2B3KA 2BWUA 1C24A 4MATA 2B3LA 4EGEA 4FLJA 4U6JA 4U70A 2BHDA 4PNCA 3IG4A 4S01A 1C21A 3TB5A 4IU6A 5CIKA 1C27A 4A6VA 1KQ0A 1QXWA 4U73A 2ZSGA 2EVMA 2NQ7A 2GA2A 1WL9A 2BHBA 1JAWA 2B3HA 2Q94A 4FUKA 2GG0A 4U71A 2MATA 1MATA 4ZWPA 3PKCA 2OAZA 4RZZA 2GG2A 1QXZA 1BN5A 1QXYA 1O0XA 1XGOA 2V3YA 2GGBA 2BWSA 5CE6A 5JI6A 4QR8A 2V6CA 3CB5A 1KP0A 4JUQA 2P99A 1XGMA 3FM3A 2BWXA 1CHMA 4RGZ1 1YW7A 5CLSA 3PKEA 4U6CA 1WN1A 2Q8KA 2V3ZA 4IKRA 1WY2A 2EA4A 2GG3A 2GGCA 5D6EA 5E5BA 4IKUA 2BN7A 4IECA 2BWYA 3Q6DA 4U6ZA 5CNXA 4U6WA 2G6PA 3IU8A 1YW9A 1YJ3A 2Q96A 2Q95A 4ZWUA 1YVMA 3S6BA 4R60A 3FMQA 3RORA 1R58A 1XGSA 5CDVA 2GU5A 4ZWOA 4Z7MA 1BOAA 2GG7A 1XNZA 4B28A 2P98A 5FCHA 4IPAA 4S2RP 5CDEA 1XGNA 4U76A 4U69A 2BWVA 4U1BA 2GU7A 2BHCA 5CDLA 1C23A 1YW8A 4IDYA 3MR1A 4OOKA 1A16A 3L7GA 4U6EA 2GG9A 1M35A 1C22A 2DFIA 1B6AA 2NQ6A 3L24A 4IKSA 4ZNGA 1B59A 2BWWA 2ADUA 5JFRA 3MATA 5D6FA 1N51A 3PKAA 3CTZA 4FKCA 2V3XA 4A6WA 1R5GA 2EA2A 3BITA 3BIPA 4FLKA 5FCFA 1WL6A 2GTXA 2GZ5A 1PV9A 2EVCA 2GG5A 3IU7A 1WLRA 3RVAA 1Y1NA 2HOWA 2Q92A 2GU4A 4IKTA 4FLLA 3PKBA 1W7VA 2P9AA 1KQ9A 2IW2A 3TAVA 3PKDA 2BH3A 2GG8A 2GU6A 2Q93A 3BIQA 2OKNA 3MX6A 4FO8A 3D27A 4S2TP 4FO7A 4RZYA 4S00A 5JHUA 4PV4A 3FMRA 2BB7A 2BHAA 2BWTA 2EVOA 4U75A 3CB6A
chains in the Genus database with same CATH superfamily
4FLIA 3IU9A 4HXXA 1R5HA 4KM3A 1W2MA 1WBQA 4IF7A 1QZYA 1WKMA 2B3KA 2BWUA 1C24A 4MATA 2B3LA 4EGEA 4FLJA 4U6JA 4U70A 2BHDA 4PNCA 3IG4A 4S01A 1C21A 3TB5A 4IU6A 5CIKA 1C27A 4A6VA 1KQ0A 1QXWA 4U73A 2ZSGA 2EVMA 2NQ7A 2GA2A 1WL9A 2BHBA 1JAWA 2B3HA 2Q94A 4FUKA 2GG0A 4U71A 2MATA 1MATA 4ZWPA 3PKCA 2OAZA 4RZZA 2GG2A 1QXZA 1BN5A 1QXYA 1O0XA 1XGOA 2V3YA 2GGBA 2BWSA 5CE6A 5JI6A 4QR8A 2V6CA 3CB5A 1KP0A 4JUQA 2P99A 1XGMA 3FM3A 2BWXA 1CHMA 4RGZ1 1YW7A 5CLSA 3PKEA 4U6CA 1WN1A 2Q8KA 2V3ZA 4IKRA 1WY2A 2EA4A 2GG3A 2GGCA 5D6EA 5E5BA 4IKUA 2BN7A 4IECA 2BWYA 3Q6DA 4U6ZA 5CNXA 4U6WA 2G6PA 3IU8A 1YW9A 1YJ3A 2Q96A 2Q95A 4ZWUA 1YVMA 3S6BA 4R60A 3FMQA 3RORA 1R58A 1XGSA 5CDVA 2GU5A 4ZWOA 4Z7MA 1BOAA 2GG7A 1XNZA 4B28A 2P98A 5FCHA 4IPAA 4S2RP 5CDEA 1XGNA 4U76A 4U69A 2BWVA 4U1BA 2GU7A 2BHCA 5CDLA 1C23A 1YW8A 4IDYA 3MR1A 4OOKA 1A16A 3L7GA 4U6EA 2GG9A 1M35A 1C22A 2DFIA 1B6AA 2NQ6A 3L24A 4IKSA 4ZNGA 1B59A 2BWWA 2ADUA 5JFRA 3MATA 5D6FA 1N51A 3PKAA 3CTZA 4FKCA 2V3XA 4A6WA 1R5GA 2EA2A 3BITA 3BIPA 4FLKA 5FCFA 1WL6A 2GTXA 2GZ5A 1PV9A 2EVCA 2GG5A 3IU7A 1WLRA 3RVAA 1Y1NA 2HOWA 2Q92A 2GU4A 4IKTA 4FLLA 3PKBA 1W7VA 2P9AA 1KQ9A 2IW2A 3TAVA 3PKDA 2BH3A 2GG8A 2GU6A 2Q93A 3BIQA 2OKNA 3MX6A 4FO8A 3D27A 4S2TP 4FO7A 4RZYA 4S00A 5JHUA 4PV4A 3FMRA 2BB7A 2BHAA 2BWTA 2EVOA 4U75A 3CB6A
chains in the Genus database with same CATH topology
4FLIA 3IU9A 4HXXA 1R5HA 4KM3A 1W2MA 1WBQA 4IF7A 1QZYA 1WKMA 2B3KA 2BWUA 1C24A 4MATA 2B3LA 4EGEA 4FLJA 4U6JA 4U70A 2BHDA 4PNCA 3IG4A 4S01A 1C21A 3TB5A 4IU6A 5CIKA 1C27A 4A6VA 1KQ0A 1QXWA 4U73A 2ZSGA 2EVMA 2NQ7A 2GA2A 1WL9A 2BHBA 1JAWA 2B3HA 2Q94A 4FUKA 2GG0A 4U71A 2MATA 1MATA 4ZWPA 3PKCA 2OAZA 4RZZA 2GG2A 1QXZA 1BN5A 1QXYA 1O0XA 1XGOA 2V3YA 2GGBA 2BWSA 5CE6A 5JI6A 4QR8A 2V6CA 3CB5A 1KP0A 4JUQA 2P99A 1XGMA 3FM3A 2BWXA 1CHMA 4RGZ1 1YW7A 5CLSA 3PKEA 4U6CA 1WN1A 2Q8KA 2V3ZA 4IKRA 1WY2A 2EA4A 2GG3A 2GGCA 5D6EA 5E5BA 4IKUA 2BN7A 4IECA 2BWYA 3Q6DA 4U6ZA 5CNXA 4U6WA 2G6PA 3IU8A 1YW9A 1YJ3A 2Q96A 2Q95A 4ZWUA 1YVMA 3S6BA 4R60A 3FMQA 3RORA 1R58A 1XGSA 5CDVA 2GU5A 4ZWOA 4Z7MA 1BOAA 2GG7A 1XNZA 4B28A 2P98A 5FCHA 4IPAA 4S2RP 5CDEA 1XGNA 4U76A 4U69A 2BWVA 4U1BA 2GU7A 2BHCA 5CDLA 1C23A 1YW8A 4IDYA 3MR1A 4OOKA 1A16A 3L7GA 4U6EA 2GG9A 1M35A 1C22A 2DFIA 1B6AA 2NQ6A 3L24A 4IKSA 4ZNGA 1B59A 2BWWA 2ADUA 5JFRA 3MATA 5D6FA 1N51A 3PKAA 3CTZA 4FKCA 2V3XA 4A6WA 1R5GA 2EA2A 3BITA 3BIPA 4FLKA 5FCFA 1WL6A 2GTXA 2GZ5A 1PV9A 2EVCA 2GG5A 3IU7A 1WLRA 3RVAA 1Y1NA 2HOWA 2Q92A 2GU4A 4IKTA 4FLLA 3PKBA 1W7VA 2P9AA 1KQ9A 2IW2A 3TAVA 3PKDA 2BH3A 2GG8A 2GU6A 2Q93A 3BIQA 2OKNA 3MX6A 4FO8A 3D27A 4S2TP 4FO7A 4RZYA 4S00A 5JHUA 4PV4A 3FMRA 2BB7A 2BHAA 2BWTA 2EVOA 4U75A 3CB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLI A;  3IU9 A;  4HXX A;  1R5H A;  4KM3 A;  1W2M A;  1WBQ A;  4IF7 A;  1QZY A;  1WKM A;  2B3K A;  2BWU A;  1C24 A;  4MAT A;  2B3L A;  4EGE A;  4FLJ A;  4U6J A;  4U70 A;  2BHD A;  4PNC A;  3IG4 A;  4S01 A;  1C21 A;  3TB5 A;  4IU6 A;  5CIK A;  1C27 A;  4A6V A;  1KQ0 A;  1QXW A;  4U73 A;  2ZSG A;  2EVM A;  2NQ7 A;  2GA2 A;  1WL9 A;  2BHB A;  1JAW A;  2B3H A;  2Q94 A;  4FUK A;  2GG0 A;  4U71 A;  2MAT A;  1MAT A;  4ZWP A;  3PKC A;  2OAZ A;  4RZZ A;  2GG2 A;  1QXZ A;  1BN5 A;  1QXY A;  1O0X A;  1XGO A;  2V3Y A;  2GGB A;  2BWS A;  5CE6 A;  5JI6 A;  4QR8 A;  2V6C A;  3CB5 A;  1KP0 A;  4JUQ A;  2P99 A;  1XGM A;  3FM3 A;  2BWX A;  1CHM A;  4RGZ 1;  1YW7 A;  5CLS A;  3PKE A;  4U6C A;  1WN1 A;  2Q8K A;  2V3Z A;  4IKR A;  1WY2 A;  2EA4 A;  2GG3 A;  2GGC A;  5D6E A;  5E5B A;  4IKU A;  2BN7 A;  4IEC A;  2BWY A;  3Q6D A;  4U6Z A;  5CNX A;  4U6W A;  2G6P A;  3IU8 A;  1YW9 A;  1YJ3 A;  2Q96 A;  2Q95 A;  4ZWU A;  1YVM A;  3S6B A;  4R60 A;  3FMQ A;  3ROR A;  1R58 A;  1XGS A;  5CDV A;  2GU5 A;  4ZWO A;  4Z7M A;  1BOA A;  2GG7 A;  1XNZ A;  4B28 A;  2P98 A;  5FCH A;  4IPA A;  4S2R P;  5CDE A;  1XGN A;  4U76 A;  4U69 A;  2BWV A;  4U1B A;  2GU7 A;  2BHC A;  5CDL A;  1C23 A;  1YW8 A;  4IDY A;  3MR1 A;  4OOK A;  1A16 A;  3L7G A;  4U6E A;  2GG9 A;  1M35 A;  1C22 A;  2DFI A;  1B6A A;  2NQ6 A;  3L24 A;  4IKS A;  4ZNG A;  1B59 A;  2BWW A;  2ADU A;  5JFR A;  3MAT A;  5D6F A;  1N51 A;  3PKA A;  3CTZ A;  4FKC A;  2V3X A;  4A6W A;  1R5G A;  2EA2 A;  3BIT A;  3BIP A;  4FLK A;  5FCF A;  1WL6 A;  2GTX A;  2GZ5 A;  1PV9 A;  2EVC A;  2GG5 A;  3IU7 A;  1WLR A;  3RVA A;  1Y1N A;  2HOW A;  2Q92 A;  2GU4 A;  4IKT A;  4FLL A;  3PKB A;  1W7V A;  2P9A A;  1KQ9 A;  2IW2 A;  3TAV A;  3PKD A;  2BH3 A;  2GG8 A;  2GU6 A;  2Q93 A;  3BIQ A;  2OKN A;  3MX6 A;  4FO8 A;  3D27 A;  4S2T P;  4FO7 A;  4RZY A;  4S00 A;  5JHU A;  4PV4 A;  3FMR A;  2BB7 A;  2BHA A;  2BWT A;  2EVO A;  4U75 A;  3CB6 A; 
#chains in the Genus database with same CATH topology
 4FLI A;  3IU9 A;  4HXX A;  1R5H A;  4KM3 A;  1W2M A;  1WBQ A;  4IF7 A;  1QZY A;  1WKM A;  2B3K A;  2BWU A;  1C24 A;  4MAT A;  2B3L A;  4EGE A;  4FLJ A;  4U6J A;  4U70 A;  2BHD A;  4PNC A;  3IG4 A;  4S01 A;  1C21 A;  3TB5 A;  4IU6 A;  5CIK A;  1C27 A;  4A6V A;  1KQ0 A;  1QXW A;  4U73 A;  2ZSG A;  2EVM A;  2NQ7 A;  2GA2 A;  1WL9 A;  2BHB A;  1JAW A;  2B3H A;  2Q94 A;  4FUK A;  2GG0 A;  4U71 A;  2MAT A;  1MAT A;  4ZWP A;  3PKC A;  2OAZ A;  4RZZ A;  2GG2 A;  1QXZ A;  1BN5 A;  1QXY A;  1O0X A;  1XGO A;  2V3Y A;  2GGB A;  2BWS A;  5CE6 A;  5JI6 A;  4QR8 A;  2V6C A;  3CB5 A;  1KP0 A;  4JUQ A;  2P99 A;  1XGM A;  3FM3 A;  2BWX A;  1CHM A;  4RGZ 1;  1YW7 A;  5CLS A;  3PKE A;  4U6C A;  1WN1 A;  2Q8K A;  2V3Z A;  4IKR A;  1WY2 A;  2EA4 A;  2GG3 A;  2GGC A;  5D6E A;  5E5B A;  4IKU A;  2BN7 A;  4IEC A;  2BWY A;  3Q6D A;  4U6Z A;  5CNX A;  4U6W A;  2G6P A;  3IU8 A;  1YW9 A;  1YJ3 A;  2Q96 A;  2Q95 A;  4ZWU A;  1YVM A;  3S6B A;  4R60 A;  3FMQ A;  3ROR A;  1R58 A;  1XGS A;  5CDV A;  2GU5 A;  4ZWO A;  4Z7M A;  1BOA A;  2GG7 A;  1XNZ A;  4B28 A;  2P98 A;  5FCH A;  4IPA A;  4S2R P;  5CDE A;  1XGN A;  4U76 A;  4U69 A;  2BWV A;  4U1B A;  2GU7 A;  2BHC A;  5CDL A;  1C23 A;  1YW8 A;  4IDY A;  3MR1 A;  4OOK A;  1A16 A;  3L7G A;  4U6E A;  2GG9 A;  1M35 A;  1C22 A;  2DFI A;  1B6A A;  2NQ6 A;  3L24 A;  4IKS A;  4ZNG A;  1B59 A;  2BWW A;  2ADU A;  5JFR A;  3MAT A;  5D6F A;  1N51 A;  3PKA A;  3CTZ A;  4FKC A;  2V3X A;  4A6W A;  1R5G A;  2EA2 A;  3BIT A;  3BIP A;  4FLK A;  5FCF A;  1WL6 A;  2GTX A;  2GZ5 A;  1PV9 A;  2EVC A;  2GG5 A;  3IU7 A;  1WLR A;  3RVA A;  1Y1N A;  2HOW A;  2Q92 A;  2GU4 A;  4IKT A;  4FLL A;  3PKB A;  1W7V A;  2P9A A;  1KQ9 A;  2IW2 A;  3TAV A;  3PKD A;  2BH3 A;  2GG8 A;  2GU6 A;  2Q93 A;  3BIQ A;  2OKN A;  3MX6 A;  4FO8 A;  3D27 A;  4S2T P;  4FO7 A;  4RZY A;  4S00 A;  5JHU A;  4PV4 A;  3FMR A;  2BB7 A;  2BHA A;  2BWT A;  2EVO A;  4U75 A;  3CB6 A; 
#chains in the Genus database with same CATH homology
 4FLI A;  3IU9 A;  4HXX A;  1R5H A;  4KM3 A;  1W2M A;  1WBQ A;  4IF7 A;  1QZY A;  1WKM A;  2B3K A;  2BWU A;  1C24 A;  4MAT A;  2B3L A;  4EGE A;  4FLJ A;  4U6J A;  4U70 A;  2BHD A;  4PNC A;  3IG4 A;  4S01 A;  1C21 A;  3TB5 A;  4IU6 A;  5CIK A;  1C27 A;  4A6V A;  1KQ0 A;  1QXW A;  4U73 A;  2ZSG A;  2EVM A;  2NQ7 A;  2GA2 A;  1WL9 A;  2BHB A;  1JAW A;  2B3H A;  2Q94 A;  4FUK A;  2GG0 A;  4U71 A;  2MAT A;  1MAT A;  4ZWP A;  3PKC A;  2OAZ A;  4RZZ A;  2GG2 A;  1QXZ A;  1BN5 A;  1QXY A;  1O0X A;  1XGO A;  2V3Y A;  2GGB A;  2BWS A;  5CE6 A;  5JI6 A;  4QR8 A;  2V6C A;  3CB5 A;  1KP0 A;  4JUQ A;  2P99 A;  1XGM A;  3FM3 A;  2BWX A;  1CHM A;  4RGZ 1;  1YW7 A;  5CLS A;  3PKE A;  4U6C A;  1WN1 A;  2Q8K A;  2V3Z A;  4IKR A;  1WY2 A;  2EA4 A;  2GG3 A;  2GGC A;  5D6E A;  5E5B A;  4IKU A;  2BN7 A;  4IEC A;  2BWY A;  3Q6D A;  4U6Z A;  5CNX A;  4U6W A;  2G6P A;  3IU8 A;  1YW9 A;  1YJ3 A;  2Q96 A;  2Q95 A;  4ZWU A;  1YVM A;  3S6B A;  4R60 A;  3FMQ A;  3ROR A;  1R58 A;  1XGS A;  5CDV A;  2GU5 A;  4ZWO A;  4Z7M A;  1BOA A;  2GG7 A;  1XNZ A;  4B28 A;  2P98 A;  5FCH A;  4IPA A;  4S2R P;  5CDE A;  1XGN A;  4U76 A;  4U69 A;  2BWV A;  4U1B A;  2GU7 A;  2BHC A;  5CDL A;  1C23 A;  1YW8 A;  4IDY A;  3MR1 A;  4OOK A;  1A16 A;  3L7G A;  4U6E A;  2GG9 A;  1M35 A;  1C22 A;  2DFI A;  1B6A A;  2NQ6 A;  3L24 A;  4IKS A;  4ZNG A;  1B59 A;  2BWW A;  2ADU A;  5JFR A;  3MAT A;  5D6F A;  1N51 A;  3PKA A;  3CTZ A;  4FKC A;  2V3X A;  4A6W A;  1R5G A;  2EA2 A;  3BIT A;  3BIP A;  4FLK A;  5FCF A;  1WL6 A;  2GTX A;  2GZ5 A;  1PV9 A;  2EVC A;  2GG5 A;  3IU7 A;  1WLR A;  3RVA A;  1Y1N A;  2HOW A;  2Q92 A;  2GU4 A;  4IKT A;  4FLL A;  3PKB A;  1W7V A;  2P9A A;  1KQ9 A;  2IW2 A;  3TAV A;  3PKD A;  2BH3 A;  2GG8 A;  2GU6 A;  2Q93 A;  3BIQ A;  2OKN A;  3MX6 A;  4FO8 A;  3D27 A;  4S2T P;  4FO7 A;  4RZY A;  4S00 A;  5JHU A;  4PV4 A;  3FMR A;  2BB7 A;  2BHA A;  2BWT A;  2EVO A;  4U75 A;  3CB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...