1QYEA

Crystal structure of the n-domain of the er hsp90 chaperone grp94 in complex with 2-chlorodideoxyadenosine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
266
structure length
225
Chain Sequence
b'KSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Structure of the N-terminal Domain of GRP94. Basis for Ligand Specificity and Regulation
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 70
structure length 225
sequence length 266
ec nomenclature
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1qyeA00
4HZ5A 2BYHA 4PL9A 3A0XA 2IWSA 4CE1A 1UYHA 3EHFA 4EFUA 2YE3A 4XC0A 5D6QA 4ASBA 3SL2A 1UYLA 2BU8A 4LWFA 4O05A 2Q8FA 4MPCA 5D7RA 4XIQA 1TC0A 4UROA 5J6AA 4LWHA 3RLRA 1GKZA 4XKAA 2O1UA 5D7CA 3KE6A 4AWPA 4JASA 4L91A 1I59A 2XJGA 3GIEA 1YESA 4XITA 2YE5A 2ZBKB 2BU5A 3HZ1A 1YSRA 2HG1A 3CGZA 3EKOA 2YGFA 4FPPA 3G7EA 4MP2A 3R4NA 1MU5A 4MPEA 3HEKA 2JKIA 4L8ZA 1AM1A 4ASFA 3RKZA 1PVGA 4LP0A 2BT0A 2BRCA 2HKJA 5CTYA 5F5RA 4L94A 2BYIA 2YE4A 3FV5A 3K60A 2YK9A 2E0AA 2YK2A 1Y4UA 3INXA 3T10A 3DGEA 2QFOA 4L90A 4HY6A 1NHHA 4LWEA 1Y8PA 4XE2A 4CWRA 2YEIA 2XABA 1EA6A 4XKOA 5CTUA 4XDMA 3B26A 3GIGA 5M4NA 4MB9A 4LWIA 1GKXA 4URMA 3EHHA 4B6CA 4WUDA 2YEJA 3A0WA 4XIPA 2BZ5A 4MOTA 2VWCA 4CWSA 3CGYA 4XIRA 4BQGA 2WI3A 1UYEA 1YERA 4BIZA 1H7SA 2ZDYA 2IWXA 2YKJA 4CWQA 3HYYA 3RLPA 3LNUA 4HXZA 4MPNA 1UY6A 3B27A 1AMWA 2YE9A 2C2AA 4BAEA 3QTFA 3O0IA 5FWKA 4BIUA 1YC4A 1U2OA 4H81A 2CCUA 4I5SA 2BSMA 1Z5BA 2Q8HA 3RLQA 1S16A 2IORA 4U7NA 2BU6A 4V26A 1YT1A 2YI5A 4CWFA 5FNFA 4BQJA 1UYFA 1UYCA 1BYQA 2WI7A 5IN9A 2WI6A 4WUBA 4X9LA 2YJXA 2IOQA 3INWA 2YKCA 3VHCA 1UY8A 1H7UA 4I3HA 4HY1A 1QY8A 4H7QA 2YEHA 4R3MA 1TH8A 5IDJA 3GIFA 2YI7A 2CH4A 4FMTA 4O04A 4HYPA 1ZXNA 2ESAA 1UYKA 1Y8OA 5M4MA 4CWNA 3FT5A 2BREA 4E01A 3EHGA 1UYDA 5FNDA 1KIJA 3CWVA 3K98A 2WERA 1Z5CA 4KP4A 4QPKA 4AWOA 2XX4A 2YE2A 2WEPA 3ZXQA 1YT2A 1UYGA 3D36A 3OWDA 4H85A 3U2DA 1TC6A 3U67A 3T2SA 2IOPA 1BXDA 4MP7A 3D0BA 1I5BA 2XHTA 2XJXA 2FXSA 1Z5AA 2VCJA 2QG2A 2Q8GA 1YETA 4JAVA 4P8OA 2HCHA 4QPJA 2XX2A 4R1FA 4O0BA 4YKZA 5CTXA 2CG9A 3B25A 2YEEA 3HYZA 4O09A 1EI1A 4E00A 2YEDA 4NH9A 5BOCA 4MBCA 3ZKDA 3K97A 4XKKA 3TZ0A 4CE3A 2YI0A 5BODA 4DUHA 2ZKJA 5J71A 4JQLA 4B7PA 4XD8A 4EMVA 4URLA 4XCJA 2K5BA 1A4HA 2XX5A 3HHUA 1UY7A 3B28A 5D7DA 2FYPA 3PEJA 4K4OA 5GGZA 4YKXA 1ID0A 3R4PA 4YKRA 2WI2A 1I5AA 3TZ2A 3Q5LA 4U7OA 2ZDXA 1AH6A 4Q20A 3VHAA 2FWZA 1JM6A 2EXLA 2WI4A 3ZKBA 3C0EA 1I5DA 4JAUA 2O1WA 3K99A 3WHAA 4E02A 4GFNA 3TZ4A 3EKRA 5F3KA 4LWGA 3ZM7A 4YKUA 4V25A 3H80A 4AS9A 2YGAA 4NH7A 2VW5A 2H55A 2PNRA 4LPBA 4AWQA 1YSZA 3O2FA 4PRVA 4EGIA 4KSGA 3A0ZA 2VCIA 3H4LA 4CWOA 3A0TA 1I58A 2UWDA 1QYEA 2YE7A 3G7BA 4CE2A 2H8MA 4FCQA 4ASGA 4NH8A 4YKWA 1UY9A 3ZXOA 2XDUA 1YC1A 1AH8A 3A0YA 1THNA 3MNRP 2XJJA 3TZ5A 4HZ0A 1QZRA 2WI1A 3TUHA 2YJWA 5L3JA 3GIGB 3BMYA 2XDSA 3O6OA 4PU9A 1TBWA 2BU7A 4EFTA 1YS3A 4HYMA 5CTWA 4YKTA 1NHIA 2XHXA 4KQVA 3Q5KA 1TIDA 3IEDA 4FCPA 2JJCA 2WI5A 4GQTA 2YGEA 3R4MA 4EGKA 2YEBA 4BXIA 1BGQA 5D6PA 4CWPA 3QDDA 3CRKA 1Y4SA 3B24A 3OWBA 2XDXA 2Q8IA 3VHDA 5M4KA 5M4PA 1TILA 2YECA 4XTJA 3D2RA 2CCTA 5M4HA 3Q5JA 4YKYA 3R91A 1Y8NA 5CPHA 3VADA 3R92A 2CCSA 2YKIA 2Q2EB 1B63A 1U0ZA 4HXWA 1B3QA 4L93A 2BTZA 4KTNA 3PEHA 2YE6A 2XDLA 4R3AA 1KZNA 1YT0A 5FNCA 3JZ3A 3T0HA 1AJ6A 2QG0A 4KFGA 2GFDA 5C93A 2WEQA 2XHRA 4EEHA 2QF6A 4URNA 1S14A 4WUCA 1YC3A 4O07A 1I5CA 3BM9A 4ZVIA 1ZXMA 1US7A 1Z59A 2YI6A 2YKEA 4GGLA 3HZ5A 4EGHA 3FT8A 5IDMA 1NHJA 2XK2A 5CF0A 4W7TA 1GJVA 1OSFA 3A0RA 1BKNA 2IWUA 3CRLA 4FCRA 2YEGA 2AKPA 2YE8A 4ZKIA 3NMQA 3OW6A 4EM7A 2YEAA 4GT8A 2YKBA 4U93A 4PRXA 3C11A 2O1VA 1UYMA 3G75A 1MX0A 2GQPA 2CGFA 1UYIA 4XCLA 4DZYA 4GEEA 4KSHA 2XCMA 3LPSA 1R62A 4ASAA 3U2KA 2FWYA 2BU2A 3T1KA 4P7AA 1ZW9A 4GCZA 2XD6A 3TTZA 3WQ9A 3OMUA 1B62A 1L0OA 2XDKA 3R4OA 3T0ZA 5M4EA 2YEFA 3EHJA 3OPDA 4YKQA 1ZWHA 4CWTA
chains in the Genus database with same CATH superfamily
4HZ5A 2BYHA 4PL9A 3A0XA 2IWSA 4CE1A 1UYHA 3EHFA 4EFUA 2YE3A 4XC0A 5D6QA 4ASBA 3SL2A 1UYLA 2BU8A 4LWFA 4O05A 2Q8FA 4MPCA 5D7RA 4XIQA 1TC0A 4UROA 5J6AA 4LWHA 3RLRA 1GKZA 4XKAA 2O1UA 5D7CA 3KE6A 4AWPA 4JASA 4L91A 1I59A 2XJGA 3GIEA 1YESA 4XITA 2YE5A 2ZBKB 2BU5A 3HZ1A 1YSRA 2HG1A 3CGZA 3EKOA 2YGFA 4FPPA 3G7EA 4MP2A 3R4NA 1MU5A 4MPEA 3HEKA 2JKIA 4L8ZA 1AM1A 4ASFA 3RKZA 1PVGA 4LP0A 2BT0A 2BRCA 2HKJA 5CTYA 5F5RA 4L94A 2BYIA 2YE4A 3FV5A 3K60A 2YK9A 2E0AA 2YK2A 1Y4UA 3INXA 3T10A 3DGEA 2QFOA 4L90A 4HY6A 1NHHA 4LWEA 1Y8PA 4XE2A 4CWRA 2YEIA 2XABA 1EA6A 4XKOA 5CTUA 4XDMA 3B26A 3GIGA 5M4NA 4MB9A 4LWIA 1GKXA 4URMA 3EHHA 4B6CA 4WUDA 2YEJA 3A0WA 4XIPA 2BZ5A 4MOTA 2VWCA 4CWSA 3CGYA 4XIRA 2FTKA 2WI3A 4BQGA 1UYEA 1YERA 4BIZA 1H7SA 2ZDYA 2IWXA 2YKJA 4CWQA 3HYYA 3RLPA 3LNUA 4HXZA 4MPNA 1UY6A 3B27A 1AMWA 2YE9A 2C2AA 4BAEA 3QTFA 3O0IA 5FWKA 4BIUA 1YC4A 1U2OA 4H81A 2CCUA 4I5SA 2BSMA 1Z5BA 2Q8HA 3RLQA 1S16A 2IORA 4U7NA 2BU6A 4V26A 1YT1A 2YI5A 4CWFA 5FNFA 4BQJA 1UYFA 1UYCA 1BYQA 2WI7A 5IN9A 2WI6A 3LMMA 3S5TA 4WUBA 4X9LA 2YJXA 2HHIA 2IOQA 3INWA 2YKCA 3VHCA 1UY8A 1H7UA 4I3HA 4HY1A 1QY8A 4H7QA 2YEHA 4R3MA 1TH8A 5IDJA 3GIFA 2YI7A 2CH4A 4FMTA 4O04A 4HYPA 1ZXNA 2ESAA 1UYKA 1Y8OA 5M4MA 4CWNA 3FT5A 2BREA 4E01A 3EHGA 1UYDA 5FNDA 1KIJA 3CWVA 3K98A 2WERA 1Z5CA 4KP4A 4QPKA 4AWOA 2XX4A 2YE2A 2WEPA 3ZXQA 1YT2A 1UYGA 3D36A 3OWDA 4H85A 3U2DA 1TC6A 3U67A 3T2SA 2IOPA 1BXDA 4MP7A 3D0BA 1I5BA 2XHTA 2XJXA 1IXMA 2FXSA 1Z5AA 2VCJA 2QG2A 2Q8GA 1YETA 4JAVA 4P8OA 2HCHA 4QPJA 2XX2A 4R1FA 4O0BA 4YKZA 5CTXA 2CG9A 3B25A 2YEEA 3HYZA 4O09A 1EI1A 4E00A 2YEDA 2C1GA 4NH9A 5BOCA 4MBCA 3ZKDA 3K97A 4XKKA 3TZ0A 4CE3A 2YI0A 5BODA 4DUHA 2ZKJA 1F51A 5J71A 4JQLA 4B7PA 4XD8A 4EMVA 4URLA 4XCJA 2K5BA 1A4HA 2XX5A 3HHUA 1UY7A 3B28A 5D7DA 2FYPA 3PEJA 4K4OA 5GGZA 4YKXA 1ID0A 4E72A 3R4PA 4YKRA 2WI2A 1I5AA 3TZ2A 3Q5LA 4U7OA 2ZDXA 1AH6A 4Q20A 3VHAA 2FWZA 1JM6A 2EXLA 2WI4A 3ZKBA 3C0EA 1I5DA 4JAUA 2O1WA 3K99A 3WHAA 4E02A 4GFNA 3TZ4A 3EKRA 5F3KA 4LWGA 3ZM7A 4YKUA 4V25A 3H80A 4AS9A 2YGAA 4NH7A 2VW5A 2H55A 2PNRA 4LPBA 4AWQA 1YSZA 3O2FA 4PRVA 4EGIA 4KSGA 3A0ZA 2VCIA 3H4LA 4CWOA 3A0TA 1I58A 2UWDA 1QYEA 2YE7A 3G7BA 4CE2A 2H8MA 4FCQA 4ASGA 4NH8A 4YKWA 1UY9A 3ZXOA 2XDUA 1YC1A 1AH8A 3A0YA 1THNA 3MNRP 2XJJA 3TZ5A 4HZ0A 1QZRA 2WI1A 3TUHA 2YJWA 5L3JA 3GIGB 3CYGA 3BMYA 2XDSA 3O6OA 4PU9A 1TBWA 2BU7A 4EFTA 1YS3A 4HYMA 5CTWA 4YKTA 1NHIA 2XHXA 4KQVA 3Q5KA 1TIDA 3IEDA 4FCPA 2JJCA 2WI5A 4GQTA 2YGEA 3R4MA 4EGKA 2YEBA 4BXIA 1BGQA 5D6PA 4CWPA 3QDDA 3CRKA 1Y4SA 3B24A 3OWBA 2XDXA 2Q8IA 3VHDA 5M4KA 5M4PA 1TILA 2YECA 5JENA 4XTJA 3D2RA 2CCTA 5M4HA 3Q5JA 4YKYA 3R91A 1Y8NA 5CPHA 3VADA 3R92A 2C1IA 2CCSA 2YKIA 2Q2EB 1B63A 1U0ZA 4HXWA 1B3QA 4L93A 2BTZA 4KTNA 3PEHA 2YE6A 2XDLA 4R3AA 1KZNA 1YT0A 5FNCA 3JZ3A 3T0HA 1AJ6A 2QG0A 4KFGA 2GFDA 5C93A 2WEQA 2XHRA 4EEHA 2QF6A 4URNA 1S14A 4WUCA 1YC3A 4O07A 1I5CA 3BM9A 4ZVIA 1ZXMA 1US7A 1Z59A 2YI6A 2YKEA 4GGLA 3HZ5A 4EGHA 3FT8A 5IDMA 1NHJA 2XK2A 5CF0A 4W7TA 1GJVA 1OSFA 3A0RA 1BKNA 2IWUA 3CRLA 4FCRA 2YEGA 2AKPA 2YE8A 4ZKIA 3NMQA 3OW6A 4EM7A 2YEAA 4GT8A 2YKBA 4U93A 4PRXA 3C11A 2O1VA 1UYMA 3G75A 1MX0A 2GQPA 2CGFA 1UYIA 4XCLA 4DZYA 4GEEA 4KSHA 2XCMA 3LPSA 1R62A 4ASAA 3U2KA 2FWYA 2BU2A 3T1KA 4P7AA 1ZW9A 4GCZA 2XD6A 3TTZA 3WQ9A 3OMUA 1B62A 1L0OA 2XDKA 3R4OA 3T0ZA 5M4EA 2YEFA 3EHJA 3OPDA 4YKQA 1ZWHA 4CWTA
chains in the Genus database with same CATH topology
4HZ5A 2BYHA 4PL9A 3A0XA 2IWSA 4CE1A 1UYHA 3EHFA 4EFUA 2YE3A 4XC0A 5D6QA 4ASBA 3SL2A 1UYLA 2BU8A 4LWFA 4O05A 2Q8FA 4MPCA 5D7RA 4XIQA 1TC0A 4UROA 5J6AA 4LWHA 3RLRA 1GKZA 4XKAA 2O1UA 5D7CA 3KE6A 4AWPA 4JASA 4L91A 1I59A 2XJGA 3GIEA 1YESA 4XITA 2YE5A 2ZBKB 2BU5A 3HZ1A 1YSRA 2HG1A 3CGZA 3EKOA 2YGFA 4FPPA 3G7EA 4MP2A 3R4NA 1MU5A 4MPEA 3HEKA 2JKIA 4L8ZA 1AM1A 4ASFA 3RKZA 1PVGA 4LP0A 2BT0A 2BRCA 2HKJA 5CTYA 5F5RA 4L94A 2BYIA 2YE4A 3FV5A 3K60A 2YK9A 2E0AA 2YK2A 1Y4UA 3INXA 3T10A 3DGEA 2QFOA 4L90A 4HY6A 1NHHA 4LWEA 1Y8PA 4XE2A 4CWRA 2YEIA 2XABA 1EA6A 4XKOA 5CTUA 4XDMA 3B26A 3GIGA 5M4NA 4MB9A 4LWIA 1GKXA 4URMA 3EHHA 4B6CA 4WUDA 2YEJA 3A0WA 4XIPA 2BZ5A 4MOTA 2VWCA 4CWSA 3CGYA 4XIRA 4BQGA 2WI3A 1UYEA 1YERA 4BIZA 1H7SA 2ZDYA 2IWXA 2YKJA 4CWQA 3HYYA 3RLPA 3LNUA 4HXZA 4MPNA 1UY6A 3B27A 1AMWA 2YE9A 2C2AA 4BAEA 3QTFA 3O0IA 5FWKA 4BIUA 1YC4A 1U2OA 4H81A 2CCUA 4I5SA 2BSMA 1Z5BA 2Q8HA 3RLQA 1S16A 2IORA 4U7NA 2BU6A 4V26A 1YT1A 2YI5A 4CWFA 5FNFA 4BQJA 1UYFA 1UYCA 1BYQA 2WI7A 5IN9A 2WI6A 4WUBA 4X9LA 2YJXA 2IOQA 3INWA 2YKCA 3VHCA 1UY8A 1H7UA 4I3HA 4HY1A 1QY8A 4H7QA 2YEHA 4R3MA 1TH8A 5IDJA 3GIFA 2YI7A 2CH4A 4FMTA 4O04A 4HYPA 1ZXNA 2ESAA 1UYKA 1Y8OA 5M4MA 4CWNA 3FT5A 2BREA 4E01A 3EHGA 1UYDA 5FNDA 1KIJA 3CWVA 3K98A 2WERA 1Z5CA 4KP4A 4QPKA 4AWOA 2XX4A 2YE2A 2WEPA 3ZXQA 1YT2A 1UYGA 3D36A 3OWDA 4H85A 3U2DA 1TC6A 3U67A 3T2SA 2IOPA 1BXDA 4MP7A 3D0BA 1I5BA 2XHTA 2XJXA 2FXSA 1Z5AA 2VCJA 2QG2A 2Q8GA 1YETA 4JAVA 4P8OA 2HCHA 4QPJA 2XX2A 4R1FA 4O0BA 4YKZA 5CTXA 2CG9A 3B25A 2YEEA 3HYZA 4O09A 1EI1A 4E00A 2YEDA 4NH9A 5BOCA 4MBCA 3ZKDA 3K97A 4XKKA 3TZ0A 4CE3A 2YI0A 5BODA 4DUHA 2ZKJA 5J71A 4JQLA 4B7PA 4XD8A 4EMVA 4URLA 4XCJA 2K5BA 1A4HA 2XX5A 3HHUA 1UY7A 3B28A 5D7DA 2FYPA 3PEJA 4K4OA 5GGZA 4YKXA 1ID0A 3R4PA 4YKRA 2WI2A 1I5AA 3TZ2A 3Q5LA 4U7OA 2ZDXA 1AH6A 4Q20A 3VHAA 2FWZA 1JM6A 2EXLA 2WI4A 3ZKBA 3C0EA 1I5DA 4JAUA 2O1WA 3K99A 3WHAA 4E02A 4GFNA 3TZ4A 3EKRA 5F3KA 4LWGA 3ZM7A 4YKUA 4V25A 3H80A 4AS9A 2YGAA 4NH7A 2VW5A 2H55A 2PNRA 4LPBA 4AWQA 1YSZA 3O2FA 4PRVA 4EGIA 4KSGA 3A0ZA 2VCIA 3H4LA 4CWOA 3A0TA 1I58A 2UWDA 1QYEA 2YE7A 3G7BA 4CE2A 2H8MA 4FCQA 4ASGA 4NH8A 4YKWA 1UY9A 3ZXOA 2XDUA 1YC1A 1AH8A 3A0YA 1THNA 3MNRP 2XJJA 3TZ5A 4HZ0A 1QZRA 2WI1A 3TUHA 2YJWA 5L3JA 3GIGB 3BMYA 2XDSA 3O6OA 4PU9A 1TBWA 2BU7A 4EFTA 1YS3A 4HYMA 5CTWA 4YKTA 1NHIA 2XHXA 4KQVA 3Q5KA 1TIDA 3IEDA 4FCPA 2JJCA 2WI5A 4GQTA 2YGEA 3R4MA 4EGKA 2YEBA 4BXIA 1BGQA 5D6PA 4CWPA 3QDDA 3CRKA 1Y4SA 3B24A 3OWBA 2XDXA 2Q8IA 3VHDA 5M4KA 5M4PA 1TILA 2YECA 4XTJA 3D2RA 2CCTA 5M4HA 3Q5JA 4YKYA 3R91A 1Y8NA 5CPHA 3VADA 3R92A 2CCSA 2YKIA 2Q2EB 1B63A 1U0ZA 4HXWA 1B3QA 4L93A 2BTZA 4KTNA 3PEHA 2YE6A 2XDLA 4R3AA 1KZNA 1YT0A 5FNCA 3JZ3A 3T0HA 1AJ6A 2QG0A 4KFGA 2GFDA 5C93A 2WEQA 2XHRA 4EEHA 2QF6A 4URNA 1S14A 4WUCA 1YC3A 4O07A 1I5CA 3BM9A 4ZVIA 1ZXMA 1US7A 1Z59A 2YI6A 2YKEA 4GGLA 3HZ5A 4EGHA 3FT8A 5IDMA 1NHJA 2XK2A 5CF0A 4W7TA 1GJVA 1OSFA 3A0RA 1BKNA 2IWUA 3CRLA 4FCRA 2YEGA 2AKPA 2YE8A 4ZKIA 3NMQA 3OW6A 4EM7A 2YEAA 4GT8A 2YKBA 4U93A 4PRXA 3C11A 2O1VA 1UYMA 3G75A 1MX0A 2GQPA 2CGFA 1UYIA 4XCLA 4DZYA 4GEEA 4KSHA 2XCMA 3LPSA 1R62A 4ASAA 3U2KA 2FWYA 2BU2A 3T1KA 4P7AA 1ZW9A 4GCZA 2XD6A 3TTZA 3WQ9A 3OMUA 1B62A 1L0OA 2XDKA 3R4OA 3T0ZA 5M4EA 2YEFA 3EHJA 3OPDA 4YKQA 1ZWHA 4CWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HZ5 A;  2BYH A;  4PL9 A;  3A0X A;  2IWS A;  4CE1 A;  1UYH A;  3EHF A;  4EFU A;  2YE3 A;  4XC0 A;  5D6Q A;  4ASB A;  3SL2 A;  1UYL A;  2BU8 A;  4LWF A;  4O05 A;  2Q8F A;  4MPC A;  5D7R A;  4XIQ A;  1TC0 A;  4URO A;  5J6A A;  4LWH A;  3RLR A;  1GKZ A;  4XKA A;  2O1U A;  5D7C A;  3KE6 A;  4AWP A;  4JAS A;  4L91 A;  1I59 A;  2XJG A;  3GIE A;  1YES A;  4XIT A;  2YE5 A;  2ZBK B;  2BU5 A;  3HZ1 A;  1YSR A;  2HG1 A;  3CGZ A;  3EKO A;  2YGF A;  4FPP A;  3G7E A;  4MP2 A;  3R4N A;  1MU5 A;  4MPE A;  3HEK A;  2JKI A;  4L8Z A;  1AM1 A;  4ASF A;  3RKZ A;  1PVG A;  4LP0 A;  2BT0 A;  2BRC A;  2HKJ A;  5CTY A;  5F5R A;  4L94 A;  2BYI A;  2YE4 A;  3FV5 A;  3K60 A;  2YK9 A;  2E0A A;  2YK2 A;  1Y4U A;  3INX A;  3T10 A;  3DGE A;  2QFO A;  4L90 A;  4HY6 A;  1NHH A;  4LWE A;  1Y8P A;  4XE2 A;  4CWR A;  2YEI A;  2XAB A;  1EA6 A;  4XKO A;  5CTU A;  4XDM A;  3B26 A;  3GIG A;  5M4N A;  4MB9 A;  4LWI A;  1GKX A;  4URM A;  3EHH A;  4B6C A;  4WUD A;  2YEJ A;  3A0W A;  4XIP A;  2BZ5 A;  4MOT A;  2VWC A;  4CWS A;  3CGY A;  4XIR A;  4BQG A;  2WI3 A;  1UYE A;  1YER A;  4BIZ A;  1H7S A;  2ZDY A;  2IWX A;  2YKJ A;  4CWQ A;  3HYY A;  3RLP A;  3LNU A;  4HXZ A;  4MPN A;  1UY6 A;  3B27 A;  1AMW A;  2YE9 A;  2C2A A;  4BAE A;  3QTF A;  3O0I A;  5FWK A;  4BIU A;  1YC4 A;  1U2O A;  4H81 A;  2CCU A;  4I5S A;  2BSM A;  1Z5B A;  2Q8H A;  3RLQ A;  1S16 A;  2IOR A;  4U7N A;  2BU6 A;  4V26 A;  1YT1 A;  2YI5 A;  4CWF A;  5FNF A;  4BQJ A;  1UYF A;  1UYC A;  1BYQ A;  2WI7 A;  5IN9 A;  2WI6 A;  4WUB A;  4X9L A;  2YJX A;  2IOQ A;  3INW A;  2YKC A;  3VHC A;  1UY8 A;  1H7U A;  4I3H A;  4HY1 A;  1QY8 A;  4H7Q A;  2YEH A;  4R3M A;  1TH8 A;  5IDJ A;  3GIF A;  2YI7 A;  2CH4 A;  4FMT A;  4O04 A;  4HYP A;  1ZXN A;  2ESA A;  1UYK A;  1Y8O A;  5M4M A;  4CWN A;  3FT5 A;  2BRE A;  4E01 A;  3EHG A;  1UYD A;  5FND A;  1KIJ A;  3CWV A;  3K98 A;  2WER A;  1Z5C A;  4KP4 A;  4QPK A;  4AWO A;  2XX4 A;  2YE2 A;  2WEP A;  3ZXQ A;  1YT2 A;  1UYG A;  3D36 A;  3OWD A;  4H85 A;  3U2D A;  1TC6 A;  3U67 A;  3T2S A;  2IOP A;  1BXD A;  4MP7 A;  3D0B A;  1I5B A;  2XHT A;  2XJX A;  2FXS A;  1Z5A A;  2VCJ A;  2QG2 A;  2Q8G A;  1YET A;  4JAV A;  4P8O A;  2HCH A;  4QPJ A;  2XX2 A;  4R1F A;  4O0B A;  4YKZ A;  5CTX A;  2CG9 A;  3B25 A;  2YEE A;  3HYZ A;  4O09 A;  1EI1 A;  4E00 A;  2YED A;  4NH9 A;  5BOC A;  4MBC A;  3ZKD A;  3K97 A;  4XKK A;  3TZ0 A;  4CE3 A;  2YI0 A;  5BOD A;  4DUH A;  2ZKJ A;  5J71 A;  4JQL A;  4B7P A;  4XD8 A;  4EMV A;  4URL A;  4XCJ A;  2K5B A;  1A4H A;  2XX5 A;  3HHU A;  1UY7 A;  3B28 A;  5D7D A;  2FYP A;  3PEJ A;  4K4O A;  5GGZ A;  4YKX A;  1ID0 A;  3R4P A;  4YKR A;  2WI2 A;  1I5A A;  3TZ2 A;  3Q5L A;  4U7O A;  2ZDX A;  1AH6 A;  4Q20 A;  3VHA A;  2FWZ A;  1JM6 A;  2EXL A;  2WI4 A;  3ZKB A;  3C0E A;  1I5D A;  4JAU A;  2O1W A;  3K99 A;  3WHA A;  4E02 A;  4GFN A;  3TZ4 A;  3EKR A;  5F3K A;  4LWG A;  3ZM7 A;  4YKU A;  4V25 A;  3H80 A;  4AS9 A;  2YGA A;  4NH7 A;  2VW5 A;  2H55 A;  2PNR A;  4LPB A;  4AWQ A;  1YSZ A;  3O2F A;  4PRV A;  4EGI A;  4KSG A;  3A0Z A;  2VCI A;  3H4L A;  4CWO A;  3A0T A;  1I58 A;  2UWD A;  1QYE A;  2YE7 A;  3G7B A;  4CE2 A;  2H8M A;  4FCQ A;  4ASG A;  4NH8 A;  4YKW A;  1UY9 A;  3ZXO A;  2XDU A;  1YC1 A;  1AH8 A;  3A0Y A;  1THN A;  3MNR P;  2XJJ A;  3TZ5 A;  4HZ0 A;  1QZR A;  2WI1 A;  3TUH A;  2YJW A;  5L3J A;  3GIG B;  3BMY A;  2XDS A;  3O6O A;  4PU9 A;  1TBW A;  2BU7 A;  4EFT A;  1YS3 A;  4HYM A;  5CTW A;  4YKT A;  1NHI A;  2XHX A;  4KQV A;  3Q5K A;  1TID A;  3IED A;  4FCP A;  2JJC A;  2WI5 A;  4GQT A;  2YGE A;  3R4M A;  4EGK A;  2YEB A;  4BXI A;  1BGQ A;  5D6P A;  4CWP A;  3QDD A;  3CRK A;  1Y4S A;  3B24 A;  3OWB A;  2XDX A;  2Q8I A;  3VHD A;  5M4K A;  5M4P A;  1TIL A;  2YEC A;  4XTJ A;  3D2R A;  2CCT A;  5M4H A;  3Q5J A;  4YKY A;  3R91 A;  1Y8N A;  5CPH A;  3VAD A;  3R92 A;  2CCS A;  2YKI A;  2Q2E B;  1B63 A;  1U0Z A;  4HXW A;  1B3Q A;  4L93 A;  2BTZ A;  4KTN A;  3PEH A;  2YE6 A;  2XDL A;  4R3A A;  1KZN A;  1YT0 A;  5FNC A;  3JZ3 A;  3T0H A;  1AJ6 A;  2QG0 A;  4KFG A;  2GFD A;  5C93 A;  2WEQ A;  2XHR A;  4EEH A;  2QF6 A;  4URN A;  1S14 A;  4WUC A;  1YC3 A;  4O07 A;  1I5C A;  3BM9 A;  4ZVI A;  1ZXM A;  1US7 A;  1Z59 A;  2YI6 A;  2YKE A;  4GGL A;  3HZ5 A;  4EGH A;  3FT8 A;  5IDM A;  1NHJ A;  2XK2 A;  5CF0 A;  4W7T A;  1GJV A;  1OSF A;  3A0R A;  1BKN A;  2IWU A;  3CRL A;  4FCR A;  2YEG A;  2AKP A;  2YE8 A;  4ZKI A;  3NMQ A;  3OW6 A;  4EM7 A;  2YEA A;  4GT8 A;  2YKB A;  4U93 A;  4PRX A;  3C11 A;  2O1V A;  1UYM A;  3G75 A;  1MX0 A;  2GQP A;  2CGF A;  1UYI A;  4XCL A;  4DZY A;  4GEE A;  4KSH A;  2XCM A;  3LPS A;  1R62 A;  4ASA A;  3U2K A;  2FWY A;  2BU2 A;  3T1K A;  4P7A A;  1ZW9 A;  4GCZ A;  2XD6 A;  3TTZ A;  3WQ9 A;  3OMU A;  1B62 A;  1L0O A;  2XDK A;  3R4O A;  3T0Z A;  5M4E A;  2YEF A;  3EHJ A;  3OPD A;  4YKQ A;  1ZWH A;  4CWT A; 
#chains in the Genus database with same CATH topology
 4HZ5 A;  2BYH A;  4PL9 A;  3A0X A;  2IWS A;  4CE1 A;  1UYH A;  3EHF A;  4EFU A;  2YE3 A;  4XC0 A;  5D6Q A;  4ASB A;  3SL2 A;  1UYL A;  2BU8 A;  4LWF A;  4O05 A;  2Q8F A;  4MPC A;  5D7R A;  4XIQ A;  1TC0 A;  4URO A;  5J6A A;  4LWH A;  3RLR A;  1GKZ A;  4XKA A;  2O1U A;  5D7C A;  3KE6 A;  4AWP A;  4JAS A;  4L91 A;  1I59 A;  2XJG A;  3GIE A;  1YES A;  4XIT A;  2YE5 A;  2ZBK B;  2BU5 A;  3HZ1 A;  1YSR A;  2HG1 A;  3CGZ A;  3EKO A;  2YGF A;  4FPP A;  3G7E A;  4MP2 A;  3R4N A;  1MU5 A;  4MPE A;  3HEK A;  2JKI A;  4L8Z A;  1AM1 A;  4ASF A;  3RKZ A;  1PVG A;  4LP0 A;  2BT0 A;  2BRC A;  2HKJ A;  5CTY A;  5F5R A;  4L94 A;  2BYI A;  2YE4 A;  3FV5 A;  3K60 A;  2YK9 A;  2E0A A;  2YK2 A;  1Y4U A;  3INX A;  3T10 A;  3DGE A;  2QFO A;  4L90 A;  4HY6 A;  1NHH A;  4LWE A;  1Y8P A;  4XE2 A;  4CWR A;  2YEI A;  2XAB A;  1EA6 A;  4XKO A;  5CTU A;  4XDM A;  3B26 A;  3GIG A;  5M4N A;  4MB9 A;  4LWI A;  1GKX A;  4URM A;  3EHH A;  4B6C A;  4WUD A;  2YEJ A;  3A0W A;  4XIP A;  2BZ5 A;  4MOT A;  2VWC A;  4CWS A;  3CGY A;  4XIR A;  2FTK A;  2WI3 A;  4BQG A;  1UYE A;  1YER A;  4BIZ A;  1H7S A;  2ZDY A;  2IWX A;  2YKJ A;  4CWQ A;  3HYY A;  3RLP A;  3LNU A;  4HXZ A;  4MPN A;  1UY6 A;  3B27 A;  1AMW A;  2YE9 A;  2C2A A;  4BAE A;  3QTF A;  3O0I A;  5FWK A;  4BIU A;  1YC4 A;  1U2O A;  4H81 A;  2CCU A;  4I5S A;  2BSM A;  1Z5B A;  2Q8H A;  3RLQ A;  1S16 A;  2IOR A;  4U7N A;  2BU6 A;  4V26 A;  1YT1 A;  2YI5 A;  4CWF A;  5FNF A;  4BQJ A;  1UYF A;  1UYC A;  1BYQ A;  2WI7 A;  5IN9 A;  2WI6 A;  3LMM A;  3S5T A;  4WUB A;  4X9L A;  2YJX A;  2HHI A;  2IOQ A;  3INW A;  2YKC A;  3VHC A;  1UY8 A;  1H7U A;  4I3H A;  4HY1 A;  1QY8 A;  4H7Q A;  2YEH A;  4R3M A;  1TH8 A;  5IDJ A;  3GIF A;  2YI7 A;  2CH4 A;  4FMT A;  4O04 A;  4HYP A;  1ZXN A;  2ESA A;  1UYK A;  1Y8O A;  5M4M A;  4CWN A;  3FT5 A;  2BRE A;  4E01 A;  3EHG A;  1UYD A;  5FND A;  1KIJ A;  3CWV A;  3K98 A;  2WER A;  1Z5C A;  4KP4 A;  4QPK A;  4AWO A;  2XX4 A;  2YE2 A;  2WEP A;  3ZXQ A;  1YT2 A;  1UYG A;  3D36 A;  3OWD A;  4H85 A;  3U2D A;  1TC6 A;  3U67 A;  3T2S A;  2IOP A;  1BXD A;  4MP7 A;  3D0B A;  1I5B A;  2XHT A;  2XJX A;  1IXM A;  2FXS A;  1Z5A A;  2VCJ A;  2QG2 A;  2Q8G A;  1YET A;  4JAV A;  4P8O A;  2HCH A;  4QPJ A;  2XX2 A;  4R1F A;  4O0B A;  4YKZ A;  5CTX A;  2CG9 A;  3B25 A;  2YEE A;  3HYZ A;  4O09 A;  1EI1 A;  4E00 A;  2YED A;  2C1G A;  4NH9 A;  5BOC A;  4MBC A;  3ZKD A;  3K97 A;  4XKK A;  3TZ0 A;  4CE3 A;  2YI0 A;  5BOD A;  4DUH A;  2ZKJ A;  1F51 A;  5J71 A;  4JQL A;  4B7P A;  4XD8 A;  4EMV A;  4URL A;  4XCJ A;  2K5B A;  1A4H A;  2XX5 A;  3HHU A;  1UY7 A;  3B28 A;  5D7D A;  2FYP A;  3PEJ A;  4K4O A;  5GGZ A;  4YKX A;  1ID0 A;  4E72 A;  3R4P A;  4YKR A;  2WI2 A;  1I5A A;  3TZ2 A;  3Q5L A;  4U7O A;  2ZDX A;  1AH6 A;  4Q20 A;  3VHA A;  2FWZ A;  1JM6 A;  2EXL A;  2WI4 A;  3ZKB A;  3C0E A;  1I5D A;  4JAU A;  2O1W A;  3K99 A;  3WHA A;  4E02 A;  4GFN A;  3TZ4 A;  3EKR A;  5F3K A;  4LWG A;  3ZM7 A;  4YKU A;  4V25 A;  3H80 A;  4AS9 A;  2YGA A;  4NH7 A;  2VW5 A;  2H55 A;  2PNR A;  4LPB A;  4AWQ A;  1YSZ A;  3O2F A;  4PRV A;  4EGI A;  4KSG A;  3A0Z A;  2VCI A;  3H4L A;  4CWO A;  3A0T A;  1I58 A;  2UWD A;  1QYE A;  2YE7 A;  3G7B A;  4CE2 A;  2H8M A;  4FCQ A;  4ASG A;  4NH8 A;  4YKW A;  1UY9 A;  3ZXO A;  2XDU A;  1YC1 A;  1AH8 A;  3A0Y A;  1THN A;  3MNR P;  2XJJ A;  3TZ5 A;  4HZ0 A;  1QZR A;  2WI1 A;  3TUH A;  2YJW A;  5L3J A;  3GIG B;  3CYG A;  3BMY A;  2XDS A;  3O6O A;  4PU9 A;  1TBW A;  2BU7 A;  4EFT A;  1YS3 A;  4HYM A;  5CTW A;  4YKT A;  1NHI A;  2XHX A;  4KQV A;  3Q5K A;  1TID A;  3IED A;  4FCP A;  2JJC A;  2WI5 A;  4GQT A;  2YGE A;  3R4M A;  4EGK A;  2YEB A;  4BXI A;  1BGQ A;  5D6P A;  4CWP A;  3QDD A;  3CRK A;  1Y4S A;  3B24 A;  3OWB A;  2XDX A;  2Q8I A;  3VHD A;  5M4K A;  5M4P A;  1TIL A;  2YEC A;  5JEN A;  4XTJ A;  3D2R A;  2CCT A;  5M4H A;  3Q5J A;  4YKY A;  3R91 A;  1Y8N A;  5CPH A;  3VAD A;  3R92 A;  2C1I A;  2CCS A;  2YKI A;  2Q2E B;  1B63 A;  1U0Z A;  4HXW A;  1B3Q A;  4L93 A;  2BTZ A;  4KTN A;  3PEH A;  2YE6 A;  2XDL A;  4R3A A;  1KZN A;  1YT0 A;  5FNC A;  3JZ3 A;  3T0H A;  1AJ6 A;  2QG0 A;  4KFG A;  2GFD A;  5C93 A;  2WEQ A;  2XHR A;  4EEH A;  2QF6 A;  4URN A;  1S14 A;  4WUC A;  1YC3 A;  4O07 A;  1I5C A;  3BM9 A;  4ZVI A;  1ZXM A;  1US7 A;  1Z59 A;  2YI6 A;  2YKE A;  4GGL A;  3HZ5 A;  4EGH A;  3FT8 A;  5IDM A;  1NHJ A;  2XK2 A;  5CF0 A;  4W7T A;  1GJV A;  1OSF A;  3A0R A;  1BKN A;  2IWU A;  3CRL A;  4FCR A;  2YEG A;  2AKP A;  2YE8 A;  4ZKI A;  3NMQ A;  3OW6 A;  4EM7 A;  2YEA A;  4GT8 A;  2YKB A;  4U93 A;  4PRX A;  3C11 A;  2O1V A;  1UYM A;  3G75 A;  1MX0 A;  2GQP A;  2CGF A;  1UYI A;  4XCL A;  4DZY A;  4GEE A;  4KSH A;  2XCM A;  3LPS A;  1R62 A;  4ASA A;  3U2K A;  2FWY A;  2BU2 A;  3T1K A;  4P7A A;  1ZW9 A;  4GCZ A;  2XD6 A;  3TTZ A;  3WQ9 A;  3OMU A;  1B62 A;  1L0O A;  2XDK A;  3R4O A;  3T0Z A;  5M4E A;  2YEF A;  3EHJ A;  3OPD A;  4YKQ A;  1ZWH A;  4CWT A; 
#chains in the Genus database with same CATH homology
 4HZ5 A;  2BYH A;  4PL9 A;  3A0X A;  2IWS A;  4CE1 A;  1UYH A;  3EHF A;  4EFU A;  2YE3 A;  4XC0 A;  5D6Q A;  4ASB A;  3SL2 A;  1UYL A;  2BU8 A;  4LWF A;  4O05 A;  2Q8F A;  4MPC A;  5D7R A;  4XIQ A;  1TC0 A;  4URO A;  5J6A A;  4LWH A;  3RLR A;  1GKZ A;  4XKA A;  2O1U A;  5D7C A;  3KE6 A;  4AWP A;  4JAS A;  4L91 A;  1I59 A;  2XJG A;  3GIE A;  1YES A;  4XIT A;  2YE5 A;  2ZBK B;  2BU5 A;  3HZ1 A;  1YSR A;  2HG1 A;  3CGZ A;  3EKO A;  2YGF A;  4FPP A;  3G7E A;  4MP2 A;  3R4N A;  1MU5 A;  4MPE A;  3HEK A;  2JKI A;  4L8Z A;  1AM1 A;  4ASF A;  3RKZ A;  1PVG A;  4LP0 A;  2BT0 A;  2BRC A;  2HKJ A;  5CTY A;  5F5R A;  4L94 A;  2BYI A;  2YE4 A;  3FV5 A;  3K60 A;  2YK9 A;  2E0A A;  2YK2 A;  1Y4U A;  3INX A;  3T10 A;  3DGE A;  2QFO A;  4L90 A;  4HY6 A;  1NHH A;  4LWE A;  1Y8P A;  4XE2 A;  4CWR A;  2YEI A;  2XAB A;  1EA6 A;  4XKO A;  5CTU A;  4XDM A;  3B26 A;  3GIG A;  5M4N A;  4MB9 A;  4LWI A;  1GKX A;  4URM A;  3EHH A;  4B6C A;  4WUD A;  2YEJ A;  3A0W A;  4XIP A;  2BZ5 A;  4MOT A;  2VWC A;  4CWS A;  3CGY A;  4XIR A;  4BQG A;  2WI3 A;  1UYE A;  1YER A;  4BIZ A;  1H7S A;  2ZDY A;  2IWX A;  2YKJ A;  4CWQ A;  3HYY A;  3RLP A;  3LNU A;  4HXZ A;  4MPN A;  1UY6 A;  3B27 A;  1AMW A;  2YE9 A;  2C2A A;  4BAE A;  3QTF A;  3O0I A;  5FWK A;  4BIU A;  1YC4 A;  1U2O A;  4H81 A;  2CCU A;  4I5S A;  2BSM A;  1Z5B A;  2Q8H A;  3RLQ A;  1S16 A;  2IOR A;  4U7N A;  2BU6 A;  4V26 A;  1YT1 A;  2YI5 A;  4CWF A;  5FNF A;  4BQJ A;  1UYF A;  1UYC A;  1BYQ A;  2WI7 A;  5IN9 A;  2WI6 A;  4WUB A;  4X9L A;  2YJX A;  2IOQ A;  3INW A;  2YKC A;  3VHC A;  1UY8 A;  1H7U A;  4I3H A;  4HY1 A;  1QY8 A;  4H7Q A;  2YEH A;  4R3M A;  1TH8 A;  5IDJ A;  3GIF A;  2YI7 A;  2CH4 A;  4FMT A;  4O04 A;  4HYP A;  1ZXN A;  2ESA A;  1UYK A;  1Y8O A;  5M4M A;  4CWN A;  3FT5 A;  2BRE A;  4E01 A;  3EHG A;  1UYD A;  5FND A;  1KIJ A;  3CWV A;  3K98 A;  2WER A;  1Z5C A;  4KP4 A;  4QPK A;  4AWO A;  2XX4 A;  2YE2 A;  2WEP A;  3ZXQ A;  1YT2 A;  1UYG A;  3D36 A;  3OWD A;  4H85 A;  3U2D A;  1TC6 A;  3U67 A;  3T2S A;  2IOP A;  1BXD A;  4MP7 A;  3D0B A;  1I5B A;  2XHT A;  2XJX A;  2FXS A;  1Z5A A;  2VCJ A;  2QG2 A;  2Q8G A;  1YET A;  4JAV A;  4P8O A;  2HCH A;  4QPJ A;  2XX2 A;  4R1F A;  4O0B A;  4YKZ A;  5CTX A;  2CG9 A;  3B25 A;  2YEE A;  3HYZ A;  4O09 A;  1EI1 A;  4E00 A;  2YED A;  4NH9 A;  5BOC A;  4MBC A;  3ZKD A;  3K97 A;  4XKK A;  3TZ0 A;  4CE3 A;  2YI0 A;  5BOD A;  4DUH A;  2ZKJ A;  5J71 A;  4JQL A;  4B7P A;  4XD8 A;  4EMV A;  4URL A;  4XCJ A;  2K5B A;  1A4H A;  2XX5 A;  3HHU A;  1UY7 A;  3B28 A;  5D7D A;  2FYP A;  3PEJ A;  4K4O A;  5GGZ A;  4YKX A;  1ID0 A;  3R4P A;  4YKR A;  2WI2 A;  1I5A A;  3TZ2 A;  3Q5L A;  4U7O A;  2ZDX A;  1AH6 A;  4Q20 A;  3VHA A;  2FWZ A;  1JM6 A;  2EXL A;  2WI4 A;  3ZKB A;  3C0E A;  1I5D A;  4JAU A;  2O1W A;  3K99 A;  3WHA A;  4E02 A;  4GFN A;  3TZ4 A;  3EKR A;  5F3K A;  4LWG A;  3ZM7 A;  4YKU A;  4V25 A;  3H80 A;  4AS9 A;  2YGA A;  4NH7 A;  2VW5 A;  2H55 A;  2PNR A;  4LPB A;  4AWQ A;  1YSZ A;  3O2F A;  4PRV A;  4EGI A;  4KSG A;  3A0Z A;  2VCI A;  3H4L A;  4CWO A;  3A0T A;  1I58 A;  2UWD A;  1QYE A;  2YE7 A;  3G7B A;  4CE2 A;  2H8M A;  4FCQ A;  4ASG A;  4NH8 A;  4YKW A;  1UY9 A;  3ZXO A;  2XDU A;  1YC1 A;  1AH8 A;  3A0Y A;  1THN A;  3MNR P;  2XJJ A;  3TZ5 A;  4HZ0 A;  1QZR A;  2WI1 A;  3TUH A;  2YJW A;  5L3J A;  3GIG B;  3BMY A;  2XDS A;  3O6O A;  4PU9 A;  1TBW A;  2BU7 A;  4EFT A;  1YS3 A;  4HYM A;  5CTW A;  4YKT A;  1NHI A;  2XHX A;  4KQV A;  3Q5K A;  1TID A;  3IED A;  4FCP A;  2JJC A;  2WI5 A;  4GQT A;  2YGE A;  3R4M A;  4EGK A;  2YEB A;  4BXI A;  1BGQ A;  5D6P A;  4CWP A;  3QDD A;  3CRK A;  1Y4S A;  3B24 A;  3OWB A;  2XDX A;  2Q8I A;  3VHD A;  5M4K A;  5M4P A;  1TIL A;  2YEC A;  4XTJ A;  3D2R A;  2CCT A;  5M4H A;  3Q5J A;  4YKY A;  3R91 A;  1Y8N A;  5CPH A;  3VAD A;  3R92 A;  2CCS A;  2YKI A;  2Q2E B;  1B63 A;  1U0Z A;  4HXW A;  1B3Q A;  4L93 A;  2BTZ A;  4KTN A;  3PEH A;  2YE6 A;  2XDL A;  4R3A A;  1KZN A;  1YT0 A;  5FNC A;  3JZ3 A;  3T0H A;  1AJ6 A;  2QG0 A;  4KFG A;  2GFD A;  5C93 A;  2WEQ A;  2XHR A;  4EEH A;  2QF6 A;  4URN A;  1S14 A;  4WUC A;  1YC3 A;  4O07 A;  1I5C A;  3BM9 A;  4ZVI A;  1ZXM A;  1US7 A;  1Z59 A;  2YI6 A;  2YKE A;  4GGL A;  3HZ5 A;  4EGH A;  3FT8 A;  5IDM A;  1NHJ A;  2XK2 A;  5CF0 A;  4W7T A;  1GJV A;  1OSF A;  3A0R A;  1BKN A;  2IWU A;  3CRL A;  4FCR A;  2YEG A;  2AKP A;  2YE8 A;  4ZKI A;  3NMQ A;  3OW6 A;  4EM7 A;  2YEA A;  4GT8 A;  2YKB A;  4U93 A;  4PRX A;  3C11 A;  2O1V A;  1UYM A;  3G75 A;  1MX0 A;  2GQP A;  2CGF A;  1UYI A;  4XCL A;  4DZY A;  4GEE A;  4KSH A;  2XCM A;  3LPS A;  1R62 A;  4ASA A;  3U2K A;  2FWY A;  2BU2 A;  3T1K A;  4P7A A;  1ZW9 A;  4GCZ A;  2XD6 A;  3TTZ A;  3WQ9 A;  3OMU A;  1B62 A;  1L0O A;  2XDK A;  3R4O A;  3T0Z A;  5M4E A;  2YEF A;  3EHJ A;  3OPD A;  4YKQ A;  1ZWH A;  4CWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...