1QYEA

Crystal structure of the n-domain of the er hsp90 chaperone grp94 in complex with 2-chlorodideoxyadenosine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
266
structure length
225
Chain Sequence
KSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal Domain of GRP94. Basis for Ligand Specificity and Regulation
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 70
structure length 225
sequence length 266
ec nomenclature
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1qyeA00
4XE2A 3T0HA 3FV5A 2YJXA 3VADA 4AS9A 2XJJA 5D7DA 4XC0A 1AJ6A 4HZ0A 3TTZA 4LPBA 4CWOA 1I58A 4CWRA 3OPDA 1AH8A 4GT8A 4QPKA 3R4NA 1UYHA 2VCIA 3C11A 3O6OA 4L91A 3K60A 4HY1A 4XCLA 3CGZA 3T0ZA 4P7AA 5GGZA 2IORA 3OW6A 2UWDA 4FCRA 2YE6A 1NHIA 3G75A 2WEQA 1ZW9A 3CGYA 5D6QA 4O07A 4EGIA 1ZXMA 2Q8IA 3EHHA 1YT2A 3JZ3A 3T1KA 1UYMA 1BKNA 1JM6A 3INXA 2ZKJA 3A0RA 4O05A 4KSGA 1YS3A 3RLPA 2FYPA 4URNA 1S16A 1YSZA 3B28A 4L93A 1UYFA 3HEKA 4L90A 2YKBA 3MNRP 2YKEA 2GFDA 2XABA 4GFNA 4E02A 5CTYA 1QYEA 4CE2A 2O1WA 4W7TA 3FT5A 4XKKA 3RLRA 1TBWA 4MBCA 1MX0A 1KZNA 2YKJA 3HYYA 4BIZA 2YGEA 4R3AA 2BSMA 2BU7A 4V26A 5J71A 4BAEA 1Z5BA 4HZ5A 1TIDA 3EHJA 2Q8GA 2WEPA 5C93A 4GQTA 1YESA 3CWVA 4DZYA 2HKJA 5D7CA 4CWPA 2YK9A 3R4PA 2CG9A 2YKIA 4I5SA 1TC0A 4BIUA 3R92A 1UY7A 5M4PA 1GKXA 3OWDA 3IEDA 1I5BA 1UYEA 4L94A 4YKYA 4CWQA 2XHTA 1YSRA 4WUDA 2K5BA 2WI4A 5D6PA 1TH8A 2YI7A 4B7PA 2VWCA 4PU9A 4WUBA 3CRKA 1MU5A 3A0XA 1Z5AA 3DGEA 1OSFA 2FXSA 5FNDA 1BYQA 2WERA 4GCZA 1UY8A 5BOCA 4MP7A 2XX4A 2YEDA 1KIJA 2IOQA 3G7BA 2CCTA 4LWFA 1H7UA 4YKWA 4CWSA 4Q20A 3TZ5A 3BM9A 4X9LA 4U93A 2BRCA 5D7RA 3EKOA 1I5DA 4YKUA 2O1VA 4FCQA 1ID0A 3FT8A 4URMA 2JKIA 4FCPA 5F3KA 3H4LA 1AH6A 3T10A 2XJXA 2QG0A 2H55A 3G7EA 4H81A 5M4MA 1L0OA 1NHJA 4XIRA 3LNUA 4MB9A 1YT0A 2XX5A 2E0AA 2YI5A 3U2DA 1Z5CA 4XIPA 2CGFA 1Y8NA 5FNFA 3ZKDA 3RLQA 1ZWHA 1B63A 3EHGA 3EHFA 4ZKIA 3C0EA 3TZ4A 4HXZA 2BU6A 4XKAA 3A0ZA 4BQGA 4NH9A 3R4OA 2CH4A 2EXLA 3U67A 1YETA 2YI0A 4KFGA 3K98A 2VW5A 3RKZA 3OMUA 1YC3A 4UROA 2XDLA 4PRXA 1BGQA 3NMQA 3GIFA 4MPNA 2XD6A 2XCMA 2YE8A 3ZXQA 3B25A 4LP0A 4WUCA 1ZXNA 1GKZA 4YKZA 4XITA 5J6AA 4U7NA 1Z59A 2AKPA 2ZDXA 3PEHA 4JQLA 2XHRA 2YEIA 4P8OA 4EM7A 4URLA 1Y4SA 1UYKA 5CF0A 4NH7A 2YEAA 2WI1A 4EGKA 4CE1A 3KE6A 4O04A 5IDMA 2YE2A 4AWOA 2HG1A 3T2SA 2FWYA 2YEBA 1AM1A 2BYIA 1QZRA 2YGFA 1PVGA 3H80A 1I5CA 4HY6A 5M4NA 2WI2A 1UYDA 5IDJA 4CE3A 3OWBA 3ZM7A 3R91A 5FNCA 4H7QA 2IOPA 3VHCA 1YC1A 5L3JA 1R62A 4DUHA 3TUHA 4U7OA 2XJGA 4YKTA 2YEEA 4ASFA 4KSHA 3Q5LA 3HYZA 3GIGA 3R4MA 4BXIA 2XDUA 3INWA 3U2KA 3QTFA 2BU2A 4L8ZA 2BYHA 2YE3A 5M4EA 1TILA 3D0BA 2IWXA 2FWZA 2Q8HA 4PRVA 4E00A 4AWPA 4I3HA 4ASGA 2IWSA 4KTNA 4K4OA 4XDMA 3HZ1A 1A4HA 4O09A 1NHHA 4LWGA 3VHAA 4NH8A 3CRLA 2WI5A 4HYPA 4LWIA 1UYIA 5FWKA 2YEHA 1UYCA 2YJWA 2BU8A 3K99A 3A0TA 4MOTA 1S14A 3HHUA 5M4KA 3D36A 1EI1A 4CWTA 4B6CA 4GEEA 3QDDA 1UY6A 4FMTA 3SL2A 4EFUA 3D2RA 4JASA 2YI6A 2YEJA 4XKOA 1UYLA 2QF6A 2ZBKB 4JAUA 1YT1A 4HXWA 4YKRA 2IWUA 2YEGA 4MP2A 3ZKBA 4MPCA 3VHDA 2WI7A 1THNA 2BZ5A 1EA6A 3PEJA 4O0BA 3GIGB 2YGAA 1B62A 3B24A 2XDKA 2BT0A 2C2AA 3O0IA 4YKQA 2CCUA 2Q2EB 4YKXA 5CTXA 1US7A 2XDSA 2BTZA 4JAVA 3TZ0A 4GGLA 3GIEA 2Q8FA 4CWNA 1U0ZA 2YKCA 2ZDYA 1H7SA 4ASAA 3TZ2A 1QY8A 2ESAA 4XCJA 2PNRA 1U2OA 3Q5KA 2XHXA 2XK2A 4R3MA 4HYMA 4FPPA 1Y8PA 1Y4UA 3K97A 3EKRA 5CTWA 4EEHA 3Q5JA 5BODA 4LWHA 2YEFA 2QFOA 3HZ5A 4CWFA 2VCJA 3O2FA 2WI3A 1I5AA 1UY9A 2HCHA 2BU5A 3WHAA 3WQ9A 4ASBA 2YK2A 4AWQA 5F5RA 1B3QA 2JJCA 4BQJA 1I59A 2YE9A 3B26A 4EFTA 2CCSA 3B27A 4XTJA 4V25A 4LWEA 4XIQA 1TC6A 1AMWA 2YE7A 1YERA 4H85A 4R1FA 4QPJA 3A0WA 4EGHA 1GJVA 2YE5A 1UYGA 4XD8A 5M4HA 2GQPA 2BREA 2XX2A 2QG2A 4KP4A 3ZXOA 4E01A 5IN9A 2YE4A 4PL9A 1Y8OA 3A0YA 2H8MA 2YECA 4KQVA 4ZVIA 2XDXA 4EMVA 3BMYA 2O1UA 5CTUA 3LPSA 5CPHA 1YC4A 4MPEA 1BXDA 2WI6A
chains in the Genus database with same CATH superfamily
4XE2A 3T0HA 3FV5A 2YJXA 3VADA 4AS9A 2XJJA 3S5TA 5D7DA 4XC0A 1AJ6A 4HZ0A 3TTZA 4LPBA 4CWOA 1I58A 4CWRA 3OPDA 1AH8A 4GT8A 4QPKA 3R4NA 1UYHA 2VCIA 3C11A 3O6OA 4L91A 3K60A 4HY1A 4XCLA 3CGZA 3T0ZA 4P7AA 5GGZA 2IORA 3OW6A 2UWDA 4FCRA 2YE6A 1NHIA 3G75A 2WEQA 1ZW9A 3CGYA 5D6QA 4O07A 4EGIA 1ZXMA 2Q8IA 1IXMA 3EHHA 1YT2A 3JZ3A 3T1KA 2C1GA 1UYMA 1BKNA 1JM6A 3INXA 2ZKJA 3A0RA 4O05A 4KSGA 1YS3A 1F51A 3RLPA 2FYPA 4URNA 1S16A 1YSZA 3B28A 4L93A 1UYFA 3HEKA 4L90A 2YKBA 3MNRP 2YKEA 2GFDA 2XABA 4GFNA 4E02A 5CTYA 1QYEA 4CE2A 2O1WA 4W7TA 3FT5A 4XKKA 3RLRA 1TBWA 4MBCA 1MX0A 1KZNA 2YKJA 3HYYA 4BIZA 2YGEA 4R3AA 2BSMA 2BU7A 4V26A 5J71A 4BAEA 1Z5BA 4HZ5A 1TIDA 3EHJA 2Q8GA 2WEPA 5C93A 4GQTA 1YESA 3CWVA 4DZYA 2HKJA 5D7CA 4CWPA 2YK9A 3R4PA 2CG9A 2YKIA 4I5SA 1TC0A 4BIUA 3R92A 1UY7A 5M4PA 1GKXA 3OWDA 3IEDA 1I5BA 1UYEA 4L94A 4YKYA 4CWQA 2XHTA 1YSRA 4WUDA 2K5BA 2WI4A 5D6PA 1TH8A 2YI7A 4B7PA 2VWCA 4PU9A 4WUBA 3CRKA 1MU5A 3A0XA 1Z5AA 3DGEA 1OSFA 2FXSA 5FNDA 1BYQA 2WERA 4GCZA 1UY8A 5BOCA 4MP7A 2XX4A 2YEDA 1KIJA 2IOQA 3G7BA 2CCTA 4LWFA 1H7UA 4YKWA 4CWSA 4Q20A 2FTKA 3TZ5A 3BM9A 4X9LA 4U93A 2BRCA 5D7RA 3EKOA 2HHIA 1I5DA 4YKUA 2O1VA 4FCQA 1ID0A 3FT8A 4URMA 2JKIA 4FCPA 5F3KA 3H4LA 1AH6A 3T10A 2XJXA 2QG0A 2H55A 3G7EA 4H81A 5M4MA 1L0OA 1NHJA 4XIRA 3LNUA 4MB9A 1YT0A 2XX5A 2E0AA 2YI5A 3U2DA 1Z5CA 4XIPA 2CGFA 1Y8NA 5FNFA 3ZKDA 3RLQA 1ZWHA 3LMMA 1B63A 3EHGA 3EHFA 4ZKIA 3C0EA 3TZ4A 4HXZA 2BU6A 4XKAA 3A0ZA 4BQGA 4NH9A 3R4OA 2CH4A 2EXLA 2C1IA 3U67A 1YETA 2YI0A 4KFGA 3K98A 2VW5A 3RKZA 3OMUA 1YC3A 4UROA 2XDLA 4PRXA 1BGQA 3NMQA 3GIFA 4MPNA 2XD6A 2XCMA 2YE8A 3CYGA 3B25A 3ZXQA 4LP0A 4WUCA 1ZXNA 1GKZA 4YKZA 4XITA 5J6AA 4U7NA 1Z59A 2AKPA 2ZDXA 3PEHA 4JQLA 2XHRA 2YEIA 4P8OA 4EM7A 4URLA 1Y4SA 1UYKA 5CF0A 4NH7A 2YEAA 2WI1A 4EGKA 4CE1A 3KE6A 4O04A 5IDMA 2YE2A 4AWOA 2HG1A 3T2SA 2FWYA 2YEBA 1AM1A 2BYIA 1QZRA 2YGFA 1PVGA 3H80A 1I5CA 4HY6A 5M4NA 2WI2A 1UYDA 5IDJA 4CE3A 3OWBA 4E72A 3ZM7A 3R91A 5FNCA 4H7QA 2IOPA 3VHCA 1YC1A 5L3JA 1R62A 4DUHA 3TUHA 4U7OA 2XJGA 4YKTA 2YEEA 4ASFA 4KSHA 3Q5LA 3HYZA 3GIGA 3R4MA 4BXIA 2XDUA 3INWA 3U2KA 3QTFA 2BU2A 2BYHA 2YE3A 4L8ZA 5M4EA 1TILA 3D0BA 2IWXA 2FWZA 2Q8HA 4PRVA 4E00A 4AWPA 4I3HA 4ASGA 2IWSA 4KTNA 4K4OA 4XDMA 3HZ1A 1A4HA 4O09A 1NHHA 4LWGA 3VHAA 4NH8A 3CRLA 2WI5A 4HYPA 4LWIA 1UYIA 5FWKA 2YEHA 1UYCA 2YJWA 2BU8A 3K99A 3A0TA 4MOTA 1S14A 3HHUA 5M4KA 3D36A 1EI1A 4CWTA 4B6CA 4GEEA 3QDDA 1UY6A 4FMTA 3SL2A 4EFUA 3D2RA 4JASA 2YI6A 2YEJA 4XKOA 1UYLA 2QF6A 2ZBKB 4JAUA 1YT1A 4HXWA 4YKRA 2IWUA 2YEGA 4MP2A 3ZKBA 4MPCA 3VHDA 2WI7A 1THNA 2BZ5A 1EA6A 3PEJA 4O0BA 3GIGB 2YGAA 1B62A 3B24A 2XDKA 2BT0A 2C2AA 3O0IA 4YKQA 2CCUA 2Q2EB 4YKXA 5CTXA 1US7A 2XDSA 2BTZA 5JENA 4JAVA 3TZ0A 4GGLA 3GIEA 2Q8FA 4CWNA 1U0ZA 2YKCA 2ZDYA 1H7SA 4ASAA 3TZ2A 1QY8A 2ESAA 4XCJA 2PNRA 1U2OA 3Q5KA 2XHXA 2XK2A 4R3MA 4HYMA 4FPPA 1Y8PA 1Y4UA 3K97A 3EKRA 5CTWA 4EEHA 3Q5JA 5BODA 4LWHA 2YEFA 2QFOA 3HZ5A 4CWFA 2VCJA 3O2FA 2WI3A 1I5AA 1UY9A 2HCHA 2BU5A 3WHAA 3WQ9A 4ASBA 2YK2A 4AWQA 5F5RA 1B3QA 2JJCA 4BQJA 1I59A 2YE9A 3B26A 4EFTA 2CCSA 3B27A 4XTJA 4V25A 4LWEA 4XIQA 1TC6A 1AMWA 2YE7A 1YERA 4H85A 4R1FA 4QPJA 3A0WA 4EGHA 1GJVA 2YE5A 1UYGA 4XD8A 5M4HA 2GQPA 2BREA 2XX2A 2QG2A 4KP4A 3ZXOA 4E01A 5IN9A 2YE4A 4PL9A 1Y8OA 3A0YA 2H8MA 2YECA 4KQVA 4ZVIA 2XDXA 4EMVA 3BMYA 2O1UA 5CTUA 3LPSA 5CPHA 1YC4A 4MPEA 1BXDA 2WI6A
chains in the Genus database with same CATH topology
4XE2A 3T0HA 3FV5A 2YJXA 3VADA 4AS9A 2XJJA 5D7DA 4XC0A 1AJ6A 4HZ0A 3TTZA 4LPBA 4CWOA 1I58A 4CWRA 3OPDA 1AH8A 4GT8A 4QPKA 3R4NA 1UYHA 2VCIA 3C11A 3O6OA 4L91A 3K60A 4HY1A 4XCLA 3CGZA 3T0ZA 4P7AA 5GGZA 2IORA 3OW6A 2UWDA 4FCRA 2YE6A 1NHIA 3G75A 2WEQA 1ZW9A 3CGYA 5D6QA 4O07A 4EGIA 1ZXMA 2Q8IA 3EHHA 1YT2A 3JZ3A 3T1KA 1UYMA 1BKNA 1JM6A 3INXA 2ZKJA 3A0RA 4O05A 4KSGA 1YS3A 3RLPA 2FYPA 4URNA 1S16A 1YSZA 3B28A 4L93A 1UYFA 3HEKA 4L90A 2YKBA 3MNRP 2YKEA 2GFDA 2XABA 4GFNA 4E02A 5CTYA 1QYEA 4CE2A 2O1WA 4W7TA 3FT5A 4XKKA 3RLRA 1TBWA 4MBCA 1MX0A 1KZNA 2YKJA 3HYYA 4BIZA 2YGEA 4R3AA 2BSMA 2BU7A 4V26A 5J71A 4BAEA 1Z5BA 4HZ5A 1TIDA 3EHJA 2Q8GA 2WEPA 5C93A 4GQTA 1YESA 3CWVA 4DZYA 2HKJA 5D7CA 4CWPA 2YK9A 3R4PA 2CG9A 2YKIA 4I5SA 1TC0A 4BIUA 3R92A 1UY7A 5M4PA 1GKXA 3OWDA 3IEDA 1I5BA 1UYEA 4L94A 4YKYA 4CWQA 2XHTA 1YSRA 4WUDA 2K5BA 2WI4A 5D6PA 1TH8A 2YI7A 4B7PA 2VWCA 4PU9A 4WUBA 3CRKA 1MU5A 3A0XA 1Z5AA 3DGEA 1OSFA 2FXSA 5FNDA 1BYQA 2WERA 4GCZA 1UY8A 5BOCA 4MP7A 2XX4A 2YEDA 1KIJA 2IOQA 3G7BA 2CCTA 4LWFA 1H7UA 4YKWA 4CWSA 4Q20A 3TZ5A 3BM9A 4X9LA 4U93A 2BRCA 5D7RA 3EKOA 1I5DA 4YKUA 2O1VA 4FCQA 1ID0A 3FT8A 4URMA 2JKIA 4FCPA 5F3KA 3H4LA 1AH6A 3T10A 2XJXA 2QG0A 2H55A 3G7EA 4H81A 5M4MA 1L0OA 1NHJA 4XIRA 3LNUA 4MB9A 1YT0A 2XX5A 2E0AA 2YI5A 3U2DA 1Z5CA 4XIPA 2CGFA 1Y8NA 5FNFA 3ZKDA 3RLQA 1ZWHA 1B63A 3EHGA 3EHFA 4ZKIA 3C0EA 3TZ4A 4HXZA 2BU6A 4XKAA 3A0ZA 4BQGA 4NH9A 3R4OA 2CH4A 2EXLA 3U67A 1YETA 2YI0A 4KFGA 3K98A 2VW5A 3RKZA 3OMUA 1YC3A 4UROA 2XDLA 4PRXA 1BGQA 3NMQA 3GIFA 4MPNA 2XD6A 2XCMA 2YE8A 3ZXQA 3B25A 4LP0A 4WUCA 1ZXNA 1GKZA 4YKZA 4XITA 5J6AA 4U7NA 1Z59A 2AKPA 2ZDXA 3PEHA 4JQLA 2XHRA 2YEIA 4P8OA 4EM7A 4URLA 1Y4SA 1UYKA 5CF0A 4NH7A 2YEAA 2WI1A 4EGKA 4CE1A 3KE6A 4O04A 5IDMA 2YE2A 4AWOA 2HG1A 3T2SA 2FWYA 2YEBA 1AM1A 2BYIA 1QZRA 2YGFA 1PVGA 3H80A 1I5CA 4HY6A 5M4NA 2WI2A 1UYDA 5IDJA 4CE3A 3OWBA 3ZM7A 3R91A 5FNCA 4H7QA 2IOPA 3VHCA 1YC1A 5L3JA 1R62A 4DUHA 3TUHA 4U7OA 2XJGA 4YKTA 2YEEA 4ASFA 4KSHA 3Q5LA 3HYZA 3GIGA 3R4MA 4BXIA 2XDUA 3INWA 3U2KA 3QTFA 2BU2A 4L8ZA 2BYHA 2YE3A 5M4EA 1TILA 3D0BA 2IWXA 2FWZA 2Q8HA 4PRVA 4E00A 4AWPA 4I3HA 4ASGA 2IWSA 4KTNA 4K4OA 4XDMA 3HZ1A 1A4HA 4O09A 1NHHA 4LWGA 3VHAA 4NH8A 3CRLA 2WI5A 4HYPA 4LWIA 1UYIA 5FWKA 2YEHA 1UYCA 2YJWA 2BU8A 3K99A 3A0TA 4MOTA 1S14A 3HHUA 5M4KA 3D36A 1EI1A 4CWTA 4B6CA 4GEEA 3QDDA 1UY6A 4FMTA 3SL2A 4EFUA 3D2RA 4JASA 2YI6A 2YEJA 4XKOA 1UYLA 2QF6A 2ZBKB 4JAUA 1YT1A 4HXWA 4YKRA 2IWUA 2YEGA 4MP2A 3ZKBA 4MPCA 3VHDA 2WI7A 1THNA 2BZ5A 1EA6A 3PEJA 4O0BA 3GIGB 2YGAA 1B62A 3B24A 2XDKA 2BT0A 2C2AA 3O0IA 4YKQA 2CCUA 2Q2EB 4YKXA 5CTXA 1US7A 2XDSA 2BTZA 4JAVA 3TZ0A 4GGLA 3GIEA 2Q8FA 4CWNA 1U0ZA 2YKCA 2ZDYA 1H7SA 4ASAA 3TZ2A 1QY8A 2ESAA 4XCJA 2PNRA 1U2OA 3Q5KA 2XHXA 2XK2A 4R3MA 4HYMA 4FPPA 1Y8PA 1Y4UA 3K97A 3EKRA 5CTWA 4EEHA 3Q5JA 5BODA 4LWHA 2YEFA 2QFOA 3HZ5A 4CWFA 2VCJA 3O2FA 2WI3A 1I5AA 1UY9A 2HCHA 2BU5A 3WHAA 3WQ9A 4ASBA 2YK2A 4AWQA 5F5RA 1B3QA 2JJCA 4BQJA 1I59A 2YE9A 3B26A 4EFTA 2CCSA 3B27A 4XTJA 4V25A 4LWEA 4XIQA 1TC6A 1AMWA 2YE7A 1YERA 4H85A 4R1FA 4QPJA 3A0WA 4EGHA 1GJVA 2YE5A 1UYGA 4XD8A 5M4HA 2GQPA 2BREA 2XX2A 2QG2A 4KP4A 3ZXOA 4E01A 5IN9A 2YE4A 4PL9A 1Y8OA 3A0YA 2H8MA 2YECA 4KQVA 4ZVIA 2XDXA 4EMVA 3BMYA 2O1UA 5CTUA 3LPSA 5CPHA 1YC4A 4MPEA 1BXDA 2WI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XE2 A;  3T0H A;  3FV5 A;  2YJX A;  3VAD A;  4AS9 A;  2XJJ A;  5D7D A;  4XC0 A;  1AJ6 A;  4HZ0 A;  3TTZ A;  4LPB A;  4CWO A;  1I58 A;  4CWR A;  3OPD A;  1AH8 A;  4GT8 A;  4QPK A;  3R4N A;  1UYH A;  2VCI A;  3C11 A;  3O6O A;  4L91 A;  3K60 A;  4HY1 A;  4XCL A;  3CGZ A;  3T0Z A;  4P7A A;  5GGZ A;  2IOR A;  3OW6 A;  2UWD A;  4FCR A;  2YE6 A;  1NHI A;  3G75 A;  2WEQ A;  1ZW9 A;  3CGY A;  5D6Q A;  4O07 A;  4EGI A;  1ZXM A;  2Q8I A;  3EHH A;  1YT2 A;  3JZ3 A;  3T1K A;  1UYM A;  1BKN A;  1JM6 A;  3INX A;  2ZKJ A;  3A0R A;  4O05 A;  4KSG A;  1YS3 A;  3RLP A;  2FYP A;  4URN A;  1S16 A;  1YSZ A;  3B28 A;  4L93 A;  1UYF A;  3HEK A;  4L90 A;  2YKB A;  3MNR P;  2YKE A;  2GFD A;  2XAB A;  4GFN A;  4E02 A;  5CTY A;  1QYE A;  4CE2 A;  2O1W A;  4W7T A;  3FT5 A;  4XKK A;  3RLR A;  1TBW A;  4MBC A;  1MX0 A;  1KZN A;  2YKJ A;  3HYY A;  4BIZ A;  2YGE A;  4R3A A;  2BSM A;  2BU7 A;  4V26 A;  5J71 A;  4BAE A;  1Z5B A;  4HZ5 A;  1TID A;  3EHJ A;  2Q8G A;  2WEP A;  5C93 A;  4GQT A;  1YES A;  3CWV A;  4DZY A;  2HKJ A;  5D7C A;  4CWP A;  2YK9 A;  3R4P A;  2CG9 A;  2YKI A;  4I5S A;  1TC0 A;  4BIU A;  3R92 A;  1UY7 A;  5M4P A;  1GKX A;  3OWD A;  3IED A;  1I5B A;  1UYE A;  4L94 A;  4YKY A;  4CWQ A;  2XHT A;  1YSR A;  4WUD A;  2K5B A;  2WI4 A;  5D6P A;  1TH8 A;  2YI7 A;  4B7P A;  2VWC A;  4PU9 A;  4WUB A;  3CRK A;  1MU5 A;  3A0X A;  1Z5A A;  3DGE A;  1OSF A;  2FXS A;  5FND A;  1BYQ A;  2WER A;  4GCZ A;  1UY8 A;  5BOC A;  4MP7 A;  2XX4 A;  2YED A;  1KIJ A;  2IOQ A;  3G7B A;  2CCT A;  4LWF A;  1H7U A;  4YKW A;  4CWS A;  4Q20 A;  3TZ5 A;  3BM9 A;  4X9L A;  4U93 A;  2BRC A;  5D7R A;  3EKO A;  1I5D A;  4YKU A;  2O1V A;  4FCQ A;  1ID0 A;  3FT8 A;  4URM A;  2JKI A;  4FCP A;  5F3K A;  3H4L A;  1AH6 A;  3T10 A;  2XJX A;  2QG0 A;  2H55 A;  3G7E A;  4H81 A;  5M4M A;  1L0O A;  1NHJ A;  4XIR A;  3LNU A;  4MB9 A;  1YT0 A;  2XX5 A;  2E0A A;  2YI5 A;  3U2D A;  1Z5C A;  4XIP A;  2CGF A;  1Y8N A;  5FNF A;  3ZKD A;  3RLQ A;  1ZWH A;  1B63 A;  3EHG A;  3EHF A;  4ZKI A;  3C0E A;  3TZ4 A;  4HXZ A;  2BU6 A;  4XKA A;  3A0Z A;  4BQG A;  4NH9 A;  3R4O A;  2CH4 A;  2EXL A;  3U67 A;  1YET A;  2YI0 A;  4KFG A;  3K98 A;  2VW5 A;  3RKZ A;  3OMU A;  1YC3 A;  4URO A;  2XDL A;  4PRX A;  1BGQ A;  3NMQ A;  3GIF A;  4MPN A;  2XD6 A;  2XCM A;  2YE8 A;  3ZXQ A;  3B25 A;  4LP0 A;  4WUC A;  1ZXN A;  1GKZ A;  4YKZ A;  4XIT A;  5J6A A;  4U7N A;  1Z59 A;  2AKP A;  2ZDX A;  3PEH A;  4JQL A;  2XHR A;  2YEI A;  4P8O A;  4EM7 A;  4URL A;  1Y4S A;  1UYK A;  5CF0 A;  4NH7 A;  2YEA A;  2WI1 A;  4EGK A;  4CE1 A;  3KE6 A;  4O04 A;  5IDM A;  2YE2 A;  4AWO A;  2HG1 A;  3T2S A;  2FWY A;  2YEB A;  1AM1 A;  2BYI A;  1QZR A;  2YGF A;  1PVG A;  3H80 A;  1I5C A;  4HY6 A;  5M4N A;  2WI2 A;  1UYD A;  5IDJ A;  4CE3 A;  3OWB A;  3ZM7 A;  3R91 A;  5FNC A;  4H7Q A;  2IOP A;  3VHC A;  1YC1 A;  5L3J A;  1R62 A;  4DUH A;  3TUH A;  4U7O A;  2XJG A;  4YKT A;  2YEE A;  4ASF A;  4KSH A;  3Q5L A;  3HYZ A;  3GIG A;  3R4M A;  4BXI A;  2XDU A;  3INW A;  3U2K A;  3QTF A;  2BU2 A;  4L8Z A;  2BYH A;  2YE3 A;  5M4E A;  1TIL A;  3D0B A;  2IWX A;  2FWZ A;  2Q8H A;  4PRV A;  4E00 A;  4AWP A;  4I3H A;  4ASG A;  2IWS A;  4KTN A;  4K4O A;  4XDM A;  3HZ1 A;  1A4H A;  4O09 A;  1NHH A;  4LWG A;  3VHA A;  4NH8 A;  3CRL A;  2WI5 A;  4HYP A;  4LWI A;  1UYI A;  5FWK A;  2YEH A;  1UYC A;  2YJW A;  2BU8 A;  3K99 A;  3A0T A;  4MOT A;  1S14 A;  3HHU A;  5M4K A;  3D36 A;  1EI1 A;  4CWT A;  4B6C A;  4GEE A;  3QDD A;  1UY6 A;  4FMT A;  3SL2 A;  4EFU A;  3D2R A;  4JAS A;  2YI6 A;  2YEJ A;  4XKO A;  1UYL A;  2QF6 A;  2ZBK B;  4JAU A;  1YT1 A;  4HXW A;  4YKR A;  2IWU A;  2YEG A;  4MP2 A;  3ZKB A;  4MPC A;  3VHD A;  2WI7 A;  1THN A;  2BZ5 A;  1EA6 A;  3PEJ A;  4O0B A;  3GIG B;  2YGA A;  1B62 A;  3B24 A;  2XDK A;  2BT0 A;  2C2A A;  3O0I A;  4YKQ A;  2CCU A;  2Q2E B;  4YKX A;  5CTX A;  1US7 A;  2XDS A;  2BTZ A;  4JAV A;  3TZ0 A;  4GGL A;  3GIE A;  2Q8F A;  4CWN A;  1U0Z A;  2YKC A;  2ZDY A;  1H7S A;  4ASA A;  3TZ2 A;  1QY8 A;  2ESA A;  4XCJ A;  2PNR A;  1U2O A;  3Q5K A;  2XHX A;  2XK2 A;  4R3M A;  4HYM A;  4FPP A;  1Y8P A;  1Y4U A;  3K97 A;  3EKR A;  5CTW A;  4EEH A;  3Q5J A;  5BOD A;  4LWH A;  2YEF A;  2QFO A;  3HZ5 A;  4CWF A;  2VCJ A;  3O2F A;  2WI3 A;  1I5A A;  1UY9 A;  2HCH A;  2BU5 A;  3WHA A;  3WQ9 A;  4ASB A;  2YK2 A;  4AWQ A;  5F5R A;  1B3Q A;  2JJC A;  4BQJ A;  1I59 A;  2YE9 A;  3B26 A;  4EFT A;  2CCS A;  3B27 A;  4XTJ A;  4V25 A;  4LWE A;  4XIQ A;  1TC6 A;  1AMW A;  2YE7 A;  1YER A;  4H85 A;  4R1F A;  4QPJ A;  3A0W A;  4EGH A;  1GJV A;  2YE5 A;  1UYG A;  4XD8 A;  5M4H A;  2GQP A;  2BRE A;  2XX2 A;  2QG2 A;  4KP4 A;  3ZXO A;  4E01 A;  5IN9 A;  2YE4 A;  4PL9 A;  1Y8O A;  3A0Y A;  2H8M A;  2YEC A;  4KQV A;  4ZVI A;  2XDX A;  4EMV A;  3BMY A;  2O1U A;  5CTU A;  3LPS A;  5CPH A;  1YC4 A;  4MPE A;  1BXD A;  2WI6 A; 
#chains in the Genus database with same CATH topology
 4XE2 A;  3T0H A;  3FV5 A;  2YJX A;  3VAD A;  4AS9 A;  2XJJ A;  3S5T A;  5D7D A;  4XC0 A;  1AJ6 A;  4HZ0 A;  3TTZ A;  4LPB A;  4CWO A;  1I58 A;  4CWR A;  3OPD A;  1AH8 A;  4GT8 A;  4QPK A;  3R4N A;  1UYH A;  2VCI A;  3C11 A;  3O6O A;  4L91 A;  3K60 A;  4HY1 A;  4XCL A;  3CGZ A;  3T0Z A;  4P7A A;  5GGZ A;  2IOR A;  3OW6 A;  2UWD A;  4FCR A;  2YE6 A;  1NHI A;  3G75 A;  2WEQ A;  1ZW9 A;  3CGY A;  5D6Q A;  4O07 A;  4EGI A;  1ZXM A;  2Q8I A;  1IXM A;  3EHH A;  1YT2 A;  3JZ3 A;  3T1K A;  2C1G A;  1UYM A;  1BKN A;  1JM6 A;  3INX A;  2ZKJ A;  3A0R A;  4O05 A;  4KSG A;  1YS3 A;  1F51 A;  3RLP A;  2FYP A;  4URN A;  1S16 A;  1YSZ A;  3B28 A;  4L93 A;  1UYF A;  3HEK A;  4L90 A;  2YKB A;  3MNR P;  2YKE A;  2GFD A;  2XAB A;  4GFN A;  4E02 A;  5CTY A;  1QYE A;  4CE2 A;  2O1W A;  4W7T A;  3FT5 A;  4XKK A;  3RLR A;  1TBW A;  4MBC A;  1MX0 A;  1KZN A;  2YKJ A;  3HYY A;  4BIZ A;  2YGE A;  4R3A A;  2BSM A;  2BU7 A;  4V26 A;  5J71 A;  4BAE A;  1Z5B A;  4HZ5 A;  1TID A;  3EHJ A;  2Q8G A;  2WEP A;  5C93 A;  4GQT A;  1YES A;  3CWV A;  4DZY A;  2HKJ A;  5D7C A;  4CWP A;  2YK9 A;  3R4P A;  2CG9 A;  2YKI A;  4I5S A;  1TC0 A;  4BIU A;  3R92 A;  1UY7 A;  5M4P A;  1GKX A;  3OWD A;  3IED A;  1I5B A;  1UYE A;  4L94 A;  4YKY A;  4CWQ A;  2XHT A;  1YSR A;  4WUD A;  2K5B A;  2WI4 A;  5D6P A;  1TH8 A;  2YI7 A;  4B7P A;  2VWC A;  4PU9 A;  4WUB A;  3CRK A;  1MU5 A;  3A0X A;  1Z5A A;  3DGE A;  1OSF A;  2FXS A;  5FND A;  1BYQ A;  2WER A;  4GCZ A;  1UY8 A;  5BOC A;  4MP7 A;  2XX4 A;  2YED A;  1KIJ A;  2IOQ A;  3G7B A;  2CCT A;  4LWF A;  1H7U A;  4YKW A;  4CWS A;  4Q20 A;  2FTK A;  3TZ5 A;  3BM9 A;  4X9L A;  4U93 A;  2BRC A;  5D7R A;  3EKO A;  2HHI A;  1I5D A;  4YKU A;  2O1V A;  4FCQ A;  1ID0 A;  3FT8 A;  4URM A;  2JKI A;  4FCP A;  5F3K A;  3H4L A;  1AH6 A;  3T10 A;  2XJX A;  2QG0 A;  2H55 A;  3G7E A;  4H81 A;  5M4M A;  1L0O A;  1NHJ A;  4XIR A;  3LNU A;  4MB9 A;  1YT0 A;  2XX5 A;  2E0A A;  2YI5 A;  3U2D A;  1Z5C A;  4XIP A;  2CGF A;  1Y8N A;  5FNF A;  3ZKD A;  3RLQ A;  1ZWH A;  3LMM A;  1B63 A;  3EHG A;  3EHF A;  4ZKI A;  3C0E A;  3TZ4 A;  4HXZ A;  2BU6 A;  4XKA A;  3A0Z A;  4BQG A;  4NH9 A;  3R4O A;  2CH4 A;  2EXL A;  2C1I A;  3U67 A;  1YET A;  2YI0 A;  4KFG A;  3K98 A;  2VW5 A;  3RKZ A;  3OMU A;  1YC3 A;  4URO A;  2XDL A;  4PRX A;  1BGQ A;  3NMQ A;  3GIF A;  4MPN A;  2XD6 A;  2XCM A;  2YE8 A;  3CYG A;  3B25 A;  3ZXQ A;  4LP0 A;  4WUC A;  1ZXN A;  1GKZ A;  4YKZ A;  4XIT A;  5J6A A;  4U7N A;  1Z59 A;  2AKP A;  2ZDX A;  3PEH A;  4JQL A;  2XHR A;  2YEI A;  4P8O A;  4EM7 A;  4URL A;  1Y4S A;  1UYK A;  5CF0 A;  4NH7 A;  2YEA A;  2WI1 A;  4EGK A;  4CE1 A;  3KE6 A;  4O04 A;  5IDM A;  2YE2 A;  4AWO A;  2HG1 A;  3T2S A;  2FWY A;  2YEB A;  1AM1 A;  2BYI A;  1QZR A;  2YGF A;  1PVG A;  3H80 A;  1I5C A;  4HY6 A;  5M4N A;  2WI2 A;  1UYD A;  5IDJ A;  4CE3 A;  3OWB A;  4E72 A;  3ZM7 A;  3R91 A;  5FNC A;  4H7Q A;  2IOP A;  3VHC A;  1YC1 A;  5L3J A;  1R62 A;  4DUH A;  3TUH A;  4U7O A;  2XJG A;  4YKT A;  2YEE A;  4ASF A;  4KSH A;  3Q5L A;  3HYZ A;  3GIG A;  3R4M A;  4BXI A;  2XDU A;  3INW A;  3U2K A;  3QTF A;  2BU2 A;  2BYH A;  2YE3 A;  4L8Z A;  5M4E A;  1TIL A;  3D0B A;  2IWX A;  2FWZ A;  2Q8H A;  4PRV A;  4E00 A;  4AWP A;  4I3H A;  4ASG A;  2IWS A;  4KTN A;  4K4O A;  4XDM A;  3HZ1 A;  1A4H A;  4O09 A;  1NHH A;  4LWG A;  3VHA A;  4NH8 A;  3CRL A;  2WI5 A;  4HYP A;  4LWI A;  1UYI A;  5FWK A;  2YEH A;  1UYC A;  2YJW A;  2BU8 A;  3K99 A;  3A0T A;  4MOT A;  1S14 A;  3HHU A;  5M4K A;  3D36 A;  1EI1 A;  4CWT A;  4B6C A;  4GEE A;  3QDD A;  1UY6 A;  4FMT A;  3SL2 A;  4EFU A;  3D2R A;  4JAS A;  2YI6 A;  2YEJ A;  4XKO A;  1UYL A;  2QF6 A;  2ZBK B;  4JAU A;  1YT1 A;  4HXW A;  4YKR A;  2IWU A;  2YEG A;  4MP2 A;  3ZKB A;  4MPC A;  3VHD A;  2WI7 A;  1THN A;  2BZ5 A;  1EA6 A;  3PEJ A;  4O0B A;  3GIG B;  2YGA A;  1B62 A;  3B24 A;  2XDK A;  2BT0 A;  2C2A A;  3O0I A;  4YKQ A;  2CCU A;  2Q2E B;  4YKX A;  5CTX A;  1US7 A;  2XDS A;  2BTZ A;  5JEN A;  4JAV A;  3TZ0 A;  4GGL A;  3GIE A;  2Q8F A;  4CWN A;  1U0Z A;  2YKC A;  2ZDY A;  1H7S A;  4ASA A;  3TZ2 A;  1QY8 A;  2ESA A;  4XCJ A;  2PNR A;  1U2O A;  3Q5K A;  2XHX A;  2XK2 A;  4R3M A;  4HYM A;  4FPP A;  1Y8P A;  1Y4U A;  3K97 A;  3EKR A;  5CTW A;  4EEH A;  3Q5J A;  5BOD A;  4LWH A;  2YEF A;  2QFO A;  3HZ5 A;  4CWF A;  2VCJ A;  3O2F A;  2WI3 A;  1I5A A;  1UY9 A;  2HCH A;  2BU5 A;  3WHA A;  3WQ9 A;  4ASB A;  2YK2 A;  4AWQ A;  5F5R A;  1B3Q A;  2JJC A;  4BQJ A;  1I59 A;  2YE9 A;  3B26 A;  4EFT A;  2CCS A;  3B27 A;  4XTJ A;  4V25 A;  4LWE A;  4XIQ A;  1TC6 A;  1AMW A;  2YE7 A;  1YER A;  4H85 A;  4R1F A;  4QPJ A;  3A0W A;  4EGH A;  1GJV A;  2YE5 A;  1UYG A;  4XD8 A;  5M4H A;  2GQP A;  2BRE A;  2XX2 A;  2QG2 A;  4KP4 A;  3ZXO A;  4E01 A;  5IN9 A;  2YE4 A;  4PL9 A;  1Y8O A;  3A0Y A;  2H8M A;  2YEC A;  4KQV A;  4ZVI A;  2XDX A;  4EMV A;  3BMY A;  2O1U A;  5CTU A;  3LPS A;  5CPH A;  1YC4 A;  4MPE A;  1BXD A;  2WI6 A; 
#chains in the Genus database with same CATH homology
 4XE2 A;  3T0H A;  3FV5 A;  2YJX A;  3VAD A;  4AS9 A;  2XJJ A;  5D7D A;  4XC0 A;  1AJ6 A;  4HZ0 A;  3TTZ A;  4LPB A;  4CWO A;  1I58 A;  4CWR A;  3OPD A;  1AH8 A;  4GT8 A;  4QPK A;  3R4N A;  1UYH A;  2VCI A;  3C11 A;  3O6O A;  4L91 A;  3K60 A;  4HY1 A;  4XCL A;  3CGZ A;  3T0Z A;  4P7A A;  5GGZ A;  2IOR A;  3OW6 A;  2UWD A;  4FCR A;  2YE6 A;  1NHI A;  3G75 A;  2WEQ A;  1ZW9 A;  3CGY A;  5D6Q A;  4O07 A;  4EGI A;  1ZXM A;  2Q8I A;  3EHH A;  1YT2 A;  3JZ3 A;  3T1K A;  1UYM A;  1BKN A;  1JM6 A;  3INX A;  2ZKJ A;  3A0R A;  4O05 A;  4KSG A;  1YS3 A;  3RLP A;  2FYP A;  4URN A;  1S16 A;  1YSZ A;  3B28 A;  4L93 A;  1UYF A;  3HEK A;  4L90 A;  2YKB A;  3MNR P;  2YKE A;  2GFD A;  2XAB A;  4GFN A;  4E02 A;  5CTY A;  1QYE A;  4CE2 A;  2O1W A;  4W7T A;  3FT5 A;  4XKK A;  3RLR A;  1TBW A;  4MBC A;  1MX0 A;  1KZN A;  2YKJ A;  3HYY A;  4BIZ A;  2YGE A;  4R3A A;  2BSM A;  2BU7 A;  4V26 A;  5J71 A;  4BAE A;  1Z5B A;  4HZ5 A;  1TID A;  3EHJ A;  2Q8G A;  2WEP A;  5C93 A;  4GQT A;  1YES A;  3CWV A;  4DZY A;  2HKJ A;  5D7C A;  4CWP A;  2YK9 A;  3R4P A;  2CG9 A;  2YKI A;  4I5S A;  1TC0 A;  4BIU A;  3R92 A;  1UY7 A;  5M4P A;  1GKX A;  3OWD A;  3IED A;  1I5B A;  1UYE A;  4L94 A;  4YKY A;  4CWQ A;  2XHT A;  1YSR A;  4WUD A;  2K5B A;  2WI4 A;  5D6P A;  1TH8 A;  2YI7 A;  4B7P A;  2VWC A;  4PU9 A;  4WUB A;  3CRK A;  1MU5 A;  3A0X A;  1Z5A A;  3DGE A;  1OSF A;  2FXS A;  5FND A;  1BYQ A;  2WER A;  4GCZ A;  1UY8 A;  5BOC A;  4MP7 A;  2XX4 A;  2YED A;  1KIJ A;  2IOQ A;  3G7B A;  2CCT A;  4LWF A;  1H7U A;  4YKW A;  4CWS A;  4Q20 A;  3TZ5 A;  3BM9 A;  4X9L A;  4U93 A;  2BRC A;  5D7R A;  3EKO A;  1I5D A;  4YKU A;  2O1V A;  4FCQ A;  1ID0 A;  3FT8 A;  4URM A;  2JKI A;  4FCP A;  5F3K A;  3H4L A;  1AH6 A;  3T10 A;  2XJX A;  2QG0 A;  2H55 A;  3G7E A;  4H81 A;  5M4M A;  1L0O A;  1NHJ A;  4XIR A;  3LNU A;  4MB9 A;  1YT0 A;  2XX5 A;  2E0A A;  2YI5 A;  3U2D A;  1Z5C A;  4XIP A;  2CGF A;  1Y8N A;  5FNF A;  3ZKD A;  3RLQ A;  1ZWH A;  1B63 A;  3EHG A;  3EHF A;  4ZKI A;  3C0E A;  3TZ4 A;  4HXZ A;  2BU6 A;  4XKA A;  3A0Z A;  4BQG A;  4NH9 A;  3R4O A;  2CH4 A;  2EXL A;  3U67 A;  1YET A;  2YI0 A;  4KFG A;  3K98 A;  2VW5 A;  3RKZ A;  3OMU A;  1YC3 A;  4URO A;  2XDL A;  4PRX A;  1BGQ A;  3NMQ A;  3GIF A;  4MPN A;  2XD6 A;  2XCM A;  2YE8 A;  3ZXQ A;  3B25 A;  4LP0 A;  4WUC A;  1ZXN A;  1GKZ A;  4YKZ A;  4XIT A;  5J6A A;  4U7N A;  1Z59 A;  2AKP A;  2ZDX A;  3PEH A;  4JQL A;  2XHR A;  2YEI A;  4P8O A;  4EM7 A;  4URL A;  1Y4S A;  1UYK A;  5CF0 A;  4NH7 A;  2YEA A;  2WI1 A;  4EGK A;  4CE1 A;  3KE6 A;  4O04 A;  5IDM A;  2YE2 A;  4AWO A;  2HG1 A;  3T2S A;  2FWY A;  2YEB A;  1AM1 A;  2BYI A;  1QZR A;  2YGF A;  1PVG A;  3H80 A;  1I5C A;  4HY6 A;  5M4N A;  2WI2 A;  1UYD A;  5IDJ A;  4CE3 A;  3OWB A;  3ZM7 A;  3R91 A;  5FNC A;  4H7Q A;  2IOP A;  3VHC A;  1YC1 A;  5L3J A;  1R62 A;  4DUH A;  3TUH A;  4U7O A;  2XJG A;  4YKT A;  2YEE A;  4ASF A;  4KSH A;  3Q5L A;  3HYZ A;  3GIG A;  3R4M A;  4BXI A;  2XDU A;  3INW A;  3U2K A;  3QTF A;  2BU2 A;  4L8Z A;  2BYH A;  2YE3 A;  5M4E A;  1TIL A;  3D0B A;  2IWX A;  2FWZ A;  2Q8H A;  4PRV A;  4E00 A;  4AWP A;  4I3H A;  4ASG A;  2IWS A;  4KTN A;  4K4O A;  4XDM A;  3HZ1 A;  1A4H A;  4O09 A;  1NHH A;  4LWG A;  3VHA A;  4NH8 A;  3CRL A;  2WI5 A;  4HYP A;  4LWI A;  1UYI A;  5FWK A;  2YEH A;  1UYC A;  2YJW A;  2BU8 A;  3K99 A;  3A0T A;  4MOT A;  1S14 A;  3HHU A;  5M4K A;  3D36 A;  1EI1 A;  4CWT A;  4B6C A;  4GEE A;  3QDD A;  1UY6 A;  4FMT A;  3SL2 A;  4EFU A;  3D2R A;  4JAS A;  2YI6 A;  2YEJ A;  4XKO A;  1UYL A;  2QF6 A;  2ZBK B;  4JAU A;  1YT1 A;  4HXW A;  4YKR A;  2IWU A;  2YEG A;  4MP2 A;  3ZKB A;  4MPC A;  3VHD A;  2WI7 A;  1THN A;  2BZ5 A;  1EA6 A;  3PEJ A;  4O0B A;  3GIG B;  2YGA A;  1B62 A;  3B24 A;  2XDK A;  2BT0 A;  2C2A A;  3O0I A;  4YKQ A;  2CCU A;  2Q2E B;  4YKX A;  5CTX A;  1US7 A;  2XDS A;  2BTZ A;  4JAV A;  3TZ0 A;  4GGL A;  3GIE A;  2Q8F A;  4CWN A;  1U0Z A;  2YKC A;  2ZDY A;  1H7S A;  4ASA A;  3TZ2 A;  1QY8 A;  2ESA A;  4XCJ A;  2PNR A;  1U2O A;  3Q5K A;  2XHX A;  2XK2 A;  4R3M A;  4HYM A;  4FPP A;  1Y8P A;  1Y4U A;  3K97 A;  3EKR A;  5CTW A;  4EEH A;  3Q5J A;  5BOD A;  4LWH A;  2YEF A;  2QFO A;  3HZ5 A;  4CWF A;  2VCJ A;  3O2F A;  2WI3 A;  1I5A A;  1UY9 A;  2HCH A;  2BU5 A;  3WHA A;  3WQ9 A;  4ASB A;  2YK2 A;  4AWQ A;  5F5R A;  1B3Q A;  2JJC A;  4BQJ A;  1I59 A;  2YE9 A;  3B26 A;  4EFT A;  2CCS A;  3B27 A;  4XTJ A;  4V25 A;  4LWE A;  4XIQ A;  1TC6 A;  1AMW A;  2YE7 A;  1YER A;  4H85 A;  4R1F A;  4QPJ A;  3A0W A;  4EGH A;  1GJV A;  2YE5 A;  1UYG A;  4XD8 A;  5M4H A;  2GQP A;  2BRE A;  2XX2 A;  2QG2 A;  4KP4 A;  3ZXO A;  4E01 A;  5IN9 A;  2YE4 A;  4PL9 A;  1Y8O A;  3A0Y A;  2H8M A;  2YEC A;  4KQV A;  4ZVI A;  2XDX A;  4EMV A;  3BMY A;  2O1U A;  5CTU A;  3LPS A;  5CPH A;  1YC4 A;  4MPE A;  1BXD A;  2WI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...