1QYEA

Crystal structure of the n-domain of the er hsp90 chaperone grp94 in complex with 2-chlorodideoxyadenosine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
266
structure length
225
Chain Sequence
KSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Structure of the N-terminal Domain of GRP94. Basis for Ligand Specificity and Regulation
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 70
structure length 225
sequence length 266
ec nomenclature
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1qyeA00
2ZDXA 2YE8A 2XJGA 4XKKA 2QF6A 1Y8PA 3INWA 2YI7A 3MNRP 1JM6A 1EI1A 2HG1A 2IORA 4CWRA 2YEDA 3OWDA 2XDLA 1GKXA 1S16A 1NHIA 3B27A 4HY6A 3R4NA 4LWHA 2VWCA 1PVGA 4YKYA 2YEAA 2YEJA 1GKZA 4HZ5A 2YKEA 1UYLA 4H85A 5J71A 4ASFA 4ASBA 4KP4A 4XD8A 4AWQA 2WI4A 5D7RA 3TTZA 4CWSA 1I5DA 1YS3A 3B28A 3INXA 4URNA 1EA6A 3FT8A 4O07A 4CWTA 3R91A 2YKCA 1TH8A 4U7OA 1I5BA 2O1WA 3CRKA 1UYEA 4FPPA 3T0HA 4CE3A 2CG9A 3GIGA 1YC1A 1UYKA 2WI2A 5IN9A 1UYCA 3IEDA 2YE3A 4R3MA 2VCJA 3ZKBA 3QDDA 2YE4A 3GIFA 3U2DA 3O0IA 1I5AA 2BU8A 4V25A 1NHJA 2Q2EB 3ZXQA 2BU6A 2H55A 2H8MA 1Z5BA 3BMYA 4JAVA 4PRXA 3OWBA 3Q5JA 1YESA 4E00A 4L91A 4EFUA 3R4OA 4CWFA 4EM7A 3ZXOA 3SL2A 3QTFA 2XJXA 3EHGA 4O09A 4P8OA 3Q5LA 1GJVA 4CWNA 4BIZA 4HZ0A 4LWGA 1ID0A 2YK9A 3T1KA 1MX0A 3HYYA 5IDMA 1AMWA 4JQLA 2XHRA 3O6OA 4DZYA 4ASGA 1TIDA 1US7A 4YKWA 4CWOA 1Y8NA 3PEHA 3R4MA 2Q8HA 3TZ0A 3EHFA 4EGKA 2YGFA 4YKXA 4Q20A 4NH8A 2BZ5A 1BKNA 4ZKIA 3A0WA 2BSMA 4AS9A 3B26A 4BXIA 5CTUA 4BAEA 2BT0A 5D6PA 3K60A 2WERA 3K99A 1I5CA 2PNRA 2YE5A 4MB9A 4MP2A 2XDKA 5D7CA 4U7NA 2XDSA 1MU5A 4L90A 5FNDA 4MPNA 2QG2A 2XDXA 2YEIA 3R92A 4ZVIA 3LNUA 3B24A 2FWYA 3D2RA 4GEEA 1U0ZA 2ZDYA 3DGEA 4H81A 2VCIA 2YEGA 4FCQA 4XITA 3TZ2A 4XCLA 1TBWA 1UYGA 5CF0A 2FXSA 4XCJA 4XTJA 4E02A 3FT5A 3HZ5A 3D0BA 1QY8A 3VHAA 5M4MA 2QFOA 4I5SA 2CH4A 3GIEA 5GGZA 4B7PA 4O0BA 2XX5A 4XC0A 4R1FA 3RLPA 4GQTA 4KQVA 3TZ5A 2ZKJA 3EKRA 3HYZA 4H7QA 4LWEA 1BGQA 5CTXA 1ZXNA 3C11A 2WI7A 2YEFA 3H80A 5D6QA 1Y8OA 4YKRA 1H7UA 1UY7A 1YSRA 1B3QA 3Q5KA 2JKIA 1L0OA 2XHXA 5M4KA 2YE7A 2QG0A 4QPKA 1QZRA 4MOTA 4NH9A 2BU7A 2BYHA 4KTNA 4UROA 4JASA 4GCZA 4FCPA 4CE2A 1THNA 3ZM7A 3C0EA 3RKZA 2YEHA 1Z5CA 3CGZA 4NH7A 3T10A 4AWOA 2WEQA 2HKJA 4W7TA 1UYIA 2BTZA 3NMQA 1TILA 4BIUA 2BU2A 1YT2A 4EFTA 4BQJA 2WI1A 2UWDA 4HXWA 5L3JA 1H7SA 5CTYA 3OMUA 4URMA 3CWVA 1I58A 2JJCA 3R4PA 1Y4SA 1TC0A 5FNCA 4MPEA 4MPCA 1TC6A 1UYDA 1YSZA 3G75A 3EHHA 4LWIA 3D36A 5M4NA 5M4EA 3H4LA 2IWSA 3PEJA 4MP7A 4LP0A 2Q8FA 1KZNA 4I3HA 2IWUA 5C93A 1NHHA 4YKZA 2BU5A 5CPHA 2YEEA 4FMTA 4CWPA 2XD6A 2BRCA 4CWQA 4FCRA 4U93A 1B63A 3JZ3A 1A4HA 4B6CA 2GQPA 2YGEA 3HEKA 2YKJA 2WI3A 1Y4UA 1AH8A 2IOQA 1Z5AA 3OPDA 2YJXA 5F5RA 2YGAA 4DUHA 3VADA 5J6AA 2YKIA 5FNFA 4XKOA 4XKAA 2K5BA 2CGFA 3G7EA 2VW5A 2XX4A 5M4PA 1ZWHA 1UYHA 4XE2A 3HHUA 3FV5A 3VHCA 4MBCA 1UYMA 1YT1A 4KSHA 5BODA 3LPSA 4JAUA 1ZXMA 2E0AA 4HY1A 3TUHA 5F3KA 2Q8GA 1YETA 4O05A 1YERA 3EHJA 4HYPA 1KIJA 3CGYA 4XIQA 2CCSA 4PU9A 3VHDA 1I59A 1AH6A 2BREA 1UY8A 1YC4A 2YKBA 4KSGA 2YJWA 4R3AA 3T0ZA 3A0YA 3RLRA 2ZBKB 1ZW9A 5IDJA 3U67A 3HZ1A 2CCTA 3GIGB 4HXZA 3T2SA 3K98A 4L94A 4EGHA 2XDUA 4L8ZA 4WUDA 3CRLA 2XHTA 2YI5A 2XABA 2YEBA 2WEPA 1B62A 4YKQA 4LPBA 2XCMA 5D7DA 5M4HA 4E01A 2AKPA 2O1UA 4WUBA 2EXLA 1YT0A 4QPJA 4BQGA 2YI6A 2HCHA 4XDMA 2FYPA 4XIPA 5BOCA 4GFNA 3BM9A 5FWKA 2C2AA 3OW6A 3O2FA 2WI5A 4V26A 1UYFA 3EKOA 3K97A 3A0RA 2GFDA 1BXDA 1AM1A 2YK2A 1AJ6A 1UY6A 2O1VA 4WUCA 4L93A 1S14A 2FWZA 4AWPA 1UY9A 3KE6A 1OSFA 3TZ4A 4K4OA 2YE6A 3WHAA 4O04A 1R62A 4KFGA 5CTWA 4PL9A 3A0XA 1QYEA 2IWXA 2CCUA 2IOPA 1U2OA 4YKTA 4ASAA 2YI0A 2ESAA 3WQ9A 3RLQA 4LWFA 4X9LA 3B25A 4EEHA 2YE9A 4GT8A 1Z59A 4CE1A 4XIRA 4URLA 4YKUA 1BYQA 4PRVA 2XX2A 2YE2A 1YC3A 2XJJA 4EMVA 4GGLA 4P7AA 2BYIA 2WI6A 2YECA 3ZKDA 3A0ZA 4EGIA 2XK2A 3U2KA 3A0TA 3G7BA 4HYMA 2Q8IA
chains in the Genus database with same CATH superfamily
2ZDXA 2YE8A 2XJGA 4XKKA 2QF6A 1Y8PA 3INWA 2YI7A 3MNRP 1JM6A 1EI1A 2C1IA 2HG1A 3S5TA 2IORA 4CWRA 2YEDA 3OWDA 2XDLA 1GKXA 1S16A 1NHIA 3B27A 4HY6A 3R4NA 4LWHA 2VWCA 1PVGA 4YKYA 2YEAA 2YEJA 1GKZA 4HZ5A 2YKEA 1UYLA 4H85A 5J71A 4ASFA 4ASBA 4KP4A 4XD8A 4AWQA 2WI4A 5D7RA 3TTZA 4CWSA 1I5DA 1YS3A 2HHIA 3B28A 3INXA 4URNA 1EA6A 3LMMA 3FT8A 4O07A 4CWTA 3R91A 2YKCA 1TH8A 4U7OA 1I5BA 2O1WA 3CRKA 1UYEA 4FPPA 3T0HA 4CE3A 2CG9A 3GIGA 1YC1A 1UYKA 2WI2A 5IN9A 1UYCA 3IEDA 2YE3A 4R3MA 2VCJA 3ZKBA 3QDDA 2YE4A 3GIFA 3U2DA 3O0IA 1I5AA 2BU8A 4V25A 1NHJA 2Q2EB 3ZXQA 2BU6A 2H55A 2H8MA 1Z5BA 3BMYA 4JAVA 4PRXA 3OWBA 3Q5JA 1YESA 4E00A 4L91A 4EFUA 3R4OA 4CWFA 4EM7A 3ZXOA 3SL2A 3QTFA 2XJXA 3EHGA 4O09A 4P8OA 3Q5LA 1GJVA 4CWNA 4BIZA 4HZ0A 4LWGA 1ID0A 2YK9A 3T1KA 1MX0A 3HYYA 5IDMA 1AMWA 4E72A 4JQLA 2XHRA 3O6OA 4DZYA 4ASGA 3CYGA 1TIDA 1US7A 4YKWA 4CWOA 1Y8NA 3PEHA 3R4MA 2Q8HA 3TZ0A 3EHFA 4EGKA 2YGFA 4YKXA 4Q20A 4NH8A 2BZ5A 1BKNA 4ZKIA 3A0WA 2BSMA 4AS9A 3B26A 4BXIA 2C1GA 5CTUA 4BAEA 2BT0A 5D6PA 3K60A 2WERA 3K99A 1I5CA 2PNRA 2YE5A 4MB9A 4MP2A 2XDKA 5D7CA 4U7NA 2XDSA 1MU5A 4L90A 5FNDA 4MPNA 2QG2A 2XDXA 2YEIA 3R92A 4ZVIA 3LNUA 5JENA 3B24A 2FWYA 3D2RA 4GEEA 1U0ZA 2ZDYA 3DGEA 4H81A 2VCIA 2YEGA 4FCQA 4XITA 3TZ2A 4XCLA 1TBWA 1UYGA 5CF0A 2FXSA 4XCJA 4XTJA 4E02A 3FT5A 3HZ5A 3D0BA 1QY8A 3VHAA 5M4MA 2QFOA 4I5SA 2CH4A 3GIEA 5GGZA 4B7PA 4O0BA 2XX5A 4XC0A 4R1FA 3RLPA 4GQTA 4KQVA 3TZ5A 2ZKJA 3EKRA 3HYZA 4H7QA 4LWEA 1BGQA 5CTXA 1ZXNA 3C11A 2WI7A 2YEFA 3H80A 5D6QA 1Y8OA 4YKRA 1H7UA 1UY7A 1YSRA 1B3QA 3Q5KA 2JKIA 1F51A 1L0OA 2XHXA 5M4KA 2YE7A 2QG0A 4QPKA 1QZRA 4MOTA 4NH9A 2BU7A 2BYHA 4KTNA 4UROA 4JASA 4FCPA 4GCZA 4CE2A 1THNA 3ZM7A 3C0EA 3RKZA 2YEHA 1Z5CA 3CGZA 4NH7A 3T10A 4AWOA 2WEQA 2HKJA 4W7TA 1UYIA 2BTZA 3NMQA 1TILA 4BIUA 2BU2A 1YT2A 4EFTA 4BQJA 2WI1A 2UWDA 4HXWA 5L3JA 1H7SA 5CTYA 3OMUA 4URMA 3CWVA 1I58A 2JJCA 3R4PA 1Y4SA 1TC0A 5FNCA 4MPEA 4MPCA 1TC6A 1UYDA 1YSZA 3G75A 3EHHA 4LWIA 3D36A 5M4NA 5M4EA 3H4LA 2IWSA 3PEJA 4MP7A 4LP0A 2Q8FA 1KZNA 4I3HA 2IWUA 5C93A 1NHHA 4YKZA 2BU5A 5CPHA 2YEEA 4FMTA 2FTKA 2XD6A 2BRCA 4CWQA 4CWPA 4FCRA 4U93A 1B63A 3JZ3A 1A4HA 4B6CA 2GQPA 2YGEA 3HEKA 2YKJA 2WI3A 1Y4UA 1AH8A 2IOQA 1Z5AA 3OPDA 2YJXA 5F5RA 2YGAA 4DUHA 3VADA 5J6AA 2YKIA 5FNFA 4XKOA 4XKAA 2K5BA 2CGFA 3G7EA 2VW5A 2XX4A 1IXMA 5M4PA 1ZWHA 1UYHA 4XE2A 3HHUA 3FV5A 3VHCA 4MBCA 1UYMA 1YT1A 4KSHA 5BODA 3LPSA 4JAUA 1ZXMA 2E0AA 4HY1A 3TUHA 5F3KA 2Q8GA 1YETA 4O05A 1YERA 3EHJA 4HYPA 1KIJA 3CGYA 4XIQA 2CCSA 4PU9A 3VHDA 1I59A 1AH6A 2BREA 1UY8A 1YC4A 2YKBA 4KSGA 2YJWA 4R3AA 3T0ZA 3A0YA 3RLRA 2ZBKB 1ZW9A 5IDJA 3U67A 3HZ1A 2CCTA 3GIGB 4HXZA 3T2SA 3K98A 4L94A 4EGHA 2XDUA 4L8ZA 4WUDA 3CRLA 2XHTA 2YI5A 2XABA 2YEBA 2WEPA 1B62A 4YKQA 4LPBA 2XCMA 5D7DA 5M4HA 4E01A 2AKPA 2O1UA 4WUBA 2EXLA 1YT0A 4QPJA 4BQGA 2YI6A 2HCHA 4XDMA 2FYPA 4XIPA 5BOCA 4GFNA 3BM9A 5FWKA 2C2AA 3OW6A 3O2FA 2WI5A 4V26A 1UYFA 3EKOA 3K97A 3A0RA 2GFDA 1BXDA 1AM1A 2YK2A 1AJ6A 1UY6A 2O1VA 4WUCA 4L93A 1S14A 2FWZA 4AWPA 1UY9A 3KE6A 1OSFA 3TZ4A 4K4OA 2YE6A 3WHAA 4O04A 1R62A 4KFGA 5CTWA 4PL9A 3A0XA 1QYEA 2IWXA 2CCUA 2IOPA 1U2OA 4YKTA 4ASAA 2YI0A 2ESAA 3WQ9A 3RLQA 4LWFA 4X9LA 3B25A 4EEHA 2YE9A 4GT8A 1Z59A 4CE1A 4XIRA 4URLA 4YKUA 1BYQA 4PRVA 2XX2A 2YE2A 1YC3A 2XJJA 4EMVA 4GGLA 4P7AA 2BYIA 2WI6A 2YECA 3ZKDA 3A0ZA 4EGIA 2XK2A 3U2KA 3A0TA 3G7BA 4HYMA 2Q8IA
chains in the Genus database with same CATH topology
2ZDXA 2YE8A 2XJGA 4XKKA 2QF6A 1Y8PA 3INWA 2YI7A 3MNRP 1JM6A 1EI1A 2HG1A 2IORA 4CWRA 2YEDA 3OWDA 2XDLA 1GKXA 1S16A 1NHIA 3B27A 4HY6A 3R4NA 4LWHA 2VWCA 1PVGA 4YKYA 2YEAA 2YEJA 1GKZA 4HZ5A 2YKEA 1UYLA 4H85A 5J71A 4ASFA 4ASBA 4KP4A 4XD8A 4AWQA 2WI4A 5D7RA 3TTZA 4CWSA 1I5DA 1YS3A 3B28A 3INXA 4URNA 1EA6A 3FT8A 4O07A 4CWTA 3R91A 2YKCA 1TH8A 4U7OA 1I5BA 2O1WA 3CRKA 1UYEA 4FPPA 3T0HA 4CE3A 2CG9A 3GIGA 1YC1A 1UYKA 2WI2A 5IN9A 1UYCA 3IEDA 2YE3A 4R3MA 2VCJA 3ZKBA 3QDDA 2YE4A 3GIFA 3U2DA 3O0IA 1I5AA 2BU8A 4V25A 1NHJA 2Q2EB 3ZXQA 2BU6A 2H55A 2H8MA 1Z5BA 3BMYA 4JAVA 4PRXA 3OWBA 3Q5JA 1YESA 4E00A 4L91A 4EFUA 3R4OA 4CWFA 4EM7A 3ZXOA 3SL2A 3QTFA 2XJXA 3EHGA 4O09A 4P8OA 3Q5LA 1GJVA 4CWNA 4BIZA 4HZ0A 4LWGA 1ID0A 2YK9A 3T1KA 1MX0A 3HYYA 5IDMA 1AMWA 4JQLA 2XHRA 3O6OA 4DZYA 4ASGA 1TIDA 1US7A 4YKWA 4CWOA 1Y8NA 3PEHA 3R4MA 2Q8HA 3TZ0A 3EHFA 4EGKA 2YGFA 4YKXA 4Q20A 4NH8A 2BZ5A 1BKNA 4ZKIA 3A0WA 2BSMA 4AS9A 3B26A 4BXIA 5CTUA 4BAEA 2BT0A 5D6PA 3K60A 2WERA 3K99A 1I5CA 2PNRA 2YE5A 4MB9A 4MP2A 2XDKA 5D7CA 4U7NA 2XDSA 1MU5A 4L90A 5FNDA 4MPNA 2QG2A 2XDXA 2YEIA 3R92A 4ZVIA 3LNUA 3B24A 2FWYA 3D2RA 4GEEA 1U0ZA 2ZDYA 3DGEA 4H81A 2VCIA 2YEGA 4FCQA 4XITA 3TZ2A 4XCLA 1TBWA 1UYGA 5CF0A 2FXSA 4XCJA 4XTJA 4E02A 3FT5A 3HZ5A 3D0BA 1QY8A 3VHAA 5M4MA 2QFOA 4I5SA 2CH4A 3GIEA 5GGZA 4B7PA 4O0BA 2XX5A 4XC0A 4R1FA 3RLPA 4GQTA 4KQVA 3TZ5A 2ZKJA 3EKRA 3HYZA 4H7QA 4LWEA 1BGQA 5CTXA 1ZXNA 3C11A 2WI7A 2YEFA 3H80A 5D6QA 1Y8OA 4YKRA 1H7UA 1UY7A 1YSRA 1B3QA 3Q5KA 2JKIA 1L0OA 2XHXA 5M4KA 2YE7A 2QG0A 4QPKA 1QZRA 4MOTA 4NH9A 2BU7A 2BYHA 4KTNA 4UROA 4JASA 4GCZA 4FCPA 4CE2A 1THNA 3ZM7A 3C0EA 3RKZA 2YEHA 1Z5CA 3CGZA 4NH7A 3T10A 4AWOA 2WEQA 2HKJA 4W7TA 1UYIA 2BTZA 3NMQA 1TILA 4BIUA 2BU2A 1YT2A 4EFTA 4BQJA 2WI1A 2UWDA 4HXWA 5L3JA 1H7SA 5CTYA 3OMUA 4URMA 3CWVA 1I58A 2JJCA 3R4PA 1Y4SA 1TC0A 5FNCA 4MPEA 4MPCA 1TC6A 1UYDA 1YSZA 3G75A 3EHHA 4LWIA 3D36A 5M4NA 5M4EA 3H4LA 2IWSA 3PEJA 4MP7A 4LP0A 2Q8FA 1KZNA 4I3HA 2IWUA 5C93A 1NHHA 4YKZA 2BU5A 5CPHA 2YEEA 4FMTA 4CWPA 2XD6A 2BRCA 4CWQA 4FCRA 4U93A 1B63A 3JZ3A 1A4HA 4B6CA 2GQPA 2YGEA 3HEKA 2YKJA 2WI3A 1Y4UA 1AH8A 2IOQA 1Z5AA 3OPDA 2YJXA 5F5RA 2YGAA 4DUHA 3VADA 5J6AA 2YKIA 5FNFA 4XKOA 4XKAA 2K5BA 2CGFA 3G7EA 2VW5A 2XX4A 5M4PA 1ZWHA 1UYHA 4XE2A 3HHUA 3FV5A 3VHCA 4MBCA 1UYMA 1YT1A 4KSHA 5BODA 3LPSA 4JAUA 1ZXMA 2E0AA 4HY1A 3TUHA 5F3KA 2Q8GA 1YETA 4O05A 1YERA 3EHJA 4HYPA 1KIJA 3CGYA 4XIQA 2CCSA 4PU9A 3VHDA 1I59A 1AH6A 2BREA 1UY8A 1YC4A 2YKBA 4KSGA 2YJWA 4R3AA 3T0ZA 3A0YA 3RLRA 2ZBKB 1ZW9A 5IDJA 3U67A 3HZ1A 2CCTA 3GIGB 4HXZA 3T2SA 3K98A 4L94A 4EGHA 2XDUA 4L8ZA 4WUDA 3CRLA 2XHTA 2YI5A 2XABA 2YEBA 2WEPA 1B62A 4YKQA 4LPBA 2XCMA 5D7DA 5M4HA 4E01A 2AKPA 2O1UA 4WUBA 2EXLA 1YT0A 4QPJA 4BQGA 2YI6A 2HCHA 4XDMA 2FYPA 4XIPA 5BOCA 4GFNA 3BM9A 5FWKA 2C2AA 3OW6A 3O2FA 2WI5A 4V26A 1UYFA 3EKOA 3K97A 3A0RA 2GFDA 1BXDA 1AM1A 2YK2A 1AJ6A 1UY6A 2O1VA 4WUCA 4L93A 1S14A 2FWZA 4AWPA 1UY9A 3KE6A 1OSFA 3TZ4A 4K4OA 2YE6A 3WHAA 4O04A 1R62A 4KFGA 5CTWA 4PL9A 3A0XA 1QYEA 2IWXA 2CCUA 2IOPA 1U2OA 4YKTA 4ASAA 2YI0A 2ESAA 3WQ9A 3RLQA 4LWFA 4X9LA 3B25A 4EEHA 2YE9A 4GT8A 1Z59A 4CE1A 4XIRA 4URLA 4YKUA 1BYQA 4PRVA 2XX2A 2YE2A 1YC3A 2XJJA 4EMVA 4GGLA 4P7AA 2BYIA 2WI6A 2YECA 3ZKDA 3A0ZA 4EGIA 2XK2A 3U2KA 3A0TA 3G7BA 4HYMA 2Q8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZDX A;  2YE8 A;  2XJG A;  4XKK A;  2QF6 A;  1Y8P A;  3INW A;  2YI7 A;  3MNR P;  1JM6 A;  1EI1 A;  2HG1 A;  2IOR A;  4CWR A;  2YED A;  3OWD A;  2XDL A;  1GKX A;  1S16 A;  1NHI A;  3B27 A;  4HY6 A;  3R4N A;  4LWH A;  2VWC A;  1PVG A;  4YKY A;  2YEA A;  2YEJ A;  1GKZ A;  4HZ5 A;  2YKE A;  1UYL A;  4H85 A;  5J71 A;  4ASF A;  4ASB A;  4KP4 A;  4XD8 A;  4AWQ A;  2WI4 A;  5D7R A;  3TTZ A;  4CWS A;  1I5D A;  1YS3 A;  3B28 A;  3INX A;  4URN A;  1EA6 A;  3FT8 A;  4O07 A;  4CWT A;  3R91 A;  2YKC A;  1TH8 A;  4U7O A;  1I5B A;  2O1W A;  3CRK A;  1UYE A;  4FPP A;  3T0H A;  4CE3 A;  2CG9 A;  3GIG A;  1YC1 A;  1UYK A;  2WI2 A;  5IN9 A;  1UYC A;  3IED A;  2YE3 A;  4R3M A;  2VCJ A;  3ZKB A;  3QDD A;  2YE4 A;  3GIF A;  3U2D A;  3O0I A;  1I5A A;  2BU8 A;  4V25 A;  1NHJ A;  2Q2E B;  3ZXQ A;  2BU6 A;  2H55 A;  2H8M A;  1Z5B A;  3BMY A;  4JAV A;  4PRX A;  3OWB A;  3Q5J A;  1YES A;  4E00 A;  4L91 A;  4EFU A;  3R4O A;  4CWF A;  4EM7 A;  3ZXO A;  3SL2 A;  3QTF A;  2XJX A;  3EHG A;  4O09 A;  4P8O A;  3Q5L A;  1GJV A;  4CWN A;  4BIZ A;  4HZ0 A;  4LWG A;  1ID0 A;  2YK9 A;  3T1K A;  1MX0 A;  3HYY A;  5IDM A;  1AMW A;  4JQL A;  2XHR A;  3O6O A;  4DZY A;  4ASG A;  1TID A;  1US7 A;  4YKW A;  4CWO A;  1Y8N A;  3PEH A;  3R4M A;  2Q8H A;  3TZ0 A;  3EHF A;  4EGK A;  2YGF A;  4YKX A;  4Q20 A;  4NH8 A;  2BZ5 A;  1BKN A;  4ZKI A;  3A0W A;  2BSM A;  4AS9 A;  3B26 A;  4BXI A;  5CTU A;  4BAE A;  2BT0 A;  5D6P A;  3K60 A;  2WER A;  3K99 A;  1I5C A;  2PNR A;  2YE5 A;  4MB9 A;  4MP2 A;  2XDK A;  5D7C A;  4U7N A;  2XDS A;  1MU5 A;  4L90 A;  5FND A;  4MPN A;  2QG2 A;  2XDX A;  2YEI A;  3R92 A;  4ZVI A;  3LNU A;  3B24 A;  2FWY A;  3D2R A;  4GEE A;  1U0Z A;  2ZDY A;  3DGE A;  4H81 A;  2VCI A;  2YEG A;  4FCQ A;  4XIT A;  3TZ2 A;  4XCL A;  1TBW A;  1UYG A;  5CF0 A;  2FXS A;  4XCJ A;  4XTJ A;  4E02 A;  3FT5 A;  3HZ5 A;  3D0B A;  1QY8 A;  3VHA A;  5M4M A;  2QFO A;  4I5S A;  2CH4 A;  3GIE A;  5GGZ A;  4B7P A;  4O0B A;  2XX5 A;  4XC0 A;  4R1F A;  3RLP A;  4GQT A;  4KQV A;  3TZ5 A;  2ZKJ A;  3EKR A;  3HYZ A;  4H7Q A;  4LWE A;  1BGQ A;  5CTX A;  1ZXN A;  3C11 A;  2WI7 A;  2YEF A;  3H80 A;  5D6Q A;  1Y8O A;  4YKR A;  1H7U A;  1UY7 A;  1YSR A;  1B3Q A;  3Q5K A;  2JKI A;  1L0O A;  2XHX A;  5M4K A;  2YE7 A;  2QG0 A;  4QPK A;  1QZR A;  4MOT A;  4NH9 A;  2BU7 A;  2BYH A;  4KTN A;  4URO A;  4JAS A;  4GCZ A;  4FCP A;  4CE2 A;  1THN A;  3ZM7 A;  3C0E A;  3RKZ A;  2YEH A;  1Z5C A;  3CGZ A;  4NH7 A;  3T10 A;  4AWO A;  2WEQ A;  2HKJ A;  4W7T A;  1UYI A;  2BTZ A;  3NMQ A;  1TIL A;  4BIU A;  2BU2 A;  1YT2 A;  4EFT A;  4BQJ A;  2WI1 A;  2UWD A;  4HXW A;  5L3J A;  1H7S A;  5CTY A;  3OMU A;  4URM A;  3CWV A;  1I58 A;  2JJC A;  3R4P A;  1Y4S A;  1TC0 A;  5FNC A;  4MPE A;  4MPC A;  1TC6 A;  1UYD A;  1YSZ A;  3G75 A;  3EHH A;  4LWI A;  3D36 A;  5M4N A;  5M4E A;  3H4L A;  2IWS A;  3PEJ A;  4MP7 A;  4LP0 A;  2Q8F A;  1KZN A;  4I3H A;  2IWU A;  5C93 A;  1NHH A;  4YKZ A;  2BU5 A;  5CPH A;  2YEE A;  4FMT A;  4CWP A;  2XD6 A;  2BRC A;  4CWQ A;  4FCR A;  4U93 A;  1B63 A;  3JZ3 A;  1A4H A;  4B6C A;  2GQP A;  2YGE A;  3HEK A;  2YKJ A;  2WI3 A;  1Y4U A;  1AH8 A;  2IOQ A;  1Z5A A;  3OPD A;  2YJX A;  5F5R A;  2YGA A;  4DUH A;  3VAD A;  5J6A A;  2YKI A;  5FNF A;  4XKO A;  4XKA A;  2K5B A;  2CGF A;  3G7E A;  2VW5 A;  2XX4 A;  5M4P A;  1ZWH A;  1UYH A;  4XE2 A;  3HHU A;  3FV5 A;  3VHC A;  4MBC A;  1UYM A;  1YT1 A;  4KSH A;  5BOD A;  3LPS A;  4JAU A;  1ZXM A;  2E0A A;  4HY1 A;  3TUH A;  5F3K A;  2Q8G A;  1YET A;  4O05 A;  1YER A;  3EHJ A;  4HYP A;  1KIJ A;  3CGY A;  4XIQ A;  2CCS A;  4PU9 A;  3VHD A;  1I59 A;  1AH6 A;  2BRE A;  1UY8 A;  1YC4 A;  2YKB A;  4KSG A;  2YJW A;  4R3A A;  3T0Z A;  3A0Y A;  3RLR A;  2ZBK B;  1ZW9 A;  5IDJ A;  3U67 A;  3HZ1 A;  2CCT A;  3GIG B;  4HXZ A;  3T2S A;  3K98 A;  4L94 A;  4EGH A;  2XDU A;  4L8Z A;  4WUD A;  3CRL A;  2XHT A;  2YI5 A;  2XAB A;  2YEB A;  2WEP A;  1B62 A;  4YKQ A;  4LPB A;  2XCM A;  5D7D A;  5M4H A;  4E01 A;  2AKP A;  2O1U A;  4WUB A;  2EXL A;  1YT0 A;  4QPJ A;  4BQG A;  2YI6 A;  2HCH A;  4XDM A;  2FYP A;  4XIP A;  5BOC A;  4GFN A;  3BM9 A;  5FWK A;  2C2A A;  3OW6 A;  3O2F A;  2WI5 A;  4V26 A;  1UYF A;  3EKO A;  3K97 A;  3A0R A;  2GFD A;  1BXD A;  1AM1 A;  2YK2 A;  1AJ6 A;  1UY6 A;  2O1V A;  4WUC A;  4L93 A;  1S14 A;  2FWZ A;  4AWP A;  1UY9 A;  3KE6 A;  1OSF A;  3TZ4 A;  4K4O A;  2YE6 A;  3WHA A;  4O04 A;  1R62 A;  4KFG A;  5CTW A;  4PL9 A;  3A0X A;  1QYE A;  2IWX A;  2CCU A;  2IOP A;  1U2O A;  4YKT A;  4ASA A;  2YI0 A;  2ESA A;  3WQ9 A;  3RLQ A;  4LWF A;  4X9L A;  3B25 A;  4EEH A;  2YE9 A;  4GT8 A;  1Z59 A;  4CE1 A;  4XIR A;  4URL A;  4YKU A;  1BYQ A;  4PRV A;  2XX2 A;  2YE2 A;  1YC3 A;  2XJJ A;  4EMV A;  4GGL A;  4P7A A;  2BYI A;  2WI6 A;  2YEC A;  3ZKD A;  3A0Z A;  4EGI A;  2XK2 A;  3U2K A;  3A0T A;  3G7B A;  4HYM A;  2Q8I A; 
#chains in the Genus database with same CATH topology
 2ZDX A;  2YE8 A;  2XJG A;  4XKK A;  2QF6 A;  1Y8P A;  3INW A;  2YI7 A;  3MNR P;  1JM6 A;  1EI1 A;  2C1I A;  2HG1 A;  3S5T A;  2IOR A;  4CWR A;  2YED A;  3OWD A;  2XDL A;  1GKX A;  1S16 A;  1NHI A;  3B27 A;  4HY6 A;  3R4N A;  4LWH A;  2VWC A;  1PVG A;  4YKY A;  2YEA A;  2YEJ A;  1GKZ A;  4HZ5 A;  2YKE A;  1UYL A;  4H85 A;  5J71 A;  4ASF A;  4ASB A;  4KP4 A;  4XD8 A;  4AWQ A;  2WI4 A;  5D7R A;  3TTZ A;  4CWS A;  1I5D A;  1YS3 A;  2HHI A;  3B28 A;  3INX A;  4URN A;  1EA6 A;  3LMM A;  3FT8 A;  4O07 A;  4CWT A;  3R91 A;  2YKC A;  1TH8 A;  4U7O A;  1I5B A;  2O1W A;  3CRK A;  1UYE A;  4FPP A;  3T0H A;  4CE3 A;  2CG9 A;  3GIG A;  1YC1 A;  1UYK A;  2WI2 A;  5IN9 A;  1UYC A;  3IED A;  2YE3 A;  4R3M A;  2VCJ A;  3ZKB A;  3QDD A;  2YE4 A;  3GIF A;  3U2D A;  3O0I A;  1I5A A;  2BU8 A;  4V25 A;  1NHJ A;  2Q2E B;  3ZXQ A;  2BU6 A;  2H55 A;  2H8M A;  1Z5B A;  3BMY A;  4JAV A;  4PRX A;  3OWB A;  3Q5J A;  1YES A;  4E00 A;  4L91 A;  4EFU A;  3R4O A;  4CWF A;  4EM7 A;  3ZXO A;  3SL2 A;  3QTF A;  2XJX A;  3EHG A;  4O09 A;  4P8O A;  3Q5L A;  1GJV A;  4CWN A;  4BIZ A;  4HZ0 A;  4LWG A;  1ID0 A;  2YK9 A;  3T1K A;  1MX0 A;  3HYY A;  5IDM A;  1AMW A;  4E72 A;  4JQL A;  2XHR A;  3O6O A;  4DZY A;  4ASG A;  3CYG A;  1TID A;  1US7 A;  4YKW A;  4CWO A;  1Y8N A;  3PEH A;  3R4M A;  2Q8H A;  3TZ0 A;  3EHF A;  4EGK A;  2YGF A;  4YKX A;  4Q20 A;  4NH8 A;  2BZ5 A;  1BKN A;  4ZKI A;  3A0W A;  2BSM A;  4AS9 A;  3B26 A;  4BXI A;  2C1G A;  5CTU A;  4BAE A;  2BT0 A;  5D6P A;  3K60 A;  2WER A;  3K99 A;  1I5C A;  2PNR A;  2YE5 A;  4MB9 A;  4MP2 A;  2XDK A;  5D7C A;  4U7N A;  2XDS A;  1MU5 A;  4L90 A;  5FND A;  4MPN A;  2QG2 A;  2XDX A;  2YEI A;  3R92 A;  4ZVI A;  3LNU A;  5JEN A;  3B24 A;  2FWY A;  3D2R A;  4GEE A;  1U0Z A;  2ZDY A;  3DGE A;  4H81 A;  2VCI A;  2YEG A;  4FCQ A;  4XIT A;  3TZ2 A;  4XCL A;  1TBW A;  1UYG A;  5CF0 A;  2FXS A;  4XCJ A;  4XTJ A;  4E02 A;  3FT5 A;  3HZ5 A;  3D0B A;  1QY8 A;  3VHA A;  5M4M A;  2QFO A;  4I5S A;  2CH4 A;  3GIE A;  5GGZ A;  4B7P A;  4O0B A;  2XX5 A;  4XC0 A;  4R1F A;  3RLP A;  4GQT A;  4KQV A;  3TZ5 A;  2ZKJ A;  3EKR A;  3HYZ A;  4H7Q A;  4LWE A;  1BGQ A;  5CTX A;  1ZXN A;  3C11 A;  2WI7 A;  2YEF A;  3H80 A;  5D6Q A;  1Y8O A;  4YKR A;  1H7U A;  1UY7 A;  1YSR A;  1B3Q A;  3Q5K A;  2JKI A;  1F51 A;  1L0O A;  2XHX A;  5M4K A;  2YE7 A;  2QG0 A;  4QPK A;  1QZR A;  4MOT A;  4NH9 A;  2BU7 A;  2BYH A;  4KTN A;  4URO A;  4JAS A;  4FCP A;  4GCZ A;  4CE2 A;  1THN A;  3ZM7 A;  3C0E A;  3RKZ A;  2YEH A;  1Z5C A;  3CGZ A;  4NH7 A;  3T10 A;  4AWO A;  2WEQ A;  2HKJ A;  4W7T A;  1UYI A;  2BTZ A;  3NMQ A;  1TIL A;  4BIU A;  2BU2 A;  1YT2 A;  4EFT A;  4BQJ A;  2WI1 A;  2UWD A;  4HXW A;  5L3J A;  1H7S A;  5CTY A;  3OMU A;  4URM A;  3CWV A;  1I58 A;  2JJC A;  3R4P A;  1Y4S A;  1TC0 A;  5FNC A;  4MPE A;  4MPC A;  1TC6 A;  1UYD A;  1YSZ A;  3G75 A;  3EHH A;  4LWI A;  3D36 A;  5M4N A;  5M4E A;  3H4L A;  2IWS A;  3PEJ A;  4MP7 A;  4LP0 A;  2Q8F A;  1KZN A;  4I3H A;  2IWU A;  5C93 A;  1NHH A;  4YKZ A;  2BU5 A;  5CPH A;  2YEE A;  4FMT A;  2FTK A;  2XD6 A;  2BRC A;  4CWQ A;  4CWP A;  4FCR A;  4U93 A;  1B63 A;  3JZ3 A;  1A4H A;  4B6C A;  2GQP A;  2YGE A;  3HEK A;  2YKJ A;  2WI3 A;  1Y4U A;  1AH8 A;  2IOQ A;  1Z5A A;  3OPD A;  2YJX A;  5F5R A;  2YGA A;  4DUH A;  3VAD A;  5J6A A;  2YKI A;  5FNF A;  4XKO A;  4XKA A;  2K5B A;  2CGF A;  3G7E A;  2VW5 A;  2XX4 A;  1IXM A;  5M4P A;  1ZWH A;  1UYH A;  4XE2 A;  3HHU A;  3FV5 A;  3VHC A;  4MBC A;  1UYM A;  1YT1 A;  4KSH A;  5BOD A;  3LPS A;  4JAU A;  1ZXM A;  2E0A A;  4HY1 A;  3TUH A;  5F3K A;  2Q8G A;  1YET A;  4O05 A;  1YER A;  3EHJ A;  4HYP A;  1KIJ A;  3CGY A;  4XIQ A;  2CCS A;  4PU9 A;  3VHD A;  1I59 A;  1AH6 A;  2BRE A;  1UY8 A;  1YC4 A;  2YKB A;  4KSG A;  2YJW A;  4R3A A;  3T0Z A;  3A0Y A;  3RLR A;  2ZBK B;  1ZW9 A;  5IDJ A;  3U67 A;  3HZ1 A;  2CCT A;  3GIG B;  4HXZ A;  3T2S A;  3K98 A;  4L94 A;  4EGH A;  2XDU A;  4L8Z A;  4WUD A;  3CRL A;  2XHT A;  2YI5 A;  2XAB A;  2YEB A;  2WEP A;  1B62 A;  4YKQ A;  4LPB A;  2XCM A;  5D7D A;  5M4H A;  4E01 A;  2AKP A;  2O1U A;  4WUB A;  2EXL A;  1YT0 A;  4QPJ A;  4BQG A;  2YI6 A;  2HCH A;  4XDM A;  2FYP A;  4XIP A;  5BOC A;  4GFN A;  3BM9 A;  5FWK A;  2C2A A;  3OW6 A;  3O2F A;  2WI5 A;  4V26 A;  1UYF A;  3EKO A;  3K97 A;  3A0R A;  2GFD A;  1BXD A;  1AM1 A;  2YK2 A;  1AJ6 A;  1UY6 A;  2O1V A;  4WUC A;  4L93 A;  1S14 A;  2FWZ A;  4AWP A;  1UY9 A;  3KE6 A;  1OSF A;  3TZ4 A;  4K4O A;  2YE6 A;  3WHA A;  4O04 A;  1R62 A;  4KFG A;  5CTW A;  4PL9 A;  3A0X A;  1QYE A;  2IWX A;  2CCU A;  2IOP A;  1U2O A;  4YKT A;  4ASA A;  2YI0 A;  2ESA A;  3WQ9 A;  3RLQ A;  4LWF A;  4X9L A;  3B25 A;  4EEH A;  2YE9 A;  4GT8 A;  1Z59 A;  4CE1 A;  4XIR A;  4URL A;  4YKU A;  1BYQ A;  4PRV A;  2XX2 A;  2YE2 A;  1YC3 A;  2XJJ A;  4EMV A;  4GGL A;  4P7A A;  2BYI A;  2WI6 A;  2YEC A;  3ZKD A;  3A0Z A;  4EGI A;  2XK2 A;  3U2K A;  3A0T A;  3G7B A;  4HYM A;  2Q8I A; 
#chains in the Genus database with same CATH homology
 2ZDX A;  2YE8 A;  2XJG A;  4XKK A;  2QF6 A;  1Y8P A;  3INW A;  2YI7 A;  3MNR P;  1JM6 A;  1EI1 A;  2HG1 A;  2IOR A;  4CWR A;  2YED A;  3OWD A;  2XDL A;  1GKX A;  1S16 A;  1NHI A;  3B27 A;  4HY6 A;  3R4N A;  4LWH A;  2VWC A;  1PVG A;  4YKY A;  2YEA A;  2YEJ A;  1GKZ A;  4HZ5 A;  2YKE A;  1UYL A;  4H85 A;  5J71 A;  4ASF A;  4ASB A;  4KP4 A;  4XD8 A;  4AWQ A;  2WI4 A;  5D7R A;  3TTZ A;  4CWS A;  1I5D A;  1YS3 A;  3B28 A;  3INX A;  4URN A;  1EA6 A;  3FT8 A;  4O07 A;  4CWT A;  3R91 A;  2YKC A;  1TH8 A;  4U7O A;  1I5B A;  2O1W A;  3CRK A;  1UYE A;  4FPP A;  3T0H A;  4CE3 A;  2CG9 A;  3GIG A;  1YC1 A;  1UYK A;  2WI2 A;  5IN9 A;  1UYC A;  3IED A;  2YE3 A;  4R3M A;  2VCJ A;  3ZKB A;  3QDD A;  2YE4 A;  3GIF A;  3U2D A;  3O0I A;  1I5A A;  2BU8 A;  4V25 A;  1NHJ A;  2Q2E B;  3ZXQ A;  2BU6 A;  2H55 A;  2H8M A;  1Z5B A;  3BMY A;  4JAV A;  4PRX A;  3OWB A;  3Q5J A;  1YES A;  4E00 A;  4L91 A;  4EFU A;  3R4O A;  4CWF A;  4EM7 A;  3ZXO A;  3SL2 A;  3QTF A;  2XJX A;  3EHG A;  4O09 A;  4P8O A;  3Q5L A;  1GJV A;  4CWN A;  4BIZ A;  4HZ0 A;  4LWG A;  1ID0 A;  2YK9 A;  3T1K A;  1MX0 A;  3HYY A;  5IDM A;  1AMW A;  4JQL A;  2XHR A;  3O6O A;  4DZY A;  4ASG A;  1TID A;  1US7 A;  4YKW A;  4CWO A;  1Y8N A;  3PEH A;  3R4M A;  2Q8H A;  3TZ0 A;  3EHF A;  4EGK A;  2YGF A;  4YKX A;  4Q20 A;  4NH8 A;  2BZ5 A;  1BKN A;  4ZKI A;  3A0W A;  2BSM A;  4AS9 A;  3B26 A;  4BXI A;  5CTU A;  4BAE A;  2BT0 A;  5D6P A;  3K60 A;  2WER A;  3K99 A;  1I5C A;  2PNR A;  2YE5 A;  4MB9 A;  4MP2 A;  2XDK A;  5D7C A;  4U7N A;  2XDS A;  1MU5 A;  4L90 A;  5FND A;  4MPN A;  2QG2 A;  2XDX A;  2YEI A;  3R92 A;  4ZVI A;  3LNU A;  3B24 A;  2FWY A;  3D2R A;  4GEE A;  1U0Z A;  2ZDY A;  3DGE A;  4H81 A;  2VCI A;  2YEG A;  4FCQ A;  4XIT A;  3TZ2 A;  4XCL A;  1TBW A;  1UYG A;  5CF0 A;  2FXS A;  4XCJ A;  4XTJ A;  4E02 A;  3FT5 A;  3HZ5 A;  3D0B A;  1QY8 A;  3VHA A;  5M4M A;  2QFO A;  4I5S A;  2CH4 A;  3GIE A;  5GGZ A;  4B7P A;  4O0B A;  2XX5 A;  4XC0 A;  4R1F A;  3RLP A;  4GQT A;  4KQV A;  3TZ5 A;  2ZKJ A;  3EKR A;  3HYZ A;  4H7Q A;  4LWE A;  1BGQ A;  5CTX A;  1ZXN A;  3C11 A;  2WI7 A;  2YEF A;  3H80 A;  5D6Q A;  1Y8O A;  4YKR A;  1H7U A;  1UY7 A;  1YSR A;  1B3Q A;  3Q5K A;  2JKI A;  1L0O A;  2XHX A;  5M4K A;  2YE7 A;  2QG0 A;  4QPK A;  1QZR A;  4MOT A;  4NH9 A;  2BU7 A;  2BYH A;  4KTN A;  4URO A;  4JAS A;  4GCZ A;  4FCP A;  4CE2 A;  1THN A;  3ZM7 A;  3C0E A;  3RKZ A;  2YEH A;  1Z5C A;  3CGZ A;  4NH7 A;  3T10 A;  4AWO A;  2WEQ A;  2HKJ A;  4W7T A;  1UYI A;  2BTZ A;  3NMQ A;  1TIL A;  4BIU A;  2BU2 A;  1YT2 A;  4EFT A;  4BQJ A;  2WI1 A;  2UWD A;  4HXW A;  5L3J A;  1H7S A;  5CTY A;  3OMU A;  4URM A;  3CWV A;  1I58 A;  2JJC A;  3R4P A;  1Y4S A;  1TC0 A;  5FNC A;  4MPE A;  4MPC A;  1TC6 A;  1UYD A;  1YSZ A;  3G75 A;  3EHH A;  4LWI A;  3D36 A;  5M4N A;  5M4E A;  3H4L A;  2IWS A;  3PEJ A;  4MP7 A;  4LP0 A;  2Q8F A;  1KZN A;  4I3H A;  2IWU A;  5C93 A;  1NHH A;  4YKZ A;  2BU5 A;  5CPH A;  2YEE A;  4FMT A;  4CWP A;  2XD6 A;  2BRC A;  4CWQ A;  4FCR A;  4U93 A;  1B63 A;  3JZ3 A;  1A4H A;  4B6C A;  2GQP A;  2YGE A;  3HEK A;  2YKJ A;  2WI3 A;  1Y4U A;  1AH8 A;  2IOQ A;  1Z5A A;  3OPD A;  2YJX A;  5F5R A;  2YGA A;  4DUH A;  3VAD A;  5J6A A;  2YKI A;  5FNF A;  4XKO A;  4XKA A;  2K5B A;  2CGF A;  3G7E A;  2VW5 A;  2XX4 A;  5M4P A;  1ZWH A;  1UYH A;  4XE2 A;  3HHU A;  3FV5 A;  3VHC A;  4MBC A;  1UYM A;  1YT1 A;  4KSH A;  5BOD A;  3LPS A;  4JAU A;  1ZXM A;  2E0A A;  4HY1 A;  3TUH A;  5F3K A;  2Q8G A;  1YET A;  4O05 A;  1YER A;  3EHJ A;  4HYP A;  1KIJ A;  3CGY A;  4XIQ A;  2CCS A;  4PU9 A;  3VHD A;  1I59 A;  1AH6 A;  2BRE A;  1UY8 A;  1YC4 A;  2YKB A;  4KSG A;  2YJW A;  4R3A A;  3T0Z A;  3A0Y A;  3RLR A;  2ZBK B;  1ZW9 A;  5IDJ A;  3U67 A;  3HZ1 A;  2CCT A;  3GIG B;  4HXZ A;  3T2S A;  3K98 A;  4L94 A;  4EGH A;  2XDU A;  4L8Z A;  4WUD A;  3CRL A;  2XHT A;  2YI5 A;  2XAB A;  2YEB A;  2WEP A;  1B62 A;  4YKQ A;  4LPB A;  2XCM A;  5D7D A;  5M4H A;  4E01 A;  2AKP A;  2O1U A;  4WUB A;  2EXL A;  1YT0 A;  4QPJ A;  4BQG A;  2YI6 A;  2HCH A;  4XDM A;  2FYP A;  4XIP A;  5BOC A;  4GFN A;  3BM9 A;  5FWK A;  2C2A A;  3OW6 A;  3O2F A;  2WI5 A;  4V26 A;  1UYF A;  3EKO A;  3K97 A;  3A0R A;  2GFD A;  1BXD A;  1AM1 A;  2YK2 A;  1AJ6 A;  1UY6 A;  2O1V A;  4WUC A;  4L93 A;  1S14 A;  2FWZ A;  4AWP A;  1UY9 A;  3KE6 A;  1OSF A;  3TZ4 A;  4K4O A;  2YE6 A;  3WHA A;  4O04 A;  1R62 A;  4KFG A;  5CTW A;  4PL9 A;  3A0X A;  1QYE A;  2IWX A;  2CCU A;  2IOP A;  1U2O A;  4YKT A;  4ASA A;  2YI0 A;  2ESA A;  3WQ9 A;  3RLQ A;  4LWF A;  4X9L A;  3B25 A;  4EEH A;  2YE9 A;  4GT8 A;  1Z59 A;  4CE1 A;  4XIR A;  4URL A;  4YKU A;  1BYQ A;  4PRV A;  2XX2 A;  2YE2 A;  1YC3 A;  2XJJ A;  4EMV A;  4GGL A;  4P7A A;  2BYI A;  2WI6 A;  2YEC A;  3ZKD A;  3A0Z A;  4EGI A;  2XK2 A;  3U2K A;  3A0T A;  3G7B A;  4HYM A;  2Q8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...