1QYEA

Crystal structure of the n-domain of the er hsp90 chaperone grp94 in complex with 2-chlorodideoxyadenosine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
266
structure length
225
Chain Sequence
KSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal Domain of GRP94. Basis for Ligand Specificity and Regulation
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 70
structure length 225
sequence length 266
ec nomenclature
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1qyeA00
4LWHA 2YEBA 2YEFA 3C11A 2WI1A 4CWQA 4E01A 4KFGA 1UYKA 4MPCA 2FXSA 3INWA 1UYFA 4PRXA 3RLQA 3T0HA 1BKNA 2IWXA 4U7NA 1B63A 5C93A 1Z5AA 3RLPA 2ESAA 1I58A 4XD8A 5D7CA 4P7AA 2BU6A 1QZRA 1H7SA 4CWSA 3OMUA 3H4LA 2JJCA 2YI7A 3B28A 3HHUA 4XE2A 1UYMA 3SL2A 4HYMA 1U0ZA 2YI6A 2XDXA 1YC3A 2XDKA 4KP4A 5IN9A 1B3QA 5GGZA 4DUHA 1I5DA 3INXA 3FV5A 3ZM7A 2VCIA 2BU5A 2CCSA 4AWQA 2IWUA 4CWTA 1Z5BA 2YEAA 1UY8A 3U2DA 1PVGA 3R4PA 3U2KA 3K98A 5D6PA 1KIJA 2BTZA 4XCJA 4B7PA 5BOCA 1ZW9A 4FCPA 3A0TA 1Z59A 4JAUA 1YS3A 4L93A 2YEIA 3D0BA 3ZKBA 4XC0A 2FYPA 2XK2A 2K5BA 4WUCA 5BODA 3D2RA 4ZKIA 3O6OA 2BU7A 4YKZA 4LWGA 1YT2A 4O09A 3O2FA 4UROA 4CWFA 4EGIA 3DGEA 2YGAA 5CPHA 4GGLA 4URLA 1UY7A 2XDUA 1OSFA 4GEEA 1TC6A 4XKKA 5CF0A 1Y8OA 3BM9A 2XJJA 1A4HA 3QDDA 1L0OA 1UYIA 4FCRA 2QFOA 4URMA 1US7A 1BGQA 1R62A 2YE5A 1YSRA 3MNRP 2JKIA 2YGEA 5F3KA 2XX4A 4YKTA 3R4NA 1YT0A 4KTNA 4KSGA 4PL9A 2XCMA 1YC1A 4R1FA 5M4MA 4MB9A 4L94A 1YERA 4MP7A 2YKBA 3U67A 1NHHA 4YKWA 5FNFA 5FNCA 3T1KA 3EHHA 2WEPA 5F5RA 1Y4UA 2CG9A 4NH7A 4E00A 1H7UA 4LWEA 5FWKA 3TUHA 2WERA 3Q5KA 1Y8PA 2CCUA 3K60A 3OWBA 4FPPA 1GJVA 2YKEA 4PRVA 3GIFA 3B26A 4R3AA 1YC4A 1Z5CA 1GKXA 2IOQA 3HYYA 2C2AA 3K99A 3CGZA 4GFNA 4ASFA 4EMVA 2YE4A 4O04A 4AWPA 1UYGA 2BT0A 1AH6A 3A0WA 4CE3A 3IEDA 4YKYA 2VWCA 3JZ3A 2XJXA 1YETA 4P8OA 4PU9A 3EKRA 4XIQA 1UYLA 2YEEA 5CTWA 1GKZA 1Y8NA 2ZKJA 1YSZA 3CRKA 4BQJA 3HZ5A 5IDJA 1I59A 2UWDA 1YT1A 4DZYA 4XIPA 4V25A 2PNRA 2HG1A 2CCTA 4O0BA 4H85A 3GIEA 3B27A 3TZ2A 1EA6A 1TILA 4B6CA 4MOTA 4W7TA 5M4HA 2BU8A 4I5SA 4MPNA 3WHAA 1TIDA 3TTZA 4MPEA 2GQPA 3Q5LA 4GT8A 4XITA 1BYQA 3ZXQA 3CWVA 1TH8A 1MU5A 2WI2A 2XABA 1AM1A 3VHCA 4BIZA 3T0ZA 2YE8A 4R3MA 3LNUA 2Q8HA 4GCZA 2XHRA 2BRCA 4EM7A 2WI4A 4HY1A 2XHXA 1MX0A 3PEHA 2YE3A 4HXZA 3OW6A 2BZ5A 5M4KA 3EKOA 4XCLA 2YE6A 1AMWA 2BU2A 4K4OA 4L91A 4ASGA 2YEJA 1BXDA 2YE2A 2YE7A 3A0RA 4MBCA 1ZXMA 4LPBA 4BQGA 2YE9A 3KE6A 1UYHA 4QPJA 4XIRA 5J6AA 2WI5A 3G7EA 2Q8IA 3R4MA 3EHGA 2CH4A 1S16A 4HZ5A 1U2OA 1THNA 2GFDA 3R4OA 4O05A 3RLRA 2WI3A 2YK2A 1NHJA 4ASBA 3WQ9A 2IOPA 2ZDXA 4XTJA 4E02A 2Q2EB 2YJXA 4BAEA 2HKJA 3Q5JA 2XD6A 1I5CA 2YKJA 4NH9A 4X9LA 5D7DA 2H55A 4JQLA 3OWDA 5FNDA 4EFTA 4I3HA 2ZBKB 4YKXA 3TZ0A 4CE2A 5M4EA 2BYHA 2FWZA 2HCHA 1AH8A 3NMQA 4JAVA 3B24A 2XX5A 3EHJA 4EGHA 5CTXA 3ZKDA 1B62A 4EGKA 4CWOA 4L8ZA 1I5AA 5IDMA 4FMTA 5CTUA 3K97A 4URNA 2E0AA 4JASA 3G7BA 1EI1A 5D7RA 4CWRA 4LP0A 4XKOA 5M4NA 2YKCA 2QG0A 4H7QA 3D36A 1UY9A 1UY6A 3TZ5A 1ZXNA 2AKPA 4AS9A 4H81A 2IORA 4YKRA 1I5BA 2EXLA 2VW5A 4HXWA 4AWOA 4XKAA 2BSMA 2WI6A 4QPKA 2H8MA 2XX2A 4XDMA 2IWSA 4HZ0A 3T10A 2YGFA 2O1VA 2YEGA 2XDLA 3B25A 2O1UA 3OPDA 4WUDA 2Q8FA 4CE1A 1ID0A 1TBWA 3RKZA 4U93A 2YJWA 3A0XA 2YI5A 2YKIA 4YKQA 1UYEA 4KQVA 3A0YA 4O07A 1YESA 1Y4SA 3BMYA 3GIGA 2CGFA 5L3JA 3C0EA 3HYZA 2VCJA 5J71A 2BREA 3EHFA 3QTFA 1S14A 2YI0A 1NHIA 1UYDA 2WEQA 4GQTA 1QY8A 4EEHA 4CWPA 5D6QA 2ZDYA 2YEDA 4L90A 3CGYA 3FT8A 1TC0A 4ZVIA 3CRLA 3T2SA 2XHTA 3A0ZA 3VHAA 1JM6A 5CTYA 4V26A 2WI7A 3TZ4A 2FWYA 3FT5A 3LPSA 4MP2A 1KZNA 4BIUA 3GIGB 4LWFA 4LWIA 1QYEA 4HY6A 2YK9A 4YKUA 5M4PA 3ZXOA 4WUBA 4HYPA 4KSHA 1ZWHA 3VADA 2XDSA 2QF6A 1UYCA 2QG2A 4Q20A 4U7OA 1AJ6A 4EFUA 2Q8GA 3VHDA 2O1WA 3O0IA 4NH8A 2YEHA 4FCQA 3R91A 3HZ1A 4CWNA 3R92A 3PEJA 4ASAA 4BXIA 3HEKA 3G75A 2BYIA 2XJGA 2YECA 3H80A
chains in the Genus database with same CATH superfamily
4LWHA 2YEBA 2YEFA 3C11A 2WI1A 4CWQA 4E01A 4KFGA 1UYKA 4MPCA 2FXSA 3INWA 1UYFA 4PRXA 3RLQA 3T0HA 1BKNA 2IWXA 4U7NA 1B63A 5C93A 1Z5AA 3RLPA 2ESAA 1I58A 3S5TA 4XD8A 5D7CA 4P7AA 2BU6A 1QZRA 1H7SA 4CWSA 3OMUA 3CYGA 3H4LA 2C1IA 2JJCA 2YI7A 3B28A 3HHUA 4XE2A 1UYMA 3SL2A 4HYMA 1U0ZA 2YI6A 2XDXA 1YC3A 2XDKA 4KP4A 5IN9A 1B3QA 5GGZA 4DUHA 1I5DA 3INXA 3FV5A 3ZM7A 2VCIA 2BU5A 2CCSA 4AWQA 2IWUA 4CWTA 1Z5BA 2YEAA 1UY8A 3U2DA 1PVGA 3R4PA 3U2KA 3K98A 5D6PA 1KIJA 2BTZA 4XCJA 4B7PA 5BOCA 1ZW9A 4FCPA 3A0TA 1Z59A 4JAUA 1YS3A 4L93A 2YEIA 3D0BA 3ZKBA 4XC0A 2FYPA 2XK2A 2K5BA 4WUCA 5BODA 3D2RA 4ZKIA 3O6OA 2BU7A 4YKZA 4LWGA 1YT2A 4O09A 3O2FA 4UROA 4CWFA 4EGIA 3DGEA 2YGAA 5CPHA 4GGLA 4URLA 1UY7A 2XDUA 1OSFA 4GEEA 1TC6A 4XKKA 5CF0A 1Y8OA 3BM9A 2XJJA 1A4HA 3QDDA 1L0OA 1UYIA 4FCRA 2QFOA 4URMA 2HHIA 1US7A 1BGQA 1R62A 2YE5A 1YSRA 3MNRP 2JKIA 2YGEA 5F3KA 2XX4A 4YKTA 3R4NA 1YT0A 4KTNA 4KSGA 4PL9A 2XCMA 1YC1A 4R1FA 5M4MA 4MB9A 4L94A 1YERA 4MP7A 2YKBA 3U67A 1NHHA 4YKWA 5FNFA 5FNCA 3T1KA 3EHHA 2WEPA 5F5RA 1Y4UA 2CG9A 4NH7A 4E00A 1H7UA 4LWEA 5FWKA 3TUHA 2WERA 3Q5KA 1Y8PA 2CCUA 3K60A 3OWBA 4FPPA 1GJVA 2YKEA 4PRVA 3GIFA 3B26A 4R3AA 1YC4A 1Z5CA 1GKXA 2IOQA 3HYYA 2C2AA 3K99A 3CGZA 4GFNA 4ASFA 4EMVA 2YE4A 4O04A 4AWPA 1UYGA 2BT0A 1AH6A 3A0WA 4CE3A 3IEDA 4YKYA 2VWCA 3JZ3A 2XJXA 1YETA 4P8OA 4PU9A 3EKRA 4XIQA 1UYLA 2YEEA 5CTWA 1F51A 1GKZA 1Y8NA 2ZKJA 1YSZA 3CRKA 4BQJA 3HZ5A 2FTKA 5IDJA 1I59A 2UWDA 1YT1A 4DZYA 4XIPA 4V25A 2PNRA 2HG1A 2CCTA 4O0BA 4H85A 3GIEA 3B27A 3TZ2A 1EA6A 1TILA 4B6CA 4MOTA 4W7TA 5M4HA 2BU8A 4I5SA 4MPNA 3WHAA 1TIDA 3TTZA 4MPEA 2GQPA 3Q5LA 4GT8A 4XITA 1BYQA 3ZXQA 3CWVA 1TH8A 1MU5A 2WI2A 2XABA 1AM1A 1IXMA 3VHCA 4BIZA 3T0ZA 2YE8A 4R3MA 3LNUA 2Q8HA 4GCZA 2XHRA 2BRCA 5JENA 4EM7A 3LMMA 2WI4A 4HY1A 2XHXA 1MX0A 3PEHA 2YE3A 4HXZA 3OW6A 2BZ5A 5M4KA 3EKOA 4XCLA 2YE6A 1AMWA 2BU2A 4K4OA 4L91A 4ASGA 2YEJA 1BXDA 2YE2A 2YE7A 3A0RA 4MBCA 1ZXMA 4LPBA 4BQGA 2YE9A 3KE6A 1UYHA 4QPJA 4XIRA 5J6AA 2WI5A 3G7EA 2Q8IA 3R4MA 3EHGA 2CH4A 1S16A 4HZ5A 1U2OA 1THNA 2GFDA 3R4OA 4O05A 3RLRA 2WI3A 2YK2A 1NHJA 4ASBA 3WQ9A 2IOPA 2ZDXA 4E72A 4XTJA 4E02A 2Q2EB 2YJXA 4BAEA 2HKJA 3Q5JA 2XD6A 1I5CA 2YKJA 4NH9A 4X9LA 5D7DA 2H55A 4JQLA 3OWDA 5FNDA 4EFTA 4I3HA 2ZBKB 4YKXA 3TZ0A 4CE2A 5M4EA 2BYHA 2FWZA 2HCHA 1AH8A 3NMQA 4JAVA 3B24A 2XX5A 3EHJA 4EGHA 5CTXA 3ZKDA 1B62A 4EGKA 4CWOA 4L8ZA 1I5AA 5IDMA 4FMTA 5CTUA 3K97A 4URNA 2E0AA 4JASA 3G7BA 1EI1A 5D7RA 4CWRA 2C1GA 4LP0A 4XKOA 5M4NA 2YKCA 2QG0A 4H7QA 3D36A 1UY9A 1UY6A 3TZ5A 1ZXNA 2AKPA 4AS9A 4H81A 2IORA 4YKRA 1I5BA 2EXLA 2VW5A 4HXWA 4AWOA 4XKAA 2BSMA 2WI6A 4QPKA 2H8MA 2XX2A 4XDMA 2IWSA 4HZ0A 3T10A 2YGFA 2O1VA 2YEGA 2XDLA 3B25A 2O1UA 3OPDA 4WUDA 2Q8FA 4CE1A 1ID0A 1TBWA 3RKZA 4U93A 2YJWA 3A0XA 2YI5A 2YKIA 4YKQA 1UYEA 4KQVA 3A0YA 4O07A 1YESA 1Y4SA 3BMYA 3GIGA 2CGFA 5L3JA 3C0EA 3HYZA 2VCJA 5J71A 2BREA 3EHFA 3QTFA 1S14A 2YI0A 1NHIA 1UYDA 2WEQA 4GQTA 1QY8A 4EEHA 4CWPA 5D6QA 2ZDYA 2YEDA 4L90A 3CGYA 3FT8A 1TC0A 4ZVIA 3CRLA 3T2SA 2XHTA 3A0ZA 3VHAA 1JM6A 5CTYA 4V26A 2WI7A 3TZ4A 2FWYA 3FT5A 3LPSA 4MP2A 1KZNA 4BIUA 3GIGB 4LWFA 4LWIA 1QYEA 4HY6A 2YK9A 4YKUA 5M4PA 3ZXOA 4WUBA 4HYPA 4KSHA 1ZWHA 3VADA 2XDSA 2QF6A 1UYCA 2QG2A 4Q20A 4U7OA 1AJ6A 4EFUA 2Q8GA 3VHDA 2O1WA 3O0IA 4NH8A 2YEHA 4FCQA 3R91A 3HZ1A 4CWNA 3R92A 3PEJA 4ASAA 4BXIA 3HEKA 3G75A 2BYIA 2XJGA 2YECA 3H80A
chains in the Genus database with same CATH topology
4LWHA 2YEBA 2YEFA 3C11A 2WI1A 4CWQA 4E01A 4KFGA 1UYKA 4MPCA 2FXSA 3INWA 1UYFA 4PRXA 3RLQA 3T0HA 1BKNA 2IWXA 4U7NA 1B63A 5C93A 1Z5AA 3RLPA 2ESAA 1I58A 4XD8A 5D7CA 4P7AA 2BU6A 1QZRA 1H7SA 4CWSA 3OMUA 3H4LA 2JJCA 2YI7A 3B28A 3HHUA 4XE2A 1UYMA 3SL2A 4HYMA 1U0ZA 2YI6A 2XDXA 1YC3A 2XDKA 4KP4A 5IN9A 1B3QA 5GGZA 4DUHA 1I5DA 3INXA 3FV5A 3ZM7A 2VCIA 2BU5A 2CCSA 4AWQA 2IWUA 4CWTA 1Z5BA 2YEAA 1UY8A 3U2DA 1PVGA 3R4PA 3U2KA 3K98A 5D6PA 1KIJA 2BTZA 4XCJA 4B7PA 5BOCA 1ZW9A 4FCPA 3A0TA 1Z59A 4JAUA 1YS3A 4L93A 2YEIA 3D0BA 3ZKBA 4XC0A 2FYPA 2XK2A 2K5BA 4WUCA 5BODA 3D2RA 4ZKIA 3O6OA 2BU7A 4YKZA 4LWGA 1YT2A 4O09A 3O2FA 4UROA 4CWFA 4EGIA 3DGEA 2YGAA 5CPHA 4GGLA 4URLA 1UY7A 2XDUA 1OSFA 4GEEA 1TC6A 4XKKA 5CF0A 1Y8OA 3BM9A 2XJJA 1A4HA 3QDDA 1L0OA 1UYIA 4FCRA 2QFOA 4URMA 1US7A 1BGQA 1R62A 2YE5A 1YSRA 3MNRP 2JKIA 2YGEA 5F3KA 2XX4A 4YKTA 3R4NA 1YT0A 4KTNA 4KSGA 4PL9A 2XCMA 1YC1A 4R1FA 5M4MA 4MB9A 4L94A 1YERA 4MP7A 2YKBA 3U67A 1NHHA 4YKWA 5FNFA 5FNCA 3T1KA 3EHHA 2WEPA 5F5RA 1Y4UA 2CG9A 4NH7A 4E00A 1H7UA 4LWEA 5FWKA 3TUHA 2WERA 3Q5KA 1Y8PA 2CCUA 3K60A 3OWBA 4FPPA 1GJVA 2YKEA 4PRVA 3GIFA 3B26A 4R3AA 1YC4A 1Z5CA 1GKXA 2IOQA 3HYYA 2C2AA 3K99A 3CGZA 4GFNA 4ASFA 4EMVA 2YE4A 4O04A 4AWPA 1UYGA 2BT0A 1AH6A 3A0WA 4CE3A 3IEDA 4YKYA 2VWCA 3JZ3A 2XJXA 1YETA 4P8OA 4PU9A 3EKRA 4XIQA 1UYLA 2YEEA 5CTWA 1GKZA 1Y8NA 2ZKJA 1YSZA 3CRKA 4BQJA 3HZ5A 5IDJA 1I59A 2UWDA 1YT1A 4DZYA 4XIPA 4V25A 2PNRA 2HG1A 2CCTA 4O0BA 4H85A 3GIEA 3B27A 3TZ2A 1EA6A 1TILA 4B6CA 4MOTA 4W7TA 5M4HA 2BU8A 4I5SA 4MPNA 3WHAA 1TIDA 3TTZA 4MPEA 2GQPA 3Q5LA 4GT8A 4XITA 1BYQA 3ZXQA 3CWVA 1TH8A 1MU5A 2WI2A 2XABA 1AM1A 3VHCA 4BIZA 3T0ZA 2YE8A 4R3MA 3LNUA 2Q8HA 4GCZA 2XHRA 2BRCA 4EM7A 2WI4A 4HY1A 2XHXA 1MX0A 3PEHA 2YE3A 4HXZA 3OW6A 2BZ5A 5M4KA 3EKOA 4XCLA 2YE6A 1AMWA 2BU2A 4K4OA 4L91A 4ASGA 2YEJA 1BXDA 2YE2A 2YE7A 3A0RA 4MBCA 1ZXMA 4LPBA 4BQGA 2YE9A 3KE6A 1UYHA 4QPJA 4XIRA 5J6AA 2WI5A 3G7EA 2Q8IA 3R4MA 3EHGA 2CH4A 1S16A 4HZ5A 1U2OA 1THNA 2GFDA 3R4OA 4O05A 3RLRA 2WI3A 2YK2A 1NHJA 4ASBA 3WQ9A 2IOPA 2ZDXA 4XTJA 4E02A 2Q2EB 2YJXA 4BAEA 2HKJA 3Q5JA 2XD6A 1I5CA 2YKJA 4NH9A 4X9LA 5D7DA 2H55A 4JQLA 3OWDA 5FNDA 4EFTA 4I3HA 2ZBKB 4YKXA 3TZ0A 4CE2A 5M4EA 2BYHA 2FWZA 2HCHA 1AH8A 3NMQA 4JAVA 3B24A 2XX5A 3EHJA 4EGHA 5CTXA 3ZKDA 1B62A 4EGKA 4CWOA 4L8ZA 1I5AA 5IDMA 4FMTA 5CTUA 3K97A 4URNA 2E0AA 4JASA 3G7BA 1EI1A 5D7RA 4CWRA 4LP0A 4XKOA 5M4NA 2YKCA 2QG0A 4H7QA 3D36A 1UY9A 1UY6A 3TZ5A 1ZXNA 2AKPA 4AS9A 4H81A 2IORA 4YKRA 1I5BA 2EXLA 2VW5A 4HXWA 4AWOA 4XKAA 2BSMA 2WI6A 4QPKA 2H8MA 2XX2A 4XDMA 2IWSA 4HZ0A 3T10A 2YGFA 2O1VA 2YEGA 2XDLA 3B25A 2O1UA 3OPDA 4WUDA 2Q8FA 4CE1A 1ID0A 1TBWA 3RKZA 4U93A 2YJWA 3A0XA 2YI5A 2YKIA 4YKQA 1UYEA 4KQVA 3A0YA 4O07A 1YESA 1Y4SA 3BMYA 3GIGA 2CGFA 5L3JA 3C0EA 3HYZA 2VCJA 5J71A 2BREA 3EHFA 3QTFA 1S14A 2YI0A 1NHIA 1UYDA 2WEQA 4GQTA 1QY8A 4EEHA 4CWPA 5D6QA 2ZDYA 2YEDA 4L90A 3CGYA 3FT8A 1TC0A 4ZVIA 3CRLA 3T2SA 2XHTA 3A0ZA 3VHAA 1JM6A 5CTYA 4V26A 2WI7A 3TZ4A 2FWYA 3FT5A 3LPSA 4MP2A 1KZNA 4BIUA 3GIGB 4LWFA 4LWIA 1QYEA 4HY6A 2YK9A 4YKUA 5M4PA 3ZXOA 4WUBA 4HYPA 4KSHA 1ZWHA 3VADA 2XDSA 2QF6A 1UYCA 2QG2A 4Q20A 4U7OA 1AJ6A 4EFUA 2Q8GA 3VHDA 2O1WA 3O0IA 4NH8A 2YEHA 4FCQA 3R91A 3HZ1A 4CWNA 3R92A 3PEJA 4ASAA 4BXIA 3HEKA 3G75A 2BYIA 2XJGA 2YECA 3H80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LWH A;  2YEB A;  2YEF A;  3C11 A;  2WI1 A;  4CWQ A;  4E01 A;  4KFG A;  1UYK A;  4MPC A;  2FXS A;  3INW A;  1UYF A;  4PRX A;  3RLQ A;  3T0H A;  1BKN A;  2IWX A;  4U7N A;  1B63 A;  5C93 A;  1Z5A A;  3RLP A;  2ESA A;  1I58 A;  4XD8 A;  5D7C A;  4P7A A;  2BU6 A;  1QZR A;  1H7S A;  4CWS A;  3OMU A;  3H4L A;  2JJC A;  2YI7 A;  3B28 A;  3HHU A;  4XE2 A;  1UYM A;  3SL2 A;  4HYM A;  1U0Z A;  2YI6 A;  2XDX A;  1YC3 A;  2XDK A;  4KP4 A;  5IN9 A;  1B3Q A;  5GGZ A;  4DUH A;  1I5D A;  3INX A;  3FV5 A;  3ZM7 A;  2VCI A;  2BU5 A;  2CCS A;  4AWQ A;  2IWU A;  4CWT A;  1Z5B A;  2YEA A;  1UY8 A;  3U2D A;  1PVG A;  3R4P A;  3U2K A;  3K98 A;  5D6P A;  1KIJ A;  2BTZ A;  4XCJ A;  4B7P A;  5BOC A;  1ZW9 A;  4FCP A;  3A0T A;  1Z59 A;  4JAU A;  1YS3 A;  4L93 A;  2YEI A;  3D0B A;  3ZKB A;  4XC0 A;  2FYP A;  2XK2 A;  2K5B A;  4WUC A;  5BOD A;  3D2R A;  4ZKI A;  3O6O A;  2BU7 A;  4YKZ A;  4LWG A;  1YT2 A;  4O09 A;  3O2F A;  4URO A;  4CWF A;  4EGI A;  3DGE A;  2YGA A;  5CPH A;  4GGL A;  4URL A;  1UY7 A;  2XDU A;  1OSF A;  4GEE A;  1TC6 A;  4XKK A;  5CF0 A;  1Y8O A;  3BM9 A;  2XJJ A;  1A4H A;  3QDD A;  1L0O A;  1UYI A;  4FCR A;  2QFO A;  4URM A;  1US7 A;  1BGQ A;  1R62 A;  2YE5 A;  1YSR A;  3MNR P;  2JKI A;  2YGE A;  5F3K A;  2XX4 A;  4YKT A;  3R4N A;  1YT0 A;  4KTN A;  4KSG A;  4PL9 A;  2XCM A;  1YC1 A;  4R1F A;  5M4M A;  4MB9 A;  4L94 A;  1YER A;  4MP7 A;  2YKB A;  3U67 A;  1NHH A;  4YKW A;  5FNF A;  5FNC A;  3T1K A;  3EHH A;  2WEP A;  5F5R A;  1Y4U A;  2CG9 A;  4NH7 A;  4E00 A;  1H7U A;  4LWE A;  5FWK A;  3TUH A;  2WER A;  3Q5K A;  1Y8P A;  2CCU A;  3K60 A;  3OWB A;  4FPP A;  1GJV A;  2YKE A;  4PRV A;  3GIF A;  3B26 A;  4R3A A;  1YC4 A;  1Z5C A;  1GKX A;  2IOQ A;  3HYY A;  2C2A A;  3K99 A;  3CGZ A;  4GFN A;  4ASF A;  4EMV A;  2YE4 A;  4O04 A;  4AWP A;  1UYG A;  2BT0 A;  1AH6 A;  3A0W A;  4CE3 A;  3IED A;  4YKY A;  2VWC A;  3JZ3 A;  2XJX A;  1YET A;  4P8O A;  4PU9 A;  3EKR A;  4XIQ A;  1UYL A;  2YEE A;  5CTW A;  1GKZ A;  1Y8N A;  2ZKJ A;  1YSZ A;  3CRK A;  4BQJ A;  3HZ5 A;  5IDJ A;  1I59 A;  2UWD A;  1YT1 A;  4DZY A;  4XIP A;  4V25 A;  2PNR A;  2HG1 A;  2CCT A;  4O0B A;  4H85 A;  3GIE A;  3B27 A;  3TZ2 A;  1EA6 A;  1TIL A;  4B6C A;  4MOT A;  4W7T A;  5M4H A;  2BU8 A;  4I5S A;  4MPN A;  3WHA A;  1TID A;  3TTZ A;  4MPE A;  2GQP A;  3Q5L A;  4GT8 A;  4XIT A;  1BYQ A;  3ZXQ A;  3CWV A;  1TH8 A;  1MU5 A;  2WI2 A;  2XAB A;  1AM1 A;  3VHC A;  4BIZ A;  3T0Z A;  2YE8 A;  4R3M A;  3LNU A;  2Q8H A;  4GCZ A;  2XHR A;  2BRC A;  4EM7 A;  2WI4 A;  4HY1 A;  2XHX A;  1MX0 A;  3PEH A;  2YE3 A;  4HXZ A;  3OW6 A;  2BZ5 A;  5M4K A;  3EKO A;  4XCL A;  2YE6 A;  1AMW A;  2BU2 A;  4K4O A;  4L91 A;  4ASG A;  2YEJ A;  1BXD A;  2YE2 A;  2YE7 A;  3A0R A;  4MBC A;  1ZXM A;  4LPB A;  4BQG A;  2YE9 A;  3KE6 A;  1UYH A;  4QPJ A;  4XIR A;  5J6A A;  2WI5 A;  3G7E A;  2Q8I A;  3R4M A;  3EHG A;  2CH4 A;  1S16 A;  4HZ5 A;  1U2O A;  1THN A;  2GFD A;  3R4O A;  4O05 A;  3RLR A;  2WI3 A;  2YK2 A;  1NHJ A;  4ASB A;  3WQ9 A;  2IOP A;  2ZDX A;  4XTJ A;  4E02 A;  2Q2E B;  2YJX A;  4BAE A;  2HKJ A;  3Q5J A;  2XD6 A;  1I5C A;  2YKJ A;  4NH9 A;  4X9L A;  5D7D A;  2H55 A;  4JQL A;  3OWD A;  5FND A;  4EFT A;  4I3H A;  2ZBK B;  4YKX A;  3TZ0 A;  4CE2 A;  5M4E A;  2BYH A;  2FWZ A;  2HCH A;  1AH8 A;  3NMQ A;  4JAV A;  3B24 A;  2XX5 A;  3EHJ A;  4EGH A;  5CTX A;  3ZKD A;  1B62 A;  4EGK A;  4CWO A;  4L8Z A;  1I5A A;  5IDM A;  4FMT A;  5CTU A;  3K97 A;  4URN A;  2E0A A;  4JAS A;  3G7B A;  1EI1 A;  5D7R A;  4CWR A;  4LP0 A;  4XKO A;  5M4N A;  2YKC A;  2QG0 A;  4H7Q A;  3D36 A;  1UY9 A;  1UY6 A;  3TZ5 A;  1ZXN A;  2AKP A;  4AS9 A;  4H81 A;  2IOR A;  4YKR A;  1I5B A;  2EXL A;  2VW5 A;  4HXW A;  4AWO A;  4XKA A;  2BSM A;  2WI6 A;  4QPK A;  2H8M A;  2XX2 A;  4XDM A;  2IWS A;  4HZ0 A;  3T10 A;  2YGF A;  2O1V A;  2YEG A;  2XDL A;  3B25 A;  2O1U A;  3OPD A;  4WUD A;  2Q8F A;  4CE1 A;  1ID0 A;  1TBW A;  3RKZ A;  4U93 A;  2YJW A;  3A0X A;  2YI5 A;  2YKI A;  4YKQ A;  1UYE A;  4KQV A;  3A0Y A;  4O07 A;  1YES A;  1Y4S A;  3BMY A;  3GIG A;  2CGF A;  5L3J A;  3C0E A;  3HYZ A;  2VCJ A;  5J71 A;  2BRE A;  3EHF A;  3QTF A;  1S14 A;  2YI0 A;  1NHI A;  1UYD A;  2WEQ A;  4GQT A;  1QY8 A;  4EEH A;  4CWP A;  5D6Q A;  2ZDY A;  2YED A;  4L90 A;  3CGY A;  3FT8 A;  1TC0 A;  4ZVI A;  3CRL A;  3T2S A;  2XHT A;  3A0Z A;  3VHA A;  1JM6 A;  5CTY A;  4V26 A;  2WI7 A;  3TZ4 A;  2FWY A;  3FT5 A;  3LPS A;  4MP2 A;  1KZN A;  4BIU A;  3GIG B;  4LWF A;  4LWI A;  1QYE A;  4HY6 A;  2YK9 A;  4YKU A;  5M4P A;  3ZXO A;  4WUB A;  4HYP A;  4KSH A;  1ZWH A;  3VAD A;  2XDS A;  2QF6 A;  1UYC A;  2QG2 A;  4Q20 A;  4U7O A;  1AJ6 A;  4EFU A;  2Q8G A;  3VHD A;  2O1W A;  3O0I A;  4NH8 A;  2YEH A;  4FCQ A;  3R91 A;  3HZ1 A;  4CWN A;  3R92 A;  3PEJ A;  4ASA A;  4BXI A;  3HEK A;  3G75 A;  2BYI A;  2XJG A;  2YEC A;  3H80 A; 
#chains in the Genus database with same CATH topology
 4LWH A;  2YEB A;  2YEF A;  3C11 A;  2WI1 A;  4CWQ A;  4E01 A;  4KFG A;  1UYK A;  4MPC A;  2FXS A;  3INW A;  1UYF A;  4PRX A;  3RLQ A;  3T0H A;  1BKN A;  2IWX A;  4U7N A;  1B63 A;  5C93 A;  1Z5A A;  3RLP A;  2ESA A;  1I58 A;  3S5T A;  4XD8 A;  5D7C A;  4P7A A;  2BU6 A;  1QZR A;  1H7S A;  4CWS A;  3OMU A;  3CYG A;  3H4L A;  2C1I A;  2JJC A;  2YI7 A;  3B28 A;  3HHU A;  4XE2 A;  1UYM A;  3SL2 A;  4HYM A;  1U0Z A;  2YI6 A;  2XDX A;  1YC3 A;  2XDK A;  4KP4 A;  5IN9 A;  1B3Q A;  5GGZ A;  4DUH A;  1I5D A;  3INX A;  3FV5 A;  3ZM7 A;  2VCI A;  2BU5 A;  2CCS A;  4AWQ A;  2IWU A;  4CWT A;  1Z5B A;  2YEA A;  1UY8 A;  3U2D A;  1PVG A;  3R4P A;  3U2K A;  3K98 A;  5D6P A;  1KIJ A;  2BTZ A;  4XCJ A;  4B7P A;  5BOC A;  1ZW9 A;  4FCP A;  3A0T A;  1Z59 A;  4JAU A;  1YS3 A;  4L93 A;  2YEI A;  3D0B A;  3ZKB A;  4XC0 A;  2FYP A;  2XK2 A;  2K5B A;  4WUC A;  5BOD A;  3D2R A;  4ZKI A;  3O6O A;  2BU7 A;  4YKZ A;  4LWG A;  1YT2 A;  4O09 A;  3O2F A;  4URO A;  4CWF A;  4EGI A;  3DGE A;  2YGA A;  5CPH A;  4GGL A;  4URL A;  1UY7 A;  2XDU A;  1OSF A;  4GEE A;  1TC6 A;  4XKK A;  5CF0 A;  1Y8O A;  3BM9 A;  2XJJ A;  1A4H A;  3QDD A;  1L0O A;  1UYI A;  4FCR A;  2QFO A;  4URM A;  2HHI A;  1US7 A;  1BGQ A;  1R62 A;  2YE5 A;  1YSR A;  3MNR P;  2JKI A;  2YGE A;  5F3K A;  2XX4 A;  4YKT A;  3R4N A;  1YT0 A;  4KTN A;  4KSG A;  4PL9 A;  2XCM A;  1YC1 A;  4R1F A;  5M4M A;  4MB9 A;  4L94 A;  1YER A;  4MP7 A;  2YKB A;  3U67 A;  1NHH A;  4YKW A;  5FNF A;  5FNC A;  3T1K A;  3EHH A;  2WEP A;  5F5R A;  1Y4U A;  2CG9 A;  4NH7 A;  4E00 A;  1H7U A;  4LWE A;  5FWK A;  3TUH A;  2WER A;  3Q5K A;  1Y8P A;  2CCU A;  3K60 A;  3OWB A;  4FPP A;  1GJV A;  2YKE A;  4PRV A;  3GIF A;  3B26 A;  4R3A A;  1YC4 A;  1Z5C A;  1GKX A;  2IOQ A;  3HYY A;  2C2A A;  3K99 A;  3CGZ A;  4GFN A;  4ASF A;  4EMV A;  2YE4 A;  4O04 A;  4AWP A;  1UYG A;  2BT0 A;  1AH6 A;  3A0W A;  4CE3 A;  3IED A;  4YKY A;  2VWC A;  3JZ3 A;  2XJX A;  1YET A;  4P8O A;  4PU9 A;  3EKR A;  4XIQ A;  1UYL A;  2YEE A;  5CTW A;  1F51 A;  1GKZ A;  1Y8N A;  2ZKJ A;  1YSZ A;  3CRK A;  4BQJ A;  3HZ5 A;  2FTK A;  5IDJ A;  1I59 A;  2UWD A;  1YT1 A;  4DZY A;  4XIP A;  4V25 A;  2PNR A;  2HG1 A;  2CCT A;  4O0B A;  4H85 A;  3GIE A;  3B27 A;  3TZ2 A;  1EA6 A;  1TIL A;  4B6C A;  4MOT A;  4W7T A;  5M4H A;  2BU8 A;  4I5S A;  4MPN A;  3WHA A;  1TID A;  3TTZ A;  4MPE A;  2GQP A;  3Q5L A;  4GT8 A;  4XIT A;  1BYQ A;  3ZXQ A;  3CWV A;  1TH8 A;  1MU5 A;  2WI2 A;  2XAB A;  1AM1 A;  1IXM A;  3VHC A;  4BIZ A;  3T0Z A;  2YE8 A;  4R3M A;  3LNU A;  2Q8H A;  4GCZ A;  2XHR A;  2BRC A;  5JEN A;  4EM7 A;  3LMM A;  2WI4 A;  4HY1 A;  2XHX A;  1MX0 A;  3PEH A;  2YE3 A;  4HXZ A;  3OW6 A;  2BZ5 A;  5M4K A;  3EKO A;  4XCL A;  2YE6 A;  1AMW A;  2BU2 A;  4K4O A;  4L91 A;  4ASG A;  2YEJ A;  1BXD A;  2YE2 A;  2YE7 A;  3A0R A;  4MBC A;  1ZXM A;  4LPB A;  4BQG A;  2YE9 A;  3KE6 A;  1UYH A;  4QPJ A;  4XIR A;  5J6A A;  2WI5 A;  3G7E A;  2Q8I A;  3R4M A;  3EHG A;  2CH4 A;  1S16 A;  4HZ5 A;  1U2O A;  1THN A;  2GFD A;  3R4O A;  4O05 A;  3RLR A;  2WI3 A;  2YK2 A;  1NHJ A;  4ASB A;  3WQ9 A;  2IOP A;  2ZDX A;  4E72 A;  4XTJ A;  4E02 A;  2Q2E B;  2YJX A;  4BAE A;  2HKJ A;  3Q5J A;  2XD6 A;  1I5C A;  2YKJ A;  4NH9 A;  4X9L A;  5D7D A;  2H55 A;  4JQL A;  3OWD A;  5FND A;  4EFT A;  4I3H A;  2ZBK B;  4YKX A;  3TZ0 A;  4CE2 A;  5M4E A;  2BYH A;  2FWZ A;  2HCH A;  1AH8 A;  3NMQ A;  4JAV A;  3B24 A;  2XX5 A;  3EHJ A;  4EGH A;  5CTX A;  3ZKD A;  1B62 A;  4EGK A;  4CWO A;  4L8Z A;  1I5A A;  5IDM A;  4FMT A;  5CTU A;  3K97 A;  4URN A;  2E0A A;  4JAS A;  3G7B A;  1EI1 A;  5D7R A;  4CWR A;  2C1G A;  4LP0 A;  4XKO A;  5M4N A;  2YKC A;  2QG0 A;  4H7Q A;  3D36 A;  1UY9 A;  1UY6 A;  3TZ5 A;  1ZXN A;  2AKP A;  4AS9 A;  4H81 A;  2IOR A;  4YKR A;  1I5B A;  2EXL A;  2VW5 A;  4HXW A;  4AWO A;  4XKA A;  2BSM A;  2WI6 A;  4QPK A;  2H8M A;  2XX2 A;  4XDM A;  2IWS A;  4HZ0 A;  3T10 A;  2YGF A;  2O1V A;  2YEG A;  2XDL A;  3B25 A;  2O1U A;  3OPD A;  4WUD A;  2Q8F A;  4CE1 A;  1ID0 A;  1TBW A;  3RKZ A;  4U93 A;  2YJW A;  3A0X A;  2YI5 A;  2YKI A;  4YKQ A;  1UYE A;  4KQV A;  3A0Y A;  4O07 A;  1YES A;  1Y4S A;  3BMY A;  3GIG A;  2CGF A;  5L3J A;  3C0E A;  3HYZ A;  2VCJ A;  5J71 A;  2BRE A;  3EHF A;  3QTF A;  1S14 A;  2YI0 A;  1NHI A;  1UYD A;  2WEQ A;  4GQT A;  1QY8 A;  4EEH A;  4CWP A;  5D6Q A;  2ZDY A;  2YED A;  4L90 A;  3CGY A;  3FT8 A;  1TC0 A;  4ZVI A;  3CRL A;  3T2S A;  2XHT A;  3A0Z A;  3VHA A;  1JM6 A;  5CTY A;  4V26 A;  2WI7 A;  3TZ4 A;  2FWY A;  3FT5 A;  3LPS A;  4MP2 A;  1KZN A;  4BIU A;  3GIG B;  4LWF A;  4LWI A;  1QYE A;  4HY6 A;  2YK9 A;  4YKU A;  5M4P A;  3ZXO A;  4WUB A;  4HYP A;  4KSH A;  1ZWH A;  3VAD A;  2XDS A;  2QF6 A;  1UYC A;  2QG2 A;  4Q20 A;  4U7O A;  1AJ6 A;  4EFU A;  2Q8G A;  3VHD A;  2O1W A;  3O0I A;  4NH8 A;  2YEH A;  4FCQ A;  3R91 A;  3HZ1 A;  4CWN A;  3R92 A;  3PEJ A;  4ASA A;  4BXI A;  3HEK A;  3G75 A;  2BYI A;  2XJG A;  2YEC A;  3H80 A; 
#chains in the Genus database with same CATH homology
 4LWH A;  2YEB A;  2YEF A;  3C11 A;  2WI1 A;  4CWQ A;  4E01 A;  4KFG A;  1UYK A;  4MPC A;  2FXS A;  3INW A;  1UYF A;  4PRX A;  3RLQ A;  3T0H A;  1BKN A;  2IWX A;  4U7N A;  1B63 A;  5C93 A;  1Z5A A;  3RLP A;  2ESA A;  1I58 A;  4XD8 A;  5D7C A;  4P7A A;  2BU6 A;  1QZR A;  1H7S A;  4CWS A;  3OMU A;  3H4L A;  2JJC A;  2YI7 A;  3B28 A;  3HHU A;  4XE2 A;  1UYM A;  3SL2 A;  4HYM A;  1U0Z A;  2YI6 A;  2XDX A;  1YC3 A;  2XDK A;  4KP4 A;  5IN9 A;  1B3Q A;  5GGZ A;  4DUH A;  1I5D A;  3INX A;  3FV5 A;  3ZM7 A;  2VCI A;  2BU5 A;  2CCS A;  4AWQ A;  2IWU A;  4CWT A;  1Z5B A;  2YEA A;  1UY8 A;  3U2D A;  1PVG A;  3R4P A;  3U2K A;  3K98 A;  5D6P A;  1KIJ A;  2BTZ A;  4XCJ A;  4B7P A;  5BOC A;  1ZW9 A;  4FCP A;  3A0T A;  1Z59 A;  4JAU A;  1YS3 A;  4L93 A;  2YEI A;  3D0B A;  3ZKB A;  4XC0 A;  2FYP A;  2XK2 A;  2K5B A;  4WUC A;  5BOD A;  3D2R A;  4ZKI A;  3O6O A;  2BU7 A;  4YKZ A;  4LWG A;  1YT2 A;  4O09 A;  3O2F A;  4URO A;  4CWF A;  4EGI A;  3DGE A;  2YGA A;  5CPH A;  4GGL A;  4URL A;  1UY7 A;  2XDU A;  1OSF A;  4GEE A;  1TC6 A;  4XKK A;  5CF0 A;  1Y8O A;  3BM9 A;  2XJJ A;  1A4H A;  3QDD A;  1L0O A;  1UYI A;  4FCR A;  2QFO A;  4URM A;  1US7 A;  1BGQ A;  1R62 A;  2YE5 A;  1YSR A;  3MNR P;  2JKI A;  2YGE A;  5F3K A;  2XX4 A;  4YKT A;  3R4N A;  1YT0 A;  4KTN A;  4KSG A;  4PL9 A;  2XCM A;  1YC1 A;  4R1F A;  5M4M A;  4MB9 A;  4L94 A;  1YER A;  4MP7 A;  2YKB A;  3U67 A;  1NHH A;  4YKW A;  5FNF A;  5FNC A;  3T1K A;  3EHH A;  2WEP A;  5F5R A;  1Y4U A;  2CG9 A;  4NH7 A;  4E00 A;  1H7U A;  4LWE A;  5FWK A;  3TUH A;  2WER A;  3Q5K A;  1Y8P A;  2CCU A;  3K60 A;  3OWB A;  4FPP A;  1GJV A;  2YKE A;  4PRV A;  3GIF A;  3B26 A;  4R3A A;  1YC4 A;  1Z5C A;  1GKX A;  2IOQ A;  3HYY A;  2C2A A;  3K99 A;  3CGZ A;  4GFN A;  4ASF A;  4EMV A;  2YE4 A;  4O04 A;  4AWP A;  1UYG A;  2BT0 A;  1AH6 A;  3A0W A;  4CE3 A;  3IED A;  4YKY A;  2VWC A;  3JZ3 A;  2XJX A;  1YET A;  4P8O A;  4PU9 A;  3EKR A;  4XIQ A;  1UYL A;  2YEE A;  5CTW A;  1GKZ A;  1Y8N A;  2ZKJ A;  1YSZ A;  3CRK A;  4BQJ A;  3HZ5 A;  5IDJ A;  1I59 A;  2UWD A;  1YT1 A;  4DZY A;  4XIP A;  4V25 A;  2PNR A;  2HG1 A;  2CCT A;  4O0B A;  4H85 A;  3GIE A;  3B27 A;  3TZ2 A;  1EA6 A;  1TIL A;  4B6C A;  4MOT A;  4W7T A;  5M4H A;  2BU8 A;  4I5S A;  4MPN A;  3WHA A;  1TID A;  3TTZ A;  4MPE A;  2GQP A;  3Q5L A;  4GT8 A;  4XIT A;  1BYQ A;  3ZXQ A;  3CWV A;  1TH8 A;  1MU5 A;  2WI2 A;  2XAB A;  1AM1 A;  3VHC A;  4BIZ A;  3T0Z A;  2YE8 A;  4R3M A;  3LNU A;  2Q8H A;  4GCZ A;  2XHR A;  2BRC A;  4EM7 A;  2WI4 A;  4HY1 A;  2XHX A;  1MX0 A;  3PEH A;  2YE3 A;  4HXZ A;  3OW6 A;  2BZ5 A;  5M4K A;  3EKO A;  4XCL A;  2YE6 A;  1AMW A;  2BU2 A;  4K4O A;  4L91 A;  4ASG A;  2YEJ A;  1BXD A;  2YE2 A;  2YE7 A;  3A0R A;  4MBC A;  1ZXM A;  4LPB A;  4BQG A;  2YE9 A;  3KE6 A;  1UYH A;  4QPJ A;  4XIR A;  5J6A A;  2WI5 A;  3G7E A;  2Q8I A;  3R4M A;  3EHG A;  2CH4 A;  1S16 A;  4HZ5 A;  1U2O A;  1THN A;  2GFD A;  3R4O A;  4O05 A;  3RLR A;  2WI3 A;  2YK2 A;  1NHJ A;  4ASB A;  3WQ9 A;  2IOP A;  2ZDX A;  4XTJ A;  4E02 A;  2Q2E B;  2YJX A;  4BAE A;  2HKJ A;  3Q5J A;  2XD6 A;  1I5C A;  2YKJ A;  4NH9 A;  4X9L A;  5D7D A;  2H55 A;  4JQL A;  3OWD A;  5FND A;  4EFT A;  4I3H A;  2ZBK B;  4YKX A;  3TZ0 A;  4CE2 A;  5M4E A;  2BYH A;  2FWZ A;  2HCH A;  1AH8 A;  3NMQ A;  4JAV A;  3B24 A;  2XX5 A;  3EHJ A;  4EGH A;  5CTX A;  3ZKD A;  1B62 A;  4EGK A;  4CWO A;  4L8Z A;  1I5A A;  5IDM A;  4FMT A;  5CTU A;  3K97 A;  4URN A;  2E0A A;  4JAS A;  3G7B A;  1EI1 A;  5D7R A;  4CWR A;  4LP0 A;  4XKO A;  5M4N A;  2YKC A;  2QG0 A;  4H7Q A;  3D36 A;  1UY9 A;  1UY6 A;  3TZ5 A;  1ZXN A;  2AKP A;  4AS9 A;  4H81 A;  2IOR A;  4YKR A;  1I5B A;  2EXL A;  2VW5 A;  4HXW A;  4AWO A;  4XKA A;  2BSM A;  2WI6 A;  4QPK A;  2H8M A;  2XX2 A;  4XDM A;  2IWS A;  4HZ0 A;  3T10 A;  2YGF A;  2O1V A;  2YEG A;  2XDL A;  3B25 A;  2O1U A;  3OPD A;  4WUD A;  2Q8F A;  4CE1 A;  1ID0 A;  1TBW A;  3RKZ A;  4U93 A;  2YJW A;  3A0X A;  2YI5 A;  2YKI A;  4YKQ A;  1UYE A;  4KQV A;  3A0Y A;  4O07 A;  1YES A;  1Y4S A;  3BMY A;  3GIG A;  2CGF A;  5L3J A;  3C0E A;  3HYZ A;  2VCJ A;  5J71 A;  2BRE A;  3EHF A;  3QTF A;  1S14 A;  2YI0 A;  1NHI A;  1UYD A;  2WEQ A;  4GQT A;  1QY8 A;  4EEH A;  4CWP A;  5D6Q A;  2ZDY A;  2YED A;  4L90 A;  3CGY A;  3FT8 A;  1TC0 A;  4ZVI A;  3CRL A;  3T2S A;  2XHT A;  3A0Z A;  3VHA A;  1JM6 A;  5CTY A;  4V26 A;  2WI7 A;  3TZ4 A;  2FWY A;  3FT5 A;  3LPS A;  4MP2 A;  1KZN A;  4BIU A;  3GIG B;  4LWF A;  4LWI A;  1QYE A;  4HY6 A;  2YK9 A;  4YKU A;  5M4P A;  3ZXO A;  4WUB A;  4HYP A;  4KSH A;  1ZWH A;  3VAD A;  2XDS A;  2QF6 A;  1UYC A;  2QG2 A;  4Q20 A;  4U7O A;  1AJ6 A;  4EFU A;  2Q8G A;  3VHD A;  2O1W A;  3O0I A;  4NH8 A;  2YEH A;  4FCQ A;  3R91 A;  3HZ1 A;  4CWN A;  3R92 A;  3PEJ A;  4ASA A;  4BXI A;  3HEK A;  3G75 A;  2BYI A;  2XJG A;  2YEC A;  3H80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...