1QYGL

Anti-cocaine antibody m82g2 complexed with benzoylecgonine
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
b'DIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGYTYLHWFLQRPGQSPQLLIYRVSNLASGVPDRFSGSGSGTAFTLRFSRVEAEDVGVYYCMQHLEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPQDITVSWKIDGAERSSGVLNSWTDQDSSDSTYSMSSTLTLTKDEYERHSSYTCEATHKTSTSPITKSFNRGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB M82G2, LIGHT CHAIN
molecule tags Immune system
publication title Diversity in hapten recognition: structural study of an anti-cocaine antibody M82G2.
pubmed doi rcsb
total genus 49
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2003-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qygL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qygL01
2AXGA 2DM4A 5E6ID 1WFOA 1VADB 4U1KB 3MCLH 3QUYA 3FB7B 1M7XA 4QLRA 2AXGB 1I9RH 3W39A 4WW2C 1U8KB 2X4QB 4JDZA 3GJFB 3IDUA 4HS6B 4L29A 1IQWL 1J0KA 1U8IB 1KCUH 1T6VN 1EEYB 4XP4L 1RMFL 5F3BA 4A6YB 4Y5VA 1IEHA 5F6IC 4MJ4A 3FQTB 1B90A 3KWWA 5JXEA 3KPRA 4ELMB 5IW1A 4PJDE 2XWJA 4G6FD 2AI0L 3JTSA 5K33A 1T1WA 4Z7OF 2V5MA 4I5BB 2K1MA 4MA3A 4MA7L 4Y2DA 1I75A 1MCNA 5AZEL 4Z7NE 1KENH 2WNGA 1ZA3B 5ADOL 3EOYG 4MS8D 3MRLB 3HZYB 4LCCC 1NC2B 1QSED 1SJVA 4QKXB 1KT2B 5E08H 4X4YA 2GJJA 3GHBH 1WSST 1C12A 1EH9A 3RWDB 1CBVL 1YNLL 1YN6B 4XHQA 2BK8A 2QQNL 5I2IA 3VW3L 3HZMB 3VFUA 3ZSTA 2YZ1A 3JXAA 1V7ML 4MAYA 1S3KH 1NSNL 3IU3A 1JUFB 1RPQA 1EZVX 4LFHG 4L9DA 3UBXA 4HWNA 2IAMD 1YEKH 4XWOC 4HLZG 1U3YA 4OM1L 4L8SC 4LPTA 3S37H 4YHNA 4OCLC 1R5IB 4JHBA 3NTCH 3GMRB 2FO1A 3MR9B 4HC1L 5EFIA 5L2JA 2FX8L 4KU1A 1NANI 1T0MB 4FQ2L 3O2DH 5KTEH 1FE8H 2X1WL 3QUZC 3RY6C 1FNAA 3B9KA 2YD9A 2A74B 4MJIE 4JLRB 5IV2B 2X4TB 2C26A 1L6ZA 3QIBA 1J87A 3U6RA 4NGHL 1IEBA 2BVPA 1S7UA 1N59B 2VC2L 3QWOB 4RQQA 1Q0YL 1ETZB 3HG1D 1YEHL 1DBBL 3QA3A 5C0CA 3G5YB 4GRWE 4JN1H 1Q9OA 5IEHA 3O3EB 4GBXC 3SDXF 1UCBH 4I48B 4N9OB 4B0MM 1I1YB 2ZG1A 4MHHI 2NY7L 1W0WA 1W0VB 3UYRL 2APTA 2X42A 3G6AA 4U6XB 3KPRB 2H32H 4Z95H 1PJ9A 1HYRC 4X7TB 1H8OA 3EO9H 2ICCA 4K8RL 3VRIA 1AGDA 1RU9L 4XNUH 5IQ7H 4QOKE 2YRLA 3WN5B 4Y4HD 1T22B 4C4KT 4G5ZH 4MJ6B 1ZT4A 1IQWH 4TUKL 1JGUH 4TPRL 3BZEB 3CFEB 2ESVE 1XGPB 1J0HA 4JQXA 5ICYA 1MFBH 1A9EB 2G5BA 3MV8D 2HLAB 5FYKE 1GZPB 4AM0B 5EZIH 3QIWC 1JV5B 2YPLA 5HHMD 1ZV5A 2DLTA 5DC0A 4APQD 2C3WA 2F9BT 4ERSL 4DK3A 3BPOC 2BSSA 4HFWA 3D5OF 1CWVA 3VXOB 4ETQA 2JIXB 3T3ME 4HJJH 5F6IB 4KROC 5D5MB 4LBEB 5DO2C 1FSKB 2WBWB 2BHZA 4OZFG 1BX2A 3VFWA 3VXRB 3OKEA 4MD5A 3R06A 4FQ1L 5TE7H 4NPYB 4WHTB 4RGMC 5BRZB 5IB2A 4PRDB 3TV3L 1HWHB 5DMIL 1YEIL 4O58H 5FF6A 3UTTA 1I7RA 1DR9A 5IUSA 1F11A 4OZHF 5GGRB 4I13B 4DVRH 1ZA6B 3OXSA 4DVBA 4Y8DC 4AJ0A 2GI7A 5EOQH 1FO0A 2O5XL 3QDHA 4PJ8A 1SJHB 3MRGA 4LLMA 3SDYH 1KB5L 2DBJA 3HS0A 2GTWB 2IGFL 3GI9H 4M00A 3MRDB 1CD0A 1J1OH 2AEQH 1MWAB 3LRGA 2XKSA 4HPYL 1KOAA 5K9JL 3TNMB 1FL5B 2X4OB 1WK0A 5DDHA 1MCWM 1U3HA 3AROA 5IHUL 1DBML 1F42A 4ONFH 3RUGF 1TQCC 3BJ91 5DJZB 4Z7QE 1X5GA 1HNGA 4NNYA 3QEQE 1QBBA 3BEWA 2DBLH 3MOAH 3GRWH 3L3OA 2I9TB 4JN2B 2A9ML 1VGKA 2MMXA 1AKJB 1CD8A 2A6JA 5DHVA 5HHOE 3MLYL 5IVXA 2Q8BH 4O2FA 3VFPA 1E4KC 3MV9B 4M9OA 4WWKB 1RZIB 1NEZA 2DQJH 3L3GB 4JN2A 1AD0A 4BH8A 4H25B 2EXYC 4MJID 1NLDH 4JRXD 4Z7WE 1JFQH 4KQ3L 3X3FH 4HS3B 3RVVC 1VCAA 4F37F 1DQQA 2BHUA 4MAUL 4Y1AE 4QT5B 4E0RB 2XACC 1T80A 1WVZA 3D39A 1RJZA 3O41B 3D25B 3O45B 3WFZA 1AGEA 4R4BA 4OD1L 1HKFA 3TT3H 1WWBX 1NUNB 1J11A 1S7WA 1N2RA 3TH2T 1U91A 4PRPB 4OZIE 1TVBA 5BQ7A 2LE9A 3VFOB 4OFVA 3IJSA 5TH2A 4YHKL 2Z91B 4O02L 2XKNB 1OQOA 3GSXB 4RGND 4MQ7A 1MIEL 5F9AC 3UTTB 3Q5TA 2G2RA 3LN4B 4JPWH 5ESQA 1QSZA 1HSBB 3EHBD 1CFQA 5I0DA 1Z5LA 5MEPA 1YECH 2P7TA 2I26N 4G6MH 2VLJB 4Z77A 1CDBA 1BQHG 1T0NA 5FO8B 2DL2A 5INCB 1A1OB 1U3JA 5IBUG 4XAWH 1A3QA 2P5WB 4MJ5A 1G9NH 1YJDH 2QQQA 4DZBB 2EYSB 2PNDA 3KYAA 3REWB 5IJKA 3QXAA 5I1KH 5ISZB 2IQ9L 3KXFA 3D0VB 5M95B 3M1BA 1A9EA 3OZ9L 2A2QT 2BJML 4KHXH 4ODSH 2XY2A 5LAXA 3SGDI 1ZKAA 2C3HA 2OTPA 3FRUA 5A16B 2AJUH 3MLWH 4C55A 3W82A 2AJXL 3U9PL 1H5BA 1RUQL 3MMEA 2AP2A 4KUZH 4M7LH 1VEMA 3VI4F 4N1HB 2EH7H 1FNSH 4HEPG 1KB5A 1N0XL 2Z8WC 3CU7A 2WP3O 5HYQA 1NGZB 4HMEA 1OTSC 5D8JH 4Q0XL 2HVJA 4ODUA 2BZDA 1OAUL 1YECL 3JWDL 4Q6IC 3V4VH 3IVKA 3VDBA 2NY3C 3INUH 5IVOA 5HY9B 1OGAD 4N8PA 1YYMH 1UQSB 3NCMA 3CNKA 1N5YH 1LO5A 3MUGB 1LE9B 1KNOA 2WANA 1I7TA 3JBG7 1FG9C 1GHFH 4O9HH 1QA9A 4UT6H 1SEQL 1SYVA 1UXSA 3WEXA 4POUB 5D7JB 2PCPB 3WDHA 1FIGH 1N7ML 5KVFH 2ZSVA 2ZCKH 1BD2E 2X1OA 3QIBB 3TT3L 4GW4A 4KQ4L 4BQ6A 1TVDA 1NAKL 4EDXB 3T2QA 2BOCB 5E9DB 1G6VK 4PTTA 5J13B 3HC3L 5D7LA 3U0PA 2BVOA 1W72A 4GKZB 2XQBL 3KPTA 1AKJA 2OX5A 3NFSL 1R3KA 4XBPB 5FO8A 4PB9H 5JHDE 4JCMA 2GTZA 3IFOB 4KPHL 3MRBA 1YQVL 3HC3H 4XCEB 1BAFL 3VFGH 1T2XA 2SEBA 3FT2A 4NCC1 4PTUA 3D39E 4OLUH 3QHFL 5D2LF 4WCYH 2DQUH 5IM7A 2NR6C 1YZZA 5E2UH 4RDQF 3K0WA 5GGSY 3A67L 1KYOK 5KSUA 3L5JA 2NXYB 1ZA6A 3OXSB 4Z95L 3HHRB 3L3IA 2JK5A 1NMCB 1P1ZB 4LARH 3T0EB 1XGTB 1NBVH 2CGRH 3M07A 3OB0K 2PXYD 1OARL 3K8LA 3C5ZB 4W6XB 1FO0L 4QXTB 1NC4B 1JGEA 4I9WE 1UZ8A 5TDPA 2GT9A 2YSSA 2CK0H 4R4ND 1UEYA 3V4VL 4FQCL 5E6IA 4DTGL 5IROC 1EEZA 2ATPB 3VDCA 3FB6A 2D7NA 3G5XA 5D7KE 5C0BA 5IVXB 2AVGA 3UP1A 4NC1C 4HUKB 5C0AD 3QG6B 4X4ZA 5ANME 4C83B 3BI9X 2VDOL 1AGBA 5ESVB 4ERSH 3L95B 2AJVL 3RGVC 4R90L 4PRIE 5JMRA 1KLGA 2VR5A 1EEUA 4TSAL 5FYLH 5L0QC 1JRHH 2AXFA 1IGTA 5TDPB 1HYSD 3FFCD 2XY1A 1ROWA 3C5ZA 4KUCF 1D5BA 3ULUC 5E2TH 2JJSA 4Y19B 1JWMB 5L2KE 4JREB 4AL8L 3UTQB 3W11D 2PYEE 3SE4A 3IJSB 3DV4A 4Z7QF 2NY0B 2RR3A 2XWTB 3VFOA 4C4KO 1RU9H 3O3UN 4XNUL 4LQ1A 5E6YA 5BS0E 4KVNH 1J0ZA 1F02I 3C6SA 3VW3H 5E99L 1TJGL 3DBXB 4QRPE 4QRRD 4MDIB 4OLVH 3TBVA 1MAMH 3LKRB 4K07A 1AXTL 1ZVHA 4Z5RA 5HPMA 1M1SA 3LQMA 3QNYB 3KHOA 1M7IA 2BY3A 2DQFA 5E8NB 1OSPL 3I6GB 3WNLA 3BP4B 5B38B 4G43B 4M5YL 4N0YH 1DUYB 4JJ5B 2EEBA 4LSSL 1AQDA 2VLKD 3BH9B 5C0DB 1CGXA 3G9AB 5C0BD 1A8JH 2MCPL 5JW5B 1RIHL 3IB4A 1AO7A 5SV3A 3IDIA 1BGXH 3D0VA 1BQUA 3I6KA 3HE7C 1OGTB 1QYGL 1HILB 2VZ1A 5LGJB 5ICZB 1WC7B 2HG5B 3T1WA 3H9SE 5LGHH 1G0DA 5L0QB 4JPIA 1FZJA 1HEZB 4DVBB 2VL5A 4F7CA 4L3ED 4TTDD 1A1NB 3HUJB 4BZ2H 1JZ7A 4FQIH 4JFDE 4R4FH 5IB5B 4KROD 4KJPD 1DBMH 3VFNB 2W59A 3QDGE 5DVOA 2MOVA 3PGCA 1IZKA 5J6HB 4UT6L 1HHGA 4HPYH 1FZMA 1F6AA 3VJ6B 5BZWB 3DMMC 4RMRA 2ZUXA 4HG4J 1CG9A 3C09C 5AWNH 1XR9B 4PBVC 4LVOC 3MV01 4KKNA 3RZCC 1DBKL 5E8OA 3GUTB 2FJFA 5GJTH 1E4WL 3QPQD 5DMJB 25C8H 4ONGL 3RIAK 5F88B 4QT5A 4JHWL 2FLBT 1EJ6A 3BQUC 1FNFA 4L8CB 4G8FA 4M61B 2Z92A 4TQEL 4Q9QH 1Q72H 2X4SA 2DWEA 5EBWB 3C6SB 2Y5TB 4HUVA 1YY9C 5LVEA 2VIRA 1HIML 4ELMA 1JHLL 3PWVB 1NCTA 4KDTA 4NFBA 5BO1H 3DX7A 1KEMH 4CU7A 5ITFB 2NX5A 2WBJB 1X44A 4LRIC 2B8OT 2IBGA 4MWFA 4HKZA 1JHKL 1PG7H 3C60B 5LCVH 4P2OB 4D8PB 3NCYS 4NSKB 4GLRH 1RUAH 5ACMA 4R2GC 4ZOEA 1YPZE 4BH7A 4CN1A 1CFQB 2VN4A 4NRYB 4U1LA 3UDWA 3EKCA 1RUML 2V7NA 3NA4A 1U93B 5K9QI 1P5UA 4YPJA 2Z92B 3I2CH 1DLHA 4O4YH 2KL6A 4BFEA 4MCZB 4PJCF 2WAHA 1AO7B 1UM5H 4MS8C 1XF3A 4JPVL 2ADGB 4U7KA 2KBGA 4ZAKA 1IGCH 2UVEA 3PNWB 3S36H 2BNUA 3MCKA 5K59E 3LRSB 5JW3L 4J4PC 3SDXA 3UJTL 4UAOC 4BELD 1XT5A 1IC5L 2ADJA 3ARDD 5L2KA 4IRZL 4ZUTB 5DRNB 4WHTA 3EO9L 1I3GH 3ULSA 4JM4H 3JWDC 2EDLA 4IMKA 2NQCA 4H8WC 4JQIH 1D3CA 4M8VA 3L3DB 5IHZB 2GT9B 5BVPL 1IKFH 5GGVY 4NCC2 3DX6A 1T66D 4LASL 3U9UB 1UB5B 2E7LC 4EIGB 1LDPL 5CEYA 1AD0B 4BH8B 1ZHBB 3JV6A 3OAUH 3MRMB 4ZAKD 4LEXL 2Y25A 5T3ZH 3GSUA 4JQXC 1H3UA 7FABH 3SPVB 4G8GE 1OAYL 4U1MA 4Z78A 3VXRE 1C5BH 4M3JA 4HW6A 1N2RB 5DJZA 1G7HA 5IF0B 3LKNB 4TVPD 4WW2B 5F1IA 3PGFH 3NAAL 5DDHB 5FUOH 5HI5D 1KEGL 4OZHB 4TNVK 4NN6C 2B4CL 5D8JL 4UDTA 2ZCLL 4HG4K 4KZEL 1P4LB 2LVEA 3IFNH 5F1OB 4WEMB 3BN9C 3I6KB 1MCQA 1G7HB 1EBAA 2GITB 1QVOB 1X5ZA 3BIKA 5FYKU 3O3AB 5C6TH 5FM4A 3TP4A 3O3BB 4Y1AB 4XVTL 4XVSL 2NTFB 2WK2A 3VGFA 4XC3L 3AXLB 2BC4B 4FFYH 3S5LA 3CVHH 1FRGH 3MRMA 4S0SD 3DTXA 3OB8A 2VITA 1GGYA 3SN6N 1I7UA 1YEKL 3H3KA 4GBXD 4JO4L 4KKLC 5C07A 3V5DB 2OL3B 3O3EA 2XN9A 3G5YA 4DN4L 4HEME 1F58L 4LLWB 3BPLB 1WCBB 1YNKH 4S10A 5KVFL 1S7VA 1EFXD 4YO0A 3ALWA 2V5RA 5FK9A 1YEFH 1VENA 4PRPD 3ULUL 1HXMB 2HMID 3CVIL 3K3QA 1OP5H 5CIPH 2QQLH 4WFED 5D71H 5C1MB 5IVXE 1CGSH 4MNQB 5B21A 2FLRT 3OAZH 3IKCA 4XCCL 1FDLH 3FN9A 1KENL 2C4FU 1SM3L 1IM3A 2J6EL 3GMLA 4JO3L 2BRQA 2WWKT 3CFEA 4MNGA 3P77B 5CGYC 4UTAH 2P1YA 5FYJD 5DJYA 2CLZB 1K8DB 2KZWA 3GSRA 4S2SA 4KKLD 4ZS7H 3ARQA 1S9YB 3H42L 1ZWIA 5MERB 4OD1H 2NX5B 2IQAB 5CILH 5FYJL 2B39A 2YMXL 5JZ7D 5EU7C 4JFEB 2J12B 3U36A 1AC0A 3UTSA 3HZMA 5L88H 4LCWA 4XMLH 4JFDA 2HFGL 4LLAA 4PJGE 2AK4A 2A83A 2W9EL 2VJXA 4OFPA 2XZAL 4NCDA 1MFCH 3GJEB 1GCFA 1F6LL 1C1EH 4Q6IB 5IBTL 4Z76B 3N1MC 5E8OB 1I8KA 3THMH 3FRPG 3S88H 3V5HB 1MH5A 2ICWA 5D1ZC 5TQ0H 3AMLA 1LEGB 4Z77B 3V6FA 1WFTA 4I2XE 3QIUD 4OCXL 4UDUA 4PJXE 1YA5A 1MCPH 2BDNH 2I25N 1I1AA 3HKFA 3JTSB 4L3CA 3RVWC 2NY2C 5DHYB 4LKCB 1UQSA 2RGSA 3LN4A 4KRNA 4L5FL 3MRPB 1NJ9B 2I5YL 1RZKH 1BD2B 3KPOB 3QDJD 1I1FB 3B43A 2VL5B 2R23A 1AQKL 1XGYL 5KSBF 3L3JA 3N9GL 4JPIB 1T20B 4HXBL 3MRFA 5E9DE 4ALAL 4HXAL 4DFHA 4C58B 2W91A 5KSAB 2G75A 2W60A 3P4NA 3BKCL 3L6FB 4FABH 4KUCD 1QFOA 4JZJC 1NGQL 3RJQB 1H5BC 2VUYA 4KK9C 5CIPB 1V7NL 3ZE0E 1FV1A 2BOCA 1GGCH 3LKPA 3F62A 2AJZA 4JHZA 2X89D 4JO4H 1KELH 4YXKH 4H0IA 1P4IH 1IL1A 3RWHB 2CLZA 5B38A 3MV8A 4PJFE 4LSPH 5T1LB 3S35X 2DLFH 1NFIA 3W9DB 4JM2F 4WHCA 3AS0A 1RUPH 1KNOB 4Y4KC 3VWJC 3VH8A 1BGXL 1OD7A 4ZXBD 4NKQB 4YXKL 4DN3H 1CT8A 4Y2DB 3N1FC 1R5VA 3T8XA 4C56B 3T2NL 3BWAA 3EYOB 3DVFA 1G9MC 3LN5B 4P4RB 4M8QA 4QWWC 3TCLA 2R2BA 5I17A 1J05B 1YPZF 2VXTH 4OI9A 3RNQA 3WIHH 3VMOA 5D4QA 2MKLC 4JDVA 4NP4L 5DFVD 2IFFL 1E28A 5F70A 1UYWH 5I1AA 1FG2B 4X6BA 1IILE 5FK9B 5IR1A 2JJTA 5CJQH 5DJAB 1F8TL 3W39B 4WI6A 3DRTB 5IW3A 5F72S 1P4BL 4UINL 4IRJC 1AFVH 3D25A 1B2WH 1ZHKB 4LASH 1CFTB 4J1UB 3SCMD 4JO1L 4G8IA 4A6YH 3IYLW 4ZS6C 4LLVA 4HJ0D 1J8HA 5IW1B 1Q9LB 2YBRB 5IB3B 3K8MA 3FAWA 4HKBB 1WEJL 2UWEF 5DJ6B 2X05A 2Q3AA 3W5NA 2IQAA 5I1CH 2EH7L 3AXLA 3CD4A 1ZWIB 4K3JL 1Q9LA 5AYUL 1QRND 4Y19E 2Y06L 4OCWL 4X5WB 2ARJB 3CLEL 4JDZB 3MV7B 3N1PC 3ARFC 2QADC 2R2EB 35C8L 4NM4L 4I0PB 2PYEB 5AUMA 4OTXH 3SO3B 5IMMB 4JB9H 5GRXG 2CKBH 4EN3A 2V5SA 2IPTH 3TNMA 5IJVA 1IRAY 1XH3A 3EFFB 1D7FA 1NCDH 1FGVL 4ZUSA 2X10A 4MJ6A 5ALBL 1CL7I 2E7MA 1A6ZB 5ETUA 3MOBL 5SX4I 2DQTL 3WNNA 3SPVA 3GFUA 1JYNA 4F2MA 1D9KB 1FLRH 4Z7UA 3X14B 1AFVL 4JGMA 1V7MH 1JWUB 5I75C 2D4FA 3T77A 4WGVB 1OQXA 1W0WB 4NBYB 1OTUD 1OM3L 3CH1A 2W0PA 1EHXA 1AIFB 1B4RA 2DLGA 2KQNA 3LPWA 4JG1H 1CBVH 3B9DA 5ID1B 1MQKH 1BREA 5HYFA 4U1GB 3FCTB 3RIAF 4XX1E 3SKMA 4P23B 4LU5H 5IIEA 3BP6A 2GKIA 2MPAH 5B3NA 1JPTL 5E2UL 3ULUE 2R69H 4DAGL 3ZYZA 5I71C 5IMOB 2VDQL 1FCGA 1S9WB 5AWNL 5IG7A 4YHLL 2BERA 1UM6L 2KZ1B 4HIHB 4RISL 1LDPH 3A0OA 4XX1G 4ZTPL 3EDDA 4WEBH 5KVGL 1NFKA 5ACZB 1KPVA 5F8RC 3QO1A 3QG7L 1NLDL 3X3FL 1NCCL 1RAMA 2HJKB 2YK1H 4CW1B 3KPSE 3MNWB 1P6AB 1PKQE 4FNLL 4GQ9H 3KPLA 2O5YH 2X70A 3QUMA 2IJ0C 2FJGA 5T3ZE 3BQUB 1EMTL 4QGTA 1MEXH 4TSBL 3RGVB 5GHWH 1R3LA 4XNXH 5GSRB 3IXTA 4X83A 5IB2B 4FP8L 1X5KA 3QUML 3P3YA 3MRRA 3R06B 4P5KB 4I48A 1QYGH 1HE7A 3PGFL 5FUOL 2AW2A 1NGWA 1YN6A 3J7HA 5IEHB 3SKOB 2DYPB 3PABB 3HUJE 3IXAA 4QRTB 4LVNB 4OGYL 1D5ZA 1EIBA 2H2SC 4KKCC 4IDJL 5CUSH 5IFHL 1ZVSB 1H3WM 4KC3B 1JNNH 2H9GA 1SVCP 5TE4L 4ZUUA 1Z3GH 8FABB 3PABA 1UXWA 2YPLB 4J12A 1IEBB 2CMRL 4PP1D 3X13B 5J13C 4KTEL 4I18C 1WZKA 3B5HA 4OJFH 1WV7T 2F53A 1AHWA 1RY7B 3UTSB 2X4RB 4U0QB 2V2WB 5FOBB 4JFEE 1R3LB 5GQBA 5H2BA 2GK0A 3GKWH 3CLFH 2AS5M 5HHVL 4OLZL 2FO4A 1KIPA 2R4SH 1SYSB 2A9NL 1NEUA 3SBWA 2XTJC 1DBAL 3GMPA 4NHUB 5ISZE 3QFJD 5J12C 4RGOH 1P7KB 2XPGB 4JZOB 2FWOA 5T33H 3HG1B 1QLFB 1U8KA 2C1PA 4KKCD 4EUPB 2BRRH 4NZTH 1CDIA 1HCVA 2OL3H 3WXWL 1QHPA 3TH4T 4LDEB 1LILA 4X0KB 1S7XA 3IKKA 3ZT5A 5HGHA 1BECA 2V2WA 1XF2A 5EZLB 1OVZA 1GGBL 3BW9B 3OWEA 3QPXL 3KDMA 5SWZD 5FECB 1N8ZA 4L8DA 4Z7UE 5TF1H 3V6BR 3P4OB 1GC1L 5FDYA 2VWEE 3U30B 4HFUL 4LLWA 3K2MC 4PJCB 4Y4FD 3KLHD 3VXSB 3LN9A 1KG0B 5KG9A 4L4TE 4ZO7A 3U7WL 1A7PH 2EE3A 4HKXA 1QEWB 3QEHB 2A74A 4XVJH 1I9IL 4Y19A 1AJ7L 1ZEAH 2Q3ZA 4KH2A 4DUVA 4OGYH 1DN0B 3MFGB 4TTGA 5FCUH 1MNUH 3MLZL 3F12B 3RHWF 4M7KL 3EDKA 1RJCA 1OAUH 5IVZB 2J8UE 3TVMB 15C8H 5GGUB 2DKSA 5T3XL 1N6QL 4OCXH 4Z9KB 3B9AA 1MHHB 4GRWH 1LEKA 2R0LL 4PJ8B 4XAKE 3F5WB 1RFDL 2D7PA 3FZUC 4PFEA 2MHAA 4MA1C 4FQXC 1MHEA 1R3IL 5DJXA 2OJZL 4ODSL 4NZUL 3QRFM 1HHIA 1QO3A 1U2HA 2DL9A 4R2GD 4JHAL 3LHPL 2X7LA 5IESH 3DUSB 5I1KL 2G9HA 2Y1VA 4G3YL 1KUMA 4PGEB 5CWSA 1ZT1A 5EO1B 5IHZA 4EUPH 5ID1A 5CILL 5FYJH 2O93L 2JK5B 1E28B 4J4PD 4LQFH 5J8OA 1VKXB 5EUOE 1DQDL 4DGVL 4NM8H 4HH9A 2R29L 5EH1A 1UG9A 5IOPA 3W5MA 2DI9A 3CUPB 4OCMC 4YFLF 4HT1H 4EKXA 1BF8A 4GQPH 3PWLA 3REVB 4P9HH 3IFPB 3ZE2E 1CT8B 3KLAA 4MA7H 4Y4HB 3VXNB 2H45A 1MCOL 2YZ8A 3X12B 4HF5L 1YNTA 5IBLD 3ZKNC 1YEFL 4NUJA 5TQ2L 3DUUA 1AD9B 1SY6H 1MCPL 4PLNC 3PDDA 5I1EL 2X9YA 4DGVH 4IBLT 2E5EA 4C83A 4PJGB 2AJZB 4JVPA 4K7PH 3UEZA 1QP1A 4C59B 1CXHA 1H3TA 5D72L 3LCYA 5EBWA 2VLLA 1U8MA 1FN4B 4GH7B 1HXYB 3BN3B 1AR2A 2DTSA 3CIQA 2X9XA 2Y4SA 1JK8B 1OP3K 4LVEA 4L1DA 4PBWD 1TQCB 1UJTA 2A9NH 4QHNA 4UT7H 4XXCC 2B1HL 3QNZB 2N7AA 3QEQA 4QNPE 4YDKH 4U0RC 4X9FA 1K2DB 1TJIH 3S98A 2UZXB 1NCAL 1CGTA 4L4JA 5DHYA 4OD3L 3MNVA 3BEVB 1E4XL 5F97E 4WFHD 3BPNB 4TRPH 3LSOB 1W2KT 4NZDA 5FCUL 1KGCD 3HAEA 4U05A 5D2NA 1G6RA 1MRFL 4XNQA 1S9XA 2VC2H 4XCEA 3UPAA 5L8JB 4P2CG 3ROLB 1S5HA 5JPNA 3OL2A 1KIUA 2FJGB 3EBAA 3FOMA 1CLOL 1EDQA 3T4AA 5HDBE 2VE6B 1OAKL 2VLRB 3U0PB 5DMYA 4AY0A 5C09D 4DZ8B 3QQ9C 5LGJA 5I8EA 1YMHA 3TCXA 4UQ3B 2WIMA 5F8QC 4XP5H 2ZUTA 4YJZL 1UKSA 2Z31A 3BYTA 2GJZB 4R6UA 4OKVB 4OZIF 1R5WA 2COQA 4CMMB 5I1HL 4K7PY 4XPBH 4WV1B 4Y89A 3T09A 4UI2A 1I8MB 1A3RH 4FQJL 4RMVA 1WLHA 5L8LB 3QXTA 3EO1B 2H6PA 4KGJA 5I9QC 4YDIH 4YFDB 3QZWB 5HHPA 4FXGA 1A1OA 1MQ8A 1F4YL 2VAAA 2NX5D 4FMFA 1X4XA 3QI9D 2GUOB 3U9PH 1T4KA 4XRCA 2WINB 3V4PH 2W9EH 4Y2DD 1QRNA 1BOGA 2R69L 3GMLB 3W9EB 1HQRA 2ZCKL 4R0LB 3KPQB 4JZJA 1T04A 4PGDA 3FHQA 2ZUWA 1U8IA 2OJEB 3SDCA 1AHWC 4LOUC 3IRZA 5J57B 2V9TA 4P5TA 3SQOL 1VESA 3MMEB 5M7QA 3ZT6A 3ZT7A 1TVBB 2AI0H 1BBDL 5BQ7B 2NTSP 4NIKB 5FUCE 4QTIL 1FHGA 3D85D 5J1AA 1EFXB 5GRUL 1A6UH 2B0SL 3INUL 2J2ZA 1LVEA 1UVQA 4ODWA 5J11B 1G7LB 5I1DA 5F7UA 1LWRA 4Y19D 4P5MA 1LEIB 4Q0XH 4NRXA 4MNHA 3L3OB 5HVHB 3JUZA 4R8WL 1X7QA 3CVIH 1MY5A 1RUQH 4KUZL 3C8KB 4YK4C 4L8SA 4M93B 5E6IB 3MO1A 2DM7A 2F8OA 4FXKA 5HVFB 1JGVH 3EYUL 1U8HB 4F8TA 4HWBH 1BVLA 4OI8A 1IGFH 1P4LA 3S4SG 3ULVF 2VOTA 3B9VA 1C16A 3I3DA 4X8JB 1OAQL 3OG4B 4R3SB 2VH5H 4YDLB 1U8QA 3NCBB 2EDOA 3RX5A 4ZYKA 1J1PL 1KIQB 3MV7E 4HIEA 3IAQA 2OZ4L 3SGKC 5CGMA 1FVEA 2VABB 2NXZD 1BM3L 1A7QL 1L7IH 4LHJB 4S1DC 5GRUH 1DBAH 5I66B 2NY6D 3DURB 3TFKD 1ND0B 4PJ5D 3F58H 5JUEH 4R96A 3MRCB 2SEBB 5GS0D 5F9OH 4YBHA 1JP5A 3X17A 5HYJB 3NCJH 1TZIB 3PDOB 4PY7B 4NP4H 1WTLA 3T2PA 1N8ZB 1NPUA 3MLUH 4L8DB 3EHBC 1MJUH 1EGJL 4U7SA 3PL6D 1VA9A 3NZ8B 4PGCB 5GSVA 5IT2L 4YHKH 5DK3A 2VDKH 2BNQE 2W0LA 4WU5A 4WCYL 5ICYB 4WTZA 3EOBA 3V4PL 5E94A 2PXYC 4DN3L 4KROB 2FEDC 1JNHA 1PY4A 1Z9OA 1VHPA 5D6CA 1T7ZA 5F7MC 1MLBA 4MAUH 2W0KA 3HG1A 1WFNA 1GGIL 1OSZA 2YUWA 2R0WH 1UWGH 4R4FL 4NC1E 4MNGE 4OZGA 4LLMB 2C9AA 4OFKA 3MRFB 5LBSH 1MJ8H 2EDDA 4HKJB 3TBWA 4KI5D 4QY8A 1IVLA 4HWEH 1AXSA 5F21B 3BGAA 5GGSB 2MJWA 4WENB 1RZ8A 1NCUA 1KN2L 4NZRH 2DBLL 2J1KA 2WINA 4Q9RH 5DVNA 2VXUL 1PZ5B 3U1SH 4PJHB 1BPVA 3DX6B 1JIBA 3IF1A 4K7FB 1YEJH 1FNEB 3WUWB 1KXVC 3MRNA 5CP3H 4LCYA 3R1GH 2OL3L 1UXWB 5DI8A 1A1MB 3Q3GA 4BSJA 1ZVSA 4X99A 2HLFD 1FNLA 2P49B 3G6JE 5I30L 1OCWH 3LPFA 3HMXA 4ZFOA 1I8IB 3PHOB 4RRPA 4OD3H 2BHYA 2GCYA 2R1XA 1E6JL 3ZTNH 3HE6A 4MMXC 3MLVL 3QQ3A 2R1WB 2IH1A 2NNAA 4JFDD 3RZCA 1EGJA 2Q8AL 3VGGA 3V0WH 2CIIB 1DSFL 5JOPE 4X6DB 1ZMYA 1ONQB 3U4BL 2PXYB 5MERA 2VXTL 3EO0A 3GSQB 3QRGH 3WJJC 4PIRF 3BQUA 5GJTL 4K3DL 1II4E 3X3GH 4HUMB 5EO9B 4M1CD 1YEGH 3AUVA 4PV8B 4YHNB 2EE9A 1FGVH 3RPIA 2Y07L 5IWLA 4GRMB 4QOKD 1P9MC 2JJTC 4D9RE 1MCCA 5HD8C 4NKMB 3MJ6A 4KZDH 4UV7L 3ZDZE 1FJ1A 3DVGA 1RD6A 3JV4A 5EU4A 4XC1L 5KVDH 4TVPL 5IG7B 4FQIL 1Q9OB 4PJDB 3KJ6L 4PJBB 3UZVB 4LGSB 3IFLH 2Z8RA 4DKDC 1CF8H 4U6HA 5J3HD 5DZOA 3RWGA 2FCBA 3QSKB 5D7IF 2UZYB 3LKRA 4LLUB 3RI5K 3KS0H 3WN5C 1A4JB 4JFYA 2JTDA 1O0VA 1JHTB 2ADIA 4J8RA 4TULL 3HAEG 2DQFB 2H1PH 3QUKA 4B7LA 1NGYB 1ND0A 3MRQA 4JPKL 1PG7X 4KKAC 4URTB 4XPHH 1JK8A 1KJ2B 2NZ9C 2AAVA 4MDJB 5SWSD 1V3LA 4X5LA 5D9SA 5MP6L 4JE4B 3DTXB 2RCSH 4EQ3A 2V5YA 2FSEA 3QDGA 1L7TH 2DKMA 1YNKL 4OZFB 1D9KA 3VXSE 4LARL 4O2EB 2QHRL 5I8OL 4U1IB 4AMKH 3DETD 3WXVH 3FFCE 1KPUB 3OKMB 2BOBB 1DCLA 4KAQH 2XQYK 4ELKA 2ZP0T 2XQYG 4P23D 1C08A 3NFPA 5D7KD 3SQBA 5TF0A 1IGTB 1HILA 2CXGA 4L4TA 4OF8A 3O6FA 4UNUA 1GVIA 3BFOA 4PJFB 2A77L 1A02N 4E9LA 1J1XH 1TJGH 3KYNA 2O61A 4CVXB 4XVUD 3IKCB 3CVHA 2K7PA 1IM9B 2ENYA 4JVUA 3O8XD 4GSDH 3QUZB 2I60H 1RK1B 3MXWH 3BPCB 4ZUWA 5MEOA 5JO5B 4RDQG 4X6EA 1ZHNB 2DTML 5DQJB 1NCDL 5AD0B 1NGXB 3UTPE 3ARVA 4W81A 4XWOD 1GGCL 2IWGA 2X6MA 5F7KC 1OPGH 4QHUB 5HGAB 1ACYH 5FHBL 1ZK9A 4YAQA 1Y0LA 1X4ZA 1IM9A 3L7EB 1A2YA 3RP1A 3UTPD 1FG2A 4X6BB 3MJGX 1GC1C 5DSCA 1EEYA 1I85A 3PP4H 5ERWA 4H26A 2H26A 4IMLB 3EYOA 2XXCB 4GW5A 4BSVB 5T1MA 3QFDA 3F7RA 5ADOH 2AKRA 3PV6A 2H1PL 4U6VH 4K71C 4HJJL 3RVUC 1MJ7L 4P2OD 1QNZL 5E8DH 3VGAC 1S7RB 3PP4L 5DUBB 4ZPTB 1R3KB 4DFIA 3WNMA 3CCHB 4YDVB 4LSUH 1KLFA 4N0FA 3MRBB 3ZLQC 1IL1B 1DANU 5LXGL 2PW2A 1NBVL 1OWWA 2CGRL 1AGCA 5TJWK 43CAB 2QQKL 2APXA 4HV8B 3MLXH 2PO6A 3D3VE 3EYQD 4GRLB 2FB4L 3TVMC 4KK5C 4MYWB 5DD1L 3CFIC 4FZ8H 2I9LA 5J1SC 4PRHE 3QIUA 4P3CL 2OXGA 3CVHL 2HT2D 3MJ8A 5T3XD 4POYA 3VXSA 5KG9B 4JCLA 2E9IA 2R4SL 4TNWF 3O6ML 3GNMH 1YN7B 1A64A 1WQVT 4YEFA 4NKIH 3L3JB 5T5NF 1A7NL 2GAZB 1WT5A 1FH5H 1CLYH 2DQDL 1DLFL 4ZS7L 4LIQH 3VRJB 4CL7A 3STZB 4Y5YC 1AO7D 2ENSA 2J5LB 4ZAKC 5EZLA 1TDQA 3HFML 3QJHB 3IVKB 5E8EA 5FGRA 1G7JB 3ULVH 1RHHB 4DW2H 3C5JB 3TBWB 4KK5D 1MJJB 4L3EE 4HGWA 3W0WB 2PXYA 5D2LA 1M7DA 3MA9H 4Z8FH 1MOEA 4MWFB 4R7NA 5JOPD 3WS6C 5CEZD 1OWRM 4OB5L 4RZCA 5DUML 1C5DB 4JQIL 3O6FC 1KTLA 2VLRD 5DHXB 2A0LC 3IU3B 4R0LC 1JJUA 3MSPA 2GK0B 1X5YA 1OB1A 4DZBA 4PGBA 5C0AA 1AHWB 4RAUA 1A5FH 4WI2A 4F8QA 1LE5B 2D7QA 2VE6A 5J11C 5GSVB 4F9LC 5ISZA 2VLKE 5DQDL 5E56A 5HHXH 1DUYA 4JJ5A 1SEBB 4HK3N 5DJYB 4XP6H 3TVMD 1A4KA 3CMOH 1B88A 4MGXA 5FHAL 1CK0L 5F7NC 3VFMB 3X12A 1QQDB 4G42A 2NY4C 2MQCA 5DEGB 5CD3B 2W92A 4PJHA 1REIA 3G04A 1KGCE 1RZ7H 4YQXL 1I3RB 3CMGA 5D7LD 2Q76B 4OZIB 3VXPA 3NCYP 5C6TL 1TPXC 5JW4Q 3WS3A 2DIJA 1HSBA 5FA3B 1NAKH 1IGYB 3RWFA 1H3XA 4LCWD 4NKDB 2B5IB 3FQWB 3WFBL 1KEGH 3EGSB 2ESVA 3OR6A 3FB8B 4OQTH 3FJTA 3IDJA 4YZFE 1S7VB 2EKJA 2YMXH 4PREA 4XI5C 3NIDE 5GGSA 4GBXB 5A40E 1J5OH 1MQKL 4X8JA 3PIQB 2JJWA 2YWYA 4DGIH 2G9HB 4PGEA 3S35L 4LCIL 4LKXB 4HS3A 2X44D 3ARYA 4P46A 3L3GA 5DTFB 5FA4B 1NMCC 5B39A 1JNJA 2NYYD 2DF3A 3PWNB 2EIDA 1DL7L 1JTOA 4JAMB 5DWUL 4OQ1A 4MXVE 4OQTL 3CZFB 3VMNA 5K9QG 1DQJB 3WJLC 4UQ2A 4ORGA 4RGNC 3RX8A 4P2YA 5DA4A 4JANB 5FKPB 3RAJL 2E27L 3QIUC 1ZTXL 2ATPA 4KI5C 1HN1A 1FL5A 4JFZH 4P23A 3UTSE 3H9HB 2BNQD 2VDNH 4IOFD 1X3DA 3VWKB 5DLML 5D1XC 5I8CA 4Z7UB 3QDJE 3Q5YA 3IDGA 5GGTL 1IAOB 3FT3B 1KIRA 1AP2B 4WV1C 5D6DA 4KQ3H 5I6XB 5CZXC 3DJ9A 4DJMA 4LEOA 4R7DA 1MAKA 4G6AD 1EBPA 4AEHL 1X6NA 2F53E 3T0ED 1NSNH 3O9WC 3KPPA 3MZTA 2H3NA 4CU8A 3ARUA 4MLIA 1EHAA 3DO3A 1XFPA 1H15B 5CWSB 1QPXA 3TZVA 4O5LL 3GSOB 4PB0H 3OTTA 3LKOA 5DEGA 3VFWB 4P2QB 1T1ZB 4M6OL 1I9EA 4G8EA 4IRSA 1R3JA 2VXVL 5CSZB 5EG6C 3BGMA 3MLTB 2RFXA 4LF3A 1F97A 5B39B 3LKSB 4BA8A 5E4EC 3LVEA 3VFTB 4L4TB 5F7EL 1IQDA 1WIUA 3BKYH 2DMKA 1BFTA 4NGHH 5EO0B 1S78C 4WFGE 4B5EA 4G9FA 2OTWB 1QKZH 2UUDH 2BNQB 3S97C 3L3KA 3TWCH 3VXTA 3LQAH 4JRXA 4PJ7B 3ILQC 3VFSB 4N0UE 5D7SH 3OJDB 2MSPA 3VGEA 3SDCB 2AERT 1LE9A 3VCLA 5F7DA 3VXUA 1I9JL 3IAPA 1IC4L 4PGDB 3TESA 2FJHA 1LO4H 4M6MH 3PWVA 2NY0D 4IOIB 5TFSL 1I3RA 4J4PA 5EU5A 4PRPE 5CBEA 4ZTPH 4N90E 1MFBL 2OI9B 3QWRD 3GI9L 5ECJE 1U8OB 4L8BB 2JLLA 5GS0H 3HTLX 1I3VA 1XCTA 3G5VB 3AC0A 4K9EH 4KRPD 2FHCA 1KJMA 1LMKA 4W4NA 1HHGB 2BVTA 5LCVL 4CVZB 1S5IH 4U1HA 4CUCA 5CJOL 4KVCL 1RZJL 4LSRH 1FV1B 1Q8MA 1ADQL 1NDGA 4OGAD 4XCYB 3TNNB 4DUWA 1QOKA 1IKNA 4NQXA 3QQ9D 1FL3A 4NO3B 3D2UA 2P5WE 1Y18A 3I50H 3B9KB 5IMLA 3NH7H 3U0WL 3SDXE 3R0MA 4JKKA 5FO9A 2XZAH 5SWZB 4JN1L 1D5IL 4KKAD 2IAMB 4NQSB 4PBXA 4BUGA 1A7QH 2DM2A 3PL6B 3VXNA 1U8PB 4V1DD 2K3TA 2E6PA 2YPLD 2AKRB 4JG0L 3GM0A 3C9NA 3MA7B 4PV9B 4EVNA 2D3VA 4XPGH 1TZGH 2FBJH 3IDYB 4XNMB 3TBSA 3T65A 4FQJH 3QNZA 4TSAH 4RBPK 4RGNE 5C0JB 6FABH 3CLEH 3C6LC 3MYJB 3AS2A 1FNHA 1U8JA 1DQMH 2NY3B 4K8RH 1WEJH 4KQ4H 2BVPB 5FB8B 3RU8H 1A0QL 3JVGC 5BV7L 1CICB 2AABH 4X80H 5D96C 4ODVH 1CLZL 5GS1B 4WGWB 2VDLL 1IAKB 3F7VA 2C3VB 3P0GB 1PEWA 4RISH 2ERJB 3O8XC 2OR7A 3ZYIA 1RZIA 3RWCA 4MJIA 5I1IH 1CFVH 3HRZA 3BKJH 3GMOB 3GEWB 5DUBA 4WUUB 2D9QB 3NGBB 2FIKB 2R2EA 3MLUL 3VXSD 5CP7B 1MI5A 1S7SB 2OR8A 2GSGA 2DQEH 3MV11 1FH5L 3BXNB 4HQQL 4TULH 5EU6D 4KV5E 3T1FB 5C9KA 4ODXB 3CUPA 4H26B 1DEEB 3MUHL 32C2A 4KRMB 5GRVK 3UBXI 2V2TA 4IRJB 5JIHA 2XICA 2IMMA 2WUBH 2BFVL 3BDYH 1T5WB 4M5ZL 4PYHA 4XMKL 2F58L 1CXKA 3BYYA 3NACH 1CXFA 1I7RB 5D1XD 4NRZB 3OG6B 4L4VD 4HUXA 4OM1H 3PQYB 4PJIB 5JNYA 2IPTL 2Z8SA 1OTTD 4MA3B 4HCRL 3QCTH 5D1QD 5JA8B 4WDIA 1YJDL 2ATKA 3QP3A 4NZJA 3LQAC 1HHHA 4HWBL 2HMIC 1F2XK 3QFJA 4UOW1 4BQCA 3P73B 5E24E 4DEPB 4D9RD 4MD0A 4ENEC 4LSUL 3HNVH 4C54A 5C08A 3FTGA 3ZTJG 1CQKA 4GRWB 2VXSH 3MGTB 5EBLB 1BIIA 2P8PB 2YD8A 4WUKL 4XPHL 2QR0B 4NUGH 2VB5A 4GAGH 3L7FB 3PWJA 4S1SL 1FFQA 5BS0A 3VE0B 5C3LD 3QISA 4WUUA 4ZSOE 2QR0A 4G9FD 4ELKB 4IDJH 5CUSL 2OMNA 4GKNB 2GTWA 3G08B 2R29H 4K9EC 2IALB 4GT7A 1LP9B 4HAGA 1GGBH 2ZWLT 4CU6A 4JEGB 4RIRA 3QDMA 2J5LC 3VRIB 5DS8A 5GGVL 5GS1A 3B9EA 3ZL4L 1FFNA 5EU3B 5C7XH 4QF1B 4OV5A 4PJEB 4D94A 4HIXH 1WGOA 1MCRA 2YD4A 3FFDB 5HJ3A 2R8SL 3BAEH 1INEH 1F3RB 4XXDB 3W2DH 5HYIA 2XZCL 2R56H 1SBSH 4QCIB 2HH0L 3RDTD 4JY5L 3IDYC 1UA6L 1T7WA 3L3DA 4LHUD 5IR1B 2P47B 3MRQB 3SDDD 5CS7A 3ZKMC 1IGJB 2CSPA 3NABL 1XIWA 2HTKD 5HHVH 1UXSB 4HFWB 4HBCH 1FYTA 4TNWK 1N59A 5IHUH 4KMTL 1F6FB 5JIKA 1A3RL 1E0OB 1F4XH 4PGZA 1FFOB 4PJAB 5LXGH 5I1EH 1BJ1H 2FECI 1X5JA 4F7PB 3DGGB 3KHQA 1CFSA 4K2UL 1MVUA 4YGVB 3SDAC 3WSQH 2BCKA 1MCFA 4DKEL 4F3FA 2HP4A 4XXCA 3FQNA 5I8OH 1S7TB 4P2RA 5C0NC 1GYAA 2G60L 1E4JA 1NFIB 4X7EC 1CZ8H 4WY7H 2ZKHL 3DPBA 5FO9B 3VRLE 2CKNA 3LZFH 2NY2B 2R0ZL 5H8DA 2H41A 3GM8A 4P2RB 4JZOA 1OTSD 3QQ4B 4FHBD 2GJZA 1JF5A 2X1XR 5D6CB 3HE7D 1H0DA 4BYHA 4M61A 2VXUH 3BIAX 4OGZA 4JFED 2IG2L 1DQDH 3KPRD 4HJGB 3RZCB 1NL0H 2DWEB 3SGEI 1D5MA 4HWEL 5DK2A 4IOFC 4Y88A 2C1OB 3D18A 4I4WA 1SBBA 1MCBA 1I3UA 1KJMB 5HHOB 1E4XH 1U41A 3MGAA 5I16B 2VLJA 4MSWB 4I9WD 4KJWD 3MBEA 4UTBH 3OAZK 4ZO9A 1OT1A 4OUUA 2EZ0C 2VDNL 4C56D 4WNQA 4F9PA 5CINH 1FNEA 1K9TA 2GY7B 3B6SB 4G7VH 1YPZA 4M48H 5T33L 3H9SB 4LAQH 2NCMA 4QY8B 3V52L 5T3XH 1NCBL 4JFFD 3TJHD 1TENA 5J0BA 3PL6A 2IQ9H 5IB4A 5ID0A 4Z0XB 3O3DA 1T0MA 2GSIA 4I3RL 2Z91A 3P0VH 2QQKH 3LB6D 2Q8AH 5KOVC 1IGMH 3IU4H 3OR7A 4Y4KB 1H8SA 1UCBL 2MTPA 2LTQC 3MACL 3NOIA 1I7UB 3L5WA 2IH3A 4QGYA 4X80L 5CJQL 4F7TA 5IFHH 2V17H 3LKSA 1IKFL 4GRLA 1HYSC 3HI6L 3WFCH 4TOYH 1LHZA 5SWQB 2A73B 3CZFA 1OAZH 3LEYL 4XNZC 3EAKA 4LSQH 2VQ1B 2DIBA 3H0TB 5AG8A 5FM5M 1XCTB 1XAUA 3CC5B 1N4XL 2OTUA 3WO4C 1QSVA 3I6LE 4QXGH 1WITA 3OV6A 3TBVB 3ARXA 3WDIA 4GW1A 1T1YB 3QDAA 1I85C 4NBZB 4NJAH 3C6LA 4IS6B 4LNRB 3PV6B 2XG5A 1QFUH 1Q9KB 1TITA 1KYOJ 5GRJH 3VFVB 1PDKA 4YWGL 4X6DE 4MQXC 4RNRA 3RL2B 1JWSB 4DUXA 5CEZL 1FYTB 2DQJL 4Y5VB 2VUOA 1DTUA 3BHBB 3BZDA 3E2HC 1A5FL 1GSMA 3BN9D 3DHMA 4P4RA 2JELH 3OKEB 3QDJB 1QFWL 2ZZUT 4JM2A 4WUUE 2FX7L 1T4KB 4XNZB 5F7EH 1KLGB 3QI9B 3PWPE 1ZOXA 5FYLE 4U6YA 4JKMA 3RPKA 3B2VL 2WSKA 5CD3A 2YPKA 2A1WL 4HUUA 3DX8A 4AIZA 4TYUA 3MO1B 2UYLA 4KKBD 4N8VB 1UWEH 3X11B 1CVSC 3PWNA 1RZKL 3CSGA 2AK1H 5FM5O 4KK8C 4DKFH 2P8MB 2BP3A 3T0DA 1XF4A 5DT1L 3L5HA 4YBLB 4O5LH 1KV3A 4ODXA 3OJ2C 3U4AA 4W4OC 2YOCA 2EH8H 1DLFH 3BMWA 5KSBA 1WT5C 2LU4A 4P2OA 4D8PA 3UJIL 2OSLA 5T1KD 5BV7H 4QXTA 3GMOA 5KJRL 1WZ1H 1FFRA 3H3BC 5DRZB 3MUJA 4X8XA 1KPRA 2HFFB 3Q6GH 2FIRT 3HN3A 3RUGA 1MFDH 5DMGD 5DGRA 1JF1A 1W0VA 2DWDB 3M45A 1YEDB 4IIQB 2X4SB 4KK9D 4NHCH 1UZ6E 5TGBA 2DQIL 2XTJD 2ATKB 4HUWB 3KJ6H 3DGGA 1JPGB 2X5PA 3BEVA 5I18H 4PJ7E 1CDUA 2YD2A 2PO6D 1T1YA 4V2BA 1FGNL 3RAJH 1ORSB 4KRLB 3MRJB 5LJYH 1ETZA 5DR5H 2V2XA 3IJYA 2NW3A 3TIDA 3SOBL 4H88L 4J3WA 4L1HA 1PKOA 1ZLWH 3X3GL 1TFHA 3HI6H 5C6PB 1BVZA 5J9PB 1IAIH 3H2WA 3JWDH 1CDYA 3SKNA 3QO0B 5GGQH 1EGJH 2VLLB 3TYGL 2CJUH 3FFDA 4YPGB 1U93A 4NQDD 3PHSA 4ETYA 3T0VA 1BBJA 3O6FD 5D1ZD 7CGTA 1D6EA 1XF5A 1CDHA 2ZSWB 5HSFA 5D2LB 3BD4A 1MFNA 4YIQB 4ZD3H 3GSRB 4S2SB 1ACYL 2W60B 1MJJA 1FLRL 2ZPKL 3N06B 1C5CH 1KCRH 2V2XB 3MR9A 4XB8A 4CN6A 5A43C 5I30H 2FX9H 4WO4C 1Y18B 3RWEB 4JDTL 1GZQB 5GIRA 4V1DB 2VDRL 4MMZC 5C0EA 1HINH 5E9DD 5TE6H 1W72L 1S8DA 5IBLC 3RWDA 3BH9A 5EUKA 5D96B 3TBYA 2YD7A 2H9GB 4ZFOB 2XQBH 4Q9RL 4NQTA 3WUZA 5DD6B 1FVCB 5HYEA 3GJEA 1WJ3A 2O5ZL 1I9JH 2BMKA 4UTAL 2P24B 4L8BA 4A2MA 1KT2A 4Y4FB 1PKQB 2ZOLB 2NY3D 3M1BB 3OKLB 3S3SA 12E8L 4X6FA 3WJLA 1LO0L 2DQGH 4JFHE 5HJ3B 5FUCC 5HHME 2X1QA 2CRIA 3SGKA 4XAKD 1TXKA 1CICD 3BPCA 1BFVH 2C3XA 4ZUWB 1LDSA 3T0AA 1GZQA 3E0GA 3CFKB 4HK3J 1A3LH 1UKQA 3RFZC 2Z35A 1CR9L 1NFDA 4QRRB 2NTFA 2Q6WA 1M7DB 5KVEH 4K3HA 2PKDA 4Y5XB 4HGMA 4LSSH 1INDH 4OBSA 2DOCA 5D1XB 4KRPB 4QRUA 4RA3A 4D0DA 3NZHL 4YHYB 1OGTA 3SDDA 4LIQL 5DYOA 3EJZC 12E8H 2VLKB 2WBJC 1F4XL 3L95A 4LSVL 1L0QA 2H26B 4IMLA 4M7ZB 1G6RL 3CFCH 2W1NA 4N0CC 5JIPA 3F58L 3FQXB 4JFXA 3MLTA 4MB4A 4JKLA 4MNQA 4TN9A 5JXED 3BUYB 4U4BA 1VB9A 4AENB 2YEZA 2C3VA 3G5VA 1MWAH 3TJEL 4NWTL 1NQBA 4YC2C 5D7IA 2HJLB 4WDIB 1JPSL 3GHEL 4X9IA 3HG1E 3GSWA 1FIEA 1K5NB 4QWWD 2W65B 3CGTA 4JM2D 1LNUB 3O45A 3GKZA 2AGJL 4PRNA 1CU4L 1OAQH 4N1CA 4UV4L 3IS1X 2NYYC 5BS0D 4XP5L 2BVYA 5CSGA 3WNOA 2R2HB 4QF1A 2X7LB 1YDPA 5JDJA 4LEOB 3EOTL 3NA9L 4OCWH 2ZCHL 1B0GA 1JMZA 3BIKB 4APQB 3T65B 4ZFZA 1A7PL 5KAQG 2K9UA 3D87B 4Y1AA 1CD9B 3C6LD 4FZEH 1MI5D 4CMHB 4KI1A 4XCCH 2AXHA 1MI5B 3TO4C 1SJHA 3MRGB 4M6NL 4L5FH 1IC5H 2XG4A 1DN0A 4GFTB 1S78D 4HIIB 2OS7A 4JKPL 5IF0A 1YY8B 3DYOA 5FV2A 4NM8L 2E7HA 5ID0B 1ONQA 4XPTL 3JV6B 2AV1B 1F58H 3GDBA 3DV6A 5CEYB 4YH6A 1FORL 4JFFE 4S1QH 1Z2KA 4H5SA 3GNML 1F11B 1AE6L 1Q38A 3TNNA 2YSSB 1U8NA 4KXZH 3TLRA 4G8GD 4LSTL 3MXVH 2BSTA 5C70A 1N64H 2VTFA 4HKXB 8FABA 5KSAC 1JHTA 2ADIB 5DURB 3MRIB 1K6QH 4HUXB 2HFGH 1PG7L 4TSBH 2GQHA 2YS4A 2HJLA 5ADPL 5IQ7L 4DQOH 3GSVB 2BNUB 4PP2A 1YQVH 3MOAL 4PJBA 3CDGA 3QUZA 1XF3B 3MLXL 4ZQKA 1MRCH 4F7EA 5DD6A 3ES6B 5BRZE 1P9MA 4LPXA 3SY0B 1RJYB 3IFNL 5HY9A 3H42H 4OAWB 5D7JC 3TCLB 1A9BB 1CDJA 2Y7QB 3MGOB 1GOFA 4EXPX 3CDCA 2PF6A 3LS4L 4HWUA 1PFCA 4PJ9D 4WI7A 3HC0B 5F93C 3KPSD 2WMPA 4LNRA 2CQVA 5IB1B 1C7TA 1S9VB 5DD5H 1XGPA 5HDQL 4YXHL 1U6AH 2A6DA 2NW2A 4XPFH 1JNLH 2ADFH 5ITFA 4JANA 5FKPA 3CAFA 5IFAL 1VEOA 4KDVA 1HDMA 1NAMB 1P7QD 2AK4D 1ZGLB 5DRWA 3MBXH 4MQSB 4AK1A 3DRQA 3KLHC 4HIHA 4G8GA 3M17B 2J8UF 2WWMC 4O51A 1OY3B 1Y6KR 4NQUA 4OAWA 1K4CA 5A3ID 4LF3B 5FEBA 2CLRB 3Q3GB 5B8CC 4EI6A 1IGJA 3GO1L 3LEVL 4LCYB 4HD9A 1EHNA 4I18B 4FFYL 4RAHA 5E2WH 3VGAB 5KOMC 4PREB 3KPOA 5DEZA 3N50A 1S3KL 4R96B 4BFIA 1UM6H 1KFAH 1U58A 4OF3A 3VJ6A 4XTRC 4NDMB 1F3JA 1Q94A 2AJVH 1CGWA 4PJXF 4XP1L 1DANT 1PYWB 2WUCH 2C4FT 3MRHB 1FYTD 2HYMA 3C87A 4YDJB 4PD4J 5L2JB 2HN7B 4RGOL 2EEDA 4XCFL 1TQBB 3SJVE 2EYRB 3G04B 4GG6F 3ABZA 4HIEB 1WISA 2FB4H 1QHOA 4NN6B 5D2NC 4K7PL 1EV2E 1FZJB 1HEZA 5GGVH 5IQ9B 1G7QB 3D0LA 3FRUB 4MXWL 3SGEH 2XN9D 1B3JA 1NH6A 1FFPB 4J3XA 4UIMA 2OYPA 3RIFK 1I9IH 1JZ4A 3SE4C 1J86A 5BRZD 1Z0MA 1PLGL 4FTVA 3FMGH 4PLKD 1FPTL 1OOAA 1MHCA 1HSAB 3SOBH 3P30H 2XRAH 5F96L 5E00A 3STLA 4DCQB 4UUJA 4X99B 4QHMA 4M43H 4HFUH 2YXFA 3RA7L 2PW2B 1FNGB 4ZS6D 2CKBB 3U46B 5GZNC 3V52H 4ODWB 3CCHA 1BF2A 2YPLE 5E1AA 1T1ZA 4J2XA 1PSKL 5FCSH 4B41A 3MRLA 2VZTA 2DLIA 1K5NA 3HLAB 4FFWC 3TFKC 3BSZL 4NNXA 4FQQB 3AY4C 4P5TB 3S5LG 1BOYA 5I1CL 3OPZL 5LBSL 1MIMH 2IANA 3NTCL 1AXSB 1IBGH 5DSCB 4Y5YB 3LHPH 4PJCE 1F00I 4ZYKB 1A6TB 2VISB 1Y0LB 3EZJB 4IRJA 4QRRE 5HTSA 3S4SB 5T1KA 1YN7A 4QYOA 1JHKH 3CDGB 3H7LA 4M8QB 3W9EA 2BNRE 5K59F 4HH8A 1G1CA 1EZVY 3QIBC 4XVTH 5HVHC 2MQ3A 1CXEA 3SDDB 3VXPB 3GMMA 2E6QA 3A6BH 3Q6FB 5DJ0B 5EORH 5L2KD 4IM8A 1KB9K 2WW8A 3Q1SL 1YMMA 3TZVD 4YDLC 2PYEA 2AEWA 2HRPH 3A67H 1VFAB 4LU5L 1ITCA 4U1SA 1MCWW 2J8UB 1JZ3A 3SO3C 4Z0BL 2EYTA 1P2CA 3EYFA 5EORL 1LO2L 5E5MA 4KY1L 2RAMA 1ZEAL 5EZOL 4YK4B 5HVWA 2BVEA 4QXWA 3ZKSD 4P46D 5AZ2L 1EO5A 2CDGA 3HAEH 4P46B 3W0WD 4HZAA 3V7AE 3WD5H 1KN4L 1CLYL 2DQDH 4EQ2A 4ODVL 1FAIH 4I0KA 4POZC 3NFSH 4X9GA 5HGBB 3I6LD 3DMMB 1WWAX 1F4WL 4K71B 4AT6A 3DXAE 2HTLC 1LK3L 1RUKH 4UILH 1DUZB 4WFGD 2L7JA 4R0LA 4AQ1B 4F7MB 3NGBC 1A2YB 3RL2A 2QSVA 3RZCD 4ZMAT 1SBSL 4AT6B 4NKMA 2CH8A 5C9JA 2CIKA 1BJ1J 3T3PF 3B8YA 2IAND 3VRJA 1UM5L 4N9GA 4R90H 5B3JE 1ZE3C 4XBEL 1U58B 1XGRB 2D2OA 4OZIA 3T8XB 4XPGL 2L7UA 1RUMH 4YLQT 3RA7H 4GKZA 5TDOB 2XWBA 1H5BB 4JDTH 3DI2B 4NZTL 4U6HB 5C0ND 5D7LB 3UMTA 4JKPH 2VQ1A 4OKVA 1D6VH 4I1NB 2VXQL 2MNUA 1YYLH 4QEGA 2CK0L 1J9CT 5I8KH 3UCRA 5CJXC 2X4NA 4LCWB 3F7PC 1UJ3B 1UEMA 2J6EH 4M43L 4UINH 5IVXF 2YXMA 5TPWL 4XCNA 1S7XB 4FTVB 5JZ7C 3D3VB 5BO1L 1OARH 3ESUF 1UB6A 3UYRH 1AC6A 5EUOB 1F90H 4J3SA 5EZJB 5EO9A 1OM3H 2XT1B 3CDYA 4F9PC 2VZVA 2FYYB 5INCA 5I73C 5CBAB 2XWBB 4Z7VA 3U4EA 1NCBH 4O2EA 1KJVA 4P46C 2IFGA 3IJYB 1N3NA 4U0RB 4HWZB 5F6HJ 2VIRB 4LDLB 4IHOA 1OAXH 3O9WB 5D9SB 5E2TL 2XA8H 2OZ4A 1CE1L 3QUXD 4JGJA 2DIAA 1N6VA 2EICA 6CGTA 3GMQA 4ODBD 2EDEA 2Q8BL 2D0HA 5C07E 3FO9A 2ZOLA 3EO1A 2VYRE 4UDUB 4JFZL 4NN5C 4HUNB 1NBZA 1P5VA 4M03A 3WBDA 2QV2A 2OSLB 5EU6A 1EXUB 4PJDA 1TETL 4YNYA 3SHSA 4FNLH 4E0RA 3QDME 1T21A 5ICXB 4K8RD 2X4PA 3DI3B 3RHWK 1D5XA 3LMJL 4KAQL 4JFEA 1YJDC 4GRWF 4HBQA 3LD8C 2YD3A 1YMME 2YD5A 4JFDB 2GFBA 5HVGB 2AEPH 3S5LB 1ODAA 3V7AG 4RFOL 2VN7A 2X4NB 1CFNA 1RK1A 3VWJA 4Q2ZB 4OCSL 1L9NA 4U1GC 4E41A 5EPMA 5A2IH 2LU7A 5F9DC 5DRWB 5H94A 3KLDA 5DS8B 4D0BB 1T0NB 3UZEA 4OFDA 4DAGH 1PEZA 3UBXG 5C09E 4PJ5E 2HG5A 4M5YH 2ARJQ 4CDHA 3KPMA 3RNKB 5E8EB 3FQNB 1OTUC 1S7RA 2W9DL 4OZHA 1K8DA 4X4XB 1T1XA 3MRHA 4YDJA 5MEPB 4X4ME 4HAFA 3HC0A 4NOFA 4UBDD 4JREC 3DVNB 2OK0H 4U1IA 3D3VA 5EIIA 3HUJF 4XC3H 3WV0A 1T0PB 1XF1A 4HS8L 3B5TA 2A9MH 1XIWD 2PR4H 4LRNL 3TBTA 5FDWB 1YEEH 2FATL 3V6ZA 5DZLA 4WFHE 4Y4HC 3SJVB 1S7WB 5E8NA 5C86A 1LO3H 3WFDH 1EVUA 1BQLH 2VLRE 3O4OB 1AGEB 3I9GL 1A1MA 4Y16D 1T66C 1I4FB 4H0GA 1T2QL 2JIXD 3TJHC 1G9MH 4NN7B 2VDPH 4I5BA 5IEKB 1NUGA 2IPKA 4XNYL 3FOLB 4TUKH 2BVQA 3WLBB 1YEGL 2F8XC 5EU5B 3UJJL 1OAYH 4ONHA 1EFQA 4LGRB 4X6EB 4HWBA 4NJAL 3ARGB 4QHMB 3BKCH 3HB3D 3SE8L 1TIUA 3BW9A 3LD8B 4YHPA 1YMMD 1Z9MA 4ODTH 2HAZA 4WUUD 3SE3A 4NFDA 4JO3H 1G0XA 32C2B 4YBLC 2OK0L 1EFXA 4RAVA 4HX1A 1N5YL 2P48B 3ULVL 2IF7A 1NAML 1CGSL 3U48A 4ELMF 5DVLA 5LQBH 1ZT4B 3DVIA 4LPUA 3TYFB 4ODTL 4BSVA 1UB6B 4GAJH 4BK5A 2HT2C 2IADB 1DBKH 4IRJD 1P4BH 3GMPB 5FHBH 2ID5A 3O8XB 3HRZB 3QULB 1J8HD 4D0BA 4E41E 3GSNL 2EDWA 5DK0A 4P4KD 3QEHA 4N8VA 2M26A 2Y9RT 4U49A 3RWFB 5A2JH 3GMNB 4KJWC 5JOFA 3NABH 3HZKA 4I8DA 3O2VH 5I1JH 4L9LC 3WIFB 4WNQB 2GCYB 3ME0A 4LLDB 2FEEL 4CGTA 5JIIA 2W65A 5C2UB 5EU7E 3BKMH 2JIXA 4ZUTA 4M4RA 1TETH 4FQ2H 5JXEC 5KTEL 4OZHE 4QHLA 1HHIB 2D4DA 4U3HA 5GS1C 4NFCA 4H5SB 5I1JL 1TTGA 2P5EB 1RQ5A 2R2CA 1J1XL 3UX9B 1O7SA 3HPLA 4PB9L 3SJVA 2D7MA 4XAWL 4HQQH 2R2BB 3OKNA 2YKLH 5D5ME 3IDGB 1YMHB 5IB5A 3OKKB 3H9YA 4BH7B 3DMMA 3I85A 1P53A 3BKYL 4KV5F 1DZBA 2DQHL 4TUJA 5C0EB 4FQQA 1ORQB 4P9ML 2JB6B 4M62H 5BZDA 4DKAA 4GAGL 3MNWA 4FXLA 2QLVB 3U4EB 5E1HB 1OLLA 1NKOA 3P2TA 3UPRA 2XZQL 1RHHA 3BH8B 5FV1L 3ULUH 1S9VA 3EYVA 3WE6A 2DS4A 5F89A 1MHCB 3RU8L 1INQA 4FQHA 4L8CA 1BBJB 1CR9H 3QNXB 3HE6B 5FA4A 4WFFE 2Y5TA 5GGQL 4IRZH 2EEAA 4WWKD 1NGYA 2AEPL 4U7MA 4G8FB 2Q7NA 3MC0A 1YYLL 1D5ZB 2EDKA 1TQBC 1FFPA 2RIKA 4UIMB 2NR6D 1RJLA 3TO4D 4HDIB 5SX5K 3GHEH 4I18A 3TA3D 3MYJA 3OF6A 1GPOH 4Z0XA 2GHWB 4RQQB 5EWIH 3O4OC 3MRCA 4M7JH 2P5WD 3M8OH 4WJ5B 4HK0A 4JG0H 2CLVA 3QXUA 5E4EB 4J3VA 2E9BA 3SBWC 2JJSC 5BZWA 2NLJB 3FL7A 3A6CL 2BRRL 3UTZB 1PZ5A 4V1DA 2VLKA 4LSVH 1ED3B 3ROOA 4KMQA 4F2MB 3MJ9L 4XMLL 3ARFA 2M2DA 3G6JB 2Q76A 1P84K 2XFXB 3KXFD 3VCLB 2X70B 2FWOB 3GMRA 1DP0A 2HJKA 4DK6A 3NH7L 3U0WH 2GEEA 4OSUL 4YDVA 4ZODA 4HIIA 2QKIB 4F33A 1KCLA 4JGUA 4NQCB 3TN0C 4N90D 5H35B 4IRSC 3HCVA 3CH8A 4PJHE 4B50A 1A3LL 3QFJE 3IFPA 3QCVH 3RZWA 4LLQA 2P8PA 3V5KB 4UIKH 1AGBB 4FQ1H 1Q1JH 5ESVA 5TE7L 5J06A 3H6JA 3M17A 4WHYH 3EOBB 2AEIT 3VA2C 1ACZA 2FZ3B 1I1RA 1YQ2A 2CXKA 2HTKC 4CADA 5HGGS 4HHAB 1UVQB 1S5HB 1CFTA 4ZOCA 2R4RL 2ZCHH 3MREA 1FZKB 3DECA 4I3SH 4RMQA 4FQLH 2IMNA 4JY6B 2XWTA 4AEFA 1JBJA 3LH2L 1P1ZA 2ZUUA 4F15B 2H3NB 3TGXA 5KZCB 1AH1A 4AEIL 3FAXA 1TTUA 1XZ0B 3H8NA 5L6YL 5HDBF 2PYFB 1JPSH 4HWZA 2Q20A 4O2CB 2LV4A 5C0IA 3ZKXC 2P4AB 3BX7C 1BQLL 4OF6A 2ZPKH 4APQC 1MFDL 3FONB 2XTLA 3QJFA 2WV3A 1P6FA 1U95B 1QSFA 4W6WB 5GGUA 3UAJC 4IJ3C 3MRIA 3MJ7A 3QIUB 5I0ZA 1QPPA 4N0CD 2EDRA 1NEZG 4FXGB 2DQCH 1NUDA 1CS6A 3QYCA 4Y7MA 1FAIL 3R8BB 2B2XL 3WJJA 4WU5B 2PTTA 3O0RH 4OZFA 3LKQB 4QRSB 4XB7A 5IB3A 3QIWB 1JGDA 4EI5C 2MHAB 2FSEB 3QDGB 1E4WH 1YEHH 3BH8A 1TCRA 5EN2A 4XGZA 3DXAA 4L4TD 3HNSL 3UPRB 5JUEL 2NY1B 3C5SA 2XZZA 1JGEB 2FHFA 4Y4KD 2ZSVB 4KVNL 2BVQB 2IH3B 4YE4H 5DR5L 5JDSA 4Z7OE 5D7JA 4U3XA 4X6DF 1QLRB 4D2NA 1A4JA 4JFYB 2XXMB 1MAJA 1FO0B 1U8LB 2EDNA 1FC1A 5A2KH 3QCUL 5CAYB 5MEND 1FVCA 4P0DA 3D6GA 4UT9H 4DOHB 3S4SA 3IDJB 4KRPC 5I17B 2EC8A 1EVTC 4ODHH 2EYRA 4GS7B 4J23A 3CU1A 1TLKA 3BSZH 3MFFB 2R2HA 3K8KA 3IJHA 2AK4E 4GUPA 3FO2B 3AREA 1BZ7B 4UU9A 5CHNA 4YWGH 4N0UA 3WD5L 3GSNH 5E2WL 3FHAA 4MZ2A 1Q9WB 2BSSB 5D7IB 3QAZB 1NC2D 1BVKA 4TPRH 5CEXA 5FAAA 1CE6A 1Y6MR 1SEBA 1I1AC 1YYML 3KR3H 4PRIA 3S34L 2Q87A 1HH6B 2A73A 2NNAB 5B8CA 5E00B 1CFNB 3H9SD 1RZGB 2G5BB 2QTEA 4GW4B 4QOKA 2F53B 1BEYH 4NYLA 3Q1SH 2YUZA 2YWZA 3RBGA 4U6YB 5F9OL 5D7LE 1I8IA 1NLBL 3B2VH 3PHOA 4HT1L 5HYSG 3RDTA 3T04D 2KPNA 3E1F1 3MUY1 1V5JA 4RCAA 5I15H 3N0PB 3EOTH 4JHWH 2XI9A 4NO5A 5KVMC 3RWJA 5IQ9A 4XCFH 4JO2H 3GIVB 4LLYB 2KQMA 3EJJX 4YHPB 1HKLH 2DB8A 3E2HB 4H1LH 5CEZH 4M62L 3SCMB 2HKFH 4I3RH 4BQBA 3WHXB 5JPMB 5JXAL 1GIGL 1T03H 3UO1H 2MQ0A 3BP5A 4AIXA 4J3TA 1WBXA 5T3ZD 5F7DB 2XNAB 4GMTL 5K9KB 5F9JA 4GW1B 3QA3B 5C0CB 4HULB 3VFMA 4Q6IA 1K8IB 4EZMA 4BZ2L 4YO0B 5DRZA 5AYUH 5DJ2A 1T3FB 3RWJB 5GS2H 1S7UB 1T5XA 3SKOA 5DMGC 4R8WH 4ONFL 3U6RB 5HDOA 2EE6A 1ZSDB 1F3DH 3TBTB 4QRPB 3RGVD 2YRZA 2EIEA 1S9WA 3DX9B 4LLQB 5DUPL 1QKZL 1JGLL 4L3EA 5L9DL 4GRMA 3ARRA 2ZG2A 2AJ3B 5C6WH 4PRID 2EH8L 4O2FB 3T0WA 4D0DB 1NCWH 3EYVB 3WE6B 1ZS8B 2PO6C 1L7TL 1T20A 3P4LA 5IHBA 3HE7A 1NAMA 4CW1A 1K4DA 5CEXB 1UT9A 3C60D 3LY6A 4HUUB 1UYWL 4MX7A 3TIDB 1GJIA 5IFJB 4DKEH 4YHML 2VLMD 1MHHA 3IGAA 1YNTB 3N85H 3GSNA 5LKNA 3ET9F 3ARFB 3G6JA 5H94B 2P7TB 3WFBH 3B6SA 1FC2D 4IIQC 3D3VD 4L3EB 5CINL 4YPGA 2P46B 1JYXA 2RB8A 1KXTB 2R39A 2MKWA 2DD8H 4CVUA 3O4LA 2E9JA 4X6FB 4BFIB 2J8OA 3NIDF 4KFZC 3BP6B 3O2WH 1YDPB 1ZGLP 2X1PA 4QRTA 4R4BB 2ZUQC 5L88L 3MJ8B 1INEL 4XPBL 4XMPH 1JCKA 4MDIA 3ZE0F 4X6CB 5DK2B 1MCSA 3IF1B 1T7YA 2CDGB 3KJ4B 2D9CA 4S0TD 3ZL4H 5C7XL 1DVFB 4JFQA 5EUKB 1WAAF 4K3DH 4GXVH 1V7NH 3UYPA 4JO2L 1LO3L 3EUUA 2R8SH 5F3BB 3MX0A 4H1LA 3L1OH 2UUDK 3EFDH 2NY4D 3PGDB 4WHYG 3GK8L 3KPLB 2IANE 1RULH 4K94C 1N4XH 3CLFL 2APBA 3OMZA 5TDNB 4YIQA 3ESVF 5DFVC 5I6XC 2HVKA 1MIEH 3TYFA 2H2SD 4ZXBA 1JN6B 5CJOH 2ICEA 4KJPC 2LVCA 4N5EC 5K9OA 3HS0B 1TNMA 3B8SA 5T5NG 5J56B 3R1GL 5CZXD 3QXDA 4MVBC 3OKDA 5BOZG 3P0VL 1YPZB 5C08D 3QUZD 1I8LA 4L4VB 5DUPH 1CYGA 2OLDA 1RK0A 1RURH 3VG9C 3S3JA 1JGUL 4ZSOA 4LCCA 5GISH 1SJEA 4NPYA 5IKCA 5ALCL 3KNBB 4PJCA 3OZ9H 4XH2A 3VD4A 4PJEA 3K4ZA 5E1AB 2O5YL 4W68A 5JOFB 3HR5B 3LQZB 4G80B 3O9WD 1DQLH 4LMQI 4S1QL 4CADB 4JRYE 4MCZA 3MLPA 2Z31B 2QL1A 3JV0A 3S9DB 5SWSE 3SCMC 1SY6L 2BNRD 4N0RA 4PJ9A 2GSGB 4WTWA 3WKML 4EVNB 3K2UH 2DD8L 1OAXL 3S8WA 1BVLB 3CPLA 5KSBB 2Y23A 3QT2A 1OD9A 2VQUA 1ERNA 5IT2H 2N7BA 5JPNB 1DE4A 1FIGL 1N7MH 1CD1A 5E7FA 5HPOA 4RBPH 2CDFB 4YHZH 2YA2A 1S7TA 3BP7B 3NCJL 1V05A 2DDQH 3HAEB 2HN7A 3BZ4B 2XIDA 3TN0B 1LO0H 2DQGL 5E99H 4G8IB 4YFEA 2X4RA 3G6AB 4NOBA 3FOLA 3MNZB 1AGFB 3ALPA 1BM3H 4YUEH 2DKUA 4RA0C 2R0KH 4M7LT 4ZSOB 3NN8A 4JM2B 4Y4FA 1CG9B 3TO4B 3MXWL 5KS9E 3V6OC 2YEZB 3IDMA 4JDVB 1JYWA 5EDXA 3RNQB 3I3EA 4QXUH 4YGAB 2CR6A 3WUWA 1KACB 5FYLL 3B3IA 3WXWH 1WWWX 1OF2B 1FZOB 1LO4L 1G6RH 3KAAA 1INQB 1PY9A 2VDOH 3PDGA 1EHLH 4NNPL 3BMVA 15C8L 3QH3A 3RUGB 3ARTA 4XBGA 3LIZH 4NO2A 1UC6A 4LAJH 1E27A 4GAYA 1AR1D 4S1RH 2AJSL 4OLWL 1C5CL 1KCRL 2GY5A 4Q9QL 3G6JF 5GGRY 2K7QA 4M3KB 4Q6YA 5C07D 1YEIH 4P57B 4FG6D 5MP6H 2NMSA 5CFHA 1C8PA 3IS0X 1BFVL 5SWZE 4PJ9B 4R26L 1DEDA 1FZOA 3JV5A 4U3CA 4F15C 2AJSH 3R0NA 1LO2H 3FB5B 1CLCA 3IETB 5C8JB 1WIPA 4JPKH 5H35A 3SE9L 3QHTC 4JFPA 4PRHD 1F3DJ 5T1LD 4RMWA 2E7BA 3JWOL 3KS0J 1XMWA 3EYSL 4J1UA 1ADQA 3ARED 2YPKB 3PWPA 1A6WH 3GMQB 3RVVD 4XP9H 1SJEB 4Q58C 1NANH 2D31A 3V4UH 2RQ8A 5JQHC 2FGWL 4C57C 1AR1C 5ELIA 5EBGA 3T0EA 4M1DH 4CBPA 2CO6B 1X5XA 2ERJC 3VXUB 4R97C 3I84A 3B3IB 1HXMA 5KZCD 4TUOB 1FVEB 2VABA 2EXYD 2R0WL 3TJEH 1UWXK 2J7LA 5IFJA 3G08A 3HZVB 4MJ2A 3QO1B 2HT4D 3MLYH 3HI5H 4M1GH 5IJVB 1SJXA 1M6OB 3NN8B 5FYKD 1QG3A 1DSFH 5CD5C 4I2XA 4ORZC 3LQAL 4ZXBB 1A6WL 3FO1A 3BZFB 4N1EA 4RGNB 2XZQH 4HJGA 4L9LA 3K81A 5FUZH 1W72B 5ABDE 4MB5A 5MENA 4MJIB 1A7OH 4PTTB 43CAA 3O3BA 2VKXA 2NPLX 2QBWA 2FECL 3MRKA 4PB0L 1UB5A 4P9MH 5HYJA 4NT6A 4DVRL 4K23H 1Q9WA 4WO4B 4MZ3A 1BJ8A 5KSVB 5D6DC 1H15A 4LKXA 1TJIL 3PP3K 4Z7WA 5J6GA 2VMFA 3DNKA 2ADJB 3HI1B 2FGZA 4K3EH 3F65A 2PUQT 1MVUB 3DIFA 3VFRA 2GSIB 5HHNA 3O2DL 2F15A 2X89A 1G7MA 2JF1A 3IDXL 5IB4B 3LRHA 3ES6A 3KPRE 5CP3A 2QADD 3D1MC 4NQEA 3BKML 3NPSC 4JRXB 4KHXL 4PGJA 1JRHL 4P3CH 1JGVL 3EYUH 1NCCH 2VDMH 4XWGH 3ECBA 3NIGE 4HC1A 4RFEA 2EDJA 1MVFA 1BIHA 2ICEB 4GMTH 4PJIA 5D1QA 3RIFF 3CFDA 5JR1L 4ETQB 4HKZB 4MB3A 3RBSA 5EIQA 3U83A 3E8UL 2BC4A 5I16A 1JI1A 2OTUB 4MNHB 4ZXBC 5JA9A 2LAAA 3G5XB 1OGAB 4X4MA 3H0TA 5FYKL 4RMTA 1FL3B 3STLB 3F7VB 1HNFA 3BISA 2FL5B 4KTYA 1U3ZA 1DLHB 1MFAH 4I0CC 1XGQB 1T83A 4NUGL 5CIPA 3CXHJ 1LP9E 3L9RA 5IMKB 1O7VA 1J5OL 4TQEH 5D7JD 4YNYB 5F1NA 3TM6A 1U95A 3CSYB 1MCHA 1MCJA 4OGAC 1PKQA 4EI5B 2ZNXA 3SDDC 1KB9J 1RZJH 4LSRL 5CZVL 4F33B 4WY7L 1BHGA 2UY6A 4EN3C 4M48L 4GXVL 1QSEE 5J6HA 4YXHH 3BGFB 3WHE1 3AM8A 4JRYB 4K9EL 3QEUA 4YBQD 3QZWG 3HMWH 1CN4A 1X5FA 3AU1B 1HQ4B 4ONOA 1BAFH 2NY1D 1I9RL 4WEUD 2NZIA 4NQDB 1IAIM 2P5EE 4L3CB 1RZ8B 4WHDA 4NNXB 3GBNH 3EIFA 4NO0A 4XBPA 1B6UA 4XVSH 4NHCL 4PJ9C 3VXTB 5BJTB 3MCKB 5KANI 1RJZB 1P69B 5FHAH 2HTLD 3QIWA 3W2DL 3JV4B 5EU4B 5FDWA 1OAZL 3LEYH 1Z0NA 4F58L 4U6TA 2V2TB 3N85L 2I9LB 5JW5A 5DTFA 1DEEA 3P40A 3MV9E 2QSTA 1QBMH 5KN5B 2XA3A 3TT1H 2QHRH 1FFNB 5EU3A 1K3ZA 1AY1H 3PJSB 3FO0L 3MACH 4OCYL 1MUJA 3FT4A 4BZYA 2J8HA 2QQNH 3QHZL 4XHJD 2JJVA 3QQ4A 1I7TB 5FGBC 2YRPA 3QEGL 4TSCH 3H9ZA 3TV3H 4MXQC 2YN3A 3P4MA 2ZUQB 4Y5XA 1U3HB 1KJ2L 5E8DL 3MRPA 5B3JF 2Q6WB 3CXDH 3LMJH 1JNLL 3CPLB 3MUZ1 5FA3A 2G60H 4JRYD 3BP5B 4HUWA 4AYFA 2QEJA 3UTSD 5JPMA 1HOCB 3V6FB 3MGTA 4K2UH 2YUXA 1MCDA 2ICES 5C08B 4P2RE 5DXWA 4ENED 3GUTA 4RSVA 4K94L 3VFSA 1BMGA 4MSWA 3DROB 3MBED 4HMDA 4KTDH 4HHAA 4J3OC 4EI5A 1GOHA 5D1QC 2DYPD 5DQDH 2Y07H 3CSBA 4HIXL 3U7AA 4AEIH 4NQEE 4YFLI 5A3IC 3AS3A 1PD6A 5GGTH 3ULSB 1RUAL 4NWTH 4JY5H 4PPTA 4KTDL 4P4KA 5DLMH 4NYLB 5MEOB 4ORGB 3WFHB 2IG2H 1H0DB 3L3HB 43C9A 4FFVD 2OBGA 4LPYA 4M02A 1ZLSL 1IE5A 1BFOB 2EDYA 5E5UB 3KYKL 1ZGLM 3LPGA 2LAGB 1NLBH 1QVOA 1U0QA 1XGYH 1YY8A 5D2LE 5CBAA 4NO5B 4MHHG 3U30C 4U1LB 2A6DB 5EC2A 1LK2A 4CAGA 3QI9A 1JNNL 3IJHB 2XV6B 2F19H 5I1AB 5CKGA 3V8CA 4V1DE 4GBXA 1AGDB 4H88H 2A6KA 4HMCA 4OD2A 3VXUE 5FF6B 4NQCE 2FBOJ 2UZIL 3SKJL 1CLZH 3AVEA 3KYKH 4H1LB 1ZT7B 3MTRA 5GZOC 1YUHB 3ARGA 2BNRB 5F44A 1MFCL 4ZUVB 5AD0A 1ZANL 4XH2B 3ARDB 3FFCB 2F5BH 3CH1B 2R56L 1ZT7A 3NFNB 1U36A 4LK4A 1QSFE 5JW4R 1U92A 1MHPH 1BWWA 5T1LA 3SO5A 5CGYD 3WHE0 2YC1B 1Q0XH 1RZJC 4XNYH 1LK3H 1RUKL 4UILL 2ICWJ 3VFGL 4X98A 1RK0B 2CKBA 2EXWC 3U46A 1JV5A 3TWCL 5FYLD 1GGIH 1CK0H 3SJVD 3I9GH 4PGBB 5C0AB 3V6ZB 3KYNB 2O61B 1XCQB 3BDYL 2WIIA 4YE4L 5DEFA 1HH9B 2VLME 4EN3B 3ZHKA 2AQ2A 1RZFH 3MZGB 4K23L 4DZ8A 5M94B 2Q7YB 3HNSH 5GS3A 2HWZL 4R7NB 2F5BL 4N8CH 4X5WA 1G7QA 1HK6A 2XOTA 3DGCR 3QJFB 4X9HA 1VFBA 2X09A 3OAYH 3ARGD 1VFOA 1G0YR 3VXME 3L3HA 4J6RL 43C9B 2VXSL 3DXAB 1VERA 2NY4B 4EXKA 3KG5A 3QWQB 1D9KD 3HNVL 4FA8A 1ZXQA 1EEZB 1BQSA 2EXWD 1KJ2A 3GI8H 1E6JH 1RSFA 1OLZA 3W11C 2RCSL 3HI5L 4LVHB 4Y16B 5IKCB 3UPCA 1LEGA 4TRPL 2VRAA 5IEKA 1F5WA 4X6CA 1HZHH 4LVOB 5DJAA 4AL8H 4NJ9L 1A4KB 1NC2A 2HKHL 3FQRA 3KDMB 2W0FA 4EI6B 2F58H 4AIOA 1NBZB 3HC4H 2AK4B 4PLJD 5HHOA 2CLRA 4KJQC 2JE8A 3THML 1BFSA 4JLRA 3QULA 1T04B 3WCYA 1VEPA 2JB5L 1RFDH 1JF6A 3OHXB 4OTXL 3TBYB 3WMSA 3LV3B 1E4KA 1UA6H 4LRIA 1ES0B 5GS0C 1C08B 1R5VB 1T6WA 2DMBA 3GBLA 1A7BA 1JN6A 2V9RA 2BXYA 1H3PH 3NIGF 3BAEL 3FRPA 4HX1B 4R97B 3Q6GL 3WN5A 2ZOKA 4UT9L 1S9YA 2XA8L 5J89A 4QO1A 3HNTH 3HMWL 4GAYB 3OJDA 4D3CL 5HDLA 3UDWC 1HKLL 4Z7VB 1IMHC 3QUYB 1BFOA 4GXUN 2BVOB 4YBQC 2NW2B 5FYJU 4J3UA 2ZOKB 1R5WB 2R15A 5AAWA 2D03L 3QPQC 4JAMA 3QQ3B 1D6EB 4N5UA 3JWNC 5TE4H 3V6OA 2UVFA 4F7PA 4UNVA 1JMXA 5FOJA 4MXWH 2W07A 4KJQD 3GGWB 2AABL 4PJAA 4EDWL 4RFNC 5C0DA 2IFFH 4OSUH 5BJTA 1A6VL 4CDGC 5B8CB 1A7OL 5GJSL 4KDWA 3TA3B 3P9MA 4CVZA 2VXVH 4E42B 2R1YB 3QXVA 4M6AA 4IMKC 1ZA3A 1WCBA 3TPUB