1QYGL

Anti-cocaine antibody m82g2 complexed with benzoylecgonine
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
DIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGYTYLHWFLQRPGQSPQLLIYRVSNLASGVPDRFSGSGSGTAFTLRFSRVEAEDVGVYYCMQHLEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPQDITVSWKIDGAERSSGVLNSWTDQDSSDSTYSMSSTLTLTKDEYERHSSYTCEATHKTSTSPITKSFNRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB M82G2, LIGHT CHAIN
publication title Diversity in hapten recognition: structural study of an anti-cocaine antibody M82G2.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2003-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qygL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qygL01
4MNGE 3U7WL 2UZIL 2SEBA 4D3CH 1ZT7B 2JIXB 4O2CB 4OKVA 1U6AH 3FO2B 3ULSB 1SJHA 1C5CL 1FG9C 1I7UB 3GK8L 1G7PA 1EK3A 5C70A 4FQJL 4IS6B 1I3UA 1MRFL 1EAPA 1Q9OB 4M9OA 3VXSA 2GUOB 5C0GA 5HDBE 1T0MA 1PKOA 4C59B 2EYTA 4QHNB 1BD2B 4PTUB 1OTTD 4PJBE 3TBWB 4RQQB 5EWIL 2FX8L 4NQCE 3C6SA 5MP6H 3WXVH 2N56A 4JG1H 3K8LA 4KMLB 4XHQA 4Z18A 1GHFH 3CLEL 1D5BB 5D93B 3SE8L 3UYRL 1GPOH 3RTQC 5HD8D 4OZHA 5GSVB 2UYLB 4FA8A 4D8PB 1FJ1A 5D2NC 1DUYA 3FFCB 4HXBH 1X5LA 5DQJA 3NMEA 1S7SB 1KUMA 4GBXA 5I1EH 3PDDA 1A7RH 5DMYA 1JNLH 3TZVB 1WEJL 2J4WH 4O58L 4G6ML 1NFIB 5CZXC 2OP4L 3QA3B 2LV4A 3EHBC 4OF3A 1R3LB 3TFKC 4MA1B 2IBGA 1MY5A 2FBOJ 4LCCC 2IBBA 3LV3B 5DO2D 2DLTA 4JPIB 3SDXF 1YMHA 5E2VL 1BWMA 1NAML 3I2CL 4PV8A 4R26H 2FD6L 5C07E 5IWLA 1NAKL 1I1AC 3GSUB 4PY8J 5MENE 5DR5L 1FN4A 4LSPL 5SWZA 5DMGD 1JF1A 5I1JH 5MERA 4QF1B 1HK6A 3GJFK 4M62H 2DTML 3IKCB 1P4BH 1QPPA 1DFBL 1NBZB 2WNGA 3BN3B 4WW1A 2PTVA 1N0XH 2H1PL 4BZ1H 1EFXD 4UMGA 5I8CA 5T3XL 4FMKA 1KB5A 1SHMA 2DI9A 5D2LF 1ZHKB 3U2SA 1XGTB 5FO7A 3BOVA 4XCNB 4KZDL 1QNZH 3KPTA 5DJ6A 3RDTC 4F80A 1D9KB 2PTTA 2F15A 1CDBA 1OAYH 4Y19E 2APVA 3ULSA 3HRZA 1CXKA 5TH2B 1EA9C 3GSQA 5ACZB 1I7UA 2XNAB 3KXFA 3QR2A 1NAMB 4DOHB 1KLGB 4TSCH 4DKFL 4U6XA 3UYOD 3IDIA 5EORL 1RSFA 1ZA6A 2VLKA 1G6VK 2R9HC 3G6JB 2JE8A 3HLAB 4RGND 3L95B 4PPTA 2NX5B 3C5ZD 4FQQA 1TTGA 1OF2A 4M6NL 4J3VA 5F3HB 3S35L 3NTCH 1T03H 2GQHA 4M7ZB 2DOCA 3GM0A 5IMOB 4WTXA 3D6GA 4FNLH 4EDXB 5LVEA 4KAQL 5J1TC 2A77L 3NCYS 4O2EB 3NZHH 3UX9B 1IQDB 5GSVA 5C8JB 1RK0B 1NDMA 4PJ8C 3WNNA 2FJHA 3FFCA 2AV1B 4LSUL 3ILQD 5E94B 4Q0XL 5MEQB 3H3KA 3GBML 3TZVA 2J8UF 4RFNC 1HZHH 3QA3A 4JY6B 3MJ7A 1RFDL 5DRXB 1NEUA 4JQIL 1R3LA 5D1ZB 3MCLH 5CD5D 1UEMA 3EJZD 3OG4B 4ZYKA 3P9LA 1HI6B 4JPIA 2L7UA 1MHPL 5A2JH 1P84J 3K46A 3MJ9H 2C4XA 5I30H 2DS4A 5C6TL 3QPXH 4OB5L 2LAAA 2K1MA 3I3BA 4Q6IB 3RTQA 1S7WB 5FYJD 3MV9D 4K3GA 2DD8L 5KS9F 1IT9L 4QF1A 5SX4I 2DQHH 3IKCA 3RBSA 1I9JH 1NBZA 3HA0A 5D2NA 4IOIB 5IOPB 1UKQA 4GH7B 5E56A 5I8KH 1ZHKA 4JJ5A 2VDPH 1B6DA 1TCRA 1CFNB 2HWZH 3MCG1 4R2GB 4XCNA 3V4UH 2MSPA 3ARTA 3V7AE 4C4KT 3AY4C 4LCCA 4OZGF 3HZVB 1MJJB 1B0RB 5DHXB 1DUZB 1EFQA 1GOFA 4JFFD 1KXQE 1RIVH 3CXHK 5I6XC 3MLUL 5EPMB 1I1AA 3FB6B 2A1WL 3VI3F 3VMPA 4P46D 2A83B 5AZ2L 3L3GB 4NSKA 3QQ3A 5GPRA 3HLAA 4FXLA 3DROA 1INDL 3BEVA 1ZLUH 1H5BB 3CFCH 1SMOA 2O26U 1BAFL 3BE1H 5FAAA 4NUJB 1K4CB 5FDWB 1OAUL 2R1WB 1GIGL 2EDXA 2BY3A 5MEPB 2OSLB 2YXMA 3RDTA 3EZJB 4O2EA 4KJWD 5HI5D 3P77B 4QGYA 1SBBA 4S1RH 3PL6D 1UC6A 1JGEB 2ZNWA 1ADQA 2Y5EA 4HT1L 2NY4C 5CHNA 1TJGH 1S9YB 5ITBL 5EH1A 3RNKB 4WFHE 2DYPA 3LN9A 2ENSA 1FZJA 5GRXG 3KDMB 4LF3A 4J3SA 4C57C 3AB0B 2G60L 5HYJE 1Q0YH 4S10A 1ND0A 3EO1B 4KQ4H 4I18B 1B3JA 1LE5B 3L1OL 4PLOB 5TDOB 2OL3A 3F12B 1MLBA 4GXUM 1P53A 1PAMA 4EXKA 3RVWD 3ALXA 3ZT7A 5GGUA 3CFDB 1A7PL 1XH3B 4Q6IA 4QO1A 1S7WA 1NMBL 2DQDH 3NH7L 2IGFH 4LHUD 3ARSA 4O4YL 2DTSA 5EIIA 4GRWF 2AQ1A 1JGDA 4PJ8A 1Z0MA 5IOPA 1QSZA 4KU1A 2CLRB 4FQIH 1F97A 1LGVA 2CXGA 3NACH 1OWWA 2A6KA 3VGBA 3E6HB 4QHUB 4YHLL 5CWSB 1BECA 4H8WH 4AIOA 4EBQL 1I8MA 4MS8D 3VG9C 2EDFA 3EDJA 4ODSL 1E4WH 1T80A 3QUZD 3HZVA 5L2JA 3IGAB 2R2EA 3IDJA 5K9KA 4XP6H 3D0LB 4XBEH 3MV7A 2O5XL 5F9OL 3LQAL 4OCWL 4MLSA 5DJCB 2A83A 3DYMA 3L3GA 3FRUB 5D7KD 5FKPB 1FGNL 2NZ9C 3HE6C 4F2MB 4JO2H 1WZMA 4OUUB 5C2BH 1AH1A 1EMTH 1Q38A 3TF7C 2HFFB 4PJAB 1IFHL 4EOWL 5C3LD 4P4KB 3RU8L 4HS8H 5IG7A 1KELL 4OZ4B 1H8OA 4YFLF 2R1WA 3VWJB 3AY4A 5JHDA 3BRGC 4K2UH 5MEPA 4M93C 1CLZL 4KV5E 3EOTL 1F11A 1DBMH 2B4CH 2V5MA 4NO2B 2NCMA 3QXVA 2XYCA 4WEMB 2EDEA 3VXMD 3K4ZA 2FDBP 4QYOB 4TPRH 2VZOA 1RIUL 5TE4H 3GHBL 1K2DB 3PDOA 3B83A 2Y07H 1KJVB 3P73B 4X5XA 4M8QB 2Z31B 5J13B 1GL4B 5E9DB 1VADB 1HH9B 2YD8A 2YZ8A 3BZEB 5FOJA 3QUMH 3V4VL 5CD3A 2QQNH 4KHTL 4FRWA 1ZLWH 1OTUD 3K8MA 3MACL 4U6YB 1L9NA 5IUSA 2Z92A 1ZS8A 2C26A 3H9HB 4YDJA 1QBLH 5KZCB 4J8RB 5KSAC 3E2HC 3MC0A 2WWKT 5HI3D 3HI1B 1ACZA 2QEJA 3CH1B 4QHLB 5DK2B 4X6EB 3E6HA 4QHUA 3CVIL 4GXVH 1N5AB 2MKLC 1GCFA 4MA7L 1QSED 3SDCC 3LD8C 4F58L 4QGTA 1A7OH 1YEDB 2IPKB 1KCUL 3PABA 4HJJL 4WU5B 3BWAB 5ITFB 2EICA 2D0HA 5AYUH 4X9BA 5JPNB 2DL9A 1V5JA 3N50A 4G9DA 4B53A 2EECA 4BH8B 4Z7OE 1ED3B 3SKMA 5HHPA 2P4AB 5F1IB 1YEFL 5C0CA 4DN3H 3FRUA 3JTTA 3PGCB 3KPOA 5E2WH 2FX7H 4KJPC 1BGXL 2HFFA 4PJAA 3VFSA 4NZDA 4W70A 1RI8A 2J88L 4P59H 1MAML 4GAJL 4R3SA 4D0CB 1RZJC 1NCWH 2D0GA 4U0QB 5HHOB 3I84A 1CICB 4L4TE 1RZGA 1FNEA 4KRPB 4DTGL 4BK5A 3ZKMC 4FZ8L 3JWNC 1DZBA 1A7BA 3O3BA 5TQ2H 4LVHC 4XCCH 3V8CA 1SM3L 1GGCH 5ICYB 4N68A 3LN4A 1IAOA 5IBTH 2DQJL 2X4RB 1RUAH 1M7IB 2GFBB 4XMLH 4XI5D 3HE6A 5I8OH 4JFEB 1UVQA 2C1OA 2ZUXA 1G0XA 1F3RB 4J3WA 4RMUA 3N1PC 5DJ8A 3QRGL 4EQ2A 5HYEA 1KJVA 2YD7A 5EBMA 5C0NC 4M8QA 2Z31A 1MWAL 3LZFL 4JVPA 2B8OT 1GGIL 1DQML 4G9FD 4M03A 2OZ4A 1BBJB 2XKNB 1HCFX 4XH2B 4NT6A 3O9WC 4X5WB 4Y5VB 5H94B 1N64L 3G6DL 2C3WA 3MXVH 2VE6B 3JTSB 4KGJA 3UJJH 1WZ1H 1QP1A 4GRLB 4LVHB 1R24A 4D0DB 3TESA 4LCIH 2ZZUT 4Y2DD 3WFDL 2H2PD 4UNTA 4M43L 4WENB 3O3AA 2VH5H 3ULVC 2X4PB 2QADC 4PRDA 3RKDD 2XRAL 1MCDA 4AG4L 2ZG2A 2C3VB 2PW1B 4F15C 2KPNA 3OJDA 4BK4A 1MCPH 3KS0H 4U2YA 1CD1B 3SCMD 1G9MH 2AJ3B 3V6FB 1PKQE 3TV3L 1DQJB 4KKLD 3DURA 2GT9B 1YEDA 2ERJB 3CH8A 2IPKA 4MAYC 5FUZL 3BIAX 4WU5A 1YMMB 5JORA 1U8IA 4L8DB 4Q74A 1MWAB 4F7MA 5DC9B 4Y8DC 2FJFA 2B2XL 2QQLL 5T3ZH 4IMKC 1ED3A 5CZKA 1TJHH 1H8NA 2YZ1A 2J2ZA 4M5YH 2DI7A 1UYWL 3RZWA 4E41D 3PGCA 1X5IA 5T1DH 4JRYE 5EU6A 5GISH 4K07A 5GRUL 4ZOBA 1LDSA 3QBTB 4ZS6D 1BQSA 1XEDA 4HPOL 4RRPG 3QQNA 2BCKB 2VN7A 5HYSB 1UZ6F 1IC7L 5JZ7C 3FRPG 1U2CA 3STLA 4UQ2A 5DVMA 1CICA 1UACL 3QEHB 5GGQL 4JY4B 1BM3H 1UXWA 5I2IB 4BSWA 5ETUA 4UUJA 1IJ9A 4JHAL 1FRGL 4XCFL 4Y7MA 5CSGA 1ZHLA 1ZK9A 1G7MA 3QPQD 3FB7A 3TO4C 4JRXB 3TVMD 2GFBA 3I75A 4KTDL 4QWWC 4JFEA 1UWGH 5C0JB 5I1KH 4LARH 4M6OH 1ERNA 3G6JE 5DYOB 1H0DA 2V17L 3HMWL 5IW1A 4CRPA 2NZIA 5IBUB 1P1ZB 3Q6GH 3ZT6A 2EXWD 1J05B 4HWNA 1B0WA 4MXWH 2XKNA 2N7BA 5EU4A 5K9OB 4X5WA 5H94A 3IFLH 3JTSA 5EU3A 1AJ7H 4GKZA 4GRLA 3HTLX 2ARJQ 3U1SL 3I02A 4GRWH 2OMBA 4Q6YA 4GG6A 3QO0A 4KRMB 3LKQA 4ZS7L 3Q5OA 2EDDA 5DK3A 4PBVC 2XTLA 4U7MA 1EJ6A 1MCSA 3VXUA 2GCYB 2MCG1 3ILPB 1NJ9A 3VXPA 4PJGB 1EO7A 2IPUK 4PJ5B 1EPFA 4QRRD 2J1KA 4JFZH 1U8HA 3LRHA 5ALBL 3BSZL 3E8UL 2BVOB 3ET9F 3EYVB 4QKXB 2N7AA 4QY8B 3FJTA 4Z7VA 2HRPH 3B2VL 2ZKHL 1DQJA 3SGDI 2GT9A 2X89A 3T8XB 4LSTL 3DGGB 1H3PL 4PYHA 5D7LA 4L8DA 3T65B 2DLIA 1J9CT 4HCRA 4FXKA 1KJ2A 4OQTH 1CXHA 3HAEB 5KVEL 3WLWD 1QLEH 1JZ5A 1CLYL 2BXYA 3C9NA 3LHPL 5A2IH 2P8PA 3HPLA 4MA8H 4Y4FC 1QFWH 4X7EC 3V7AG 1KIPA 2ZOLA 3CXHJ 4P2CG 5HYSA 1XF1A 5C0IA 5T1KB 1Q9KA 4LKCA 1CN4A 4LASH 4LSVL 5JUEH 3QUXC 4BJLA 1NEZG 1P6AB 1YPZA 4BH7B 3IETA 1RURH 2HJKB 3DLQR 5J3HD 1PEZA 2VABB 3ZMRA 4WFFE 1JHLL 1OD7A 4MNGA 5DUBA 2KZWA 3R1GL 3QIWB 3RPIA 4A2MA 1WCQA 3FCTB 2AEQH 4Y4KB 4P23C 4FABL 1FDLH 3FN9A 1Y6KR 4XPAH 1XGUA 1XCTB 3CFKA 1A22B 4DGYH 5ICXB 4NC2B 4S0TD 3MBXL 4UNUA 4PJBA 4XC1H 5B4MC 4NQCA 3GMMB 4X99A 3ULUC 1R3HA 1ACYL 4YNYA 2F8VA 4HC1L 3EYQC 3BEWB 4KK5C 3MJ8B 1AY1H 1SVCP 5C09D 4GAYB 4QLRA 2OM5A 3KPQB 4AT6B 4JHZA 1IEBB 3H0TA 1AR2A 4WDIB 4PJ5A 1NCCH 3P4LA 4HAFA 4U1HB 2DQGL 4HWUA 1V7MH 4OJFH 5HVHC 2GJJA 4QY8A 1MFEL 3O8XD 4HH8A 4K3EL 1J5OL 1RUMH 2V7NB 1JV5A 5F9JA 1A9EB 1FG2B 3WO3B 1ZHBB 2OYPA 5KW9L 1KCRL 4N9GA 1A5FH 5TGBA 2AXJA 3T65A 4K3JL 2P8MA 3EDKA 5KSAD 3BZFA 2HVJA 3D5OF 4KJYA 3WHE0 1CFQB 1DVFC 3CFBB 2P1YA 4LLMB 4XMKH 1U8JB 2UWEF 4NN6C 1BX2A 4FQLL 5D1XB 5I18L 3LKSB 1KJ3H 3SDCD 5MENA 5HHNA 4X4ME 3P30L 4UV7L 3DX9A 2HG5A 3EOAB 4TTGA 2DWDB 3WUWG 5A2KH 5CEXB 4YXKL 4FQCL 2VAAA 2GTZB 4WRLA 3DMMB 2KQNA 3MNWB 1JP5A 1RULL 2E27H 4BH7A 4EI5C 4M7KL 2HJKA 3IDNA 5F6HI 3MRMB 1KGCE 4FHBD 2VABA 1UWXK 4ZUSB 3QIWA 1G7LA 2X4TA 1S9VB 2LU3A 3UROR 4Y19A 2XWBB 3Q5TA 4OUOA 3FCTA 3REWB 1MEXH 4Y4FA 2HRLA 4WUUE 1JRHL 1EHLH 4PGCB 3HR6A 3SDAD 2YA0A 4NQED 1AXTH 3AMKA 2NY6B 1NGWA 2XZQH 2AAVA 4N1CA 3GSNB 1RK1A 4I8DA 5E4IA 4BZYA 4DQOL 3QUXA 3ARFD 3LKRA 3LY6A 4EI6B 4I4WA 1JWSA 2UUDH 2VDNL 1WBXA 5CIPA 1MCNA 3MJ8A 5EZIH 4D9QD 3T08A 4U1GC 1AIFA 3JV0A 4AT6A 4DGVL 3QXAB 5SX5K 1H3VA 3U30B 5IJVB 1LDPH 4U1HA 1NGZA 3UTSB 3ZKXC 3KPLA 1IEAB 4JFHE 5HDQH 3T2QA 1I1FB 3O9WD 5IMKA 5EUKB 4WUKL 4M5ZH 1NC2D 2V9RA 4OBRA 1NPUA 3V52H 3PQYE 3T09A 3DXAB 5H37G 5E5MB 1FG2A 3DSNA 4P2RE 5IQ7L 2KDGA 1JNNL 4X6CE 3QULB 2UV3A 3OWEA 1WZKA 4OLEA 3MSPA 5J12C 1ZEAL 4L8SC 5BO1H 3W39B 3CLFL 1DP0A 3CFBA 4HW6A 4LLMA 4POZD 1U8JA 2HT3C 4X4XA 5CMAA 3UBXG 3X14B 5JNYB 32C2A 3W5MA 3PWPA 1MRDH 4N8CL 4MAYD 1FORL 4NNPH 2NY1D 3SKUD 1P4IH 4XCEB 3EOAA 4HKBA 2C1PB 1YYLL 4QTIL 1C08A 2J6EA 1BPVA 1JWMA 2YPLA 2GTZA 1R5WA 4MXQC 2XA8L 5TFSH 1JMZA 1MFDH 2V2TA 1UB6A 1I3RA 2Y72A 4O2FA 4L8CA 4K8RH 4L3AA 2AEPH 4MJIB 1YN6B 1U8OA 4LFHD 1FE8H 4XBGA 5JZ7D 1PSKL 4QXGL 4HWBA 3EFDH 3RWFA 1NEZA 3KLAB 3MGOB 5LWYH 1DR9A 2VUOA 1C5BH 1IGFH 1QYGL 4MQTB 4FP8H 2X4NB 4K8RD 3C60C 4NO3A 3VCLA 2EIDA 2J7LA 1PLGL 4GW1B 3K80A 3F58L 4KROC 4X4YA 3RA7H 3GSNA 1ZT4B 2VERN 3K81A 1VCAA 4JPVL 3C6LB 4HIEA 3QIUD 3TO4D 2AJUH 5I17A 4BSVB 5CJQL 4C56E 5KOVC 1HWGB 2KBGA 1KIQB 5C0DB 3QXAA 1KNOA 4NNXA 1A3RH 1ZXQA 5IHUH 1YY9C 3NFSH 2VDLH 3TT1L 2Q7YA 5DJZB 3FT3A 4I5BA 5DJYA 1I1FA 1TZGH 3KLHC 3W11D 1LD9B 2B0SH 2BSTA 3WKMH 2HTLD 1A6ZB 2DM2A 3LEYH 4JM4H 5E5MA 3S36L 5C07D 4LK4A 5HYJA 3V6OE 1NCBL 5MI0B 4EIGB 1QO3B 2YOCA 5JO5A 1Q9WA 1CLCA 4KDTC 3PV6A 5ILTH 2JKXA 4G42A 1L0QA 3WXWL 1NLDH 3OKDB 3WNKA 1F4WL 1Q94A 5SX4H 1GGTA 3EJYC 3QEQA 3OKKB 1YUHB 5DD3L 4DW2L 2DN7A 4JY5L 4Z7OF 5I1GH 1J8HB 3VXQA 1RUPL 5GIRB 4LEOB 3OKMA 2AERT 1NGXB 3MV11 1MI5B 4HMEA 3WYRA 4FQXB 7CGTA 1IM3A 4LGRB 4I77L 3GGWB 5HJ3A 3G5YA 5KVFL 5I1AB 1JYNA 3OKEB 2PF6A 4MJIA 3BGAA 1F4XH 1D5XB 3H7BB 1WZLA 3WUWA 4JFPB 2A73B 3Q1SH 2ADJA 4L8SA 1FVDB 1GOHA 1LO5A 1TZHB 4O9HH 3TIEB 4F7TA 4WWKC 4Z5RB 3IFPA 3V0VB 2B7DT 3SE4C 5FDYA 4GFTB 4HBCH 1NBVH 5FHAL 4PLJC 5IGXH 3JWOL 3SDYL 4R0LB 4YK4C 5JQHC 5LBSL 1OAKH 1ZT4A 2YPKB 2B1HH 1FQ9C 2R2HB 4PJCE 3HKFA 5JMRA 1AGDB 2D7OA 3GMRB 1ETZA 2DLFL 1A21A 2X70B 3PP4H 4BSVA 4P23D 3MRLB 4U3XA 5KSBE 2HA1A 3L9RA 3QHFL 2WINA 3BDYL 1DBBL 3HB3D 5EA0L 5IESL 3QH3A 4F37K 4PS4H 1N59B 3RWIB 1UGNA 3U7YH 3VJ6B 4HQQL 1MQKL 5EOQL 2NQCA 1CE6B 5DJZA 1UB5B 4YWGL 5CP7B 3TJHD 3BMWA 2NY0D 3ARED 2DQIL 2JB5L 3C60A 3ARGB 3DUSB 3IJHA 4N5ED 3EYQD 1AHWC 2VDMH 4FMFA 1KN2H 1KBGH 2XV6B 2ZCLH 4OLZH 5IHZB 1MFNA 4R7DB 1CZ8L 4Z78B 4LU5L 5DD1H 3H3PH 4X0KB 2LU4A 3WFCL 4NRZB 1MHHB 2EDRA 3NCBB 1KACB 5IVXE 3OKKA 2P42B 4U1LA 1C5DA 3E1F1 2XZAH 1N3NB 3RWGB 1X5AA 5E5UB 2VXQH 4KI5E 4JM2C 1QRNE 4J6RH 5D5ME 2PR4H 1XF3B 3F5WB 5IHLB 4U1IA 5KTEL 4LEOA 4MQ7B 4PJGE 5IKCA 1EJOH 4YR6A 4QTHA 1QFPA 4N9OB 2AK1H 1DVFD 3QO1A 4X7TB 3CVHA 2F74A 3GGWA 2GTWB 3MFGB 3LSOA 3UBXA 2I9LB 1ZGLA 1LNUA 3N9GL 3OKEA 3HNTL 1QA9A 2CDFA 3Q3GB 4HK3J 4XNQA 4ODXA 4YXHL 4OI7A 2YEZA 2QSVA 1FVDA 2KH2B 1TZHA 4KDTA 4TVPL 4UTBH 2EDOA 1ZLSH 4HWEL 4XGZB 4CVZA 1K8DA 1VKXA 4TUJB 2ZSVB 4EI5D 4PB9L 3RWDB 5EC2A 1SEQL 2XWJA 1AXIB 5EO9B 1R0AH 4EUPB 2R2HA 3DX7B 4OLUL 2LE9A 4HS3A 3G6JF 3BPLB 2NW3A 4JO4L 1ZLVH 1WAAA 4NPYB 4G5ZL 1I8IB 4XPTL 2NXYD 5HGDA 1V05A 1IQWL 4WFHD 1P7KB 1XF5A 3KPNB 3U82B 4HXAH 2W07A 5D9SB 5D7IB 3S36X 4WWKA 2WANA 2W91A 4L3CA 3G08A 3IJYA 1UB5A 1I9IH 1KCVH 3O4LE 5ESAB 4CVXB 4LSRH 1JVKA 3GRWL 4ZXBB 4JDZB 3DX8A 3ARGA 4U1NB 1EXUA 2O5ZL 2KUTA 2WUBL 4AEHL 2BOCB 3NFNA 3RX5A 3RAJL 3RWEB 2VXUH 3JWDH 5E4EB 4RA0C 2B5IB 3KPSE 1EUUA 5IHZA 3UTTB 1IGCL 1ONQA 2WIIA 4QXTA 3QNXB 2FZ3B 1U95B 4NRZA 1MHHA 1CU4L 1TPXB 3RGVB 5HXMA 1NSNH 5FGCB 4CMHC 4I0CC 1C7SA 1XF3A 1GH7A 2P46B 2A74B 4MQ7A 4UOW0 4HIXL 1KCSH 4P3CL 1I9RH 4WFEE 2Z9TA 1P9MC 1JYXA 1AHWA 2VLJD 3DWTA 3S37L 1KSRA 1PKQA 1QQDB 5CLTA 1FO0H 3VXOA 4B7IA 4Z95L 2R29H 4CNIA 4HFWB 1NMAL 5D7SL 2EYSB 1CDJA 2ZWLT 5GRJL 4NKMB 2EEDA 1S7QB 5E1AA 1WBZA 4KHXL 5F1NB 4I0PD 2E8YA 5C0RH 3VU2A 3BGFC 4JM2A 4NQDE 3SGJA 4RDQF 1LEIA 2GHWB 1AI1L 3N0PB 1N7ML 1RZ8A 2HH0H 4U1SB 4HPYL 3CNKA 3FO0L 4KKBD 3ARBB 4MDIA 4QOKD 4LPXA 1K4DA 4X7FC 1MVFA 4H25A 1WK0A 4NZRL 4Z0BH 4H0HB 1OARL 5F7LB 3T0WA 5EOCJ 2EIEA 2W0PA 3UJTH 3KPNA 4OCSL 3IAQA 5INCB 5D9SA 1FC2D 3HC0B 5DD0L 1U3ZA 4KROD 4PV9B 3AS0A 3SO3B 2R56H 3MV8E 3I6KA 1NGYB 4PGEB 1NUFA 4WO4C 4O51A 6FABH 3EYFA 3S4SG 3AFLA 5F1OB 4RAVA 4U1NA 2BNQD 3DV4A 3I85A 4KMTH 3FO1A 4PREA 4LSQL 2R2CA 3RWEA 1KEMH 4MCZB 4WNQA 5DEFA 3C08L 1TVDA 1YEEH 1BHGA 4R4BB 3QFJE 3QDJD 1H15A 2FO4A 5JDSA 3QUYD 3VXRA 4NP4L 3O2DA 3P0YH 1N4XH 2HJFB 2FZ3A 2E6PA 2MJWA 3MODL 1UM6H 5DD6B 3MRBA 2HT4C 1S8DA 5C9JB 3U6RA 5CP3H 4NQXA 1A6TA 1JTPA 2DIAA 7FABL 1OTSD 1UWEL 5FYLL 3NIDE 1BJ1H 3UTSE 5I19H 3KHOA 4Y1AB 4G6AC 1LO3L 4YAQB 4K55A 2BVQB 4N0UB 5DVKA 5C08A 3U9PH 1IEHA 5EULV 3DXAE 5F6IC 3QZWG 5TE6H 4O02H 1KB5H 4ZUTB 1JE6A 2EH8H 1PVHA 5LQBH 2VLME 2EYSA 2D4DA 4OFVA 4UINH 1S7QA 4OLXH 1J1OL 5JOFB 2O5YL 2Q1EA 1OP5K 1QZ1A 4JZNA 4OIIL 5AUMB 5AAWA 2CRYA 4KXZI 3TJEL 5JHLL 5I1EL 1EHXA 3DETC 5DK0A 4L4TD 5J1AB 2FO1A 4S1QL 5J6HA 1QSVA 2DJUA 2H9GB 4ZNCD 2I9TB 5E8OB 2ZUVA 3MBEC 3KYKH 2JIXD 4UB0H 2R69L 1P9MA 4A6YL 1AR1D 5GGSA 4QXWA 4NGHL 1FVCB 4WU7B 4LVNC 1XR9A 5CEZL 8CGTA 4K94H 2EE3A 2VDQH 3SY0B 5HPOA 1QSFE 3X13B 1S9WB 5DS8A 5DQ9B 3UEZA 5GSRB 1YEJH 1P2CA 3SJVE 5INCA 3VD9A 5B3NA 1VGEH 3LDBC 2GSIA 5I1JL 3HC0A 1BZ9B 1NMCC 4HKJA 3FT2B 3JUYA 3U7WH 2APFA 3ZKQD 1BD2D 2UZIH 2IQAB 4QNPE 1E4XL 4BM7A 2WAHA 3TH4T 5IB2B 5HDOA 1MFBL 3GK8H 3C09C 3L7FA 2QHRL 4FQJH 3CFEB 1MRFH 2GJZA 4OFYD 2GW5A 4NO5A 3BRFA 1KLUA 1YY8B 2DDQL 3GIVA 3BDBA 1JRHI 3KYOB 3W9EA 4A6YB 1KN4L 1HNFA 4BELD 1I3GL 1W72L 4BFGA 2EXYD 4RAHA 2XOTA 4E5XA 5EWIH 5DD6A 3OR7A 4IIQC 3HZYB 4D9LL 1MCEA 3BQUC 4NOBA 2FRGP 1F2XK 3ARXA 3TA3C 3S37X 5FUCC 4JAMB 3CLEH 3K8KA 5T5FL 5DJXA 3QWRD 2YD4A 3SE8H 4NC1E 4WO4A 3UYRH 4AIXA 3BGMA 4PJXE 3ZLQC 4Y8AA 5I9QB 2B1AL 5H2BB 3SGDH 2HFEB 2Y7QB 3BVNB 4K7FB 4JR9H 4HKZB 4JRYD 4X5LA 3RI5K 2PCPB 1WEJH 4KY1L 3AU1B 4O58H 5IB4B 5IEKB 2OP4H 2RHEA 3FQUB 1HXYA 1K3IA 2YR3A 1W72B 4V2CB 1U8NA 4Y4HB 4OV5A 3B9KB 5IB3B 5E2VH 3PNWB 4B41A 1NAMH 5L7XL 1DQDL 3I2CH 5FIEA 4XNZB 2FD6H 5DA0B 5D1QB 3GB7A 2H9GA 3GI8L 2VLRB 1MI5E 5JMOC 1D9KD 4KQ3L 1J0YA 4ZPTB 2DTMH 1MJUL 1FVCA 3GO1L 1DFBH 3I6GB 4ZOCA 2CDGB 3FZUD 2H1PH 4M6AA 5T3XH 4AM0B 5LXGH 3TO2A 3EAKA 2EEAA 4KZDH 2WBKA 5D6DC 2NX5D 1AGCA 2HVKA 5CEYB 4Q2ZB 1CYGA 1BVZA 2XI9A 4W6XB 3IXAB 3EYOB 3GKWL 4P5TB 4WUUA 3LRGA 2HWZL 5BS0E 1ZA3B 3L3KA 4JLRA 3E3QE 1X5GA 2IPUG 3CFEA 4DKFH 4HUUB 1AKJA 3MBEA 5EORH 2ED8A 1RZKL 4FFYL 3V6OC 4LDLB 4ZFZA 3CSBA 1JWUA 4NHUB 3K0WA 5D72L 3WEXA 4M6NH 3DRQA 3M1BB 3S35H 5ERWA 4MSWB 5J56B 1FCGA 2XPGA 5JW5B 4KAQH 5IVOA 2A77H 4I3SL 5DUPL 4PGZA 3U0TA 2NY2C 5D1ZD 3TLRA 3BHBA 3QNZB 3BXNA 1PJ9A 3AAZB 4J3OC 5A3ID 4E9LA 5GZOC 2HFEA 5GJTL 1SJEB 1ZE3C 3BVNA 5D6CB 1F6AB 4LSUH 3RZCC 5FV2A 2MQ0A 4Q0XH 3OKNA 4HKZA 4GKOA 4P2RA 1CGSH 3GBMH 3IXTB 5F7EL 2D0FA 3AU1A 5IB4A 3OHXB 2AXGB 1IM9A 3FQUA 3Q6FB 4X6CA 1RFDH 3C5SB 4JQIH 1TJGL 3RY6C 4QRPB 4LDEB 4IIQA 3L5XL 4OCYL 5HYIA 2ATPB 2BNRE 3BQUA 3QZWA 1MHPH 3PNWA 1T7WA 3TT3L 4HLZG 1F02I 2W9LA 1JN6A 1T1WA 5T5NG 5D96B 4RMRA 1F58L 5C6PB 2DD8H 2GSGA 4WFFD 1IT9H 1F90L 3RVUC 3U46B 5EO1A 4M61B 3OJMB 4OF6A 4CU6A 1W0VB 2J5LC 3I6GA 1FZMB 3D2UB 2P7TB 4RGOH 3T0EB 1LWRA 1MHEB 1VB9A 1ZWIA 4H5SB 5FB8A 4KK9D 3MUGB 3P4OB 4NQVA 5EN2A 3LQMA 2ZUQB 3ECBA 3DYPA 5EZJB 2E3VA 3WNOA 2Z91A 4E0RA 1W0WB 1N0LA 4YHOL 2H2SC 1I7TA 3MLUH 4LNRA 4X9GA 1ZA3A 5LJYH 1B6UA 2A1WH 1YN7A 5AZ2H 3OQ3B 1G7HB 3KGRA 1T7XA 3GSRA 1INDH 1QKZL 1T1ZB 1MLCB 2GJ6E 5INDA 1GYAA 1XIWB 4V1DB 2YSSA 4WCYL 1BAFH 1W2KT 4AEFA 1ZLUK 5E7BA 3BPOB 2ED7A 1H8SA 4U6TA 4OZFB 3SPVA 3GMNA 4F57L 5D7IE 1OAUH 5D6DA 1PYWA 3JUZA 1GIGH 1OCWH 2CKNA 2XQYK 4PG9A 4TVPE 4KI5C 4NO0B 3O0RL 3QNZA 5J4MA 4M3KB 1R3KA 4MX7B 3AAZA 3MPCA 1FNGB 4HT1H 5D5MF 3W0WE 3WNLA 3ZKSD 5B39B 3QXWA 5ITBH 1T04B 4RGMC 3HG1A 3L7EA 4PJGF 5D6CA 2Y5TA 2CO7B 5CILH 5JOEA 4F3FB 1C16B 4M7LT 3V6OA 3UTTE 4MB4A 2G60H 4G8GE 4S2SA 2AXGA 4D94A 4G7YL 3Q6FA 2IH3A 3ZDXF 3KPMB 3MNZB 4LOUC 5T5NF 4PJ9C 4XP9L 4ELMB 1A1OA 1GGBL 3L1OH 4P49A 2E8ZA 1VFMA 2CK0L 1IKNC 4Y0GA 2JK5B 2H3NB 2ATKB 5KVDL 1GGUA 4LGPB 4X7CC 1A7PH 4PP2B 4IEFB 3BX7C 3NH7H 4X6FB 1KGCD 1U8PA 5L2KB 3FQRB 4HGMA 4O4YH 4R90L 1G84A 3L5IA 5JW4Q 4ZSOB 2P7TA 5CJXC 1JZ8A 1X5KA 3MOAH 1EEZB 1IGML 3T0EA 5IJKC 1CFSB 3V6BR 1JGLL 4JFQB 3STBA 2LVCA 4YHLH 3F7VA 5ANMB 3VA6A 3QHTC 4X6DA 4EBQH 3ALPA 5GGTA 3RY6A 1W0WA 1PG7L 2EIZA 4P4KD 5J06A 1U93A 3BD3A 4HDIA 4ISVB 1P7QA 5F7UA 3OB8A 2A6IB 2O5XH 5F9OH 3LQAH 4OCWH 4PBXA 3VWJD 2F53B 1FGNH 1G7HA 5DVLA 3T77B 3PHQB 2COQA 3T0VA 2IF7A 1I8KB 4PTTB 1FBIL 3D1MC 1AFVL 1MLCA 1IFHH 4PJCA 4EOWH 4NRYA 2PYEB 3KPRA 4V1DA 3KYAA 4I9WD 5KSUA 1P69B 1A0QL 2NW2B 4FFVC 5GRVL 5KSBA 1KELH 1AC6A 4JFHD 3B8SA 1XGQA 2QKIA 3MOBL 4HJ0C 3O3DA 3PQYD 3SBWC 4OFDA 1CLZH 4J12A 3V7MA 2A6DA 5E9DD 4XTRD 4L3EB 3EOTH 4LLVA 3NOIA 1UFUA 5D7JC 3N85L 5EZLA 3LEXB 4N8VG 1WQVT 4X98A 3GSXB 3INUL 4MA3A 1NCWL 4HKXB 1HN1A 5BXFB 1RJZB 3PGDB 1S78D 1ZT1B 4QRQB 1B2WL 4F9PC 3N1GC 2OBGA 4KVCL 1RIUH 5KVMC 5LGHL 3TA3D 3BP7B 4BFEA 3GHBH 4NQSA 1JFQH 3NZ8B 1BFOB 5KZCD 5MHSE 4YBHA 3O45A 4M1CD 4AQOA 3TNNB 4U1JA 3RWCB 4NCC1 4CADA 2QR0B 4L8BB 3JV4B 5IVXA 4RX4D 3V4VH 2P47B 4ZFGH 1KPRB 4RNRB 5HGHB 1T5WA 2I07B 1QRNA 5HGBA 4JN1L 4OCRH 3MACH 3O6ML 3CDCA 1ZLWK 3BH9B 4YJZL 1KTDB 1HHHB 3LN5B 4MB3A 4JJHA 5DEZA 1XF4B 1CFSA 5DHYB 5ISZB 4JFQA 4P2OB 1I4FB 3CVIH 3RVVC 4JB9L 3ZHLA 4F58H 5ESVB 4LVOC 4PJ9A 1KCUH 4HJJH 3MLVL 1ZMYA 1F45A 2EE6A 2BVPB 1IKNA 2XN9B 3BPNB 5FV1L 5F7MC 2Z35B 1AO7A 5HHOD 5GS0C 4LCYB 2MOVA 2LAGB 4IRJC 2F53A 4KRPD 2L4OA 1YEFH 4C56D 2AJXL 4RCAA 5FYLE 3FT4A 1CDGA 3BN9C 5CZVL 4KDWA 3T77A 1DN2A 2JJVA 5FM8A 5GRVK 2JCCB 1BGXH 4Q58C 2BHYA 3U7AA 2X4UB 5DURB 4APQB 2J88H 5JTWA 4HGWB 4JGUA 3ELAT 1PZ5A 1MAMH 5KANG 4GAJH 4IRZL 3TBTA 5E5RB 3ARUA 5TF0A 4WI9A 4DTGH 4WW2C 5HHMB 1DL7L 2CO6B 4FZ8H 3AMLA 2YS4A 4GKNB 2VOTA 3B2UC 4WW2F 1SM3H 3RWJA 1UM5L 4DK3A 1X44A 5E6IC 3GSXA 3O4LA 1J0JA 3DIFA 2X7LB 1J12A 4OBSA 2Y6SC 4HUKB 2DQJH 3NIDF 2FB4L 3WDJA 1ZSDB 4RMWA 1TQBC 3VD4A 4FG6C 4R7NB 3M17B 3VRLE 3QRGH 1BFOA 3MLTB 3CSPA 2OI9B 4PJFB 5IK3A 2NY2D 1AGBA 4P57A 2YRLA 1MWAH 3TNNA 5CEZE 3LZFH 4WI2A 2DLGA 5KVGL 8FABA 1CDCA 1GGIH 1DQMH 1OGAB 2UZXB 2WWMD 2EDYA 4Y16B 3N1FC 4PRIB 4RNRA 3RZCD 3DBXB 1N64H 1XGRA 3G6DH 5ADPL 3SBWA 2W1NA 3T1FB 1YMMD 1D5MA 5D7JA 3GJEB 4PJHE 3LN5A 3K4AA 4MD4A 2V5SA 2XRAH 1PG7X 4AG4H 2E7BA 5DHYA 3O6FC 4XVUC 1NBYB 2XT1B 4G8FB 1I4FA 4L1HA 1R3JB 3BPCB 1MUJB 2GYSA 2FIKB 3TV3H 1NCTA 1YQ2A 2BMKA 3ARPA 5ESVA 4CKVX 1ORQB 3B43A 5FUZH 2X4OA 1G9NC 2BVPA 1HKFA 2Z8RA 3VFUA 2GI7A 2B2XH 4LSSL 4KK6C 2JTDA 1CVRA 3TBSA 3UC0L 4NQDA 1UYWH 3HMXA 4NBZB 1FH5L 2VLRE 2Y36L 4QNPF 4Q97A 5GRUH 1U58A 3JVGC 1GSMA 1S7XA 3IFOA 4B7LA 2R1YB 3QG6B 4HPOH 5A16B 1HHJB 3BKYL 1HCVA 1IC7H 4JRXD 2IADA 4XNUL 5F7DA 3T4AB 2MHAB 5CS7A 1MREH 1UACH 5GGQH 1CL7L 1CFTA 1D5ZA 2YKLL 4JREC 4I48B 5AG9A 2FEDC 3KYMA 4GKNA 3UPRA 3ES6B 3OXSA 2YHGA 4JHAH 1FRGH 4XCFH 3FOLB 5K9QI 1A9BA 4X8JB 4G8EB 1JK8B 4HZLA 3DHJA 3WS3B 4JFDB 4Z76A 1RUQL 4KTDH 2EDBA 1ZSDA 4PJXF 3U36A 5L6YL 4KUCF 5CSZA 3LPGA 2DRUA 5IM7A 3MLTA 1LVEA 3MA9L 2OK0L 1E4XI 4JHBA 2V17H 3HMWH 3UZVB 3P4MB 4N8VA 1A2YB 5EC1B 2HTKC 1OM3L 4QHMB 3HAEH 3MRGA 1EBAA 2AV7B 1P4LA 4P2QB 5ESQB 4PG2C 4XNYH 4H88L 5FO8B 2AJYL 3GHEH 5IBLC 2OTWB 2CLZB 4PRPB 3DO3A 5IB5B 3U1SH 3GJEA 5E6IA 1KJMA 4ZS7H 1B90A 3OL2A 1S7RB 5M94B 4PJIA 3V4PL 1FYTB 5T1LA 4LKXA 4N8PA 1NBYA 5GRYA 1FFPB 3WE6B 5ALBH 3RL2A 1F4HA 1R3JA 3BSZH 3BPCA 3E8UH 4UT9L 5C0BE 1VA9A 1MUJA 4FZEL 3B2VH 1KXTB 2ZKHH 4F37F 4XP5L 1U3HB 2FGWL 4LSTH 1YJDC 1H3PH 5F7KC 2BOBA 3VXNB 1AC0A 5T1KD 4NN7C 4F7EB 2V6HA 5KVEH 1DLFL 3WFHB 1CLYH 3LHPH 2CIIA 4AY0A 3G6AB 2VZ1A 1FL3A 5I15L 4AEEA 5DHVA 1KT2B 1VENA 4HK0B 3OPZL 4XZUA 4X83A 4F9LC 2XTJC 4M6ML 1S3KH 5CBAB 3O6FA 3QFDA 1I85C 5HY9A 4Y4KD 4IRSB 1QSFA 4LSVH 4GSDL 1BIIA 2NTFA 1JF6A 4I48A 3UPCA 1ZAGA 2P5EE 5EG6C 4G3YL 4M7LL 1JHLH 2ICEA 5TF1L 4R8WL 4WHYG 3MRHA 4FFZL 3R1GH 1OB1A 3KPSD 3CUPA 2RB8A 5ELIA 1SYVA 4MQSB 1AP2A 1R6VA 3ARDB 3CX5K 1A7QL 1UA6L 4IHOA 5D70L 3WS3A 2YBRB 2E27L 1UWXH 2GITB 2DQFA 3GMLB 2P5WB 5KSVA 4FABH 4QHKJ 1UCBL 3JVGA 4Y5XC 3S5LB 3V5DA 5I1DB 4LGSB 3WIIL 5ID1A 2XWTB 4DUWA 5BVJB 2HT2C 5EC1A 3DSFL 3MBXH 3RVTC 4BQBA 4WFED 5BV7C 2OR9L 4ZAKB 2AV7A 4K9EL 4MNQA 5ESQA 1ACYH 2DKUA 4JKLA 4HC1H 3FQWA 5IB5A 5DGQA 5C7XL 5FGSA 4UTAL 1KCLA 4KK8C 3QUKB 4MJ5A 1X7QB 4L9LC 3MXWL 4CDHA 2PTUA 2DQGH 4GMTL 4C83A 1EGJA 5ENWA 1UXSA 5F7FA 1XAUA 5D1XD 5BZDB 1C12B 4CVWA 4K3EH 4BQ8A 1DQQB 5I75B 1KCRH 5SWSB 4ELME 4ZNEE 4KXZH 3AS2A 4K3JH 4PGDB 3KWWB 4UILL 3EFFB 4HH9B 4I2XE 5C1MB 4PG2A 4HWBH 2UY7A 1KC5L 1M6OB 2BZDA 3DMMD 1QEWB 2K7PA 2VZTA 1JL8A 4FQLH 2OTUB 5I18H 4MMXC 4HK0A 2IFGA 1OOAA 5CINL 3EGSB 4M48L 3P30H 1T2QL 4UV7H 3VFPB 2ESVB 4KKCC 4WY7L 2HKFL 3GSNH 3C2AL 5BO1L 4ZFFA 1YZZA 1PD6A 3MV8D 2DKMA 5IVZA 4YXKH 1U8QA 4FQCH 2F54B 1JGVH 4IRJD 5ANME 1RULH 5BRZB 2F8OA 3SKOB 3BN9D 4M7KH 1JPGA 4NKOB 2JELL 2NY6D 3L3OB 1X4YA 4WJ5A 2Q76B 1VACA 3QFJD 5KN5A 2XFXA 2BSSA 3ARRA 5D7IF 2PXYC 1TTFA 3ARDA 1BVLA 1WC7B 5BS0A 5FHBL 4Z7UB 4ZTPL 2EDHA 2JJTC 1JRHH 4FTVB 4ODUB 3S5LA 3FQXA 3QI9B 4JN2A 1II4E 2XWTA 4F9LA 1TZIB 1I85A 2F19L 3D39B 3UTSD 2HFTA 4CJ0A 4DQOH 1LK2A 25C8L 4ZAKA 4MWFA 3JBG7 2DLHA 2G2RB 4RWHA 2VDNH 2VQ1B 4PJEB 1QBBA 3DXAD 4ZOAA 1DLHB 3CZFB 3HI5L 3MO1B 4PB0L 1RZ7H 1XFPA 1FC1A 2UUDK 4LPWA 4DGVH 5E0QA 3RA7L 3NN8A 2WMPA 3W82A 4PRHB 5JIPA 4NUGL 3D69B 4L4VB 5GJSL 4Y5XA 4ZODA 1C12A 4WUKH 1LO4L 4YHNB 2DWEA 5DSCB 1U8LB 1BZ7A 1DQQA 1FPTL 4F7CB 3GSOB 5IQ7H 3NFSL 3V6ZB 1RHHA 3ZYIA 4RMTA 5D8JL 1JNNH 4P9HC 1ZEAH 4YH6A 4YZFF 3CLFH 5LG1A 1QEWA 2KL6A 1G6RL 3IDYC 4JQVC 4OGZA 2D3VA 2NTSP 1TVBA 5C71A 3D0VB 1ZV5A 4R97C 5F88B 1DANU 2YD1A 2IAMC 1L6XA 5CFHA 1Y0LA 4N8CH 3EGSA 5J9PA 1FORH 1KOAA 3SJVD 1ZGLM 4HUVB 4L29B 1YYLH 4LRIC 5ISZE 2BC4B 5DVNA 2Z8WC 4QTIH 4DZBB 2N4IA 2I27N 4U4BA 1QBML 2X09A 5HPMA 4G6FB 4EN3C 4OD2A 2ICWB 2XA8H 1OSPL 4HIHB 4NKOA 4HBQA 3LQZB 1HHGA 3QEGL 3GMOB 3MFFA 1TFHA 3L3JB 3C6LD 3HE7C 1RHFA 1PSKH 4RISL 3PWJA 5EUOA 1WC7A 5A2FA 2CJUL 1JJUA 1G6RB 4Z7UA 1NGQL 3QCVL 4F8TA 2FGZA 3E6FA 4WTZA 3V9FA 1QYGH 1CK0L 3IFNH 3QI9A 1EEYB 2JCCE 3WO4C 5SV3A 1TZIA 4V2BA 3VE0A 3D39A 1PLGH 1VGKB 1QOKA 3F58H 2GJ6A 1JZ2A 4JPVH 3JZ7A 3OKLB 1M7DA 5C0AB 3QDGB 3ARQA 4KUCD 2JB6A 5DRNB 1NFDB 5CJQH 5HHME 4PJEA 5H8DA 1S7UB 3DO7A 3CZFA 1M4KA 3D25B 1OAKL 2AK4B 3NA9H 2VLLB 3CFJB 4JPKL 2PXYA 4RFEB 2AW2A 1ZTXH 2VITA 3TT1H 4L4VA 3W0WA 1HSAB 5CLWA 4E41E 1NQBA 2JJTA 1B0GB 1KTLB 2V2WB 4S0SD 1OSZB 3U48A 4X8XA 5I76B 4UBDD 1SEBA 3WS6A 1EHNA 3S36H 4PJ7B 1J8HD 2NNAA 1LO2H 3DARA 3U7YL 5T3ZE 4LLUB 5I74B 1NCBH 2BY1A 1MI5D 3TNMA 4FQXD 5E70A 1HYRC 1LP9B 1OTTC 3G5XA 4PRIE 2WBJB 4PGBA 2IANA 3MCKA 1DCLA 3WXWH 4G8IB 3MR9B 1F4WH 3KS0J 3OF6A 2DQUL 1DBJL 3DGCR 3MRCB 3RY4A 3KYNB 3MRRB 4DW2H 4YHKL 4HUVA 4JY5H 1BJMA 1A4JB 1INQA 2BVYA 4NZTL 4RMVA 5HD8C 2DF3A 1RUPH 2ZSWA 1YNTB 2GK0A 1XR8B 5F9AC 4AENB 1JPFA 2X4SB 1HQRA 4XNMB 1KFAL 2YA2A 3OAUL 2CKBL 3LKOB 3DV6B 4I77H 1CF8L 2VXQL 1T1XB 5KVFH 3HNSL 3LQZA 3D48R 1WWCA 3BDXA 5IB1A 1AXSB 4GW4A 2D31B 5CJBA 5EU7E 1AGFB 3TP4A 2WLZA 1BP3B 3DX6B 4K71C 4YDKL 1T20A 2I60L 4YX2L 4JQVA 5DO2C 1EO8L 5L0QC 2O61B 4IMLB 1BMGA 2IAMA 1BQHB 3HZMB 1A6AA 4YHML 5IF0A 1I1CA 5FHAH 4QT5A 2IH1B 3JWOH 4MD5B 3SDYH 2FHBA 4LRIA 4OAWB 3VMOA 4MJ6A 5LBSH 2VXVL 4QRRE 4KKAC 4NNYA 4EN3A 3VRLF 5C0AA 5IW6B 2DLFH 5DRNA 1T89C 2CKBB 1N5YL 2A6JA 4YXLL 4JFYB 3QHFH 4PRAB 3BDYH 1DBBH 2VLLA 5EA0H 5IESH 5L8LB 4H20H 4UV4L 5JW4N 2HT2D 3HE7A 1VERA 2PYFA 3TCLB 5A1AA 4HQQH 1MQKH 5EOQH 3VA2C 2IALA 2NY5L 2CMRL 5K33A 1I3VA 3SDDB 1T22B 2CUMA 2BNRD 4LCWB 2DQIH 3QNYB 2JB5H 4ZUWA 1T6WA 4OF0A 3IVKB 4RGNC 4H1LB 2PW2A 3BW9B 3D9AL 1RPQA 1LP9A 1CZ8H 4LU5H 4P2QE 3B9VA 2GAZB 3QDMB 2XG4A 4XVTL 3WFCH 2V7HA 3LKPB 2H32B 3D85B 3T0AA 5LCVH 5IVNA 3U0WL 2Q86B 3UO1L 5KTEH 4EUPH 1FYTE 3CCHB 4JZOB 1U91A 5BJTA 3SOBL 4AENA 3NFPA 4XNMA 2RIKA 3KLSA 3LKOA 4G43B 1HHKA 2BNUA 3ILQC 1SY6L 3R06B 3D3VB 4P0DA 1NC4B 1UKSA 2D7QA 3N9GH 3WHXB 4JDVA 1AXSA 4IOFD 3HNTH 2YMXL 2YC1A 3C5ZB 5C0FA 5I66B 5HSFA 1QR1B 4YGVB 4KKCD 1RZIB 3STZA 3DI3B 4YXHH 3DX6A 4TVPH 1Q9LA 5CD5C 1JTOA 5JW4R 3EJZC 1QBAA 5EU5A 3FOMA 2WIMA 4HWEH 5F3BB 5JIHA 4LLQA 5B8CC 1UADC 4IMLA 3HC3L 2M2DA 1C8PA 1HH6B 3OKOB 3FFDB 1K6QL 3HZMA 2P45B 5FYJL 2L7JA 3MUHL 4PB9H 5EBLA 1SEQH 2ZJSL 4LLYA 5IMLA 3MGTA 4ENED 4U1KA 4DKAA 3CX5J 4MAUL 4Z77B 1DSFL 3OXRA 4TVPD 4QCIB 1CGVA 3CC5B 3O2DH 4LMQI 4OLUH 3IRZA 5C0RL 1IGTA 4ZXBD 2W60B 4JO4H 1L7IL 4G5ZH 4XPTH 1FSKB 5EOTB 2CDEB 4JFYA 1IQWH 4MB5A 3TBVA 4PRAA 4F7PB 4LHUG 3NCFB 2VNCA 3QAZC 3AXLB 1M71B 3ZDZF 3UTTD 4HEPG 1FVEA 4G8GD 2VR9A 5B8CB 4Y5YB 2FL5B 2R0KL 2FATL 2Y06L 1CL7I 4H0GA 4ELKA 4MVBD 4OZIB 3MV01 2H8PB 4OD3L 1XGPB 1IAKB 3C8KA 3GRWH 3RGVD 3KR3L 5F96L 3RUGA 2O5ZH 2WUBH 3IDGB 4AEHH 3H9SB 3MV9B 3RAJH 1VFBB 4Z7WB 1RAMA 3VGDA 4CN6A 4YDLB 2FR4A 2EDKA 4HIJB 3WJJC 4X6BA 3BIBX 1EEQA 2SEBB 4GS7B 4OKVB 1EFXA 5E08L 1IGCH 3BFOA 1T89A 4KMTL 1CU4H 3LKPA 1MRCL 1G7PB 2NPLX 4AH2A 1N26A 1YEEL 3WN5C 3OB0K 1NCAL 1DQLL 5CJOL 2LVEA 1QFUL 3HUJE 1EAPB 3VXSB 3VH8G 4PJDB 4JFFB 1T0MB 4PJHA 3PL6C 4HIXH 2EYTB 4P3CH 3R0NA 3DRTA 4UQ3A 3CPLA 1RQ5A 3GIZL 3C6SB 5HYFA 1XMWA 4P46B 3X3GL 2HKHL 2NLJB 3S37H 4OF8A 3ARBD 4Z95H 3C5ZA 4B0MM 1NMAH 4YGVA 5D7SH 4L5FL 1RZIA 5GRJH 5LKNA 4KHXH 4BZ2L 1FLTX 5F3BA 1AD9B 2X05A 1IC1A 3VGEA 1DUYB 5DWUH 1Z6JT 3IDXL 1Q1JL 3FFDA 5DQJB 2AABL 3NGBB 1Z5LA 2A9NL 4XXDA 1AI1H 1N7MH 3EUUA 1GOGA 3CSYA 2AQ2A 1EHAA 3FO0H 1QLRA 2IG2L 3SEPA 2F54E 2KKQA 2D2OA 1YMHB 3S96B 5BRZE 1UZ8A 2VKWA 1OARH 1MHCA 4OQ1A 5KAQF 5GGVH 3O4OB 4OCSH 2UY6A 3GMQA 5IQ9A 1FN4B 5SWZB 1JF1B 3QUZC 5MERB 5DD0H 3KJ4B 2R39A 1I7RA 5B8CA 2FL5A 3BP4A 1EEUA 4MQXD 5MHSD 4OZIA 4WW1B 1MOEA 3L6FB 5I8CB 1FAIL 2WLYA 2IFFH 2VIRA 4H8WC 3MV9A 4LSQH 4Z7WA 3SKNA 3C08H 5KG9B 5DJ6B 2FHFA 2PTTB 4NP4H 4Y1AD 4AEIL 1CDIA 3MJ9A 2NY3B 3HCVA 4K7PY 3HRZB 1U92B 3GSQB 2AJSL 3EOBA 4GRMB 2W0FA 4X4ZA 3KXFB 3MODH 1C1EL 1FNLA 5E8EB 4ELMF 1FFNB 1UZ6E 4U6XB 3V5KA 3IDIB 1M1SA 7FABH 1ZA6B 2VLKB 2BHZA 1UWEH 1AE6L 1EUTA 4PJDA 5FYLH 4JFFA 1E28A 2IPTL 4FQQB 2YRZA 1LO3H 1OF2B 3BKJH 3PIQB 4P46A 1IMHC 2X9XA 4YO0A 3RX8A 2NLJA 1Z3GL 4OLYL 2DMBA 5I71C 3WJJA 2QSCL 1L0XA 3MUY1 4OGXL 5FYLD 5GRWA 3PV7A 1NCDL 3ZHDA 2E9WA 2B4CC 1AD0A 3WSQL 2NYYD 1J1OH 1AD9A 2O5YH 1NDMB 2FJHB 3QWQB 3PGFL 3WN5A 4OIIH 3RJQB 3X12B 1X6LA 1VDGA 2DM7A 3TJEH 2APWA 5JHLH 2EC8A 1OTUC 4JR9L 4LRNL 4HZAA 4U6VL 3PL6A 4S1QH 3MJ7B 4A6YH 1JZ6A 3LS4L 2R69H 3ZSSA 4ZYKB 3P9LB 4NGHH 2CR3A 2PN5A 3S96A 3MROA 5HI3C 5CEZH 2YK1L 1KIUA 3RBGA 4YHIA 3QCTL 1OP9A 4K7PL 2RFXA 4A2LA 1WISA 3RTQB 3MLYL 3Q0HA 1P5VA 2P43B 1BOGA 2W9EL 4KKAD 4XNXL 5D2NB 5TDPA 5CEZD 4JO3L 3L6FA 3VDBA 1CE1L 1E4XH 2A9ML 5LXGL 1LQSR 1MFBH 4JJ5B 4LHUA 1IVLA 2QHRH 1TCRB 3MLSL 2VAJA 5JLZA 3ZTJH 5KG9A 3SDXB 3G04A 4LCCB 1CD8A 3I9GL 1LO0L 2DDQH 3QDGE 1ADQL 1S9XA 2RGSA 1U92A 1KN4H 4TUKL 1NFDE 4GRMA 1I3GH 1W72H 3K74B 3L5HA 5E8EA 1I1AB 4MD0A 1FFNA 3ARWA 1TQCC 1QSEB 4XCYA 4D9LH 4FQHA 4NSKB 3QUZA 3QQ3B 1CDUA 3F7QA 3MUZ1 5C0EA 1VEMA 4CJ1A 4N90E 3NAAL 2YWZA 3DROB 4NYLA 5T5FH 3BEVB 4LLWA 4GOSA 1I7ZA 1KENL 2OL3L 1G1YA 3PIQA 4Y4HD 2B1AH 3B9KD 1MJ8L 2HLAB 3PWUA 4XI5C 3UZQA 2XQBL 5D1QD 4QRSA 4S1DD 4NDMA 3VH8A 3RDTB 4AJ0A 4ERSL 1U9KA 2VLRD 2ICWI 3IS0X 2EC9T 4ZNEA 4KY1H 4YBLC 3IDUA 5CHNB 1Z9LA 1VESA 3VFWA 3X12A 2DYPB 4NN5C 1FZJB 4HMDA 5L7XH 1DQDH 4LF3B 3LKNA 1CGSL 1JZ7A 3LRSB 4Y2DC 4HUWA 2H2PC 3MRQA 3GI8H 4JKWA 1Z0NA 5CSBA 1ND0B 3PHSA 2C7UA 4KQ3H 4XWGL 3BH8A 3RKDC 5JIIA 3VXMA 4HK3N 5DFVD 1MJUH 3GO1H 2OL3B 4RAUA 2JCCF 1MLBB 4JDTL 4ACPA 4P5TD 3SCMC 5IEHA 5I1CL 5GGUB 2LTQC 4ONHA 4EZMA 4QRTA 4KKLC 4OGAC 2J8HA 3B9DA 4K3HA 3DUHA 3X17A 5GS3A 3BRDA 5EIIB 1JGDB 4PJ8B 4RGOL 4U6HA 1VFAB 3QEUA 2J8UB 1NANI 5F7NC 1M05A 1KEGL 2ADGA 2A6KB 1G9MC 2M1KA 3GKWH 1B4RA 3FMGL 2ADIA 4RFNB 3SDXA 1I8MB 2AXFA 2AP2A 3QXDA 4XPFL 3QWOA 5FM5M 4OM1L 4ZS6C 2UWEE 1KYOK 4NJ9L 1RZKH 5L2JB 5IFAL 4FFYH 2R2EB 3IDJB 5K9KB 4GQPH 1OAQL 4PJFF 3VMNA 3MV7B 5D72H 5AZEL 4R96A 3QISA 1QSEA 3QIBC 3MREA 2E6QA 5C0BD 1Y18A 2FIRT 3FB8A 3UTPE 5D2LA 2YA1A 4I3SH 5DUPH 1Z9OA 5EBWB 4QRPD 1MCLA 1K8IB 2DBJA 3QPQC 1GVIA 3GI9L 2HLAA 4LCWE 3TVMC 5IG7B 1E27A 4C4KO 1G7JA 5GJTH 4OM0L 4GKSB 5JHDB 1OCWL 3IRPX 1M7XA 3PJSA 4DGIL 4DAGL 2ITDA 4ZTOL 5F7EH 4ZPVA 1F11B 2EXWC 5I6XB 1CTNA 5EU7C 3QDME 1T2XA 3D2UD 5JXED 3L5XH 4OCYH 5CILL 5F44A 3H3BC 3PDOB 1MF2L 3LRSA 3TT3H 1S7VA 4K7PX 3PF2A 4OD1L 2X5PA 1F58H 2P5ED 4X5XB 4IJ3C 1FYHB 1F90H 2EE2A 1B88A 5FYKU 1YEKL 1FL5A 1FZOB 1LMKA 2I24N 5CD3B 1HOCA 5FA3A 4OZFH 2ARJA 5HI4D 1CI5A 2MCPL 2E7MA 2VJXA 5E24E 2DBLL 4M7JL 2Z92B 1ZS8B 4YDJB 2E7LC 3DUUB 4G9FA 2NY4B 3OSKA 2JJSC 3QDAA 3MOAL 1VFAA 1XIWD 1QTYT 1GZPA 2J8UA 1F8TL 3WLWC 4YHOH 5E00B 3GUTA 4Y2DA 4KPHL 1DN0A 3PABB 4NO0D 2ZCKL 1GXEA 2VDOL 1QKZH 4G9DB 5KS9A 4WCYH 2VLJE 1J1PL 3SCMA 3SKMB 1QHPA 4KFZC 4M4PA 5HHPB 3BP5A 3S35X 5C0CB 2WQRA 3JTTB 5F9DC 5B38G 3KPOB 2ZG1A 4F57H 5J3HC 5EIVA 5E99L 5K93A 3A6BL 5BMFL 3VFSB 5EBWA 1F5WA 3O0RH 1K8IA 3QT2A 4MCYA 2OZ4L 2R2BA 4R3SB 4NZJA 3MMEA 4E41A 4K23L 4Q9CA 4OZGA 4X9HA 3VG9B 5DJDA 1RZGB 1FNEB 3FQTA 4GKSA 3CGTA 4FQPA 1AGEA 1K3ZA 1UJ3C 3O3BB 3VFTA 1KPUA 5TPWL 5L2KD 4QOKE 3UTZB 2G5BA 1BZQK 4G7YH 4AZ8A 3LN4B 1IAOB 4HWZA 1NLBL 2PNDA 4U7SA 2V2XA 4XP9H 1T7YA 4DN4L 1GGBH 4LPYA 4YC2C 2CK0H 3HE6B 5DQDL 1BQLL 3PWNB 1UVQB 2C1OB 1JFQL 2DIJA 4XVJL 1BF8A 3VXSE 1U3YA 5DJ8B 5KVDH 1MH5A 1W0YT 2AEWA 4UIMA 4ZDHA 5EBMB 4U7KA 2ZUYA 3TVMA 4R90H 4OT1L 1FZOA 4OIAA 2BNQE 2ZP0T 4FQ2L 4ZFGL 1IGMH 4NT6B 3VWKC 3O8XC 3WDIA 1JGLH 2AQ3A 3A6CL 4M93B 1F3DJ 2BDNL 3QDJE 4OCRL 1R24B 1BIHA 5F8RC 5IT2L 1A6WL 1JHTA 3O3AB 1T21A 3UMTA 3DUUA 4OZHE 4H26A 3FHQA 4PRDB 2VWEC 5ID0A 4NKDA 2PYED 1ITCA 1PG7H 4TRPL 5E00A 3OJDB 5C09B 3UDWC 4DUVA 4P2YA 3FKUS 2L0DA 2RCSL 3K2UL 3DURB 2CPCA 4OV6F 5JORB 1BFTA 1U8IB 4L3ED 4QRRA 43C9A 1FBIH 4F7MB 1AFVH 2ADFL 2FJFB 5C9KA 1R5IA 5BZWA 3BZ4A 3RNQB 5I73C 1A0QH 1IAIM 5J57B 4U31A 3HI6H 3MLWL 5EU6B 3MOBH 2YD9A 2WWKO 2JJSA 5KSAB 3NABH 3E2HB 3AUVA 2W92A 5HHVL 1RZJL 3QJHB 4I1NB 3N85H 2ICES 3MRJA 1SBSL 3HUJF 3INUH 5FCUL 3STLB 4UQ2B 4NWUL 1B2WH 4NM4L 1YC7A 3LD8B 3SDCB 3TWCL 3MNVA 4KVCH 1UXWB 4BSWB 5LGHH 3SDAC 5ETUB 4UUJB 2NXZC 2YUWA 4UAOC 3UTZA 3HR5B 4LFHG 1BJ1J 4DKEL 1ZHLB 5F9WC 3UJIL 4MHHI 3KXFE 1G7MB 5E8PB 3ARFC 3FB7B 5ISZD 3I75B 4P2OD 3PWNA 1IARB 4YHYC 3BYTA 2VLKE 4PIRF 4TQEL 5FGBC 3TYFA 1RVFL 1H0DB 3MLXL 5IW1B 4JN1H 1BD2E 1G0DA 4NRXA 3O6MH 5DEGA 4HCRL 1KJ2L 3O6KL 2VMFA 1R5VA 2FYYA 4XAWL 2XN9D 5EU4B 2ZOKB 4ODTL 4ZMAT 5HDLA 1HQ4A 3VXTA 1UJ3A 4NQEB 5EU3B 4GKZB 5DC0A 4XP1L 3UXFA 3ULVL 4KZEH 3KAAA 3I02B 1I1YA 5DDHA 3WIFA 15C8H 2YUXA 4GG6B 3QO0B 4JB9H 3LKQB 3EYUL 2DAVA 4APQD 5DURD 3RQ3A 3RVXD 3VXUB 2VL5A 2CRIA 3MLVH 5IR1A 1NJ9B 3FFCE 3VXPB 3B3IA 3MX0A 5C09A 4YHYB 1U8HB 4KTEL 4POZC 4CGTA 4Z7VB 4CMMA 5FO9B 4XC3L 1RZFL 5HHMD 4OGAD 2AJXH 5DZOA 2LABA 5CZVH 2NY1C 4YPGA 4PBWD 5D7LB 1X4XA 3MRIA 4FXKB 1KJ2B 3O9WB 3O8XA 5F8QC 3RNQA 3C9NB 4KI1A 4IRZH 4FFWD 2P8PB 3HPLB 1DL7H 2QADB 5KSAA 4WI7A 1KIPB 2ZOLB 4LHQB 5D2NE 4UDUA 3QJHA 5GS1C 5T3ZD 5C0IB 1Q9KB 1UM5H 4F15B 4Z0XB 4LKCB 1OGAD 3UDWA 2FCBA 3TN0C 4Y16D 1MREL 2AI0L 4PRID 5B3JF 3QIBD 3SDCA 2FB4H 5B38A 1ORSA 5TDNB 4CAGA 3BWUC 3CIQA 4MAYB 1YPZB 4K8RC 3IETB 1IZJA 3AROA 2BRRL 2P24A 4M1DL 3HR5A 4MNGB 5DUBB 3WNMA 1A6VL 3OZ9L 3RPIB 5E8PA 3SN6N 1UKTA 3QIUC 5GRZA 4DOHE 3UZEA 3BO8A 2YPVL 5KVGH 3CDGA 1KF9B 1A7NL 1PQZA 1CQKA 1J1XL 3GBNL 5ADPH 1XGUB 3ZDYF 3FB5A 2NX5E 4ONGL 3CFKB 4PY7A 5DRZA 3VGAC 1YNLL 4AIZA 1MNUH 3BISA 2E6JA 5T3XE 4PJBB 2IMNA 4NQCB 2ZOKA 4X99B 4YDVA 3O11A 4DJMA 1R3HB 4XNYL 4YNYB 5IFJA 3W11C 3SDAA 1KTRL 3GSVA 4NQEA 4JKPL 3GHEL 3PUCA 1DEEA 2HTLC 3O41A 4U3CA 4WVRA 1U36A 3H0TB 2R8SL 3ARFA 3QIUB 3TO4B 4PRBB 3AVEA 4HUXA 2FSEB 1XF2B 1A4KA 4NM8L 4FQ1L 1CVSC 3NCEB 4LSSH 1JGUL 2BVTA 5FO9A 3UC0H 5ICZB 1JV5B 3V2AR 5F9JB 1FH5H 2Y36H 3BUYA 1GGYA 3C5JA 4N9GB 5TGBB 1OW0C 1MCWW 2P8MB 5JR1L 3BZFB 2EO9A 2HVJB 3EDFA 2EEBA 3O9WA 3BKYH 1EVTC 1NC2A 4KJYB 1CWVA 4JFDD 4XNUH 1BQHG 4YFDB 4MDJA 3C8HA 3WIHL 1EV2E 1BX2B 3NCCB 1F2QA 5C07B 1KYOJ 1CFVL 2OJZL 1CL7H 5MENB 2YKLH 1NFDF 5HHNB 2EDTA 3OG6B 3DX9B 1S3KL 2HG5B 3VFNA 4Z0XA 4XXCC 4FXGB 2VAAB 1IE5A 4P2QD 3U0PB 4NC0B 5TDNA 1EGJH 1RUQH 3IDMB 4CU7A 4MAYA 4ETQA 1WTGT 3HS0A 3IDNB 4PRPD 4ETYA 4N0CD 5L6YH 5DMKA 2RBLA 3MA9H 2OK0H 3LAFA 4IMKA 4P5KA 1G7LB 1NGPL 1L6ZA 2X4TB 4GW5A 3MV7E 4Q9RL 4PJ7F 4Y19B 4WI3A 1FYTD 1HILB 2ITCA 1OM3H 2VDRL 1PX4A 1ULVA 3M45A 4Y4FB 4D9RE 3OGOE 4KH2A 4U0RC 1OP3H 5GS2H 1OLLA 4H88H 3HB3C 4WWID 1U3HD 2AJYH 4N0FA 1CBVL 5GS1A 1NGWB 4XVSL 4H1LG 4XT1C 2XKUA 1I1RA 3ULUL 1RK1B 2R4SL 3TJHC 3QUXB 2NY0C 1BREA 2QTEA 2W0LA 3ROLA 3LKRB 3V4PH 3AREC 1JMXA 4I4WB 1JWSB 1WBXB 4LIQL 4N5EC 2LQRA 5CIPB 5GS2D 4UT9H 2Z4QA 1AIFB 1J7VR 4FZEH 2CLVA 4MJ2A 1X5JA 3PWLB 4XP5H 1G7IA 2R0ZL 2FGWH 4J23A 1BEYL 1KB9K 3O3EA 3QIUA 3TO4A 2QLVB 4PRBA 3MA7A 3CMGA 4P23B 2J6EL 2FSEA 1NGZB 1XF2A 3KPLB 2CRMA 4IRSD 5F6HJ 3R8QA 3VWKD 5IMKB 1DLFH 3WLBA 4HJGA 3TGXA 1EO5A 3BUTA 5ICZA 1T66D 5I15H 4U49A 3Q2CA 3OPZH 4EKXA 3RKPA 4P3DA 1DANT 1ZHNA 4M6MH 4HWBL 1S5HA 3FTGB 3FONA 1FP5A 2D03L 4PR5A 2P5WD 5C07A 4X4XB 5CMAB 4GSDH 2W38A 32C2B 1F00I 3PWPB 4Q7DA 2VISB 4G3YH 5F1SA 3MRNB 1FFQA 4HKBB 4M7LH 2VXTL 5TF1H 3GSNL 4R8WH 5AG8A 4FFZH 5HVHB 1T0PB 5IW3A 1C08B 4FXGA 2XXCB 1OQXA 1JGVL 1JWMB 2YPLB 1R5WB 3U0PA 1A7QH 1UA6H 3IDMA 5D70H 2V2TB 1UB6B 3MYJA 1I3RB 1CLOL 4O2FB 4L8CB 1UCBH 1OW0A 5K9JL 4RRPA 3WIIH 5FOBB 3FRPA 1U8OB 3DSFH 2DIBA 4XBGB 1HILA 1DVFB 1HYSC 4OLVH 1RMFL 1FNSL 3X3FL 3RWFB 4NN6B 3SHSA 3AS3A 2OR9H 5EDXA 1NEZB 2NXYC 4K9EH 3H8NA 3WIHA 1WWAX 2PETA 5J11C 1P5UA 4NO3B 4PJAE 1FZKA 2NXZD 5BOPA 1IGYA 3VCLB 1J18A 1FNHA 4TUOA 5C7XH 4HSQA 3ROOA 5SWSD 1D6VL 4UTAH 3UCRA 4X4YB 3CXDL 4HIEB 1A1MA 3IF1B 5I17B 3MXWH 2FJGA 4EI5B 4CDGC 1QFHA 4GMTH 1D7FA 1CGWA 5L88H 4I3RL 5CUSL 1RZ7L 1T1YA 3FN3A 3VFOA 1KNOB 3S97C 5DJ0A 1JUFA 1CR9L 3OR6B 3PWLA 4B50A 1MFAL 1BFSA 2ESVD 3NCYP 4I9WE 4NNXB 1BLNA 4P23A 1LHZA 1J8KA 4YEEA 2Q7YB 3FT3B 4UILH 4I5BB 5DJYB 2F54D 1EZVY 4L9DA 4ZD3L 1BFVL 1KC5H 4R4ND 2W59A 3IAPA 5FKAA 3JWDC 2AJVL 3V79C 5BRZD 4G80A 1BF2A 2BSTB 3QXUA 1NKOA 4UOJA 1CD9B 5E9DE 5FA4A 5HYJB 3NPSC 2OJEA 5CINH 1YQVL 1MCFA 4M48H 4ZOEA 1T2QH 3AREA 4WY7H 5JO5B 1Q9WB 2VR4A 2HKFH 2NR6C 3FTGA 1F13A 3C2AH 3PV6B 4G42B 4M1GH 1Q94B 4U1GB 3QQ9C 3F7YB 2VDKL 4ZUVA 3QEQB 4FTVD 5I8EB 4ODHL 2JELH 2VISA 3MRNA 4X80L 3VXQB 1ZKAA 3OKMB 3ZKXB 1JNHA 5GHWL 4I0PC 2HP4A 5SWQB 4YQXL 1IM3B 5E8DL 5JA8B 1UQSA 5HJ3B 3G5YB 5FHBH 2XG5A 4ZTPH 1MIML 2VZSA 5AD0A 4KKBC 3MRDB 2NY7L 4PRHD 5FOBA 2UWEA 2HMIC 3WUWB 3B9EA 5J12B 2ADJB 4L8SB 3J8F7 4F7TB 1LO5B 1DVFA 2F19H 1HSBA 3IFPB 5CBEA 5F89B 3TN0D 25C8H 2OQJB 5EU6E 5GQBA 3RGHA 3IFNL 3DTXA 2V5RA 2VR5A 1NDGB 2CGRL 3OX8A 1KCKA 3HI5H 4PB0H 1OQOA 5FYJU 2HJLA 3VI4E 2UVFA 2QSQA 1H3UA 5HHOE 4NUGH 2EYRA 3IF1A 3HHRB 1ETZB 1HDMA 4EI5A 5GJSH 4NBXB 3L9RB 2EH7L 2WINB 3KHQA 3NA9L 1N8ZA 3OR6A 3GM8A 1LO4H 3QH3B 4XRCA 1FPTH 3QUYC 1ZTXL 2VXSH 2Z0BA 3NIFE 4HV8A 4TVSa 5D8JH 5L9DL 1WUNT 4JFEE 3T3MF 3PG2A 2AGJL 3CVHL 4OZHF 1OAXL 3C60B 3IJHB 4JZJC 2JJUA 1G6RH 4ZO7A 1CTOA 1RY7B 4GBXC 1MVUA 1OTSC 3N1MC 1LO2L 4KROB 4GAGL 4BFBD 3TPUA 1BJ8A 5EO0B 5GGRB 1WBYB 3MRPA 4D0BB 1QBMH 4J4PD 5DTFA 4QRUA 4EVNA 3F7YA 4WV1C 4U1LB 1C5DB 5IWLC 1OSPH 5I8EA 3VXUE 4U1IB 1NANH 3QEGH 3CD4A 5IKCB 5E2UL 4YR6B 4QTHB 2J12B 2CUHA 3QDGD 5SWQA 1CGTA 4KKNA 4Z7VE 3QO1B 3CVHB 2F74B 4RISH 3UBXB 3LSOB 2CJUH 1VPOL 5CGTA 1NGQH 3QCVH 1ZGLB 1LNUB 4MLIA 2JLLA 1YMME 2DLEA 1QA9B 3MRDA 2AK4D 5D7LE 1CK0H 2CDFB 4XNQB 5I1HL 4P5MB 3MZGB 1LEGA 4ODXB 1X9QA 2YEZB 4N90D 2UZYB 1AR1C 3O2VL 4Q9BA 3LH2L 4TNWK 5F89A 3THML 4CVZB 1K8DB 2VLJA 2OQJA 1VKXB 2H26A 2BXZA 3NCMA 3WBDA 5FGRA 3HPJA 5EC2B 1WIPA 5FECB 1NDGA 2XWJB 1SQ2N 3T1WA 4I0PA 5JDJA 1YEIL 4JPKH 2APTA 3ESVF 4HS3B 2YWYA 4HX1A 4K94C 1WT5C 2NW3B 3U4EA 2WBJD 3S9DB 1FO0A 2Q6WB 5HGDB 2D7TL 1MCOL 2F9BT 3BD5A 1XF5B 4KUZL 1MCJA 4HMCA 4URTB 4H20L 5D93C 4QOKA 3ARYA 4ORGA 4WWKB 1T7VA 3IS1X 3PHOA 4L3CB 3G08B 2YD2A 4JRXE 2C3HA 3IJYB 4ODWA 2EXYC 3DX8B 4LQ1A 2Z8SA 1EXUB 3NFNB 2XXMB 4LPVA 3IU3A 4YK4B 1OGTB 2DQUH 4OCNC 4LAQL 3TZVC 2OR8A 1DBJH 2Y23A 2BSRA 12E8L 4YHKH 3A0OA 5TQ0L 4NZTH 4MA1C 1ONQB 2ARWA 1MSPA 2VSDA 2WIIB 3JV5A 4QXTB 4U1MA 4W6YB 5EO0A 3QYCA 5GGRA 2BNQA 1WBYA 4D0BA 2R0LL 3GJFB 3EJJX 1GC1H 1KFAH 3S88L 3OAUH 3VDAA 2CKBH 3QDJA 1CF8H 3RIAK 3QUYA 2VQUA 3JV6A 1N6QL 3HNSH 3CMOL 5LCVL 4GUPA 4PJ5E 4HF5L 2EKJA 4XBPB 1L7TL 2RQ8A 5HYQA 1E6JL 4YDKH 2I60H 4JZJA 5BQ7B 4YX2H 4Z8FL 1EO8H 4HIIA 3EDDA 4GAFB 3ZDXE 4WHTA 1AHWB 5EFIA 1RIHL 1DEDA 4UI2A 1PKQB 1S7TA 5DI8A 3VXOB 4YIQB 1U8MB 2FHCA 4YHMH 3ZE1E 1N2RA 4CNIB 2VN4A 4P5MA 5LAXA 1CQYA 4PP1D 5HHXL 2OLDA 5DJ2A 1EZVX 1D9KC 1FIGL 1T6VN 5E1AB 4H1LH 3UTPD 1WBZB 2VXVH 5CP3A 1X6NA 3SDDD 5ALCL 3FZUC 4WV1A 4LCWD 1UH3A 4JM2B 5FK9A 2WUCL 4JRYB 5GGSY 4F33A 3UAJD 5FECA 1LEIB 1N5YH 1RZ8B 1J88A 4YXLH 2H32H 1HXMA 3MRKA 4MDIB 4UV4H 3O2DL 1TLKA 1FFOA 4MXVE 1K4DB 1HYSD 4RDQG 3EO0A 4H25B 2C3GA 3TH3T 1EVUA 3QDMD 3QCUL 4TTDD 2NY5H 2CMRH 1S5IL 2Q6WA 4L4TA 4M7ZC 3QG7L 4ZUUA 1CGUA 1E4KC 2PO6D 5DD5L 1UEYA 1ZT7A 2JIXA 4O2CA 3D85D 3FO2A 3T4YB 4HD9A 2I26N 2WQ8A 3I6KB 3SE4A 4O51B 3D9AH 2W65B 1WVZA 3IT8D 3EYFB 4XB7A 4IS6A 2Q7NA 4RAVB 3DV4B 4PREB 4XVTH 3FO1B 3D3VD 1Q9OA 1G9EA 1NC4D 5JXAL 1OGTA 4WNQB 4JPWL 5DEFB 2GUOA 1KB9J 2CRZA 2ZCHL 3MYZA 4XHJD 1CFBA 4PY8I 2DI8A 4JQXC 4QHNA 1H15B 5C92A 2FO4B 1BD2A 4PTUA 1E6OL 3WHE1 5JDSB 3VXRB 4YDIL 3TBWA 2A0LD 4RQQA 5D1ZC 3U0WH 5GGVY 1WT5A 3UO1H 3OB0H 3SOBH 5A3IC 3GJFA 1HE7A 4BKLB 2QJDA 1WLHA 1TCMA 3MRBB 1D5BA 4OFYA 1S8DB 3U6RB 1SY6H 2EDWA 4NQXB 1A6TB 4Q6IC 5C6WH 1XGYL 1TETL 2UYLA 4NJAL 2YMXH 4HHAB 4D8PA 2IMMA 5CGMA 5FM5O 2FH6A 4XBPA 2NR6D 5IROC 4JCLA 5BQ7A 1MJ7L 1S7SA 5C08B 3BMVA 3HC3H 5IHBA 3QQ9D 2X41A 1K6QH 1NFIA 4R2GC 3QWRA 3BKCL 3M8OL 1U8MA 4YIQA 5FYJH 2ZJSH 1WJ3A 3ULUE 3LV3A 3H7LA 1JHKL 1Y6NR 5CAYB 1AQKL 4MAUH 1DSFH 2W0KA 1IAMA 5DWUL 1X5HA 4JZNB 4LIQE 4ONFL 3GSUA 4CMHB 1L7IH 3PWPE 1F3DH 3H9SD 2DQCL 4JRYA 4KK9C 5DK0B 3UTOA 4WIQA 1A3QA 5K59F 5J6HB 2HMID 1H5BC 3EOYG 1R3IL 3S3JA 4H0IA 3RIFF 5GGSB 2YPLE 4DCQB 1KV3A 2R0KH 2FATH 2Y06H 1XR9B 4UT7L 1FLRL 1XGTA 4OD3H 4XWOD 5GGVL 3KNBB 5DS8B 4NKIL 3KR3H 4GXUN 4BQ6A 4XP4L 5F96H 1P2CB 2EIBA 3SGEI 1D9KA 3VXSD 2GSIB 3T4YA 4DWHA 5TH2A 4HKJB 5IMMB 1WFTA 3GSWB 5ACZA 2XNAA 2W65A 1NAMA 1CS6A 5E08H 1T0NB 1KLGA 3BGFB 2IFFL 3CFIC 3V95A 1EIBA 4JO1L 1MRCH 3V5HB 3L7FB 3AB0C 3F7PC 3G6JA 4YE4L 1X5FA 3L95A 1NCAH 4RWYL 2NX5A 2GJZB 1DQLH 5HGAB 5CJOH 1BBDL 1QFUH 4NO5B 1KLUB 3GIVB 3MRFB 4I18C 3W9EB 5F3HA 4BKLA 4NHCL 1LK3L 5IMOA 4E5XB 3GIZH 4EDXA 3MTRA 5CJ5A 5E2TH 3OR7B 1E4KA 3X3GH 2HKHH 4GBXD 5D71L 3OAZH 1IQDA 5C8JA 5DJXB 4HHAA 4WO4B 1RK0A 3BGMB 4L5FH 1YEGL 3BKJL 1EBPA 2AV1A 5E94A 4BZ2H 1A3LL 4Z7NE 5MEQA 3V0WL 3VFRB 4IDLA 1OAZL 4N0YL 3RJDA 3IDXH 1Q1JH 4W81A 4JQXA 4JY6A 4X7SL 5KBNC 2AABH 5DRXA 2A9NH 5SWZD 5D1ZA 3I3DA 5C2UB 1OY3B 4HG4K 1H3WM 1HI6A 1ZOXA 4WHCA 1FL6B 1HXYB 1V3KA 2IQ9L 4HFUL 3LIZL 2IG2H 1U8NB 4OV5B 3QEQE 4HAGA 1PBYA 3SQOL 4EDWL 2B20A 3GB7B 1YYML 4HS6B 4IOIA 5IROA 2ZPKL 1IKFL 2DQEL 1H3XA 4DCQA 4AMKL 2NY3D 4P4KC 4PJAF 5F6IB 1A1NB 3KXFD 1CFNA 3KNBA 1OT1A 1FAIH 4MJIE 3VWJC 3HRPA 1WSST 3TO2B 1B0RA 1MJJA 1TITA 2VLKD 1DUZA 2BSED 4ZG1A 1D5IL 5JA9A 5IMMA 3GSWA 1AGCB 3VG0L 2HVKB 5EPMA 4AEIH 1T0NA 3FB6A 3LQAC 1JI2A 2AJSH 3K1KC 3OTTA 3V5HA 1C1EH 4WUUB 4J2XA 3L3KB 4JLRB 2FX9L 1H5BA 5HGAA 2XA3A 4UIKL 1AKJB 3MBEB 5DVOA 4WI6A 2Z31C 5J13C 2ED9A 3LMJL 1AE6H 2V9QA 4NUJA 1FCCA 4M02A 1K4CA 3MRFA 4LVNB 4XTRC 5FDWA 3QB7C 2G5RA 4XPHL 4ZFZB 2IPTH 4LSDA 4MYWB 1JWUB 2E9IA 3S4SB 4O5LL 3WEXB 1UJTA 3O2WL 3FFCD 1HINL 1S78C 2A2QT 3DRQB 3T3PF 5T33L 5GZNC 2OSLA 5ERWB 4KWUA 1IC4L 1Z3GH 3P77A 3LDBB 5F21B 2XPGB 4OLYH 1J0ZA 4OSUL 1NMCB 3ABZA 3TZVD 2QSCH 3HN3A 1JGEA 4OGXH 2XZCL 3U0TB 4F8QA 1S9YA 1NCDH 3BHBB 4M1CC 3RNKA 3K3QA 3BXNB 3WSQH 43CAB 3ZL4L 3C09B 3CAFA 3KDMA 3VFRA 3PGFH 1OT2A 3PQYB 3RTQD 3OKNB 3OMZA 4PFEA 4P2RB 3EO1A 4I18A 4LRNH 3BAEL 4U6VH 1LE5A 5TDOA 1IM9B 2MMXA 3F12A 2P8LB 1FL6A 3FN0L 4X6CB 5JQ6L 3LS4H 1Z9SA 2HAZA 4IIQB 4WHDA 1L4IA 3BQUB 3CFDA 3QZWB 1XH3A 3TA3B 2YK1H 3F7RA 5CZXD 1J8HE 3QCTH 3CDYA 1JN6B 1T1WB 4K7PH 4X4MA 3EHBD 2DJSA 2W9DL 3RHWK 3TFKD 4HS6A 4R9HA 3DVNB 3MLYH 2CLRA 2GSGB 4HUNB 1S9KC 2F8XC 5EO1B 2Q8AL 2W9EH 2V5TA 4XNXH 1A1NA 1XT5A 4JO3H 3P2TA 5CWSA 1I1AD 1CICC 1CE1H 1E0OB 4KRPC 3VI4F 1ZWIB 5FB8B 2A9MH 3BJ91 3VW3L 1X5YA 3MLSH 4NQVB 5EN2B 3IGAA 3ECBB 5HYSG 4K3DL 3D0LA 3S8WA 2Z91B 4E0RB