1QYGL

Anti-cocaine antibody m82g2 complexed with benzoylecgonine
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
DIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGYTYLHWFLQRPGQSPQLLIYRVSNLASGVPDRFSGSGSGTAFTLRFSRVEAEDVGVYYCMQHLEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPQDITVSWKIDGAERSSGVLNSWTDQDSSDSTYSMSSTLTLTKDEYERHSSYTCEATHKTSTSPITKSFNRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity in hapten recognition: structural study of an anti-cocaine antibody M82G2.
pubmed doi rcsb
molecule tags Immune system
molecule keywords FAB M82G2, LIGHT CHAIN
total genus 49
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2003-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qygL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qygL01
1G7QB 5HHQA 4HJJL 3UDWC 1XIWC 1A6VH 3BGAA 1MLCB 1NEZG 5DTFB 3FO1B 1PDKA 1TVDA 3SKOA 1FIGL 2IAMA 3ARED 4OLWH 2HT2D 4DOHE 4LCWA 1TDQA 3W0WA 4WDIA 1FYTD 1PG7X 2V7HA 1ZOXA 4OT1H 3PWUB 4ODVL 4HUVA 3RI5F 4CUCA 3KPPB 1C5DA 4WV1C 4V1DA 1KIUA 5I1LB 1CGSH 2JKXA 5ITBH 3CFBA 3RAJH 2DLHA 4RRPG 4XAWH 4HIIA 4P4RB 4NGHL 4JAMA 2J8UF 4GOSA 5K9KB 4NZRL 5I76A 4PRIA 3KLAA 5DYOA 1Y6NR 3E2HC 3GHEL 3HAEB 5CILH 4KKLC 3DURB 2O61A 4JFEB 2R9HD 5E4EC 1EJOH 5HYQA 1EFXB 5DF0A 3P4MA 3TVMB 4N5UA 1C7SA 5FDYA 4OD3H 1QBML 3STZB 3PWPD 3IDMB 4Y5YB 3RWGB 3SE3A 2QQLH 3ZTNH 2R2EA 4XNZB 5HHOD 5JDSA 1JNLL 1KLGA 1X5AA 4IIQB 4QHMB 3V0AC 5JPNB 4KJPC 4Z95L 4NCDA 3AFLA 1MLBB 3OMZA 3RNQB 3K81A 4OF3A 2NY0D 5ISZB 1CL7I 5FGCE 5D1QD 3VXME 3HG1A 4OGXL 1MJ8L 4WUUE 3KLSA 3QIUB 3WDJA 5E6ZA 5GRZA 3VXRD 2XQBL 5I73C 3WJJA 4XMLL 1T7YA 4P4KA 3CZJA 4M6MH 4Z7VA 2YWYA 4OD3L 3KXFE 4KRPD 5I9QB 3ZDXE 3MRLB 4IRJD 3RVXD 1Y18B 2R29L 3UAJC 4YDJB 5I1HH 1Q9WA 1WEJH 2W0LA 3GJFK 1YUHB 1I9RL 3T8XA 1FNFA 3GEWB 5C09E 1R5VB 2DWEA 2VLJB 1VB9A 1XF5B 3RWCA 4W81A 1OHQA 1YN7B 3CVHB 2GCYB 3LEVH 3CFEB 3B9DA 1ZLSL 4WI7A 4EKXA 1BOGB 4PJXF 4HIEB 4JN2B 2R2HA 4JANB 5MI0B 4MB4A 3SHSA 3HC3H 1KCRH 1ITBB 3QRGL 1LGVA 4L4TE 4N68A 5TGBA 3D9AL 4R0LA 2I26N 3VGAB 4LU5L 3EDKA 3TBWA 4HWEL 1IZKA 1JHLL 3RDTC 3BIBX 3CVIL 4FFWD 4AEHH 4PY8I 3Q1SL 5BXFB 4F2MB 4DW2H 3STBA 5J89A 1S9XA 4IMKC 1TZHA 1RAMA 4G8IB 1N6VA 3O8XD 3LB6D 4P3CH 4I0PA 2DLFL 3T0WA 1B0RA 1BFOA 2ZSVB 5F89B 3ZT5A 2YEZB 1KJVA 4PJHE 4FRWA 1RZKL 2ADJA 2X4SB 4OCYH 4UUJB 5L7XH 1P4LA 2YA1A 4RMWA 4QF1A 5FYKL 2YSSB 4XMLH 5M7QA 1MHHA 2DMCA 1DQDL 5T33H 5DWUL 4RBPH 2R2HB 5FK9B 3KXFB 4QTHA 4QNPE 3ARWA 2HTLC 5I19L 1RFDL 5ACZA 3SJVA 3IJYA 4ZAKD 4ODSL 4JJ5B 2F58H 2R8SL 2FO4B 2FYYB 1U8MB 3MLTA 2CGRH 3MRFA 4X6EB 2VIRA 3DGGB 12E8H 2WBWB 1KPRA 3DSNA 5DEGB 4JVWA 4P5KA 4JQXA 5JW4M 5IFAL 4OLZH 3F7VB 3VD7A 4BELD 3BVNB 1FDLL 3X3GL 4FQQB 2UYLB 4M9OA 1MHEA 3ZO0A 5C7XL 3UTZB 2EEAA 3WS3B 5IQ7L 3FB7A 3GBNH 2JCCA 5C6TL 2PYED 1LEGA 1HILA 2VZ1A 4GS7C 2LVEA 3OKEB 4R4NC 2HLFD 5DMKB 5KN5A 3QAZC 5DJYA 1CFTB 1Z9MA 1CFBA 4FP8L 2YSSA 1F6AB 1I9EA 3O3BA 4P57B 5FYKH 1EHLL 4NN6B 5IFJA 4NJ9L 4OCYL 2PR4L 1UWGL 3BXNA 3DX9A 3Q6GL 2GYSA 3VXTA 4XGZB 4LNVA 2NY0B 5ISZD 5FYLL 3QEUA 1QO3B 2R69L 2VDML 5HYSB 3SDDA 4M1CC 4JPVH 4PJFF 3TBVA 1KCKA 3MJ9H 3WIIH 1JWSB 1CE1L 3QIUD 4LASH 5F7DB 3T4AA 4Y5XA 5IROA 5HHXH 3CVIH 3TVMA 4RMTA 3MV9B 5FV2A 3OR6A 3CX5J 3RQ3A 2FX9H 2VLLA 4MZ3A 2I5YH 4PJGF 1XGYL 4ZPTB 1CF8H 3FQRA 2JCCB 3VFRB 1X6NA 2VZVA 3IS0X 1G6RL 1X6LA 3BKJL 3QEGH 2BNRA 3INUH 2P48B 4LVOC 4JY6A 2ARJB 5JXED 5DJYB 2I24N 3RVUD 3B2UC 1UWEH 1S3KL 5BV7B 3VXRA 2QADC 4JY4A 4ZS6C 2IQAB 3C8DA 3HZVA 2BCKA 3V6FB 1TJIH 1QACA 3QIUA 1QOKA 1I7UA 2IALB 1NGPH 3I3BA 4Y0GA 1FYHB 5IUSA 5F6IC 4D3CL 3E0GA 4KK5D 4MVBD 2QV2A 1PQZB 5A3ID 3OKDB 3FFCA 4H26B 4YWGL 1CD9B 4QXUL 4UT9L 3G6JF 5I1AA 1N6QL 1OF2A 4JM4H 3MRNA 4HV8B 4OV6F 1QFPA 4MDIB 2OJEA 5TE7H 1T0NA 1K4DA 2QR0A 1PY4A 4NHCL 2V17H 3MV9A 5B4MC 6FABL 1MREH 3BPOC 4I77L 5IV2B 3PABB 4K71B 1KJ2A 1IM9A 1AKJA 1JTPA 4WI8A 1I8LA 3O9WA 5JZ7C 4D2NA 1F42A 1OWWA 3WE6B 1BREA 4HIEA 2FEDD 1J7VR 4XMPL 3VXMB 3MSPA 3KHQA 1IJ9A 4NQEE 1CFSA 1KN4H 5TDOA 4L5FL 1CFVH 3LEXA 4LSQH 4NZUL 1CT8A 1FZKA 3MODL 3NTCH 3QRFM 4M7JH 3M1BA 2EDEA 1DUYA 2OJZL 2E3VA 2GK0B 5FCSH 3MRDA 4OZHB 3T2NH 5LAXA 1D6VH 1WBZB 1HWHB 5ESQA 4Q9RH 3M07A 1FNLA 2JF1A 2V6HA 5D2LA 1CTNA 2Q6WB 3UO1L 5HJ3A 4BUHA 4MS8D 1BJ8A 4KQ4H 5DEFA 2C1OA 3CNKA 2YKLH 5TDOB 1ITCA 3HNVL 3C08H 3OGCA 1M7IA 3DO3A 2Z9TA 4O2FA 1U36A 4YDVB 5B4MD 3PWLA 2XICA 3QUXA 1FJ1B 4LDLB 3SKJL 1FNHA 3O9WB 4CBPA 4G5ZL 2OI9C 4JRYE 1QLRB 2KPNA 3KPMA 4MJ5A 2Q6WA 1YQVH 5M94B 1UB5A 3V7MA 3P4OB 5CJ5A 3NFSL 5DHVH 5J6GB 4LVNC 3MRQA 3O0RL 4PJEA 3GNML 5AWNL 2DQTH 3IDIA 1AGCB 4TUKH 25C8H 3OQ3B 2BJMH 2AW2A 3OAZK 4G8GA 3MGTB 1WWCA 1YQVL 3L3IB 1JI1A 3AM8C 5T1MA 4JCLA 1HHGB 1UH3A 5IMKB 1V5JA 4MD5A 1RPQA 1VGKB 3MLRL 4JKMA 5T1LA 2RGSA 5HDBF 1J8HE 3MROB 2W60B 4CU7A 3MLYH 3G6JE 5GJSH 43C9A 1FG2A 2XG4A 3CX5K 4TTDC 3UO1H 1KJ3L 4C56E 3H9SB 1FVDB 2WP3T 4JFQB 1AP2A 2BY3A 3KXFD 4WTXA 3QIUC 5DGQA 5KANI 1FZOA 1ED3A 1UXWB 4WVRA 2DI8A 4JHBA 5A3IC 3HTLX 1BD2A 1WTGT 4AIZA 1T6VN 2P47B 4OIAA 3X12B 4YX2H 2JELL 4JM2F 2D4FA 3W39A 3OWEA 4M93B 4LSRL 4LLYB 4JQVC 1CN4A 2R0ZH 3KYKH 5IP4A 3G6AB 2F8XC 1JYNA 1JUFB 1C8PA 5F96H 2AP2A 1MJJB 3BX7C 1FORL 4WWKD 1B2WL 2HA1A 4POUB 1DEEA 2W9EL 2HLFC 4PJ5E 5HHOE 5I16A 1JGEB 1AY1L 3HMXL 5F9DC 2VWEE 4JFOA 4WHDA 3N1MC 4U31A 3HS0B 5GGTL 1RUPL 5JXEA 4M02A 3C6SB 3OJVC 5FUOL 3PP4L 1ZHKB 5IM7B 5EZJB 3AXLA 4IOFD 3VGEA 2OL3L 1QLFB 4LKCA 3BHBB 1BEYL 4L1DA 1AD9A 2IH3B 5HPOA 4L4VD 3TN0D 2VR9A 3OKLA 2YPLB 2LU7A 5GISL 4PD4J 3NA9L 4DVBA 4KKBC 1RZ7H 4QRSB 1OGTB 5FO9B 3HUJB 3EAKA 4XTRC 4PJCF 4ZO7A 4AENA 3BKMH 3TNMB 3RRQA 1UZ8B 2NX5A 3ALPA 1ZHNA 1T0PB 3E6FA 4I3RL 4MNQA 4X7DC 5AUMB 1H15B 1ES0B 1R5WB 1FYTE 4K3EL 3ROOB 4R96A 5HYJE 1WZMA 5D1ZD 5J56B 5DQDL 2XT1B 5ILTH 3EO9H 1MFEH 2YPLA 3LIZH 4MAYC 1AKJD 5BS0A 1CE6A 1U3YA 4A6YA 3FONB 1Z2KA 3BDYH 4NOBA 1NGQH 1DFBH 2FHFA 1T66D 2OXGA 4MXWL 3GMNA 4ELMB 2BHZA 3QEUB 3VFTB 4Z77A 4OGAD 1A3LH 4DN3H 4LLVB 3QQ9D 5D2NA 3BGMB 5TDPB 4APQA 3UPAA 3HC4L 4MNQD 1RU9H 1UB6B 1T2JA 2IANA 3RVWC 1FGVH 5D1ZA 3BN3B 3V7AE 3ULVL 5DFWH 4LIQH 5F6HI 3GZKA 2EH8H 5E2WL 5LAXB 3GKWH 3HN3A 3JWDL 4QHUA 5E24E 5CUSH 4GBXA 5DDHB 5J06A 4EI5C 4YZFF 2AJSL 3VH8B 2BCKB 3B9KD 4GMTL 4OGYH 1YECL 3HPJA 4LSPH 4NWUH 1RIHH 4HXBH 1A6WL 1H5BC 3VXMD 5C2UB 1YN6B 1ZLUH 3GSNL 1CGXA 1NAMA 1RUMH 1ONQA 1R3IL 1KTDA 1OGAD 2DDQL 4LASL 3SY0B 1MF2H 1JPST 1T7WA 1D9KD 5L2JA 2EIBA 5DJCB 4LGSB 5TF0A 5FDWB 4O5LL 4PJ7B 2PO6B 1JNLH 3E6HB 4HGWA 5EORH 1ORQB 1TVHA 1IC4L 1TTUA 4XHJC 1FH5L 2WIMA 4HXAL 2AXFB 4PJIE 1X4YA 4OB5L 3TYFB 4YDIL 4DKAA 1M05A 1FAIH 3LMJL 3IVKB 3ZDXF 3JV6A 3IAGC 2R0WH 4PRPD 3V52H 1X5FA 5JMOC 5J1AA 3QCUL 1IAOA 5CJQH 3H9SA 5CBAB 1A7PH 4XH2A 4EIGB 4N0CC 4HLZH 4S1DD 1XZ0A 2VDRL 5FOBA 1N0XL 3RTQA 1QKZL 1XGUA 4RFOH 3F6IA 4U1MA 1VACA 2VL4A 1QRKA 5IF0A 1A1MB 3R0NA 4IRSD 2ADFL 5EUOA 3TN0B 5EZIL 3MFFA 1FIGH 1SJEA 3UTSA 2X5PA 3ARSA 2Q76A 4LLMA 5IHBA 2QADD 4CN4A 5FHAH 5E70A 4XP1H 4MNHA 4JFPA 2FBOJ 3PQYD 2ZP0T 3KJ6L 3PL6A 3A0OA 4EBQL 2DM4A 4OCXL 2VKWA 3I6LD 5IB4B 4Z7QF 4YHOL 3FN3A 4HKZB 3UROR 1P69B 4N9GB 4PGDB 3HI6H 2R1WB 3BO8B 1N64L 4M6ML 3H2WA 1HHJA 2FSEA 3PDOA 5AZEH 3P40A 2ZUSA 5E8NA 4QY8B 1T22B 1NBYA 2HJLB 2NY2B 2R4SL 1U41A 1ZGLA 5GQBA 1JCKA 4JRYD 2JTDA 4K8RD 2NXZD 4K9EL 1X4ZA 4MHHI 1ZA3A 4MQTB 3VW3L 1S7VA 3WFDH 5EC1A 3UDWA 2BRRL 2Q76B 4XNQB 2N7BA 5E2VL 5E95B 4TQEL 3VRIB 2YBRB 4HEME 1K2DA 2XNAA 4A6YB 2Y07L 3GMPB 3K8KA 5DHYA 4HPOH 3KPSE 2B4CH 4QGTA 1U3JA 1DQLL 2OI9B 1KB9K 4XNYL 4JREB 4PBVC 3P9WB 4L8SB 5IEHA 4F7TA 2HFGH 1IEAA 1K2DB 5KTEH 1QFUH 4XP1L 1EV2E 3HAEA 4I0PC 3NPSB 3T1FA 1G7PB 2DQIL 2ITCB 1J1PL 4P46B 5D7LA 1H3PL 1Q0YH 2AJUH 3M17A 5F97E 1MOEA 2I9LB 2WUCH 4UTAH 2DM2A 1NCBL 2H2SC 5K93A 1C1EL 1NUGA 3B9KA 3V4UL 4GS7B 1P84K 1D9KB 4PGBB 1YEKL 2XWTA 3VG9C 2F5AH 2QQKH 5F1IA 2X44D 3BMVA 5HVHB 2PO6D 4LARL 5I1KH 4WW2A 1GGCL 5HVWA 4R7DB 1NSNH 1LDPL 4YBQC 2FB4H 2E6QA 2J88L 1S8DB 4XCCH 4HFUL 5CBEA 3RNKB 4MXQC 3D5OF 4L9LA 4R8WL 4YK4C 5DR5L 3WN5B 1RI8A 5F71A 4GAGH 4N9OB 3T3MF 1D9KA 4PR5A 3PQYE 3VI3E 4LL9A 4HK0A 2NY1D 3B4NA 3SY0A 2G75B 1GC1L 3NVQA 5L2JB 5FA4B 1F4YH 1CXKA 5BVPH 4KDTC 1BX2B 3ZKMD 5I18H 1F6LL 3GSNB 4LSTH 1RK0A 2C26A 5C9KA 4N1CA 4YEFA 2RHEA 1FO0A 1UA6L 1PKQB 1WUNT 4CNIB 3FFCE 1BEYH 3AUVA 3QCVL 3PGDB 4OI7A 4K8RC 2H1PH 3DI3B 3JSSA 2GCYA 3U7AA 1FN4A 1WIPA 3O4OC 1NFDA 1V8HA 4NIKB 3GB7B 3U4BL 2QADB 3QHZH 2EDJA 4GW1A 5T1DH 3HRPA 1H3PH 5FA3A 4MQXD 1I7TB 5SWZA 3NCMA 3BH9A 3B3IA 5H8DA 3L7EA 3L3DA 3H3KA 5J7CC 1XGUB 2DJUA 3V6OC 3ZKQD 1Q9OA 4RQQB 3ARBB 4OFVA 1JIBA 3IRZA 2OTWA 1DANT 1BVKA 3MUJA 4XBEH 2FJHA 1UXSB 2A0LC 4TULL 4P2RE 2BNQD 1OPGL 4KJWD 1WAAF 4WW2F 5LBSL 2LTQB 3PQYA 4OLUH 4LVEA 3O3EA 3RBSA 5HYEA 3ZSTA 3OKKB 4V2CB 4N1HB 4UTBH 2W91A 2NXZC 2NXZB 5F7HA 1JGLL 4HIXH 5HI5C 3FO1A 3A6OA 5A16A 4KGJA 3UC0L 1EAJA 2APFA 4ONGL 3VFWB 4NN6C 1X5ZA 3EO0B 5A2KH 1QQDA 1S9VB 1S7RB 3TJEH 1EO7A 4W4OC 3CSYB 3MRGB 1YEHL 5FUZH 4R90L 1IM3B 1D3CA 1MFCL 1A7RL 3OXRA 5AG9A 1J10A 1YNKH 3UPRA 4MA8L 4KY1L 2YHGA 1ZHNB 1EZVY 4QRRE 4JQVA 5EOQL 3W82A 4JLRA 1KF9B 5EFIB 1I8KA 3BD3A 4NKIL 2BERA 2YUWA 4OCWL 2FEEL 2YD8A 4FTVB 4NT6B 3B2VH 2YD9A 4WU5A 4HIHB 3TIEA 3T2PA 1EJOL 3EYSH 2M2DA 3I02B 4NO5B 5T3ZL 6CGTA 4WWKA 5F7EH 3RWEA 3TO2A 4R7NB 3ULUD 3ECBB 2WINA 1ZT4B 1IAMA 2Y9RT 3TT1H 3AB0B 4QHKJ 3DX8B 4CVWA 5FYKU 4HGKC 2MHAB 2ESVB 5EU4B 3NCFB 3ZDYE 2UY6A 4IS6A 2A9NH 2IFGA 3E2HB 5I1AB 3K8LA 2ATPB 4Q6IC 3NMEA 3UYOD 1NANI 5IEKA 1BJ1H 4YXHH 4G43A 1INQA 2WWKO 2H3NA 4HJ0C 3KLHC 5E9DB 2OTUA 4JRYB 2DI9A 4PRHE 2RCSL 5I1IH 4JLRB 5J1TC 2QSVA 5DD5H 1AD0B 1A7PL 3JTTB 4PTUB 1CL7H 4KZDH 4KK6C 2BFVL 4FQIH 1MAJA 1G7MB 3D48R 1HNGA 4HJGB 1ETZA 3RDTB 3TJEL 3RY6C 3VFNA 3BESR 3CK0L 5F1OB 5CEXA 4C83B 3W11D 1CBVH 5IMOA 4XCYA 1TCMA 1INDH 4HEPG 4URTB 5HI4C 3MFGB 1FFOB 5CZXD 4LHUA 3QIBA 5ICYB 4PUBL 3HZMB 4L4TA 4ZOBA 1FIEA 4GJTB 2C1OB 2FCBA 4LP5A 3P4LA 1AXSB 4ZDHA 1YJDL 3NN8A 4P2OC 3C08L 4ONHB 1QRNA 3MRIB 1YY9C 3O2VL 5DJ8B 3UTSE 1CG9A 5TQ0L 2ED7A 4AG4H 4ENED 5J3HC 4KV5F 5D2NC 4J3OC 4J23A 1I3RA 1I85C 3F7PC 4IHOA 1PFCA 2ZUUA 1IGFH 3DMMA 1W8OA 5D1ZC 4L8CB 3I6LE 2XOTA 5IGXH 2FBJH 4HUUB 1B4JL 2EC8A 4XP5H 5F96L 1GXEA 1XR8A 1KIPB 4JEGB 4NKIH 5DA0B 2G9HB 3INUL 4J3UA 5E5UB 3QDJB 3LQZB 4ZS7L 3HZKB 3C60C 2ADJB 1HDMA 1NEUA 1OARH 3ARFB 3VXMA 3G9AB 4LGRB 3D39D 4EOWH 3C5SA 1FVCA 5JW3L 3IFPB 4JJHA 3KYMB 3QDME 1XR8B 2BSTB 4RMVA 3M1BB 4JFFB 1Y0LA 2ZPKH 3G6DH 3ILQD 1LO0L 2H32A 1JK8B 1IL1B 1P6FA 5TPWL 3QWRA 3OAYK 4JKWA 3TZVD 2D7TL 3OKMB 1JI2A 4NKMB 4LPTA 4MAYD 4XC1H 3WFEL 2EE2A 3WKMH 2FECI 2X70B 4FQ2L 4OZHE 1LK2B 2Z0BA 2FIRT 4QGYA 5E2TL 4FABH 4X6CB 4K7FB 4QHNB 1I1AC 1VHPA 2NY2C 1CICC 5HHVL 4PRPA 3UZVB 3U7YL 2SEBB 5TE4L 3SGDH 1B4JH 3HR5B 5FAAA 3BZ4B 1I3UA 1NBZA 3QWRD 3TVMC 5JOPE 3LN4A 1BLNB 2J4WL 4V1DD 1DEEB 1ZHKA 1QBLH 1NAMH 1J0ZA 1KBGL 2MQ0A 3W0WE 5DJDB 2Y36L 3MNZA 4AMKL 5J13C 2GSIA 1MY7A 3CU1A 3UEZA 2NCMA 1R0AH 1KFAL 1QBBA 1T7VA 5KSUA 1Q72H 4M00A 3RVVC 5KJRL 1NDGA 3EJZD 3OX8A 3GKZA 3PWNB 1Q8MA 4R0LB 3B5TA 5CJOL 3BE1H 2WUCL 2EYSB 3LKNB 4X0KA 4CJ0A 3SKNA 1N5AA 5EPMB 1N6UA 3BRGC 1E4KA 3BZFA 3O2DA 4JZOB 2CLZA 3O81A 2LU4A 1TZIA 4N0YL 5I1CL 2X09A 4I2XE 1CXIA 2VMFA 4TQEH 3ELAT 2BVPB 4YFDB 3RIFF 3TCLB 1BBDL 3RGHA 4IEFB 4GLRI 1PSKL 1IAKB 4N0UE 4M6NL 1FZMB 4UUJA 5I0ZA 4G8EA 1V7ML 4MNQE 4ZFOA 3MCKB 3ILPA 5JOPD 4F7CA 3T3PE 4ETQB 5C0ND 3L3JB 1M1SA 3AM8A 5JHDB 1IRAY 4D94A 4RGND 4ZSOB 2D7TH 4XNMA 2LV4A 2VN7A 1VFAB 2BHUA 3C6LB 1KCRL 4H8WH 1ZA6B 2V5MA 4LF3B 5AZ2H 3SBWA 3MLYL 2D7QA 4P3DB 5EBMA 1AO7B 5CZXC 4P5KB 4JG1H 2APWA 5D71L 4JM2B 3SOBL 1F6FB 1X44A 1JJUA 4EI5B 1I1FA 4JVPA 1YY8B 2BDNH 3DSFL 4PFEA 4ZUVA 3BT2L 4ESKA 5BRZB 3QG7L 2EIDA 2H2SD 1DUZA 1J11A 4M1GH 1F4YL 4YE4L 1KJMA 5BVPL 2ZWLT 4KAQL 1MHPH 3DV6B 2FECL 1QRND 2C9AA 1HQ4A 1V7NL 3T77A 4HC1A 2V2TA 1VGEL 1JNNL 5JA9A 2P4AB 4Z8FH 3DYPA 3QJHA 2VLRA 5B3JF 1F3RB 3P9LA 3HNSL 2IC2A 4P3DA 3CPLA 5HGGS 5C0AD 3WO4C 5GZOD 3QZWA 1IQWL 5J3HD 3P3YA 5D7LD 5IR1A 1QYGH 1P5VA 2L7JA 4UB0L 3OB0H 3RZCB 3VGFA 4DAGL 5J6HA 3CVHL 3D3VE 1OAZH 5IG7A 3C6LA 1BBJB 2LU3A 4QKXB 4LSSH 2EE3A 4ODSH 2DN7A 4MAYB 1KLFA 4PJ7A 4BSVB 4ELMA 4C56A 1QP1A 3T4AB 2J5LC 4NSKB 2B2XH 1N7ML 2XXMB 3IETA 5I30H 5DRNB 4PGEA 1CI5A 1WFTA 2E6JA 4OB5H 1J8HA 3T77B 1GJIA 1EEYB 4NO0A 4O9HH 2Q7YA 3LRGA 2OK0L 3MBXL 4R97B 2ITDA 3KYAA 5CBAA 2HYMA 4DGYL 4AEEA 4K8RH 1DQLH 2AV7B 1JN6A 2OR9H 1IILE 5E6ID 2BVEA 2EZ0D 1I7UB 4XX1E 4CL7A 4GBXB 1G7LB 1HHIB 2DLIA 3W9DB 1LEGB 1CXLA 2MCPL 2VXTH 3O6FD 2O5ZL 1VGKA 4M7KH 3U0TA 5FO8B 1FNEA 2PYEA 5DLMH 3V5DB 4L3EA 3MJ7A 5IVXF 3Q6FB 3KYNB 3NAAH 4P57A 4ZUTA 5HGBB 4ZO6A 1I3RB 2UUDK 1RURL 4LGPB 1YPZE 3I3DA 4UB0H 5DWUH 4KAQH 5SWZD 1NBZB 1JTTA 1Q9LB 4FQJH 5AZEL 2HT2C 7FABL 4UAOC 1NGPL 3FTGA 3L3OA 3QG7H 3HG1D 4CDGC 2F5BH 3TBVB 1PVHA 1HYSC 1WK0A 5E8OB 1DQTA 4F80A 3LQZA 1CCZA 4Z8FL 3RVTC 1KYOJ 2VE6B 4LLQA 4MQXC 5L9DL 3NABL 1BVZA 5GGTA 3EOTH 4DEPC 1JRHI 1NKRA 3VWJB 2EDOA 1X7QB 1QNZL 1EAPB 3BT2H 1H5BB 2NZIA 4X6CE 3BH8A 3S4SB 4LRNH 5I76B 2EXWD 3W0WB 1RURH 4R90H 1FO0H 3FRPG 1MIML 3WO4B 1QBAA 1Q38A 3SDCB 4OZFG 5EU3B 5EN2B 1JV5B 5E00A 3WIIL 4X8XA 4V1DB 4P9HC 2P5WD 1M7IB 5FEBA 2DQUL 1Z0NA 3OZ9H 2AI0H 5D6DA 5E9DE 1NCBH 3MLXL 3ARGD 2XZAH 5MP6H 1VKXA 3G04B 3MLWL 2VUYA 3S37L 4R4ND 4HD9A 1C08B 4U3HA 4P5TD 4Y5VC 5F7YC 1S7UA 3V8CA 1QSVA 2YR3A 5IBLC 1FL5A 3QHTC 3IFNH 4M8VA 2FX8H 4OZFH 3ZE0F 1OAXL 3BW9A 3FHAA 2CJUH 4YGVB 4HWNA 4Y4FB 2BY0A 4KI1A 4ZXBC 3S96A 3OB8A 3EYUH 4PP1D 1K4CA 4WENB 4IRZL 4F3FB 1II4E 2BC4A 2WP3O 4IMKA 4KKAD 1MFAH 4LCCC 1NGYB 2Z31C 2Z4QA 4JDVB 1TTGA 3HMWL 2AI0L 5CINL 4K94L 4PJGA 2ZCLH 1WGOA 4PRBB 3QDMA 4NZDA 5ICXA 3LKOA 1CBVL 1MQKL 4S0SD 1JZ5A 1A3LL 5JQ6L 5FCUL 5ITFB 1D5XB 3ETBF 4E0RB 3HLAB 5I1GL 1BM3H 3WNMA 1TPXB 3NPZB 3RNKA 5CBEB 35C8H 5JPMB 5B21A 3AROA 4G80B 4FABL 1N59A 4WI3A 5IBTL 1RJCA 2R1XB 2VUOA 1Y18A 4P23D 4PR5B 2CIIB 3MRCB 1AE6L 2ICES 4GMTH 4LPYA 4OGYL 4L3CB 3IXAB 5TF1H 1SEBB 4GAFB 5BO1L 5BRZD 4NNYB 1T5XB 1N4XH 1HDMB 3S4SG 4UOW1 4WFFE 2P1YA 2VDNL 3X14A 1L4IA 4NQXA 3LKPA 2I60L 1MVUA 3LS5L 4NO0D 3MJ8B 1WBYB 4JANA 3DBXA 3QQ3B 3HI1A 1GYAA 1FC2D 3VXTB 1NMCC 3K80A 1EEYA 1FO0B 1DP0A 5IB1B 3NCYP 5GJSL 3L3IA 1JWSA 1PBYA 1NMAL 1NAKL 2H6PB 3RZCD 1T3FB 3KWWB 2JK5B 1JN6B 1QKZH 3A6CL 4BUGA 4XC3L 4MJID 5GIRA 4K7FA 5FDWA 5C0CB 3O45A 5IBTH 3ULVF 2FNBA 1MFDH 4ODWA 2W0FB 3NCJH 5MENA 3EZJB 1ZMYA 4KDWA 3VGBA 4YHYC 2R2BB 1LO4L 4P5TC 1KTKE 1U6AL 5FUCC 4CW1A 5KS9B 3F7VA 3IGAB 2H6PA 3SO3C 5L2KD 5F7DA 5CD5D 1REIA 5C07B 4OF6A 3TA3B 4ZUTB 3KPLB 4BH8A 5HGBA 1OB1B 5K9QG 5B39G 5IESH 1D5ZB 4WFHD 2IAMD 3AREA 4HK0B 4ZFGL 5IVXE 3IJYB 3QI9C 4LCWD 1VSCA 2F53A 1BBJA 5CGMA 2OR8A 5D7KE 1T04A 4J4PA 4YDKL 5F70A 4MYWB 3WBDA 1CVRA 1FL3B 4O2EB 3OG4B 2X42A 4O2CA 4WTZA 4U1SA 1OAXH 3PGCA 4NSKA 5BMFH 3KPSD 1SYVB 1KB5B 2G60H 4JY4B 4LVNB 2UYLA 4Y8DC 2X4NA 2GK2A 4XVSL 3MGAA 3N1QC 3REWB 4PUBH 4Z6AT 5L2KA 3FFCD 5SWSD 4RA3A 1EA9C 4Z7UB 1INDL 1NFDB 1NLBL 2PNDA 4XB8A 4ZO9A 5KAQG 1T04B 2NZ9C 5FECA 1WBXA 3TH4T 1A14H 5I17B 3RPIB 3FB5B 3MOQA 4QRRA 5C0BB 2LTQC 3FO9A 1MCNA 1MVFA 4C54A 3C09B 4Z7OE 5LCVL 4QRSA 3VWKB 2XPGA 1G7QA 5HHQB 1F4WH 1MH5B 4HCRH 4P5TA 4HS8L 2C3GA 1ZKAA 5CSBA 4EVNB 3O41B 3IT8D 2Y5EA 2VLKA 4KVNL 4JVUA 4QRQA 4RAVA 2I60H 4KI5C 1U0QA 3U0TB 5FO8A 4QXTA 1ES0A 4X7EC 5L6YH 1SMAA 4L8BB 3VA2C 1Z6JT 2EZ0C 4JM2A 2W9DH 3ESUF 2X4NB 1UVQA 3FONA 4DK3A 3KJ4B 2Z8SA 4MSWA 4QHLB 1KJMB 1AE6H 4G43B 1N8ZA 4PTUA 2ORBL 5DFVD 4H26A 5KG9A 1KELL 5BZDB 3HR6A 5LCVH 3UTTE 3WNPA 4LSVL 5D2LB 2P7TB 2E7LA 3UJJH 3L3GB 4OCRL 4UINH 4NN7B 3BPCB 5HGHB 3OR7B 5E8EA 4X9BA 2EYTB 4JFYA 5BMFL 1TVBB 4U6VL 2YOCA 4GG6A 3O0RH 5I8EB 1MAKA 1MH5A 4P5TB 3QNYA 3BP5B 1JWMA 1EK3A 3QUXB 4APQD 5DD1H 3QIBC 4P23A 4WUKL 1M6OB 5F6IB 1NFDE 5KVEH 1HH6B 1G7PA 4G8GD 2WINB 1DZBA 2VLKE 3JWDC 4QOKD 2QKIB 3EFFA 5DMGD 3U0PB 2Z91B 4C56B 4PJEF 3MUGB 1Q72L 4HJ0D 3QUZB 3QNZA 1S7WB 4GW4A 1OP3K 1J18A 4N5EC 5JIIA 3JV4A 3PABA 4LVOB 1AJ7H 4PGEB 4AK1A 3QDHA 4Y16C 4JKPH 5T1MB 5C0CD 2DKUA 1JYWA 4E41A 5CGTA 2P43B 1YN6A 4JGUA 4E5XA 3QUYD 4JFZL 4WFGE 3NTCL 1KGCD 2RFXA 1MCWM 2J8UA 1DL7H 4YUEL 5C8JB 1BAFL 4AY0A 1JPFA 3NPSC 3QB7C 3PWLB 1R3LB 2DM3A 2X4RB 1MAMH 3ARFA 1JP5A 1C12A 1XGTB 4Q9QL 5IOPB 3QXDB 5GSRA 2WLZA 4PRHB 1HIML 2FSEB 5I19H 1X5KA 5DC4B 2E8YA 1GAFL 4YNYA 3P4OA 3QQ9C 3DYMA 4RDQG 4Z7QE 2HJLA 4Y4KC 2F53E 3ARUA 2EDLA 2WANA 4P3WA 5H35A 3IDIB 5IVXA 2E7MA 3PP3K 2UZYB 1AGFB 1H0DB 2YC1A 4GAYB 4YXKH 3IXTA 2R8SH 1DANU 4Y2OA 5EOCH 4WJ5B 5I8OL 3WHE0 3TBWB 1HNFA 3ZHKA 3DROA 4KVCH 3QXDA 1MIEH 5IT2L 4U1LA 2WZPD 4IDJL 2OCFD 5CWSA 3C5ZC 4M1CD 4E42B 3HE6D 1UWXH 4FXGB 4LCIH 4PPTA 5JW4R 1DBJH 2FB4L 1EFXA 2J88H 4RX4D 1JHLH 1NFDF 3RTQD 1BFOB 5F89A 4ZXBB 2NX5B 1FYTB 1PYWA 4K7PL 3UTSB 5E6YA 1P4LB 1WZLA 1CXFA 4P5MB 1T03L 4K2UH 4FFZL 5C7XH 2X1WL 1CVSC 4Z7OF 3DXAB 5C08A 1W0YT 1U9KA 4YNYB 5BS0B 3X3GH 1NC4D 3G5XB 2WIIB 4NRYB 2XACC 4YHKH 2JB6B 5ISZA 1QSEB 5JORA 2P5EB 3HUJA 4YZFE 1KNOA 5H35B 3RUGA 1ZVYA 1HIMH 3L3KB 3T0EC 4UU9B 1EEQA 3LEVL 4GRMB 3HE6A 3D18B 4RGNE 4O02H 4L3ED 3WYRA 4Y4KD 3CLFH 3MPCA 3SDXB 2IG2H 4ONGH 1EFXD 4RX4A 1NQBA 3F7RA 1BBDH 3G5VB 3TVMD 1HHJB 1OM3L 1X5YA 4MB5A 2VDPL 3O6LL 2P8LB 1UM5H 1OGAE 4JO2L 3VWKA 2DQIH 4F9PC 2AV1B 4RSVA 3NIGF 4TSCL 3SGJC 3RL2A 5C08D 5MENB 2GUOB 2Y07H 2BNRD 4F37F 1UCTA 3WIHL 3WHE1 1QLFA 2CLZB 3U7WL 5DRXB 5EFIA 2VJXA 4HHAB 1MCQA 1T89A 4LSSL 4WI9A 2NY7H 1YQ2A 1DDHB 5DD5L 1P5UA 1IAKA 5I66A 3S35L 1DLFL 5HYQB 3ECBA 4XGZA 1QA9B 4FQCL 4YHZH 3VCLA 1AGEB 1YY9D 4UOJA 1S5IL 2GSGB 2KQNA 1A47A 1FHGA 3D2UD 4PB9L 5GRJL 3RDTD 1J1OL 3QUZD 3W81A 2A9NL 4GT7A 4PP2A 5F21B 5IQ9B 1RIVL 1RULH 2AJVL 5JPMA 3DVFA 3QUMB 5DJCA 1QA9A 1DBJL 3RWIA 5CKGA 3FKUS 5TJWK 4FFVD 4GBXC 3GDBA 4OZFA 3HNTH 4BH7A 4PIRF 2VXUL 3IF1A 5ID1A 1HOCA 1FLTX 25C8L 2GJ6E 3D2UA 3NAAL 5TF1L 2X4OB 2XXCB 1R5IA 4G6AC 4XXCC 3SDCC 5IW6A 5JHLH 4E41D 2GIYA 4HS6A 32C2A 1E6JH 2APXA 1NEZA 3TH2T 2X4QB 3QXVA 1S78D 1CLOL 3CMGA 3NACH 4KQ3L 5CGYC 2OZ4H 2WMPA 3HAEH 4PJXA 4JO3H 4EN3A 2UWEE 3GBML 1OAKL 2J5LB 3ULVE 4XP6H 1PZUB 3T0DA 4OI8A 1F4XH 1YEKH 4L4VE 4XB7A 1UVQB 3SBWC 1KSRA 3ZYOA 2AK4E 4DK6A 4GKZA 4RRPA 5FKPA 2R4RL 5C0RL 4BSVA 4TUJA 4Z7WA 4PGCB 5C0CE 4HH9A 3GIZL 4X5XA 3UPRB 4OLUL 4QHUB 3B2UD 4LVHB 5KTEL 4LQFH 3GBLA 1CGVA 3NA9H 1FN4B 4OBRA 4U1MB 1NGXB 1WZ1H 2X4OA 4QWWD 4ZUVB 4MCZB 5BRZA 1F2QA 3QO0A 3L5HA 4RGNC 3TZVB 4EUPB 3KPLA 4BH8B 5KSBB 1EHAA 4FNLH 2EDFA 3IU3A 4LLWB 4XP6L 3BO8A 2AV7A 1AGBB 2GJJA 5FB8A 1LE5A 4L4JA 2PYEE 3P9LB 2VZ3A 1OQOA 1A6ZB 2VZOA 3BEVB 3GJFH 4UDTB 5JW5B 3EOAA 2ZJSL 2YXMA 4ZAKA 4L3EB 4L3AA 4MJIE 3Q0HA 3VFOA 2ZUYA 5CFHA 3RJDA 3I6KA 4BZYA 4ERSL 4XRCA 5KW9L 1EUTA 1GGYA 1F4XL 4NM4H 3TP4A 4ODHL 3WSQH 1SEQL 4R3SA 2ZSWA 1DN0A 3PL6C 3B8SA 3T0AA 3RWJA 2H3NB 1HSBB 1RSFA 3HNTL 3U7WH 2BNQA 3DRQB 3TYFA 3BP4A 3MLSL 5FF6A 1X5GA 2AEPH 3MV7A 3O8XB 4X5WB 5HYJA 4LNRA 2B39A 4DZBA 4R2GC 2G5BB 1Q1JL 5E8DL 4NUJB 4UU9A 2X4PB 3HB3D 5HDBE 2NX5E 3OL2A 3ARDB 5ACLA 1IT9H 1WC7A 4Y5YA 1A4JB 1VGEH 1S5HB 2X4UA 4JQIH 1UM6H 3VFNB 5DRWB 4MD5B 1NCUA 2OBGA 3BH8B 3FHQA 3ZE0E 4AYFA 1W2KT 4KKCD 1RZFL 3MRJB 4XWGL 5CP3A 3WJLC 2FX7L 2GTZA 4ZAKB 2O5YH 3U83A 4BFIA 4LLUB 2EC9T 5JPNA 4UILH 5DO2C 5EU3A 3MV7D 43C9B 4EXPX 5HDQH 2FD6H 4AEFA 5I1JL 1U91A 5JIKA 3QDAA 3C2AL 4DKEH 4AM0B 2O5XL 3ZYJA 3UCRA 2P5ED 3UYPA 4ZD3H 1ADQH 1MELA 3IU4L 4OZIF 1ADQA 3FT3B 3FT4B 1IKFL 1AC6A 2PYEB 1UJ3B 1OAUL 5D7IB 3VXNB 3VI3F 4EUPG 4RGNB 1RUQL 5EG6C 3G9VA 1BZQK 4AL8H 3T3ME 5SX4I 1S7UB 2DM7A 3N9GL 1WJ3A 4V2BA 4ZPTA 4F8TA 3CSBA 4I3RH 4LVHC 5JQ6H 4P4RA 1OTSC 4X4XA 2AAVA 1FNSL 1CFNB 2DS4A 2EEBA 5E8NB 3G5XA 4HIXL 1I1AB 1UCBH 4QTIH 3P2TA 4Q9RL 1AFVL 1DJSA 1YNLL 4F3FA 3D87B 3L3KA 4WEUD 3BZEB 4PLNC 1MCCA 3G6JA 4NYLB 3SN6N 4G42B 3DVGA 1IAIH 1I8MB 4PV8A 1RIUL 3MV9D 3GHBL 3VRIA 2EKJA 4PRAA 3PP4H 4D9QE 4GO6B 5HI3C 4WRLA 4AL8L 1A7OH 1OTUC 2BFVH 2IPUK 2W59A 4FQIL 1KUMA 4H5SB 4EN3D 4LAJH 1OAUH 1RIHL 1DBML 1E28B 4TSAH 5IK3B 4JKLA 3JUZA 3S37X 1NAKH 4I77H 1TZHB 2WM0A 2HMIC 1PLGH 2NY4C 4JCMA 3HKFA 4J7RA 2YMXH 1DDHA 1F11B 3RL1A 4DFIA 3QXTA 2H41A 1KTLB 3DMMB 2EKSB 5DT1L 1BQLH 2XZCH 3H9HA 1CFSB 5D7SH 4KVNH 1GAFH 4JE4B 1FAKT 1QNZH 5C0AE 5IB5A 3I2CL 4ZFZB 1U93A 1EVTC 4EJ1C 4C57C 3BPNB 1VFOA 3L3HB 1RVFL 2VYRE 4LAQH 1SY6L 5D7JC 4Q9CA 5C0CA 4M6OH 1OTTD 4MJ6A 4S0TD 4GAGL 4J3SA 5E08L 2JK5A 4ZTPH 1PKQA 5F88A 3D3VB 3I50H 3MRMA 4RWYH 1CYGA 3WJLA 3PGDA 3LV3A 4X4YB 3TPUB 2LAAA 3S8WA 1HEZB 1M71A 4GRWE 5BXFA 2EDRA 4P99A 1MI5B 1FV1A 3H9SD 4GW1B 2NY6C 3R1GL 4XVJL 1JPSL 5ALBH 5FGBA 1OP9A 4H88L 5BV7C 3H9HB 4R7NA 4XXDB 3TA3A 1E4JA 1FH5H 1F4AA 2PETA 4GRMA 1TETL 2VL5B 4R4FH 1JZ8A 2ZCHL 3FCTB 1LDSA 2CUIA 2WBKA 3AAZA 5DT1H 4OZIA 5GS2H 1LNUA 3CGTA 5E5MA 5SV4A 1E6OH 4HUXB 1JPGA 3SPVB 1OT2A 1UQSB 1KULA 1ROWA 4N0CD 1RUML 4QRPE 4WWKB 3KYNA 1OY3B 4BM7A 5GGRB 1NAML 1U8KA 5KSVA 2ED9A 1KB5A 4JO4L 1A6TA 1YDPA 1OLZA 2A6IB 4HT1L 2EXYD 3VXRE 5DD1L 1WFOA 4K7PY 4OCNC 4PJ9D 1M05B 3ARBA 5GGVH 3O4LD 4KK8C 4X4YA 1JGUH 2BOBA 2XZQH 1YECH 3DX8A 4MD0B 2MQCA 3DV6A 4RMUA 3D0VB 4RFEB 2DQUH 5F7WC 4LAQL 3GSOB 5IMLA 12E8L 3L6FB 2IALA 3X11A 4U1JB 3T65A 1YA5A 3JWDH 3PP3H 2IAMC 3ARGB 1KELH 3KNBB 1GOHA 3B8YA 1E6OL 3WDHA 1GIGH 4G9FB 1QRNE 4OCLC 4OJFL 3I3EA 2F8OA 5KN5B 3ARDD 1D5IL 2P8MA 4U1GC 3S9DB 2A0LD 4PYGA 3FQUB 1XCTA 3SKMA 1MCKA 1MEXL 2VLKB 3I6GB 3UTOA 3MA7B 1GHFL 4Y4KA 4M9PA 4TNWF 3HA0A 2DTSA 4YIQA 4Z5RB 4YFLF 1JPSH 5D1ZB 5ALBL 3T65B 2VDKL 2DQCL 5EU5B 3V5KA 3TO4C 5K33A 3WFBL 2B5IC 3RX8A 4XCYB 1CFNA 1RQ5A 2A1WH 1YEEL 4UT7H 1HHKB 3WXWH 4PJBA 3C8KB 1U8JA 4DCQB 4KROD 3QBTB 3L5JA 1DSFH 1ZLVK 2AXGA 2NY3D 3U4EA 4HWEH 4TRPH 2CUMA 4HW6A 5B3NA 4OD1H 1WTLA 4QO1A 1DUYB 3T08A 3S98A 5ISZE 1UWXK 3DMMD 5BW7A 5EOTB 3MRJA 2DQEH 3GMOA 3CFDB 5F9AC 3VRJA 1H15A 4ZNEE 1P7QB 1MFAL 2DQJH 4MJ2A 4RBPK 4UDUA 2D03L 4Z9KB 2LE9A 3GSXA 1GVIA 3FFDA 3JWOL 2DTML 2FJGA 3P9MB 4NQVB 3BP7B 3KYMA 5CZVL 2A83A 1B6UA 4L4VB 1KJ2H 3QDGD 3HAEG 5BOPA 2BXYA 4TOYL 1WEJL 2RB8A 4Z7WB 5HVFB 4E5XB 3QIBB 2W65A 3HLAA 3GSUB 2ZOLA 5C1MB 4MDIA 3WKNA 1QPXA 3CAFA 3GIZH 4NNPL 1LK3L 3E3QE 4LSDA 1NGXA 3MJ6A 1U3HD 1U8QB 2NQCA 3HE7D 3QIWD 3SE9L 3S3SA 2NYYC 3ESVF 3IFPA 4LLDA 4F9LC 4P0DA 2B1HL 5CCKH 5DJ8A 4OLZL 3VXUD 3J8F7 1BQUA 2NW2B 3HZYB 3UYRL 1X5JA 4PJBE 5T3XL 1AKJB 4OGXH 3IXAA 4U1HB 4Q97A 5K9JH 3TBSA 5BZDA 3JV5A 5HTSA 2VDOH 4OFYA 1P1ZB 5GSVA 4QXGH 1FGNH 3DIFA 4BQBA 1ZHBA 1DE4B 4YK4B 2RR3A 5LGHH 3VD3A 4U1NA 1KPVA 4OGAC 1OTSD 3WDIA 4HUUA 1BMGA 1EGJA 4KMLB 4G8FB 1Z5LB 2J8UE 4ALAL 1UM6L 1GC1H 1U3HA 2DOCA 3KPRB 4OLYH 5L7XL 4XCEB 4FN0A 5IBLD 4NKOA 4PRPB 3FRUA 4MD4B 1T1WB 3U7YH 4HWZA 3VXUA 3D85D 4DTGL 2PW2B 3DETD 3DRQA 1JNNH 2VXUH 1V7NH 4KZEH 4E41E 4ZG1A 2FATH 3VWKC 4F9PA 2IAMB 4BZ2H 3BUYA 2AJZA 3O4LB 4OFYD 4UQ2A 2X4PA 4O58L 1CXEA 4LCYB 5FHAL 4CVXB 3PWUA 1NSNL 1IGJA 5ETUB 1S3KH 3QFDB 5INCA 4XP4H 3O6FA 5T3ZD 43CAB 1QLRA 3IFOB 3LRHA 3BKJH 3C2AH 3QEGL 4CN1A 4KI5F 3HC3L 1WF5A 4FXKA 4QRPA 1U8LB 1EEZA 3DXAA 3GJFA 1KXTB 1UZ6E 2BHYA 1A7RH 4LKCB 2Z4QB 4QXGL 3DLQR 3AREB 4IRZH 4ZTOH 4K3DH 4KJYB 2BVOA 3LKOB 3PV7A 2ADIB 3CC5B 4K8RL 5C6PB 1K8IA 3CSPA 4S2SB 3UC0H 1VEPA 1N5YL 1EHNA 3LQMA 2XNAB 3A6BL 3IDMA 3RWGA 4K94H 4LF3A 4DZ8A 4FXKB 4QRPB 1J0HA 1G9MH 2HLAB 3DTXB 3DV4A 4O9HL 4YR6B 3KNBA 2P8LA 1MCFA 1G7HA 5LWYH 3VRLF 3DWTA 5M95B 1NLDH 3L3JA 5ETUA 4K94C 3QFDA 4KJYA 1XCTB 3SKMB 5IHLB 1BVKB 2HVJA 3HE7C 5TH2A 5ICZA 3GO1H 4NC0B 2VLRB 4U2YA 2VQ1B 3C5JB 2HWZH 3WFDL 1RULL 3DTXA 3GBNL 2E5EA 1MIMH 4KGLA 2EDQA 3OAUH 4UZGA 2HFTA 3BKCH 4LEOA 3EDDA 1JF6A 2HKFH 3O8XC 4WEMB 5MEOA 1S5IH 3DBXB 1RZIB 1ZLUK 3AMKA 3VFWA 1TTFA 4HUXA 3SJVB 1I85A 4JDTH 4NO2B 5C0AA 3PWJB 3TCLA 4HPYL 4F37K 2VABB 1FORH 4KK9D 2D7OA 5INDA 2ZUTA 4O51B 4F9LA 1GPOH 4FNLL 1FZMA 4W6XB 1S9WA 2ATKA 1BIHA 4NWTH 3QZWB 4XCFH 1G7HB 4YX2L 4O58H 5D1XB 5EOTA 4XWOD 2ORBH 4I3GA 1NLDL 2RCSH 5CLWA 3EOTL 3CFKA 4JO1L 4FTVA 4NT6A 5L88L 1MCEA 4WI4A 2AJYH 3MUHL 2VABA 4CKVX 5J6HB 4OZFB 4L9LC 4KROC 1CD1A 3P0VL 3U9PH 2L0DA 1QG3A 1VPOL 2QHRH 5FYJU 4EI5A 2C3XA 2A74A 2ZCKH 2E7LC 3EYOA 1DBKL 4LHUD 1A6UL 2DKSA 1I9IH 4TVPD 3QIWA 1XGYH 3LS4L 5DMGC 3QUYB 3KR3L 2VAJA 1F2XK 3EDFA 8FABB 4NQDE 3KDMB 1FPTL 4X6CF 1CU4H 3EDEA 2CDFB 3RZWA 2VLMD 3ET9F 4CMHB 4GQPH 3D85B 2Y5TB 1INQB 5HI4D 4KK5C 3W5NA 4HDIA 2PO6A 2D0GA 4QRUB 3W11C 1IVLA 1R3JA 3S5LG 3GSQA 3UMTA 5HDLA 4PGCA 4Q0XH 4B0MM 4AZ8A 2DKMA 3L1OL 5EDXA 1NUNB 2ENYA 3TJHD 2X10A 3H9ZA 5DS8B 1G9NL 1RJYB 1HEZA 1DQMH 1M71B 1V3JA 4LPWA 3SCMA 5MERA 5CIPB 1QSFE 1R3KA 3MRFB 1A9BB 5DVKA 4EXKA 1CS6A 5FECB 3SGJA 5HPMB 4JZNA 3FZUC 1G6RA 1NH6A 1ERNA 3TF7C 1XGQB 4J8RA 3FO9B 2ZOKA 4BQ6A 2AABH 4LP4A 2A9MH 4DAGH 4HZLB 1VFBB 4UTBL 4B53A 1MCLA 3ZDZE 5A16B 1R5IB 1A9EA 5IF0B 3GI9L 3RNQA 3QFJB 4M7JL 5D72H 3VFOB 4R2GB 3WUZA 1WV7T 4U6VH 2YK1L 4OIIH 1MQ8A 3DXAD 4G7YH 5BQ7B 1OAQL 1SJEB 1JF1A 1JHTB 1FVEA 1U8OB 1XGRB 1J0YA 2VSDA 4U1LB 4O4YL 2EDTA 1VKXB 2F53B 4FHBD 5EO9A 1NMBL 3MBEC 4ZO8A 4L29B 1FGVL 4O2CB 1SM3H 1XH3B 4PJIA 1JZ4A 3RGVB 4PB0L 4PJGE 3MV7E 4S1QH 1G0YR 3PDOB 4X9IA 3HPLA 1CT8B 2HTKD 3EBAA 4UNTA 2UV3A 3S34L 1L0QA 4LQ1A 2MKWA 1HSAB 1CGSL 3KPOA 5SWSA 1IGCH 5GGSB 1F8TH 3LPFA 1SJHA 2R23B 3LIZL 4MD4A 4QNPF 4F33A 2Q20A 3OKNB 4KJWC 2Q7NA 2XI9A 3Q2CA 1FVEB 1U8OA 5KVFH 1K85A 2XWJA 1FQ9C 2IH1B 1DBMH 1B88A 2A38A 3BKML 1IEBB 2AKRB 3ARBD 1F3JA 1E4WL 5DVMA 5T1KD 3T1WA 3FAXA 3ILQC 4N8VB 5FUZL 4PS4H 3T09A 1H9VA 1KT2A 2R0WL 3GJEB 1HXMB 3OKNA 4OLVH 5I74B 4NFCA 1IBGH 2IANE 5I8OH 1S9WB 4IIQA 5HI3D 2NLJB 3V5HA 1OSPH 3G5ZA 3GSWB 1WC7B 5D1XA 5BV7H 3R06A 5GISH 1P2CA 3RWEB 1SJHB 1PG7L 3BPCA 5HGHA 4OJFH 5DRWA 1PEZA 3IS1X 4D0BA 4PJIF 4GXUN 4PJXE 2Z31D 1T22A 3VFPA 5GS1C 1LEIA 1DN2A 1XF2A 4HUNB 3MLZH 5JTWA 4ISVA 2K9UA 4YHPB 1A1NA 2FEEI 3KWWA 4CU8A 3I50L 1I7RB 1YPZA 1MFBL 1V3LA 1AY1H 5JR1H 5SX5K 1EXUA 2GJ6A 5IGXL 2R2CA 2CKBB 3PV6A 3ALXA 1I8IB 3GJEA 2EH7L 3F7YA 4W4NA 3C5JA 1MI5E 2D9QB 4FQPA 4ZXBA 4JY5H 4U33A 1HI6B 5FM8A 4FQXA 5DC0A 5F9JB 4NJAH 2F58L 2MOVA 4P2QB 2H9GB 2Z31A 4JM2C 3UTPE 4KHTL 3QPXL 5MEOB 4WW1A 2CKNA 5D7SL 2VITA 4OM1L 1MCJA 5CHNB 1I8LC 2RQ8A 3O9WC 2B0SH 3KAAA 3MLVL 3MYJA 4D0BB 3AVEA 2GEEA 1ZA6A 1FL6B 1YEDA 3D18A 1AIFA 5D6DC 4H8WC 3NFNB 5ESVB 3JWNC 1JZ2A 1HH9B 4GKZB 3ARFD 4YC2C 3UJJL 2F53D 2GKIA 5D8JH 1DFBL 1NGQL 4MJ6B 1OARL 3SKUD 4YDLB 1IGFL 4AEHL 5JIPA 4JJ5A 5CP7B 3R8BB 4OV5A 1YNTA 1C5CL 2Y1VA 1UXSA 3Q48A 1BD2E 4OF0A 4XPTL 5TE6L 4M3KB 5MEPA 2OTPA 5AD0A 5F9WC 2OZ4A 3KYOA 5CJXC 4ZUWA 4L8CA 1V3MA 1A3RL 1MHHB 5DUPL 1NBQA 4XPBL 2CDEA 3HZVB 3V6FA 1WQVT 2PCPB 5H37H 2BNUB 3L7FB 4ZS6D 3N0PB 3MOAH 4PRDB 2IBZX 1XGPB 2CDFA 2XTJE 5EO1A 5HD8D 4I4WB 4AJ0A 2GI7A 4YQXL 1KTRL 1NDMA 4N90E 3BWAB 4OUOA 4PJIB 4HV8A 2VH5H 3K8MA 3EGSA 5MHSE 5JNYA 4NWTL 2W1NA 4WTZG 1A6TB 1YDPB 5FGBC 5C08E 4CMHC 5GIRB 1LVEA 4G8GE 5C2BH 2CPCA 2GAZB 1JE6A 1MWAB 4HPOL 3AY4A 4WO4B 4PJEE 3GB7A 4PRID 3RPKA 3MRBB 1NC4A 5I1EH 4HLZG 5D70H 1N7MH 2R15A 3MODH 1UADC 4JO4H 4KWUA 1D7FA 1P4IH 5C2BL 3U4BH 2AXHA 1MRCH 3KYOB 3QUKB 1WIOA 4Y1AA 5DC9B 1YMME 1I4FB 1EIBA 2OXHA 4WI2A 1KPUA 4JM4L 3MNWA 5IVNA 3LV3B 3CVHH 3QNYB 4ERSH 1PX4A 1GSMA 2R4SH 1I9JL 3W9EB 4N0UA 1QO3A 3DHMA 4LHJB 5F1NA 4YHIA 2V7HB 4Q74A 3NH7L 3UBXI 3PWPB 5H94A 2NY4D 1JZ6A 5A1AA 3NABH 3CSGA 3EGSB 5AAWA 3HI6L 3IB4A 4HHAA 4I2XA 4HUVB 2FLRT 1OPGH 3FB8A 4RA0C 4X7SH 2QQNL 1RUKH 4YHNB 3QDGE 3OR6B 4KTDH 3AS0A 5F44A 1GGIL 1Z9LA 3CFIC 4P4KD 4ELMF 1UKSA 1LO3H 5T3ZE 1DQML 2GHWB 3BIAX 4OM0H 5HGDA 3UJIL 4IRJA 1S7RA 3ULUL 1TJIL 5JHDD 3T04D 2E9WA 3MRNB 1MY5A 1EFQA 5E08H 1UEMA 5C92A 4Z18A 3VG0L 5HHXL 4GUPB 3HC0B 4G9DB 1S7QB 2FH8A 1U2HA 4H1LB 4P2QD 1MQKH 1N8ZB 3QUXC 3FAWA 3E8UL 4UV4H 5T1KB 3EJYC 5FYLH 5IIEA 1ZT1B 3K74B 1AXSA 5A2IH 3UX9B 2HJKA 1CGYA 4U1KB 4M6NH 4PRPE 3BN9D 4PJAE 3MJGX 1E6JL 1LE9B 4LCCA 4ZDHB 3F7YB 3WNKA 1LEKB 4KZEL 3RY4A 3BDXA 4XNYH 4RISH 3MACH 5C9JB 2G5RA 1UC6A 4OZHA 4MHHG 1ZT1A 3IDGA 5LWYL 3WE6A 1DQQB 5HJ3B 4BFBD 4P9MH 1KIPA 4FP8H 2QKIA 4NN7C 1F02I 1WT5C 4ODTH 4R9HA 4QOKE 1TLKA 4MNGE 3TT3L 1GGCH 5ADPH 3IXTB 2YD2A 3JTTA 4UNVA 1MJJA 1DTUA 1J1OH 1X3DA 4HPYH 5FUOH 3VGGA 5GRJH 4KFZC 2MCPH 5T1DL 2OP4H 4IJ3B 3C6LD 2QSQA 5CEXB 3M8OL 2L7UA 2Z91A 4PJ5B 2JJTC 4YPGA 1NL0H 3OF6A 1FE8L 5C0IB 3BI9X 1CLYL 1R6VA 4PJ7F 3K46A 1Q9LA 5GSRB 1AGBA 2VDQL 3HI5L 1T1WA 4J3WA 3MUZ1 1XZ0B 3V0WH 3WLWD 3NFPA 4BZ2L 2ZUQC 2CIIA 4AIXA 3SCMD 2MTPA 1L9MA 2N7AA 2SEBA 4TSCH 2Y6SC 2JCCF 4HWBH 5T3XD 1X5LA 1RHFA 5D6CB 4KKBD 2F5AL 3GMLB 3E8UH 4UV4L 4JRWA 1N5YH 5E6IA 5KBNC 5SV3A 3IDNA 1C7TA 1RZJL 3RVVD 2DIAA 3MC0A 5HYJB 3MLRH 1ZEAH 1T1YB 3QUMH 5A2JH 1D5MB 5I73B 4DN4H 3J7HA 2I9LA 3SJVE 1OVZA 1H0DA 3RWFA 1KEML 4WY7H 4Y19B 2DQDL 2RJMA 2GSIB 1UH4A 3BYTA 3D69A 5ID0B 1IGYB 1HKFA 4ZUSB 2F8VA 1LO3L 4X7FC 4WCYL 4OZIB 5E2UL 3TNNB 1KG0B 1YEIL 2ICWJ 1CK0L 3DV4B 4BFEA 1E4XI 4X99A 1QPPA 1D6EA 1UG9A 1Y0LB 5DK2B 4LK4A 2QEJA 4KMTH 4BJLA 4P2RB 1OSZB 4HWZB 1S7VB 2GQHA 5GHWH 5AD0B 3ZZ1A 4QRRD 2BOBB 5IJKA 4XPAL 1HKLH 2Q8AL 5HHME 5ANMB 2DBLL 4WO4D 2JB5L 3DVNA 3LPGA 5MI0C 4I48A 3RL1B 3QO1B 5DK2A 1UT9A 4UAOB 4JB9H 1UZ8A 4KPHH 2VE6A 3HMXH 1U92B 5HHNB 1IGYA 3IDUA 1X7QA 3FQUA 5DK3A 1KG0A 2P5WE 1EEZB 5DJAB 2Z93A 1A1NB 4KUZH 4UINL 3MXVL 2X9WA 3FB6B 2Y7QA 5H2BB 3ALWA 1IM9D 4HC1H 4FFVC 4U4BA 5CS7A 5HVHC 3TBTB 4NPYB 1XIWB 3T4YA 3QJHB 3ULVH 5I2IB 4JY6B 3BISA 4U1GB 4X80H 1KCLA 4FQXB 5KVDL 3V6OE 4YHMH 4M4RA 4R96B 4IRSB 4RQQA 5F8QC 1K3ZA 3U6RA 5DUMH 3QDGB 5CJOH 3IVKA 4Z7VB 3BD5A 1C08A 3BGFC 1A3QA 3BAEL 4WUUA 5HYIA 2Y06L 3HG1E 3SGEI 2AK4D 5A43C 3RU8L 3MREB 1L6ZA 1OD9A 1N0LA 3F8UB 2VISB 4JR9L 4IIQC 4MXWH 1TCRA 3EYOB 2VDRH 3MOAL 4PJDE 2VKXA 4XNZC 4LU5H 4MNGA 2VIRB 3C2SA 4GFTB 4QOKA 3MR9A 4O00A 3EJJX 3H3PL 1A6UH 4PTTB 3NZHH 4LEXH 4FG6D 3EO9L 5IW3A 1IEHA 2Y23A 3EYSL 4CVZA 3R1GH 2EDYA 4L8DA 3OAYH 1AR1C 4YUEH 1RJLB 5CUSL 4NPYA 4PJHB 4JDZB 1TCRB 3UTQA 3WS6C 2EIZB 4HBCL 3VD4A 1E27A 2PTTA 2ARJQ 5CJBA 1IC4H 2EH8L 2ZNWA 4DZBB 3BE1L 5E1HB 3KPRD 5T5FH 4FQ2H 1AJ7L 5DJXA 4JR9H 4YO0B 2XN9E 5D71H 3TLRA 2R29H 3T0EE 4RZCA 2NY6B 1UJ3C 5C0NC 3AS1A 4HZLA 1DN0B 3MREA 2HJFA 4QT5A 4KHXL 1ZT4A 1KBGH 1E4XL 1SEBA 1P1ZA 5EOCJ 5GSVB 1VEOA 2BX5A 3LAFA 5HYSA 3Q3GA 3CPLB 1CIUA 3QJFA 4HXBL 5IHZA 3MJ7B 2HKFL 3BWAA 4KHTH 3T0EA 5KOVC 2MHAA 3I6GA 1NCAH 2XN9A 4DKFH 1FNGB 4Q9QH 1L6XA 3VFGL 1WBYA 2VZSA 1ZWIB 1AQKH 4QRTB 1JF1B 5ILTL 3RZCA 2X4TA 4JDZA 5L0QC 4XMKL 1H3XA 1ZHLB 4Z7UA 1RMFH 2E27H 4P46D 3MLTB 1U8MA 1ZVHA 2H8PB 2AJ3B 2YD3A 4KJQD 2YS4A 5DYOB 4ZTPL 2CRYA 1PG7H 3U82B 2C3WA 2DL9A 2J8UB 3JVGC 1FNGA 1RZ7L 1QFOA 6FABH 1E4XH 4R3SB 4OQTA 4Y19A 3WXVL 3T0ED 3OG6B 4OLXH 1CDJA 4HMDA 4YPJA 3IJSB 3KPSB 2XN9D 1L9NA 4NZRH 3SCMB 1BJ1J 2HG5A 3I2CH 3WNOA 4MNHB 3OKEA 2CRZA 5MHSD 1UA6H 3BEVA 3MLUH 3CFDA 5HPMA 4HFWB 3SQOL 4RGOH 4MD0A 4ZFGH 3CFCL 4HCRL 5FUCE 3WHXA 4J4PD 5EN2A 1PJ9A 4WUKH 1MRFL 3VDCA 2NY1B 1G7JB 2NXYD 1F3DH 1QLEL 3KPSA 4XVJH 1J9CT 4LLMB 3V6OA 3C60A 4OI9A 2F19L 5CEYB 2VB5A 4PRAB 3C87A 3VWKD 4XPTH 3DVNB 5F3BB 3RGVC 3MX0A 4X4ZA 3LVEA 1RZ8A 1UFUA 3BQUB 5JIHA 4GQ9L 4MA3A 5CAYB 3TZVC 4PV9A 3FT2B 2MNUA 3WXWL 3OR7A 3ARDA 4R97C 4Y4HC 1PAMA 2VDLL 3LEXB 3VI4E 1TJHL 3B9EA 3T3PF 4FQLL 4Y1AD 1GCFA 5HBBA 1YN7A 2A77H 3CVHA 3RKPA 4BYHA 4EN3C 2ED8A 2CKBL 5FO7B 2JJSC 3MRDB 1M6OA 2DBJA 1P7KA 5FHBH 2MQ3A 5GGQL 5F1KC 1UKQA 3R06B 2ARJA 4I0CC 2IJ0C 2NTFA 1YYMH 3C60D 3MV8D 2C5DC 3R4DA 1W0VA 4RGOL 1SVCP 1H8SA 5C0DB 4N8CL 4R4BB 3BQUC 1ETZB 5IFHH 3RDTA 4I5BA 4CNIA 4ZFZA 1OL0A 1IQDB 3P4NB 4PJGB 4PRBA 3VMPA 2IADA 5GS1A 4YBLC 3ES6B 3QIWC 1RMFL 4QRQB 4N0FA 4OSUL 3QUYC 4U1IB 3FFCB 4TUOA 2Q87A 2GY7B 4UT6L 5T3XH 3MA9L 4NQEB 1RUQH 2F74B 2R0KH 3BQUA 1G7IA 3RY6A 2QR0B 3LB6C 3MLWH 4TVPL 4NNPH 1ODAA 1B9ZA 2KKQA 3L3DB 3UAJD 1NCDH 3BN9C 2WWMC 4PV8B 3MRCA 4QOKB 4OF8A 4Q7DA 4U3CA 5EU6D 5E2VH 1FRGL 5B8CB 1IM9B 4X9FA 5DD3L 4DQOL 3LKPB 5LQBL 4MMZC 4PG2C 1FO0L 2A74B 1T21A 1H3UA 2W60A 2XA3A 5IJVB 1A5FL 3GSVB 3ZDZF 4YGVA 2PXYC 3B9KB 2D31A 1YYML 3T2QA 2NW2A 3BJ91 3HZYA 4PLJD 4M5ZH 2YPVH 2OR7A 4KH2A 1N4XL 3HZKA 5F7UA 2BK8A 3U0WH 1PY9A 2IANB 4RDQF 1RHHB 2XQYK 3GI8H 5GGUB 1FZOB 3HHRB 3RBGA 3NFPB 1NGZB 2DLFH 4MQ7A 1S8DA 3UTZA 3O45B 4HULB 2EXYC 4LKXA 4M5YL 4PRHD 1YC7A 4K3HA 2I9TB 4QT5B 4JZJA 1HILB 4J3VA 2VERN 1D5XA 2ESVD 3GMMB 1A6AB 3VE0A 1EHXA 3G6AA 1HYSD 1Z5LA 3JUYA 1F13A 4NBZB 4PD4K 1MFCH 2XZAL 1H8OA 2R4RH 4CADB 3OKLB 5DA4A 2XN9B 4NQSB 1CE1H 1IFHH 4RMQA 5DLML 5J6GA 1NEZB 1W0WA 3QDJD 4M7KL 4MVBC 2DMBA 1BGXL 2CKBA 3PV6B 3GSNA 3BP6B 3V4PH 4TYUA 1P84J 3LKRA 1MRFH 3BUYB 3O4LA 2WBJB 5CJ8A 4HWBL 4G9FA 4UT9H 5IM7A 4RNRA 3GMMA 1GGTA 1WFNA 3SDDB 2EICA 4I18C 5DRZB 1IGJB 1PZ5B 1YEFH 1KEGH 4HF5L 3AREC 3D0VA 5J13B 2A6KB 3MTRA 3UTSD 1KN4L 1FL3A 2ESVE 4NKDB 3IFNL 4OQ1A 4YHLL 5ACZB 3X11B 2XA8H 1B3JA 3B2VL 3VDAA 1UYWH 3V0VA 4WFED 4OAWB 2OJZH 1KPRB 2DD8H 1Q9KB 1R5WA 5JR1L 5C0RH 2BVOB 3HCVB 2VZUA 2A6DB 4MQSB 4Y1AB 4WIQA 1FV1B 4GAJL 2GFBA 5I66B 4XHJD 2NY7L 5GGRA 1TZGH 2CIKB 3WMSA 2RBLA 5CSZB 4OF7A 5D9SA 3ZTJG 2X1OA 5GS3A 4BQ8A 1HQRA 4IRSC 1ZXQA 3MNWB 4WGWB 3QG6A 3Q3GB 4JRXB 4LRNL 3U46A 5CINH 1K5NA 1R3HA 5KS9A 2BOCB 2YPLE 5I18L 3AAZB 3FCTA 4KPHL 5T33L 5IBUB 1TMCB 1CFQA 5CEZH 3GSXB 4WHYG 2AXGB 5DJ0B 4LSPL 5F1NB 3AMLA 3EYUL 2DYPB 2R0KL 5H94B 1DBBL 2M1KA 1SJVA 3LN5A 2X05A 3TO2B 2FHBA 2P5EA 2IQ9L 1ORSB 1DLHA 4HKXB 4YWGH 4PRDA 1AHWA 1LMKA 3BPLC 5DVNA 4U0RC 3OXSA 3IETB 4EDWH 3VRJB 2XWJB 2EDBA 2BVQA 4FQJL 2J2ZA 5JNYB 3D0LA 4Z7WF 4P2OB 3QDGA 3V95A 2FJFA 4JG0L 4TVSa 5ELIA 5DMYA 3X13B 1M7DA 2GFBB 3OZ9L 1ORSA 3RL2B 4WO4A 1NC4B 3RVWD 2O5ZH 4K3DL 4K07A 5JUEL 5I8EA 4LIQE 4WI6A 4ZTOL 1HH6A 4DVRL 3K0WA 2W65B 3UTTD 1VFBA 2VLME 4D8PB 4G7VL 3MA7A 5I8KH 4XP9H 4NJ9H 3BDYL 4K3JH 2HMID 1G7JA 3S97C 5D96B 3QNZB 3QUZA 4GW4B 4Y1AE 1CD1B 2VDNH 1DR9A 2Y06H 4EDWL 2JJUA 5KZCD 3SE8L 4U1KA 2NW3B 3ARYA 4XH2B 5FOJA 4YFLI 4E41B 5BO1H 1PLGL 1T4KA 4ZYKB 4NKMA 4MJ5B 1OD7A 1KENL 4LLVA 4D9RD 4EI5D 3VXQA 1JHTA 4OZ4B 4ISVB 2MCG1 3RX5A 3EJYD 1P4BL 3MCLL 2V5SA 5CD3B 3OKYA 1CIDA 3D85A 4NQDA 1YEGH 3NZ8B 4PRHA 4EDXB 1J86A 1WFUA 5MEQB 4NJAL 2IBZY 2DI7A 3GSUA 3D25A 5GRXG 1NGZA 3DARA 2OSLA 4AMKH 4JDTL 2HN7A 1HOCB 4A6YL 5DK0A 5DJZB 2OP4L 2BSSA 4NYLA 4RFOL 1J88A 4Q6IB 3W2DL 4CMMA 1G6RB 2XKNA 3C5ZB 1MFBH 2AABL 3QDJA 5DJ2A 4G6KH 1ZLWK 2CJUL 3O2DH 2B1AL 4IHOB 3BFOA 4LPXA 4PJBF 4NC1E 1HCVA 1G7IB 1RJZB 1JRHH 1NCAL 4YR6A 4P46C 2JE8A 4DGVL 3IDJB 3GSRA 1TETH 3OSKA 1FFQA 4J4PC 1WVZA 5DUBB 1RZJC 5JUEH 1EDQA 3U9UA 4H88H 3CFBB 1Q94B 4NOFA 1EEUA 3IAPA 2JB6A 1KFAH 2FWOB 5E6IB 4MLSA 1WCBA 3FTGB 3L3OB 4M7LL 3V0VB 1A6VL 3MYZA 2VDLH 5KVGL 5E6IC 1U93B 5GRWA 4FMFA 2D0FA 3BHBA 2BP3A 3SDXA 5ID0A 3GSRB 4GXUM 2WAHA 3HMXA 3O6FB 1RZJH 5EBLB 5D8JL 1F97A 4NO2A 2HH0L 1JF5A 4M61A 9CGTA 1A1OA 3QI9B 4I3SH 3GMPA 3LN4B 4IJ3C 4P46A 2Z35A 2GUOA 4P2RA 2FDBP 5F88B 4ZFFA 1FZJA 3QWOA 2BXZA 4PJ9A 2CUHA 5C0GA 5C07E 2B0SL 4TVPE 1BZ9B 3B5GA 2AJXH 4NHUA 1D5IH 1HQ4B 2V2TB 2VR4A 4S2SA 3MLUL 4Y2DB 4FG6C 1ULVA 5IT2H 1W72B 5I1HL 4NP4H 5SWZE 4GG8B 1O5DT 1L0YA 1IAII 1I3GH 2LABA 3LKNA 2NTFB 1R0AL 1WT5A 2Z92A 3WXVH 2DB8A 2CLRA 1BWMA 4G3YL 2E9IA 4Q2ZB 5DRZA 2J4WH 2WQRA 4QTHB 3REVA 3CXDL 1JPGB 2ADIA 3CC5A 3QA3B 5K9QI 1JGVL 5FKAB 4NZTH 2IBGA 1YMMB 1FL6A 1YEDB 2N4IA 1D5MA 3K7UA 5CMAB 2GY5A 1BAFH 1T3FA 1RIUH 2PXYD 3QEHB 4XP5L 5ENWA 3PXJA 4FQQA 4U49A 4YDKH 2XRAH 3ZHDA 4XAWL 2YWZA 5TH2B 1VFAA 4Q9BA 5BZWA 3GSOA 5I30L 3LPWA 4GMSH 1YNTB 2LVCA 3DOSA 4JKPL 5IESL 3MACL 5JZ7D 1ND0B 2YA2A 3GHEH 5CILL 1FLRL 4J6RH 4G6JH 5I75B 4QRUA 3ILPB 5E03A 3ZT7A 1N59B 2ZG2A 1K5NB 1R3HB 2E7CA 1CDCA 5FV1L 4F57L 4DUXA 5T5FL 2DTMH 2X4QA 1DVFA 4UMGA 1UM4H 1OP5K 4OZ4A 4ZQKA 4PJ8D 3QA3A 3W5MA 1QYGL 4NQDD 2GJ6D 4X98A 3RIFK 2C3VB 3KS0J 1A9BA 3N06B 2OL3B 3QFJA 5D7LE 2BJML 1A22B 5IWLC 3H7BB 3UTTB 5DQJA 3F6LA 4LCCB 1I1FB 4NQXB 5E2UH 4C4KO 3WCYA 1RVFH 4TRPL 1QHOA 3S88H 4OSUH 1MRDH 3KHOA 1MWAA 1A2YA 4RWYL 5DJXB 4M1GL 5ESAB 4HJGA 3QEQA 3SQOH 4NQSA 4N8VG 1MCPH 4AT6B 2P5WB 1ZE3C 4OBSA 3VH8G 5E8OA 2W9DL 1I7ZB 2QQNH 3MOBL 3U1SH 5SWQA 4ZNEA 3F5WB 2YMXL 1ZANL 1FFOA 5FHBL 2YPVL 4MXVF 5L6YL 1Z0MA 1GHFH 5EIIA 1EERB 2NY5C 4M7ZC 3ARBC 5IHZB 4ORGA 2PR4H 2HT4D 3UJTL 5IW6B 5JXAH 3V8OA 4UDTA 5JW5A 3ARQA 1CD8A 1GIGL 3QHFH 2ZSWB 4NNXA 5JLZA 1XH3A 3QI9D 5DQJB 4Y5XC 1BFTA 1RK0B 4EN3B 3D39B 3MQIA 3SDDC 2JELH 2XKSA 5AWNH 2EH7H 3HE6C 1TENA 1A2YB 1QFHA 2NPLX 1KCSH 4DEPB 1ZHLA 2VXVH 3FOMA 5IMMB 3TN0C 4PJDB 3WIHH 5I15L 5C71A 3SDAC 4Z7VF 2Q7YB 3MV11 4F58H 3B6SA 5ACMA 4EQ3A 2HFEB 5CP3H 1FL5B 2IFFH 2YRPA 3TBSB 3DX6A 2DQHL 4JFYB 3L7EB 4RAUB 5D2LF 1G9NC 2K3TA 3B5HA 3GM0A 2X89A 3REWA 4FQHB 4QCIB 4RFNB 5L2KB 1WWAX 1IGTA 1DE4A 2F54E 3QXAA 3TA3D 4P2CG 5DQ9A 3FOMB 5IMMA 1QSFD 5D7JD 2ZCLL 5T1KA 3TT1L 1CDUA 2BC4B 3KLAB 2XWBB 4KJQC 1DQDH 2EIEA 3T0XA 2B4CC 5EB9A 5ERWB 5J0BA 1U91B 1SHMA 4LLWA 1WAAA 1T1ZA 3P0GB 2V5TA 5I15H 4FFZH 4UNUA 1Q0XH 2P8PA 3N1FC 2MMXA 4FTVE 2X70A 1XGRA 2EE6A 4OCWH 3A6BH 1EAPA 1IKNC 4E0RA 3H9SE 3D3VD 4J12A 5FYJE 2NTSP 4LDEB 4X6BB 4LCIL 3RP1A 4ONHA 1KACB 1X4XA 2V2XB 2OJEB 1OSZA 4OZIE 4I0PB 5JW4N 2P8PB 3I9GL 1JPFB 1R3LA 3OHXB 3F58L 3PL6B 2PXYA 5B38G 2YKLL 3ZYIA 3QXAB 5ICYA 5LKNA 1F4HA 2JIXD 5HXMA 4JREC 1CTOA 3BZEA 2PO6C 3U1SL 5IKCB 5B39B 4YHPA 1N2RB 1CGWA 1Q0YL 2AJUL 4UTAL 3S5LB 5KVDH 3T0VA 2FR4A 4XXCA 3SDCA 4Z0BH 3QPXH 4FQXD 3CZFB 1L7TL 4TPRL 3S6CA 4PJCE 1KGCE 1D5BB 4HC1L 1AGFA 2YD7A 4GAYA 4LCUA 1HI6A 4U7SA 1PKQE 1T83A 2P42B 5D5MB 3GSWA 4P2QA 4GRLC 1IEBA 1WICA 2AKRA 4PJ9B 5DURD 4H5SA 1P7QD 3N50A 1KC5H 4ZOCA 5IEKB 4GRLB 1IGMH 2VITB 5MP6L 2VXTL 3PDDA 1CF8L 1XCQB 1BFSA 4FZEH 1A7NH 4ODXB 4FFWC 4NHCH 2I27N 3RWCB 3WEXA 4J3TA 5D6CA 4MA3B 2OR9L 4H0IA 4G8EB 3VFUA 1TZGL 3O2WL 2NLJA 3V5HB 4XBPB 2BVTA 4D9QD 5FGSA 4Q2ZA 4GAJH 5IJVA 4HUKB 1NUDA 4JFDD 3GO1L 5E94B 2QBWA 1DQJA 2ZJSH 4ODTL 1U8IB 2IF7A 1U3HB 5GJTL 1AFVH 1YNLH 2IBBA 2J12B 1LK3H 5ESAA 1AHWC 4O51A 1T5XA 4POYA 3CU7A 4C56D 4U6TA 5D7LB 4YHOH 1G9ML 3EYVB 4QF1B 4XVUC 1YY8A 3BGFB 1U6AH 3SE8H 4I5BB 4KROB 2PTUA 1EXUB 1JL8A 2GJ6B 3QQ3A 1INEH 1J8HD 2XWTB 4DW2L 4LSVH 4PRNB 3HE7A 1OAKH 4CDHA 3L7FA 4JFDA 5KVGH 1J0JA 3QUML 3DGGA 1ZEAL 1OP5H 3U9UB 2VO5A 3MUY1 3V4VH 1K6QH 1I9IL 4A6YH 3K1KC 4PG9B 3RPIA 1F45A 3MJ9L 4XPGL 1KCUH 1U2CA 2DL2A 3OF6D 1MJUH 3CDGA 5D5ME 2FD6L 5I1JH 1N5AB 3ZE2F 2AXJA 1CE6B 4JRXE 4TN9A 2IMMA 4JPWH 2OQJA 1ZSDB 1FFPB 3ULUC 3ZHLA 2EDNA 5JOFA 1J5OL 4AIOA 1P53A 2G75A 3MRPA 4PBWD 4IDLA 2FYYA 4M3JA 2H2PC 2R0LH 1CGUA 2AK1L 4I18A 1A1OB 3STLB 2FH6A 3WD5H 1INEL 3VFSB 3FL7A 3T0EB 4XBGB 2QHRL 1KLUA 3PIQA 5B22A 3CCHB 1MHEB 3GMQA 3GMRB 3MRHA 1A14L 2VXQH 5EH1A 2EECA 1CQKA 3HE7B 4BFGA 2HFFB 2X1PA 1IL1A 4ALAH 1OTTC 4XZUA 3TBTA 2YZ1A 4KC3B 3RZCC 1DEDA 3WD5L 2AJ3A 5EORL 5DZLA 3ARXA 5FM4A 2DF3A 4XBGA 1DBAL 3IGAA 4G7YL 3L3GA 5D7KD 5SWZB 3QXWA 1YEHH 2JJWA 1CDHA 1TQCC 1A0QL 3HC0A 4G9DA 4LFHG 4QRPD 3D1MC 2AV1A 1VFMA 4JY5L 5JHDA 3VDBA 3PWVB 4WNQA 3MXWH 5D9SB 4ZUUB 5CD5C 2NNAB 5EBWB 2XZQL 1GH7A 1IGML 2YEZA 1FNEB 1IGIL 4D0CA 3BKCL 3VRLE 4YXLL 1NKOA 1QBMH 3VWJD 1NFIB 1DLHB 4Y4KB 1U42A 3O3AB 2HFGL 1QFWI 5BJTB 3RIAK 1JYVA 3HRZB 4LSUL 4NN5C 2BNQE 4OCXH 1I75A 4L9DA 4ONFL 3ARFC 2NR6C 4HGWB 3IYLW 1DBBH 4Y16A 1J12A 2R0LL 1HXYB 1YEJH 4AH2A 3DJ9A 4OTXH 2DLGA 3BIKB 4FQ1L 3L1OH 4PLJC 4LMQE 4N8PA 2HRLA 3LRSA 2AEQL 2X2YA 2E7HA 4FQHA 4QCIA 3DUSB 3IFLL 2ZNXA 5DZNA 1IAOB 3PXHA 1P7QA 1EH9A 5DI8A 1H5BA 5TE4H 1BP3B 5IOPA 4OLWL 5GXBB 5D1XD 4Y16B 3TYGL 4I0PD 1U95B 3I02A 5IMLB 4QXTB 2V5YA 1OCWH 2ZUVA 3QDMD 1E4WH 2CIKA 4Y4FD 1F90L 2R23A 2EYRA 4MXVE 4BQ9A 5BRZE 3D2UB 5C0DA 2XQYG 5IVXB 5DQDH 3GSQB 3O3BB 2EDWA 3BP7A 1HN1A 4OFKA 5FGCB 2ZOLB 3CXHJ 2JJSA 3GK8H 5EZOH 4CN6A 5EA0H 1CFQB 5EIQA 3UBXG 2VDKH 4RFNC 1GOFA 5KG9B 3FQTB 3UPCA 3FQXB 4LFHD 4Y8AA 1HSBA 3BRFA 5TFSL 1LO0H 4QYOB 3DYOA 1OW0C 4NQEA 2AK4A 5E2WH 1IGCL 5GS0D 5JW3H 3EFFB 4ZODA 1IARB 1TVBA 2PYFB 4NUJA 3PUCA 4CVZB 1NC2A 3SDAB 1MJ8H 1F4WL 3DHJA 5C0EB 5C0IA 1A4JA 5HYSG 3WFCL 3D0LB 4RGMC 1LO2H 3AS2A 3W9DA 3V4UH 4DN3L 3C5SB 5B3JE 3MV9E 1DVFD 3BPOB 3UBXA 1QR1B 5D96C 5DD6B 4HKJB 1R24A 4JPKL 1N0XH 5F7MC 3TO4D 2J8HA 2HAZA 3L5XH 5ITFA 1UACL 4LCUB 3SE4C 3MGTA 5ADOL 1I1YB 2WSKA 4XMKH 4M7ZB 1CDYA 4RAHA 4HIIB 5FB8B 1MWAH 5IG7B 4G80A 1DL7L 3AS3A 1S7TB 3SDXE 1QR1A 4P49A 3IDNB 5I1CH 4X7SL 3MRIA 3THMH 1MUJB 5DZOA 3LQAH 3WFEH 1IGIH 1T4KB 4ZYKA 3IJHB 3RWHA 2C4FT 1HZHH 4KHXH 5F9JA 4KTEH 3K1DA 3O6FC 5JDSB 1U8QA 1KJ2B 3X14B 2KQMA 3A67L 4NFBA 3CLFL 3S4SA 4OLVL 4HMEA 4OD1L 2DRUA 3K2UH 4FZ8L 3WUWB 2IFFL 4IBLT 2D03H 3QAZB 3WFHB 4OCSL 1MCIA 4HGMA 1U8LA 3H3BC 1EUUA 5A2LH 2YPKB 5IB4A 1EZVX 4KDVA 1QEWB 1PYWB 2DQEL 3QI9A 1AGDA 5J8OA 1V05A 2PTVA 2EYSA 4X0KB 5KVFL 2GK0A 3NCCB 3IDXL 1SY6H 2HRPL 2H2PD 4HCRA 1VEMA 4YHLH 3QISA 3BZFB 4JZOA 2GTZB 4D9RE 2M26A 3LKQB 3NIFF 2EDDA 2ZUQB 3RIAF 3FRUB 2YUXA 1RUAL 3MNVA 3UJIH 1HHHA 1NPUA 1BF8A 4NGHH 3KPNB 3SKJH 3NGBB 1AR1D 5AG8A 1UM4L 4XNUL 2H32H 4CW1B 4RMSA 2DYPD 4KVCL 2AJZB 4HKBA 2X89D 1RUAH 5D7IF 5AZ2L 3G5ZB 3FT3A 5I16B 3VJ6B 1ZANH 4P59L 4Y16D 4M7LT 1ZK9A 1QSEA 1T1YA 3IDYB 3FN0H 1IFHL 3QSKB 1S78C 4P48A 2Z92B 2WV3A 5AAMA 5ICXB 5L8KB 3HPLB 2P24B 3LDBC 3AXLB 1I9JH 1A7QL 3FZUD 1C5CH 4MS8C 3EO1A 4MA7L 3G5VA 3AGVA 1NMCB 5GPRA 1LD9B 4WUUD 5IWLA 2FIKB 4K23H 2GAZA 2QSCH 5F9WB 4HK3J 4M1DH 3M17B 4HS3A 3EHBD 4NZTL 5DI8B 4RIRB 3U0WL 3X17A 4PJHA 4JFZH 3TFKC 2ARWA 3OXSB 1MJ7L 5ENWB 1EBPA 1JGDB 1ZGLP 3PWNA 3IAQA 4HXAH 4KY1H 1I8MA 1W72L 4GKOA 5F1IB 2VQTA 4KK9C 4PTTA 3KPTA 1HYRC 1MVUB 2Y7QB 2FL5A 5H2BA 1IBGL 5HDOA 2E8ZA 3KLHD 2HWZL <