1QZRA

Crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii bound to icrf-187 (dexrazoxane)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
404
structure length
382
Chain Sequence
SASDKYQKISQLEHILKRPDTYIGSVETQEQLQWIYDEETDCMIEKNVTIVPGLFKIFDEILVNAADNKVRDPSMKRIDVNIHAEEHTIEVKNDGKGIPIEIHNKENIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADLNVGQKYVQKWENNMSICHPPKITSYKKGPSYTKVTFKPDLTRFGMKELDNDILGVMRRRVYDINGSVRDINVYLNGKSLKIRNFKNYVELYLKSLIPTILYERINNRWEVAFAVSDISFQQISFVNSIATTMGGTHVNYITDQIVKKISEILKKVKSFQIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCEIPLEYINKIMKTDLATRMFEIADANEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA topoisomerase II
publication title Structure of the topoisomerase II ATPase region and its mechanism of inhibition by the chemotherapeutic agent ICRF-187
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 125
structure length 382
sequence length 404
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1qzrA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1qzrA01
1YT2A 4U93A 4JI2I 4CWOA 4EMDA 2O1VA 2HK2A 2YJXA 4LWHA 1ZWHA 3HZ1A 1NHHA 4L90A 3EHGA 4AS9A 4DR7I 3GIGB 1OJ4A 1WUUA 2V2QA 4DR1E 1HNWI 4JI8I 3R4NA 4H85A 1GJVA 1L0OA 4CE3A 1US7A 1YSRA 2XX4A 4DV2I 4JI7E 2ZDYA 3EHHA 4FCRA 1MX0A 3BMYA 1IBMI 3B28A 3OWBA 4LF5I 5M4NA 5M4KA 2BZ5A 2DEIA 4LFCE 2IWUA 4HY6A 5GMEA 4HYMA 3R4PA 3K97A 4NXNI 4LF7E 5CPHA 1TIDA 2GS8A 4X9LA 5FNCA 2HKEA 1U2OA 3B27A 1B3QA 4B3RE 3GIGA 2WI6A 4DPYA 2XX5A 4FCQA 2QG0A 2XDKA 4DV7E 1U0ZA 2YKJA 4LFBI 2FYPA 3ZXOA 3K1JA 4YY3I 2FXSA 2UWDA 4JI2E 3T1YE 4H81A 3HHUA 4EGIA 1Z0CA 5FWKA 4B3SI 3ZXQA 4L94A 4B3ME 1YC1A 3R91A 4P52A 4LF6I 3JZ3A 4DUZI 4MBCA 1QZRA 4O05A 2YEJA 2BTZA 1H73A 2YK9A 4DPTA 3T10A 1QYEA 4MYTA 1XNQI 2V2ZA 4GEEA 1Z0BA 1IBME 2Q8IA 4BQJA 3A0YA 2XDLA 5CTWA 2X7IA 2PNRA 4LWFA 2UUCI 3LPSA 1YC4A 3O6OA 4XKKA 4CWNA 3HYYA 4MPNA 3J7AM 2GFDA 1H7SA 3QT6A 2HHHE 2UUAI 4LF4I 4FN5A 4HACB 1XHKA 1RREA 3QDDA 3R4OA 4LWGA 4E01A 3U2DA 5A2QQ 4LFBE 3RLRA 1UYEA 3NMQA 4DUHA 1THNA 1AMWA 4FMTA 2WI4A 1N0UA 3B8HA 1YC3A 1Y8OA 4PRVA 3EHJA 2YKIA 4B3SE 2E0AA 3RLQA 2BT0A 2H55A 4HZ5A 3WQ9A 3WHAA 3KE6A 4L8ZA 4HXZA 1XNQE 4HACA 4LF8I 3Q1QA 1YT0A 1Z5AA 1I94I 3RLPA 2UUCE 3OWDA 2CCSA 4JI6E 1NZ0A 4YKQA 5GGZA 4AQYE 4B7PA 4E02A 3T1HI 4XIRA 1YETA 4R1FA 4I3HA 3ZKBA 5IT9C 2YE7A 4URLA 2AJ4A 1ZM9A 2WW4A 3MNRP 3VHDA 4YKYA 1Z0EA 5L3JA 4JYAE 4DV6E 1Z0WA 4FWHA 2R3VA 1H7UA 3A0WA 1I58A 3HEKA 4HYPA 4FW9A 2BU6A 1UYLA 2IWSA 1KTVA 4KSGA 4X66I 1TC6A 2QG2A 3QT8A 3INWA 3ZKDA 4O07A 3WU3A 4R3AA 5CF0A 5D7RA 2BU7A 1OSFA 1HNZI 2YGEA 2UUBI 4XDMA 4BQGA 3PEJA 3J81C 2K5BA 2X36A 5LL6R 3T0HA 4YKWA 4JI5E 4CWSA 3OTOI 4CWRA 5D7DA 3LNUA 3ZZTA 3G75A 2FWYA 4LP0A 4NH9A 2YEFA 5A2QC 1XNRI 3G7BA 4RPFA 3QTFA 4KP4A 2UXCI 3GIEA 1ZM2A 4GKJI 3C0EA 4DV1I 1JM6A 4DV4E 4NXMI 1RR9A 4CWQA 4LF9I 3SL2A 2YEGA 4USMA 4X62E 4MPEA 1KVKA 2YECA 4B3TE 2UU9I 4JAVA 1HR0E 4GFNA 1BXDA 1J5EI 2VQEI 3B26A 1IBLI 1N33E 3DGEA 3ZZUA 4CWPA 5CTXA 2BV3A 4DR2I 4KFGA 3HZ5A 4X65I 3A0RA 4Q20A 3JAMC 3IEDA 4DR3E 1FJGE 3O0IA 3OTOE 2UXDI 2IOPA 1PIEA 4JASA 4MP2A 1UYFA 2BREA 4V26A 4YKXA 4KSHA 1DARA 3ZZ0A 4ASGA 5IWAI 1UEKA 4XTJA 1YS3A 1ZW9A 5IT9Q 2YI7A 1HNXI 2WI2A 4U7OA 4BIUA 2XHTA 2YGAA 2ZKJA 4OX9I 4UTGA 4NXME 4JV5I 1PVGA 1YESA 4ASFA 2YE4A 1EI1A 1Z0GA 1AH6A 3Q5JA 4DR7E 4V25A 4AWPA 5F5RA 1J5EE 4HY1A 1HNWE 5BR8I 4JI8E 4DU7A 2XHRA 2YK2A 2YKEA 4CWFA 4DR4I 4DV2E 2ZM6I 1UY9A 1UY6A 1XMQI 3GONA 2BM1A 4JI0I 4DR2E 1UYKA 4JI4I 4KTNA 1XMOI 1UYIA 4XKOA 2YE3A 4LF5E 3D0BA 5FLXC 3J81Q 1IBKI 2O1UA 1ID0A 4JI3I 4NXNE 5IDJA 2A2DA 3CRKA 1Y4UA 3R4MA 2F4VI 4PU9A 5CTYA 4DV3I 3INXA 1AM1A 1N34I 3TZ2A 1TILA 4DPXA 1FI4A 4U7NA 2BM0A 3V5RA 5D7CA 1N0VC 4YY3E 3B78A 4OX9E 4JV5E 4K4OA 5BOCA 3TZ5A 4JI1I 3VHCA 4XCJA 2Q8FA 5FNDA 1UY7A 3H4LA 1N32I 2BRCA 2O1WA 4XIPA 3B82A 1I5BA 4JG4A 4LF6E 3TZ0A 1Z59A 4DUZE 5D6QA 3PYEA 4DR4E 2HKJA 3U67A 1AH8A 2XHXA 3D36A 4MPCA 3A0TA 2IORA 4MOTA 4QPKA 2HFSA 1Z0VA 1UYGA 4YKUA 1XMOE 5M4MA 2E5LI 4XITA 2CGFA 4DV5I 3JAMQ 1BYQA 2AKPA 5LMUI 1PKPA 3K98A 2XCMA 2Q8HA 2UUAE 3T1KA 4W7TA 4LF4E 4EGHA 4DV3E 1ELOA 3OW6A 2Q8GA 2YJWA 3LTOA 4XC0A 4HZ0A 1I5DA 3WU6A 4NH7A 2YE5A 4DV0I 2XK2A 1H72C 2BYHA 4DUYI 2EFGA 2H8MA 1YSZA 4JI1E 2VQFI 3T2SA 5FNFA 2ZDXA 2YEIA 4O0BA 3B24A 4LPBA 5LMNI 1N32E 4ASBA 4K0KI 2WI3A 3A0XA 2CCUA 1I5CA 3RKZA 1UYMA 2YKBA 5IDMA 4L91A 2XDUA 4X64I 4O09A 1FWLA 2QF6A 2YE6A 1Y8PA 1FNMA 4QPJA 1B63A 4LF8E 4L93A 1KIJA 4FWGA 1I94E 4LFAI 2E5LE 3PEHA 1Y8NA 3Q5LA 2YI6A 3T1HE 2BU2A 1S16A 5FLXQ 3HYZA 1TBWA 2ZITA 4FPPA 4DR1I 3C11A 2ESAA 3ZM7A 4P7AA 3R92A 2WI1A 4H7QA 2IOQA 2VWCA 4Z7CA 1QY8A 2E1RA 4M1KA 1U2RA 3F0NA 1S14A 4JAUA 2WEPA 3OMUA 1ZXNA 3PYGA 2VQFE 1NHIA 2V8PA 4X66E 1VISA 5LMNE 2JKIA 3CGYA 4E00A 4K0KE 2WERA 3WU4A 5M4PA 4XE2A 1Y4SA 4LF7I 2CZ9A 4X64E 1HNZE 4KQVA 2YE8A 2UUBE 1UY8A 4B3RI 3B25A 4BXIA 5C93A 1UYCA 1BKNA 2J7KA 5M4HA 2XDSA 4DV7I 4GKKI 3FV5A 5IN9A 4LFAE 1A4HA 3CWVA 2IWXA 4BAEA 3QT5A 2XJJA 4CE2A 4B6CA 3T1YI 4NH8A 3EKRA 4FWDA 2YI0A 4XD8A 4AWOA 1XNRE 4B3MI 2C2AA 2XEXA 2YEBA 2UXCE 2Q2EB 4GKJE 4DV1E 3A0ZA 3QT7A 1UYHA 2YKCA 4LF9E 4CE1A 2YEDA 3FT8A 2CCTA 1AJ6A 4MB9A 5D6PA 4LWEA 2VF3A 2UU9E 2HK3A 4WUBA 3CGZA 1B62A 3G7EA 2VQEE 4YHHI 1IBLE 4DXLA 1TH8A 2BU5A 3T0ZA 1YERA 4R3MA 4GGLA 2HHHI 3TZ4A 3J7AG 1K47A 4X65E 4KHPI 2XJXA 3D4JA 2YI5A 1MU5A 4YKTA 2VW5A 4GKKE 4EFTA 3PYFA 2XDXA 1ZM4A 2UXDE 1UYDA 2XX2A 5J71A 2YEEA 2R42A 4YKRA 4ZVIA 3TTZA 5F3KA 3GIFA 2EXLA 3K99A 5IWAE 3J80C 2BSMA 2V34A 5GMDA 4DR6I 1BGQA 2XD6A 1HNXE 4HXWA 5CTUA 3FT5A 1TC0A 2CH4A 3BM9A 3OPDA 4Z7YA 2NPFA 2XJGA 1H74A 2VCJA 2YE9A 2ZBKB 2QFOA 4USKA 2VCIA 1GKXA 4EMVA 2CG9A 4YHHE 4JI6I 5M4EA 5BR8E 4AQYI 4EGKA 4MYUA 2ZM6E 2YE2A 1XMQE 4GCZA 3VADA 1A6FA 4JI0E 3H80A 4JI4E 4KHPE 4JQLA 4JYAI 4DV6I 4GT8A 1FKAE 1IBKE 4JI3E 1YT1A 1ZM3A 1Z5BA 4PRXA 3V2UC 2YEHA 4EEHA 2F4VE 4ZKIA 3K60A 3EKOA 1N34E 4DR6E 3TUHA 3HULA 1GKZA 4URNA 1N36I 4DPUA 2UXBI 3PYDA 4CWTA 4MP7A 2LJPA 4I5SA 4EFUA 5J6AA 2JJCA 4LWIA 2OI2A 4AWQA 4JI5I 1MG7A 2WEQA 4O04A 1I5AA 2A2CA 3D2RA 1FWKA 3M6AA 2HCHA 3U2KA 4XCLA 2WI5A 4DR5I 2BU8A 3EHFA 1S4EA 1KZNA 4XIQA 4DV4I 1I59A 2HFUA 4FCPA 4DV5E 2DEJA 3K17A 1NHJA 2YGFA 4X62I 2V2VA 1Z0TA 5LMUE 4B3TI 1ZXMA 4PL9A 1HR0I 3VHAA 4DU8A 1D6TA 1N33I 4EM7A 2GQPA 4JI7I 4BIZA 2FWZA 4UROA 3J80Q 1N36E 2HG1A 4DV0E 4XKAA 4DUYE 4DZYA 1KKHA 2UXBE 4UT4A 4URMA 2XABA 4DPWA 4DR3I 2WI7A 4LFCI 1FJGI 4GQTA 3O2FA 5BODA 3WU5A 1Z5CA 2YEAA 3CRLA 4ED4A 4WUCA 4WUDA 1EA6A 4P8OA 4YKZA 4ASAA 3Q5KA 4DR5E 1R62A 2BYIA
chains in the Genus database with same CATH superfamily
2C1GA 2O1TA 1YT2A 4U93A 4JI2I 4CWOA 2O1VA 4EMDA 2HK2A 2YJXA 4LWHA 2C37B 1ZWHA 3HZ1A 1NHHA 4L90A 4IFDC 3EHGA 4AS9A 3LMMA 4DR7I 5K36E 3GIGB 1OJ4A 1WUUA 2V2QA 4DR1E 1HNWI 4JI8I 3R4NA 4H85A 1GJVA 1L0OA 4CE3A 1US7A 1YSRA 2XX4A 4DV2I 4JI7E 3P3CA 2ZDYA 3EHHA 4FCRA 1MX0A 3BMYA 5C0XF 1IBMI 3B28A 3OWBA 4LF5I 5M4NA 5M4KA 2BR2A 2BZ5A 2DEIA 2WP8B 4LFCE 2IWUA 4HY6A 5GMEA 4HYMA 4IFDB 3R4PA 3K97A 4OKGA 4NXNI 4LF7E 5CPHA 2C37A 3UHMA 2GS8A 1TIDA 3CDIA 4X9LA 2HKEA 1U2OA 3B27A 5FNCA 1B3QA 4B3RE 3GIGA 2WI6A 2PO2B 4DPYA 2XX5A 4FCQA 2QG0A 2XDKA 5C0XD 4DV7E 1U0ZA 2YKJA 4LFBI 2FYPA 4AIMA 3M7NG 3ZXOA 3K1JA 4YY3I 4OO1E 2FXSA 2UWDA 4JI2E 3T1YE 4H81A 3HHUA 4EGIA 2WNRB 1Z0CA 5FWKA 4B3SI 2WP8A 2JEAB 3ZXQA 4L94A 4B3ME 1YC1A 3Q6NA 3R91A 4MDTA 4P52A 4LF6I 4IFDA 3JZ3A 4DUZI 4MBCA 3M85D 1QZRA 4O05A 2YEJA 2BTZA 1H73A 2YK9A 4LCFA 4DPTA 3T10A 1QYEA 4MYTA 1XNQI 2V2ZA 2PO2A 4GEEA 1Z0BA 1IBME 2Q8IA 4BQJA 2C38B 3A0YA 2XDLA 5CTWA 2X7IA 2PNRA 3GMEA 2PO1B 4LWFA 2UUCI 3LPSA 1YC4A 3O6OA 4XKKA 2BA1G 4CWNA 3HYYA 2WNRA 3H1CA 4MPNA 3P76A 3J7AM 2GFDA 1H7SA 3QT6A 2HHHE 2UUAI 2JEAA 4LF4I 4FW6A 4FN5A 4HACB 1XHKA 1RREA 3QDDA 3R4OA 4LWGA 4E01A 3U2DA 5A2QQ 4LFBE 3RLRA 1UYEA 3NMQA 4DUHA 1THNA 4J3DA 1AMWA 2GO4A 4FMTA 2C38A 3U1YA 1N0UA 3B8HA 1Y60A 1YC3A 2WI4A 3P3EA 4PRVA 1Y8OA 3EHJA 4LOMA 4B3SE 2PO1A 2E0AA 5DNLA 2BT0A 2YKIA 3RLQA 2H55A 3HKMA 4HZ5A 3WQ9A 1HK7A 3WHAA 3U1KA 3KE6A 4L8ZA 4HXZA 1XNQE 4HACA 4LF8I 1RHYA 3Q1QA 1YT0A 1Z5AA 1I94I 4MU0A 3RLPA 2UUCE 3OWDA 2CCSA 4JI6E 1NZ0A 4YKQA 5GGZA 4AQYE 4B7PA 4E02A 3T1HI 4XIRA 1YETA 4R1FA 4I3HA 3ZKBA 5IT9C 2YE7A 2AJ4A 4URLA 5JEAE 1ZM9A 2WW4A 5K36F 3MNRP 3VHDA 4AM3A 3CYGA 4YKYA 1Z0EA 5L3JA 4JYAE 2F1DA 4DV6E 1Z0WA 4FWHA 2R3VA 4MU1A 1H7UA 3A0WA 1I58A 3HEKA 4HYPA 4FW9A 2BU6A 3KRNA 1UYLA 2IWSA 3M85G 1KTVA 4KSGA 4X66I 1TC6A 4LPFA 3QT8A 2QG2A 3PRYA 3ZKDA 3WU3A 3INWA 5K36D 4R3AA 5D7RA 3P3GA 2BU7A 3K85A 1R6LA 1Y6ZA 1OSFA 1HNZI 2YGEA 2UUBI 4XDMA 4BQGA 3PEJA 5C0XC 3J81C 2K5BA 2X36A 5LL6R 3T0HA 3NZKA 4YKWA 4IZKB 4JI5E 4IZJD 4OO1F 4CWSA 3OTOI 4CWRA 2O3ZA 3LNUA 3ZZTA 5D7DA 4MQYA 3G75A 2FWYA 4LP0A 4NH9A 1E3PA 2YEFA 5A2QC 1XNRI 3G7BA 4RPFA 3QTFA 4KP4A 2UXCI 3GIEA 1ZM2A 4GKJI 3C0EA 5C0XB 4DV1I 1JM6A 4DV4E 4NXMI 1RR9A 4CWQA 4LF9I 3SL2A 2YEGA 4USMA 4OO1D 4X62E 4MPEA 1KVKA 2YECA 4B3TE 2UU9I 4FW7A 4JAVA 1HR0E 4GFNA 1BXDA 1J5EI 4IZKA 2VQEI 3B26A 1IBLI 1N33E 3DGEA 3ZZUA 4CWPA 1XXEA 5CTXA 2BV3A 4DR2I 4KFGA 3HZ5A 4X65I 3A0RA 4Q20A 2GO3A 3JAMC 3IEDA 5C0XA 4DR3E 2HHIA 4FW4A 1FJGE 4QNKA 3O0IA 3OTOE 2UXDI 2IOPA 1PIEA 4JASA 4MP2A 1UYFA 2BREA 4V26A 4YKXA 4KSHA 1DARA 3ZZ0A 4ASGA 5IWAI 1UEKA 4XTJA 1YS3A 1R6MA 1ZW9A 5IT9Q 2YI7A 1HNXI 2WI2A 4U7OA 4BIUA 2XHTA 2YGAA 2ZKJA 4OX9I 4GQUA 2Z5EA 5EL9A 4UTGA 4NXME 4JV5I 1PVGA 1YESA 4ASFA 2YE4A 1EI1A 1Z0GA 1AH6A 3Q5JA 4DR7E 4V25A 4AWPA 5F5RA 1J5EE 4HY1A 3Q6MA 5BR8I 4JI8E 4OZEA 4DU7A 1HNWE 2XHRA 2YKEA 2NN6E 2YK2A 4DR4I 1YH8A 4DV2E 2Z5CB 2PO0B 2ZM6I 1UY9A 5DNXA 1XMQI 3GONA 4MU3A 5JEAF 2BM1A 1UY6A 4JI0I 4DR2E 1UYKA 1UDQA 4JI4I 4KTNA 1XMOI 4BA2B 1UYIA 4XKOA 1OYRA 2YE3A 4LF5E 3D0BA 5FLXC 2O1UA 3J81Q 1IBKI 2FTKA 1ID0A 4JI3I 4NXNE 5IDJA 2A2DA 4U3DA 3CRKA 5K36C 1Y4UA 3R4MA 2F4VI 4PU9A 5JEAD 5CTYA 4DV3I 3INXA 1AM1A 1N34I 3TZ2A 1TILA 4DPXA 1FI4A 4U7NA 2BM0A 2PO0A 3V5RA 5D7CA 1N0VC 4YY3E 3B78A 4OX9E 4JV5E 4K4OA 5BOCA 3TZ5A 3P06A 4JI1I 4BA2A 3VHCA 2GQ0A 4QNJA 4XCJA 2Q8FA 1UDSA 5FNDA 1UY7A 3H4LA 1N32I 2O1WA 2BRCA 4XIPA 3B82A 3DD6A 1I5BA 4JG4A 2C39B 4LF6E 5K36B 3TZ0A 1Z59A 4DUZE 5D6QA 4BA1B 1E3HA 3PYEA 4DR4E 2HKJA 3U67A 1AH8A 5DRRA 2XHXA 3D36A 3A0TA 2IORA 4MPCA 4MOTA 4QPKA 4CWFA 2HFSA 1Z0VA 1UYGA 4YKUA 1XMOE 4LCGA 3S5TA 4U3BA 5M4MA 2E5LI 4OO1C 4XITA 2CGFA 4IZJB 4DV5I 3JAMQ 1BYQA 2IESA 2AKPA 4FW3A 5LMUI 1PKPA 3K98A 2XCMA 2Q8HA 2UUAE 3T1KA 4W7TA 4LF4E 2C39A 4DV3E 1ELOA 3OW6A 4EGHA 2Q8GA 2YJWA 4BA1A 3LTOA 4XC0A 4HZ0A 1F51A 1I5DA 3WU6A 4NH7A 5JENA 2YE5A 4DV0I 2XK2A 1H72C 2BYHA 4DUYI 2EFGA 2H8MA 1YSZA 4OO1B 4JI1E 2VQFI 2JEBB 3T2SA 2ZDXA 5FNFA 2YEIA 4O0BA 3B24A 4LPBA 4IFDE 5LMNI 1N32E 4ASBA 4DR5E 4K0KI 2WI3A 3A0XA 2CCUA 4IZJA 1I5CA 2Z5BB 4AIDA 1UYMA 3RKZA 2YKBA 5IDMA 4L91A 2XDUA 4X64I 4O09A 1FWLA 2QF6A 2YE6A 1Y8PA 1FNMA 4QPJA 1OYPA 1B63A 3GCMA 4LF8E 4L93A 1VI7A 1KIJA 4FWGA 1I94E 2PNMA 2E5LE 4LFAI 3PEHA 1Y8NA 3Q5LA 2YI6A 3T1HE 4OO1A 1S16A 5FLXQ 2BU2A 2PNLA 3HYZA 1IXMA 1TBWA 2ZITA 4FPPA 4DR1I 2Z5BA 3B4TA 3C11A 2NN6F 2ESAA 3ZM7A 4P7AA 2VESA 3R92A 2WI1A 4H7QA 2IOQA 2VWCA 4Z7CA 1QY8A 2E1RA 4M1KA 1U2RA 3F0NA 2IERA 1S14A 4JAUA 2WEPA 3OMUA 1ZXNA 3PYGA 2VQFE 4O07A 1NHIA 2V8PA 4X66E 1VISA 5LMNE 2JKIA 3CGYA 4E00A 4K0KE 2WERA 3WU4A 5M4PA 4XE2A 1Y4SA 4LF7I 2CZ9A 2NN6D 1P42A 5JEAC 4KQVA 4X64E 1HNZE 2UUBE 1UY8A 2YE8A 4B3RI 3B25A 4BXIA 5C93A 4FW5A 1UYCA 1BKNA 2J7KA 5M4HA 2BA1D 2XDSA 4DV7I 4GKKI 3FV5A 5IN9A 4LFAE 1A4HA 3CWVA 2IWXA 4BAEA 3QT5A 2XJJA 4CE2A 4B6CA 3T1YI 4LCHA 4NH8A 3EKRA 4FWDA 2YI0A 4XD8A 4AWOA 1XNRE 4B3MI 2C2AA 2XEXA 5JEAB 2YEBA 2UXCE 2Q2EB 4GKJE 4DV1E 3A0ZA 3QT7A 1UYHA 2YKCA 4LF9E 4CE1A 2YEDA 3FT8A 2CCTA 1AJ6A 4MB9A 5D6PA 4LWEA 4MU4A 2VF3A 2UU9E 2HK3A 2C1IA 4WUBA 3CGZA 1B62A 3G7EA 2VQEE 4YHHI 1IBLE 4DXLA 1TH8A 2PNZB 2BU5A 3T0ZA 1YHCA 1YERA 4R3MA 4GGLA 2HHHI 3TZ4A 3J7AG 1K47A 4X65E 4KHPI 2XJXA 3D4JA 5JEAA 2YI5A 1MU5A 4YKTA 2VW5A 4GKKE 4EFTA 3PYFA 2XDXA 1ZM4A 2UXDE 1UYDA 2XX2A 5J71A 2YEEA 2R42A 4YKRA 5CF0A 4ZVIA 3TTZA 5F3KA 4NBQA 3GIFA 2EXLA 5ELWA 4IFDF 3K99A 5IWAE 3J80C 2BSMA 2V34A 5GMDA 4DR6I 1BGQA 2PNZA 2XD6A 2JT2A 1HNXE 4HXWA 5CTUA 2Z5CA 1TC0A 2CH4A 3FT5A 3L7ZB 3BM9A 3OPDA 4Z7YA 2NPFA 2XJGA 1H74A 2VCJA 2YE9A 2ZBKB 2QFOA 4USKA 2VCIA 1GKXA 4EMVA 2CG9A 4IFDD 1USUA 4YHHE 4JI6I 5BR8E 3GLLA 5M4EA 4AQYI 4EGKA 4MYUA 2ZM6E 2YE2A 1XMQE 4GCZA 3VADA 1A6FA 4JI0E 3H80A 4JI4E 4KHPE 4JQLA 5C0XE 4JYAI 4DV6I 4GT8A 1FKAE 3L7ZA 5DROA 2BA0D 2CGEA 2J65A 1IBKE 3HJCA 2JE6B 4JI3E 1YT1A 1ZM3A 1Z5BA 4PRXA 5EKWA 3V2UC 3PS1A 2YEHA 4EEHA 2F4VE 4ZKIA 5K36A 3K60A 2AE8A 2NN6C 3EKOA 1N34E 4DR6E 3TUHA 3HULA 5DRPA 1GKZA 4URNA 1N36I 4ISAA 2CVEA 4DPUA 2UXBI 3PYDA 4CWTA 4MP7A 2LJPA 4I5SA 4EFUA 5J6AA 2JJCA 4LWIA 3PS3A 2OI2A 4AWQA 4JI5I 1MG7A 2WEQA 1UDNA 2JE6A 4O04A 1I5AA 2A2CA 3D2RA 1FWKA 2NN6B 3M6AA 2HCHA 3U2KA 4XCLA 2WI5A 4DR5I 2BU8A 3EHFA 1S4EA 1KZNA 4XIQA 4DV4I 1I59A 2HFUA 4N3OA 4FCPA 4DV5E 2DEJA 3K17A 1NHJA 2YGFA 4X62I 2V2VA 2JEBA 1Z0TA 4IS9A 5LMUE 1ZXMA 4B3TI 4PL9A 1HR0I 3M7ND 3VHAA 4DU8A 1D6TA 1N33I 1OYSA 4EM7A 2GQPA 4JI7I 4BIZA 2NN6A 2FWZA 4UROA 3J80Q 1N36E 2HG1A 4DV0E 4XKAA 4DUYE 4DZYA 1KKHA 2UXBE 3CDJA 4UT4A 4URMA 2XABA 4DPWA 4DR3I 2WI7A 4LFCI 1FJGI 1UDOA 4GQTA 3O2FA 5DRQA 5BODA 1Y5YA 3WU5A 1Z5CA 2YEAA 3CRLA 4E72A 2BA0G 4ED4A 4WUCA 4WUDA 1EA6A 4P8OA 4YKZA 4ASAA 3Q5KA 3PS2A 1USVA 2BR2B 1R62A 2BYIA
chains in the Genus database with same CATH topology
2O1TA 1YT2A 4U93A 4JI2I 4CWOA 2O1VA 4EMDA 2HK2A 2YJXA 4LWHA 1ZWHA 3HZ1A 1NHHA 4L90A 3EHGA 4AS9A 4DR7I 3GIGB 1OJ4A 1WUUA 2V2QA 4DR1E 1HNWI 4JI8I 3R4NA 4H85A 1GJVA 1L0OA 4CE3A 1US7A 1YSRA 2XX4A 4DV2I 4JI7E 2ZDYA 3EHHA 4FCRA 1MX0A 3BMYA 1IBMI 3B28A 3OWBA 4LF5I 5M4NA 5M4KA 2BZ5A 2DEIA 4LFCE 2IWUA 4HY6A 5GMEA 4HYMA 3R4PA 3K97A 4NXNI 4LF7E 5CPHA 1TIDA 2GS8A 4X9LA 5FNCA 2HKEA 1U2OA 3B27A 1B3QA 4B3RE 3GIGA 2WI6A 4DPYA 2XX5A 4FCQA 2QG0A 2XDKA 4DV7E 1U0ZA 2YKJA 4LFBI 2FYPA 3ZXOA 3K1JA 4YY3I 2FXSA 2UWDA 4JI2E 3T1YE 4H81A 3HHUA 4EGIA 1Z0CA 5FWKA 4B3SI 3ZXQA 4L94A 4B3ME 1YC1A 3Q6NA 3R91A 4P52A 4LF6I 3JZ3A 4DUZI 4MBCA 1QZRA 4O05A 2YEJA 2BTZA 1H73A 2YK9A 4DPTA 3T10A 1QYEA 4MYTA 1XNQI 2V2ZA 4GEEA 1Z0BA 1IBME 2Q8IA 4BQJA 3A0YA 2XDLA 5CTWA 2X7IA 2PNRA 4LWFA 2UUCI 3LPSA 1YC4A 3O6OA 4XKKA 4CWNA 3HYYA 4MPNA 3J7AM 2GFDA 1H7SA 3QT6A 2HHHE 2UUAI 4LF4I 4FN5A 4HACB 1XHKA 1RREA 3QDDA 3R4OA 4LWGA 4E01A 3U2DA 5A2QQ 4LFBE 3RLRA 1UYEA 3NMQA 4DUHA 1THNA 1AMWA 4FMTA 2WI4A 1N0UA 3B8HA 1YC3A 1Y8OA 4PRVA 3EHJA 2YKIA 4B3SE 2E0AA 3RLQA 2BT0A 2H55A 4HZ5A 3WQ9A 1HK7A 3WHAA 3KE6A 4L8ZA 4HXZA 1XNQE 4HACA 4LF8I 3Q1QA 1YT0A 1Z5AA 1I94I 3RLPA 2UUCE 3OWDA 2CCSA 4JI6E 1NZ0A 4YKQA 5GGZA 4AQYE 4B7PA 4E02A 3T1HI 4XIRA 1YETA 4R1FA 4I3HA 3ZKBA 5IT9C 2YE7A 4URLA 2AJ4A 1ZM9A 2WW4A 3MNRP 3VHDA 4YKYA 1Z0EA 5L3JA 4JYAE 4DV6E 1Z0WA 4FWHA 2R3VA 1H7UA 3A0WA 1I58A 3HEKA 4HYPA 4FW9A 2BU6A 1UYLA 2IWSA 1KTVA 4KSGA 4X66I 1TC6A 2QG2A 3QT8A 3INWA 3PRYA 3ZKDA 3WU3A 4O07A 4R3AA 5D7RA 2BU7A 3K85A 1Y6ZA 1OSFA 1HNZI 2YGEA 2UUBI 4XDMA 4BQGA 3PEJA 3J81C 2K5BA 2X36A 5LL6R 3T0HA 4YKWA 4IZKB 4JI5E 4IZJD 4CWSA 3OTOI 4CWRA 5D7DA 3LNUA 3ZZTA 3G75A 2FWYA 4LP0A 4NH9A 2YEFA 5A2QC 1XNRI 3G7BA 4RPFA 3QTFA 4KP4A 2UXCI 3GIEA 1ZM2A 4GKJI 3C0EA 4DV1I 1JM6A 4DV4E 4NXMI 1RR9A 4CWQA 4LF9I 3SL2A 2YEGA 4USMA 4X62E 4MPEA 1KVKA 2YECA 4B3TE 2UU9I 4JAVA 1HR0E 4GFNA 1BXDA 1J5EI 4IZKA 2VQEI 3B26A 1IBLI 1N33E 3DGEA 3ZZUA 4CWPA 5CTXA 2BV3A 4DR2I 4KFGA 3HZ5A 4X65I 3A0RA 4Q20A 3JAMC 3IEDA 4DR3E 1FJGE 3O0IA 3OTOE 2UXDI 2IOPA 1PIEA 4JASA 4MP2A 1UYFA 2BREA 4V26A 4YKXA 4KSHA 1DARA 3ZZ0A 4ASGA 5IWAI 1UEKA 4XTJA 1YS3A 1ZW9A 5IT9Q 2YI7A 1HNXI 2WI2A 4U7OA 4BIUA 2XHTA 2YGAA 2ZKJA 4OX9I 4UTGA 2Z5EA 4NXME 4JV5I 1PVGA 1YESA 4ASFA 2YE4A 1EI1A 1Z0GA 1AH6A 3Q5JA 4DR7E 4V25A 4AWPA 5F5RA 1J5EE 4HY1A 3Q6MA 5BR8I 4JI8E 4DU7A 1HNWE 2XHRA 2YKEA 2YK2A 4CWFA 4DR4I 4DV2E 2ZM6I 2Z5CB 1UY9A 1UY6A 1XMQI 3GONA 2BM1A 4JI0I 4DR2E 1UYKA 4JI4I 4KTNA 1XMOI 1UYIA 4XKOA 2YE3A 4LF5E 3D0BA 5FLXC 2O1UA 3J81Q 1IBKI 1ID0A 4JI3I 4NXNE 5IDJA 2A2DA 3CRKA 1Y4UA 3R4MA 2F4VI 4PU9A 5CTYA 4DV3I 3INXA 1AM1A 1N34I 3TZ2A 1TILA 4DPXA 1FI4A 4U7NA 2BM0A 3V5RA 5D7CA 1N0VC 4YY3E 3B78A 4OX9E 4JV5E 4K4OA 5BOCA 3TZ5A 3P06A 4JI1I 3VHCA 2GQ0A 4XCJA 2Q8FA 5FNDA 1UY7A 3H4LA 1N32I 2O1WA 2BRCA 4XIPA 3B82A 1I5BA 4JG4A 4LF6E 3TZ0A 1Z59A 4DUZE 5D6QA 3PYEA 4DR4E 2HKJA 3U67A 1AH8A 2XHXA 3D36A 4MPCA 3A0TA 2IORA 4MOTA 4QPKA 2HFSA 1Z0VA 1UYGA 4YKUA 1XMOE 5M4MA 2E5LI 4XITA 2CGFA 4IZJB 4DV5I 3JAMQ 1BYQA 2AKPA 5LMUI 1PKPA 3K98A 2XCMA 2Q8HA 2UUAE 3T1KA 4W7TA 4LF4E 4EGHA 4DV3E 1ELOA 3OW6A 2Q8GA 2YJWA 3LTOA 4XC0A 4HZ0A 1I5DA 3WU6A 4NH7A 2YE5A 4DV0I 2XK2A 1H72C 2BYHA 4DUYI 2EFGA 2H8MA 1YSZA 4JI1E 2VQFI 3T2SA 5FNFA 2ZDXA 2YEIA 4O0BA 3B24A 4LPBA 5LMNI 1N32E 4ASBA 4K0KI 2WI3A 3A0XA 2CCUA 4IZJA 1I5CA 2Z5BB 1UYMA 3RKZA 2YKBA 5IDMA 4L91A 2XDUA 4X64I 4O09A 1FWLA 2QF6A 2YE6A 1Y8PA 1FNMA 4QPJA 1B63A 4LF8E 4L93A 1KIJA 4FWGA 1I94E 2PNMA 2E5LE 4LFAI 3PEHA 1Y8NA 3Q5LA 2YI6A 3T1HE 2BU2A 1S16A 5FLXQ 2PNLA 3HYZA 1TBWA 2ZITA 4FPPA 4DR1I 2Z5BA 3C11A 2ESAA 3ZM7A 4P7AA 3R92A 2WI1A 4H7QA 2IOQA 2VWCA 4Z7CA 1QY8A 2E1RA 4M1KA 1U2RA 3F0NA 1S14A 4JAUA 2WEPA 3OMUA 1ZXNA 3PYGA 2VQFE 1NHIA 2V8PA 4X66E 1VISA 5LMNE 2JKIA 3CGYA 4E00A 4K0KE 2WERA 3WU4A 5M4PA 4XE2A 1Y4SA 4LF7I 2CZ9A 4X64E 1HNZE 4KQVA 2YE8A 2UUBE 1UY8A 4B3RI 3B25A 4BXIA 5C93A 1UYCA 1BKNA 2J7KA 5M4HA 2XDSA 4DV7I 4GKKI 3FV5A 5IN9A 4LFAE 1A4HA 3CWVA 2IWXA 4BAEA 3QT5A 2XJJA 4CE2A 4B6CA 3T1YI 4NH8A 3EKRA 4FWDA 2YI0A 4XD8A 4AWOA 1XNRE 4B3MI 2C2AA 2XEXA 2YEBA 2UXCE 2Q2EB 4GKJE 4DV1E 3A0ZA 3QT7A 1UYHA 2YKCA 4LF9E 4CE1A 2YEDA 3FT8A 2CCTA 1AJ6A 4MB9A 5D6PA 4LWEA 2VF3A 2UU9E 2HK3A 4WUBA 3CGZA 1B62A 3G7EA 2VQEE 4YHHI 1IBLE 4DXLA 1TH8A 2BU5A 3T0ZA 1YERA 4R3MA 4GGLA 2HHHI 3TZ4A 3J7AG 1K47A 4X65E 4KHPI 2XJXA 3D4JA 2YI5A 1MU5A 4YKTA 2VW5A 4GKKE 4EFTA 3PYFA 2XDXA 1ZM4A 2UXDE 1UYDA 2XX2A 5J71A 2YEEA 2R42A 4YKRA 5CF0A 4ZVIA 3TTZA 5F3KA 3GIFA 2EXLA 3K99A 5IWAE 3J80C 2BSMA 2V34A 5GMDA 4DR6I 1BGQA 2XD6A 1HNXE 4HXWA 5CTUA 2Z5CA 1TC0A 2CH4A 3FT5A 3BM9A 3OPDA 4Z7YA 2NPFA 2XJGA 1H74A 2VCJA 2YE9A 2ZBKB 2QFOA 4USKA 2VCIA 1GKXA 4EMVA 2CG9A 1USUA 4YHHE 4JI6I 5BR8E 5M4EA 4AQYI 4EGKA 4MYUA 2ZM6E 2YE2A 1XMQE 4GCZA 3VADA 1A6FA 4JI0E 3H80A 4JI4E 4KHPE 4JQLA 4JYAI 4DV6I 4GT8A 1FKAE 1IBKE 2CGEA 3HJCA 4JI3E 1YT1A 1ZM3A 1Z5BA 4PRXA 3V2UC 2YEHA 4EEHA 2F4VE 4ZKIA 3K60A 3EKOA 1N34E 4DR6E 3TUHA 3HULA 1GKZA 4URNA 1N36I 4DPUA 2UXBI 3PYDA 4CWTA 4MP7A 2LJPA 4I5SA 4EFUA 5J6AA 2JJCA 4LWIA 2OI2A 4AWQA 4JI5I 1MG7A 2WEQA 4O04A 1I5AA 2A2CA 3D2RA 1FWKA 3M6AA 2HCHA 3U2KA 4XCLA 2WI5A 4DR5I 2BU8A 3EHFA 1S4EA 1KZNA 4XIQA 4DV4I 1I59A 2HFUA 4N3OA 4FCPA 4DV5E 2DEJA 3K17A 1NHJA 2YGFA 4X62I 2V2VA 1Z0TA 5LMUE 4B3TI 1ZXMA 4PL9A 1HR0I 3VHAA 4DU8A 1D6TA 1N33I 4EM7A 2GQPA 4JI7I 4BIZA 2FWZA 4UROA 3J80Q 1N36E 2HG1A 4DV0E 4XKAA 4DUYE 4DZYA 1KKHA 2UXBE 4UT4A 4URMA 2XABA 4DPWA 4DR3I 2WI7A 4LFCI 1FJGI 4GQTA 3O2FA 5BODA 3WU5A 1Z5CA 2YEAA 3CRLA 4ED4A 4WUCA 4WUDA 1EA6A 4P8OA 4YKZA 4ASAA 3Q5KA 1USVA 4DR5E 1R62A 2BYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YT2 A;  4U93 A;  4JI2 I;  4CWO A;  4EMD A;  2O1V A;  2HK2 A;  2YJX A;  4LWH A;  1ZWH A;  3HZ1 A;  1NHH A;  4L90 A;  3EHG A;  4AS9 A;  4DR7 I;  3GIG B;  1OJ4 A;  1WUU A;  2V2Q A;  4DR1 E;  1HNW I;  4JI8 I;  3R4N A;  4H85 A;  1GJV A;  1L0O A;  4CE3 A;  1US7 A;  1YSR A;  2XX4 A;  4DV2 I;  4JI7 E;  2ZDY A;  3EHH A;  4FCR A;  1MX0 A;  3BMY A;  1IBM I;  3B28 A;  3OWB A;  4LF5 I;  5M4N A;  5M4K A;  2BZ5 A;  2DEI A;  4LFC E;  2IWU A;  4HY6 A;  5GME A;  4HYM A;  3R4P A;  3K97 A;  4NXN I;  4LF7 E;  5CPH A;  1TID A;  2GS8 A;  4X9L A;  5FNC A;  2HKE A;  1U2O A;  3B27 A;  1B3Q A;  4B3R E;  3GIG A;  2WI6 A;  4DPY A;  2XX5 A;  4FCQ A;  2QG0 A;  2XDK A;  4DV7 E;  1U0Z A;  2YKJ A;  4LFB I;  2FYP A;  3ZXO A;  3K1J A;  4YY3 I;  2FXS A;  2UWD A;  4JI2 E;  3T1Y E;  4H81 A;  3HHU A;  4EGI A;  1Z0C A;  5FWK A;  4B3S I;  3ZXQ A;  4L94 A;  4B3M E;  1YC1 A;  3R91 A;  4P52 A;  4LF6 I;  3JZ3 A;  4DUZ I;  4MBC A;  1QZR A;  4O05 A;  2YEJ A;  2BTZ A;  1H73 A;  2YK9 A;  4DPT A;  3T10 A;  1QYE A;  4MYT A;  1XNQ I;  2V2Z A;  4GEE A;  1Z0B A;  1IBM E;  2Q8I A;  4BQJ A;  3A0Y A;  2XDL A;  5CTW A;  2X7I A;  2PNR A;  4LWF A;  2UUC I;  3LPS A;  1YC4 A;  3O6O A;  4XKK A;  4CWN A;  3HYY A;  4MPN A;  3J7A M;  2GFD A;  1H7S A;  3QT6 A;  2HHH E;  2UUA I;  4LF4 I;  4FN5 A;  4HAC B;  1XHK A;  1RRE A;  3QDD A;  3R4O A;  4LWG A;  4E01 A;  3U2D A;  5A2Q Q;  4LFB E;  3RLR A;  1UYE A;  3NMQ A;  4DUH A;  1THN A;  1AMW A;  4FMT A;  2WI4 A;  1N0U A;  3B8H A;  1YC3 A;  1Y8O A;  4PRV A;  3EHJ A;  2YKI A;  4B3S E;  2E0A A;  3RLQ A;  2BT0 A;  2H55 A;  4HZ5 A;  3WQ9 A;  3WHA A;  3KE6 A;  4L8Z A;  4HXZ A;  1XNQ E;  4HAC A;  4LF8 I;  3Q1Q A;  1YT0 A;  1Z5A A;  1I94 I;  3RLP A;  2UUC E;  3OWD A;  2CCS A;  4JI6 E;  1NZ0 A;  4YKQ A;  5GGZ A;  4AQY E;  4B7P A;  4E02 A;  3T1H I;  4XIR A;  1YET A;  4R1F A;  4I3H A;  3ZKB A;  5IT9 C;  2YE7 A;  4URL A;  2AJ4 A;  1ZM9 A;  2WW4 A;  3MNR P;  3VHD A;  4YKY A;  1Z0E A;  5L3J A;  4JYA E;  4DV6 E;  1Z0W A;  4FWH A;  2R3V A;  1H7U A;  3A0W A;  1I58 A;  3HEK A;  4HYP A;  4FW9 A;  2BU6 A;  1UYL A;  2IWS A;  1KTV A;  4KSG A;  4X66 I;  1TC6 A;  2QG2 A;  3QT8 A;  3INW A;  3ZKD A;  4O07 A;  3WU3 A;  4R3A A;  5CF0 A;  5D7R A;  2BU7 A;  1OSF A;  1HNZ I;  2YGE A;  2UUB I;  4XDM A;  4BQG A;  3PEJ A;  3J81 C;  2K5B A;  2X36 A;  5LL6 R;  3T0H A;  4YKW A;  4JI5 E;  4CWS A;  3OTO I;  4CWR A;  5D7D A;  3LNU A;  3ZZT A;  3G75 A;  2FWY A;  4LP0 A;  4NH9 A;  2YEF A;  5A2Q C;  1XNR I;  3G7B A;  4RPF A;  3QTF A;  4KP4 A;  2UXC I;  3GIE A;  1ZM2 A;  4GKJ I;  3C0E A;  4DV1 I;  1JM6 A;  4DV4 E;  4NXM I;  1RR9 A;  4CWQ A;  4LF9 I;  3SL2 A;  2YEG A;  4USM A;  4X62 E;  4MPE A;  1KVK A;  2YEC A;  4B3T E;  2UU9 I;  4JAV A;  1HR0 E;  4GFN A;  1BXD A;  1J5E I;  2VQE I;  3B26 A;  1IBL I;  1N33 E;  3DGE A;  3ZZU A;  4CWP A;  5CTX A;  2BV3 A;  4DR2 I;  4KFG A;  3HZ5 A;  4X65 I;  3A0R A;  4Q20 A;  3JAM C;  3IED A;  4DR3 E;  1FJG E;  3O0I A;  3OTO E;  2UXD I;  2IOP A;  1PIE A;  4JAS A;  4MP2 A;  1UYF A;  2BRE A;  4V26 A;  4YKX A;  4KSH A;  1DAR A;  3ZZ0 A;  4ASG A;  5IWA I;  1UEK A;  4XTJ A;  1YS3 A;  1ZW9 A;  5IT9 Q;  2YI7 A;  1HNX I;  2WI2 A;  4U7O A;  4BIU A;  2XHT A;  2YGA A;  2ZKJ A;  4OX9 I;  4UTG A;  4NXM E;  4JV5 I;  1PVG A;  1YES A;  4ASF A;  2YE4 A;  1EI1 A;  1Z0G A;  1AH6 A;  3Q5J A;  4DR7 E;  4V25 A;  4AWP A;  5F5R A;  1J5E E;  4HY1 A;  1HNW E;  5BR8 I;  4JI8 E;  4DU7 A;  2XHR A;  2YK2 A;  2YKE A;  4CWF A;  4DR4 I;  4DV2 E;  2ZM6 I;  1UY9 A;  1UY6 A;  1XMQ I;  3GON A;  2BM1 A;  4JI0 I;  4DR2 E;  1UYK A;  4JI4 I;  4KTN A;  1XMO I;  1UYI A;  4XKO A;  2YE3 A;  4LF5 E;  3D0B A;  5FLX C;  3J81 Q;  1IBK I;  2O1U A;  1ID0 A;  4JI3 I;  4NXN E;  5IDJ A;  2A2D A;  3CRK A;  1Y4U A;  3R4M A;  2F4V I;  4PU9 A;  5CTY A;  4DV3 I;  3INX A;  1AM1 A;  1N34 I;  3TZ2 A;  1TIL A;  4DPX A;  1FI4 A;  4U7N A;  2BM0 A;  3V5R A;  5D7C A;  1N0V C;  4YY3 E;  3B78 A;  4OX9 E;  4JV5 E;  4K4O A;  5BOC A;  3TZ5 A;  4JI1 I;  3VHC A;  4XCJ A;  2Q8F A;  5FND A;  1UY7 A;  3H4L A;  1N32 I;  2BRC A;  2O1W A;  4XIP A;  3B82 A;  1I5B A;  4JG4 A;  4LF6 E;  3TZ0 A;  1Z59 A;  4DUZ E;  5D6Q A;  3PYE A;  4DR4 E;  2HKJ A;  3U67 A;  1AH8 A;  2XHX A;  3D36 A;  4MPC A;  3A0T A;  2IOR A;  4MOT A;  4QPK A;  2HFS A;  1Z0V A;  1UYG A;  4YKU A;  1XMO E;  5M4M A;  2E5L I;  4XIT A;  2CGF A;  4DV5 I;  3JAM Q;  1BYQ A;  2AKP A;  5LMU I;  1PKP A;  3K98 A;  2XCM A;  2Q8H A;  2UUA E;  3T1K A;  4W7T A;  4LF4 E;  4EGH A;  4DV3 E;  1ELO A;  3OW6 A;  2Q8G A;  2YJW A;  3LTO A;  4XC0 A;  4HZ0 A;  1I5D A;  3WU6 A;  4NH7 A;  2YE5 A;  4DV0 I;  2XK2 A;  1H72 C;  2BYH A;  4DUY I;  2EFG A;  2H8M A;  1YSZ A;  4JI1 E;  2VQF I;  3T2S A;  5FNF A;  2ZDX A;  2YEI A;  4O0B A;  3B24 A;  4LPB A;  5LMN I;  1N32 E;  4ASB A;  4K0K I;  2WI3 A;  3A0X A;  2CCU A;  1I5C A;  3RKZ A;  1UYM A;  2YKB A;  5IDM A;  4L91 A;  2XDU A;  4X64 I;  4O09 A;  1FWL A;  2QF6 A;  2YE6 A;  1Y8P A;  1FNM A;  4QPJ A;  1B63 A;  4LF8 E;  4L93 A;  1KIJ A;  4FWG A;  1I94 E;  4LFA I;  2E5L E;  3PEH A;  1Y8N A;  3Q5L A;  2YI6 A;  3T1H E;  2BU2 A;  1S16 A;  5FLX Q;  3HYZ A;  1TBW A;  2ZIT A;  4FPP A;  4DR1 I;  3C11 A;  2ESA A;  3ZM7 A;  4P7A A;  3R92 A;  2WI1 A;  4H7Q A;  2IOQ A;  2VWC A;  4Z7C A;  1QY8 A;  2E1R A;  4M1K A;  1U2R A;  3F0N A;  1S14 A;  4JAU A;  2WEP A;  3OMU A;  1ZXN A;  3PYG A;  2VQF E;  1NHI A;  2V8P A;  4X66 E;  1VIS A;  5LMN E;  2JKI A;  3CGY A;  4E00 A;  4K0K E;  2WER A;  3WU4 A;  5M4P A;  4XE2 A;  1Y4S A;  4LF7 I;  2CZ9 A;  4X64 E;  1HNZ E;  4KQV A;  2YE8 A;  2UUB E;  1UY8 A;  4B3R I;  3B25 A;  4BXI A;  5C93 A;  1UYC A;  1BKN A;  2J7K A;  5M4H A;  2XDS A;  4DV7 I;  4GKK I;  3FV5 A;  5IN9 A;  4LFA E;  1A4H A;  3CWV A;  2IWX A;  4BAE A;  3QT5 A;  2XJJ A;  4CE2 A;  4B6C A;  3T1Y I;  4NH8 A;  3EKR A;  4FWD A;  2YI0 A;  4XD8 A;  4AWO A;  1XNR E;  4B3M I;  2C2A A;  2XEX A;  2YEB A;  2UXC E;  2Q2E B;  4GKJ E;  4DV1 E;  3A0Z A;  3QT7 A;  1UYH A;  2YKC A;  4LF9 E;  4CE1 A;  2YED A;  3FT8 A;  2CCT A;  1AJ6 A;  4MB9 A;  5D6P A;  4LWE A;  2VF3 A;  2UU9 E;  2HK3 A;  4WUB A;  3CGZ A;  1B62 A;  3G7E A;  2VQE E;  4YHH I;  1IBL E;  4DXL A;  1TH8 A;  2BU5 A;  3T0Z A;  1YER A;  4R3M A;  4GGL A;  2HHH I;  3TZ4 A;  3J7A G;  1K47 A;  4X65 E;  4KHP I;  2XJX A;  3D4J A;  2YI5 A;  1MU5 A;  4YKT A;  2VW5 A;  4GKK E;  4EFT A;  3PYF A;  2XDX A;  1ZM4 A;  2UXD E;  1UYD A;  2XX2 A;  5J71 A;  2YEE A;  2R42 A;  4YKR A;  4ZVI A;  3TTZ A;  5F3K A;  3GIF A;  2EXL A;  3K99 A;  5IWA E;  3J80 C;  2BSM A;  2V34 A;  5GMD A;  4DR6 I;  1BGQ A;  2XD6 A;  1HNX E;  4HXW A;  5CTU A;  3FT5 A;  1TC0 A;  2CH4 A;  3BM9 A;  3OPD A;  4Z7Y A;  2NPF A;  2XJG A;  1H74 A;  2VCJ A;  2YE9 A;  2ZBK B;  2QFO A;  4USK A;  2VCI A;  1GKX A;  4EMV A;  2CG9 A;  4YHH E;  4JI6 I;  5M4E A;  5BR8 E;  4AQY I;  4EGK A;  4MYU A;  2ZM6 E;  2YE2 A;  1XMQ E;  4GCZ A;  3VAD A;  1A6F A;  4JI0 E;  3H80 A;  4JI4 E;  4KHP E;  4JQL A;  4JYA I;  4DV6 I;  4GT8 A;  1FKA E;  1IBK E;  4JI3 E;  1YT1 A;  1ZM3 A;  1Z5B A;  4PRX A;  3V2U C;  2YEH A;  4EEH A;  2F4V E;  4ZKI A;  3K60 A;  3EKO A;  1N34 E;  4DR6 E;  3TUH A;  3HUL A;  1GKZ A;  4URN A;  1N36 I;  4DPU A;  2UXB I;  3PYD A;  4CWT A;  4MP7 A;  2LJP A;  4I5S A;  4EFU A;  5J6A A;  2JJC A;  4LWI A;  2OI2 A;  4AWQ A;  4JI5 I;  1MG7 A;  2WEQ A;  4O04 A;  1I5A A;  2A2C A;  3D2R A;  1FWK A;  3M6A A;  2HCH A;  3U2K A;  4XCL A;  2WI5 A;  4DR5 I;  2BU8 A;  3EHF A;  1S4E A;  1KZN A;  4XIQ A;  4DV4 I;  1I59 A;  2HFU A;  4FCP A;  4DV5 E;  2DEJ A;  3K17 A;  1NHJ A;  2YGF A;  4X62 I;  2V2V A;  1Z0T A;  5LMU E;  4B3T I;  1ZXM A;  4PL9 A;  1HR0 I;  3VHA A;  4DU8 A;  1D6T A;  1N33 I;  4EM7 A;  2GQP A;  4JI7 I;  4BIZ A;  2FWZ A;  4URO A;  3J80 Q;  1N36 E;  2HG1 A;  4DV0 E;  4XKA A;  4DUY E;  4DZY A;  1KKH A;  2UXB E;  4UT4 A;  4URM A;  2XAB A;  4DPW A;  4DR3 I;  2WI7 A;  4LFC I;  1FJG I;  4GQT A;  3O2F A;  5BOD A;  3WU5 A;  1Z5C A;  2YEA A;  3CRL A;  4ED4 A;  4WUC A;  4WUD A;  1EA6 A;  4P8O A;  4YKZ A;  4ASA A;  3Q5K A;  4DR5 E;  1R62 A;  2BYI A; 
#chains in the Genus database with same CATH topology
 2C1G A;  2O1T A;  1YT2 A;  4U93 A;  4JI2 I;  4CWO A;  2O1V A;  4EMD A;  2HK2 A;  2YJX A;  4LWH A;  2C37 B;  1ZWH A;  3HZ1 A;  1NHH A;  4L90 A;  4IFD C;  3EHG A;  4AS9 A;  3LMM A;  4DR7 I;  5K36 E;  3GIG B;  1OJ4 A;  1WUU A;  2V2Q A;  4DR1 E;  1HNW I;  4JI8 I;  3R4N A;  4H85 A;  1GJV A;  1L0O A;  4CE3 A;  1US7 A;  1YSR A;  2XX4 A;  4DV2 I;  4JI7 E;  3P3C A;  2ZDY A;  3EHH A;  4FCR A;  1MX0 A;  3BMY A;  5C0X F;  1IBM I;  3B28 A;  3OWB A;  4LF5 I;  5M4N A;  5M4K A;  2BR2 A;  2BZ5 A;  2DEI A;  2WP8 B;  4LFC E;  2IWU A;  4HY6 A;  5GME A;  4HYM A;  4IFD B;  3R4P A;  3K97 A;  4OKG A;  4NXN I;  4LF7 E;  5CPH A;  2C37 A;  3UHM A;  2GS8 A;  1TID A;  3CDI A;  4X9L A;  2HKE A;  1U2O A;  3B27 A;  5FNC A;  1B3Q A;  4B3R E;  3GIG A;  2WI6 A;  2PO2 B;  4DPY A;  2XX5 A;  4FCQ A;  2QG0 A;  2XDK A;  5C0X D;  4DV7 E;  1U0Z A;  2YKJ A;  4LFB I;  2FYP A;  4AIM A;  3M7N G;  3ZXO A;  3K1J A;  4YY3 I;  4OO1 E;  2FXS A;  2UWD A;  4JI2 E;  3T1Y E;  4H81 A;  3HHU A;  4EGI A;  2WNR B;  1Z0C A;  5FWK A;  4B3S I;  2WP8 A;  2JEA B;  3ZXQ A;  4L94 A;  4B3M E;  1YC1 A;  3Q6N A;  3R91 A;  4MDT A;  4P52 A;  4LF6 I;  4IFD A;  3JZ3 A;  4DUZ I;  4MBC A;  3M85 D;  1QZR A;  4O05 A;  2YEJ A;  2BTZ A;  1H73 A;  2YK9 A;  4LCF A;  4DPT A;  3T10 A;  1QYE A;  4MYT A;  1XNQ I;  2V2Z A;  2PO2 A;  4GEE A;  1Z0B A;  1IBM E;  2Q8I A;  4BQJ A;  2C38 B;  3A0Y A;  2XDL A;  5CTW A;  2X7I A;  2PNR A;  3GME A;  2PO1 B;  4LWF A;  2UUC I;  3LPS A;  1YC4 A;  3O6O A;  4XKK A;  2BA1 G;  4CWN A;  3HYY A;  2WNR A;  3H1C A;  4MPN A;  3P76 A;  3J7A M;  2GFD A;  1H7S A;  3QT6 A;  2HHH E;  2UUA I;  2JEA A;  4LF4 I;  4FW6 A;  4FN5 A;  4HAC B;  1XHK A;  1RRE A;  3QDD A;  3R4O A;  4LWG A;  4E01 A;  3U2D A;  5A2Q Q;  4LFB E;  3RLR A;  1UYE A;  3NMQ A;  4DUH A;  1THN A;  4J3D A;  1AMW A;  2GO4 A;  4FMT A;  2C38 A;  3U1Y A;  1N0U A;  3B8H A;  1Y60 A;  1YC3 A;  2WI4 A;  3P3E A;  4PRV A;  1Y8O A;  3EHJ A;  4LOM A;  4B3S E;  2PO1 A;  2E0A A;  5DNL A;  2BT0 A;  2YKI A;  3RLQ A;  2H55 A;  3HKM A;  4HZ5 A;  3WQ9 A;  1HK7 A;  3WHA A;  3U1K A;  3KE6 A;  4L8Z A;  4HXZ A;  1XNQ E;  4HAC A;  4LF8 I;  1RHY A;  3Q1Q A;  1YT0 A;  1Z5A A;  1I94 I;  4MU0 A;  3RLP A;  2UUC E;  3OWD A;  2CCS A;  4JI6 E;  1NZ0 A;  4YKQ A;  5GGZ A;  4AQY E;  4B7P A;  4E02 A;  3T1H I;  4XIR A;  1YET A;  4R1F A;  4I3H A;  3ZKB A;  5IT9 C;  2YE7 A;  2AJ4 A;  4URL A;  5JEA E;  1ZM9 A;  2WW4 A;  5K36 F;  3MNR P;  3VHD A;  4AM3 A;  3CYG A;  4YKY A;  1Z0E A;  5L3J A;  4JYA E;  2F1D A;  4DV6 E;  1Z0W A;  4FWH A;  2R3V A;  4MU1 A;  1H7U A;  3A0W A;  1I58 A;  3HEK A;  4HYP A;  4FW9 A;  2BU6 A;  3KRN A;  1UYL A;  2IWS A;  3M85 G;  1KTV A;  4KSG A;  4X66 I;  1TC6 A;  4LPF A;  3QT8 A;  2QG2 A;  3PRY A;  3ZKD A;  3WU3 A;  3INW A;  5K36 D;  4R3A A;  5D7R A;  3P3G A;  2BU7 A;  3K85 A;  1R6L A;  1Y6Z A;  1OSF A;  1HNZ I;  2YGE A;  2UUB I;  4XDM A;  4BQG A;  3PEJ A;  5C0X C;  3J81 C;  2K5B A;  2X36 A;  5LL6 R;  3T0H A;  3NZK A;  4YKW A;  4IZK B;  4JI5 E;  4IZJ D;  4OO1 F;  4CWS A;  3OTO I;  4CWR A;  2O3Z A;  3LNU A;  3ZZT A;  5D7D A;  4MQY A;  3G75 A;  2FWY A;  4LP0 A;  4NH9 A;  1E3P A;  2YEF A;  5A2Q C;  1XNR I;  3G7B A;  4RPF A;  3QTF A;  4KP4 A;  2UXC I;  3GIE A;  1ZM2 A;  4GKJ I;  3C0E A;  5C0X B;  4DV1 I;  1JM6 A;  4DV4 E;  4NXM I;  1RR9 A;  4CWQ A;  4LF9 I;  3SL2 A;  2YEG A;  4USM A;  4OO1 D;  4X62 E;  4MPE A;  1KVK A;  2YEC A;  4B3T E;  2UU9 I;  4FW7 A;  4JAV A;  1HR0 E;  4GFN A;  1BXD A;  1J5E I;  4IZK A;  2VQE I;  3B26 A;  1IBL I;  1N33 E;  3DGE A;  3ZZU A;  4CWP A;  1XXE A;  5CTX A;  2BV3 A;  4DR2 I;  4KFG A;  3HZ5 A;  4X65 I;  3A0R A;  4Q20 A;  2GO3 A;  3JAM C;  3IED A;  5C0X A;  4DR3 E;  2HHI A;  4FW4 A;  1FJG E;  4QNK A;  3O0I A;  3OTO E;  2UXD I;  2IOP A;  1PIE A;  4JAS A;  4MP2 A;  1UYF A;  2BRE A;  4V26 A;  4YKX A;  4KSH A;  1DAR A;  3ZZ0 A;  4ASG A;  5IWA I;  1UEK A;  4XTJ A;  1YS3 A;  1R6M A;  1ZW9 A;  5IT9 Q;  2YI7 A;  1HNX I;  2WI2 A;  4U7O A;  4BIU A;  2XHT A;  2YGA A;  2ZKJ A;  4OX9 I;  4GQU A;  2Z5E A;  5EL9 A;  4UTG A;  4NXM E;  4JV5 I;  1PVG A;  1YES A;  4ASF A;  2YE4 A;  1EI1 A;  1Z0G A;  1AH6 A;  3Q5J A;  4DR7 E;  4V25 A;  4AWP A;  5F5R A;  1J5E E;  4HY1 A;  3Q6M A;  5BR8 I;  4JI8 E;  4OZE A;  4DU7 A;  1HNW E;  2XHR A;  2YKE A;  2NN6 E;  2YK2 A;  4DR4 I;  1YH8 A;  4DV2 E;  2Z5C B;  2PO0 B;  2ZM6 I;  1UY9 A;  5DNX A;  1XMQ I;  3GON A;  4MU3 A;  5JEA F;  2BM1 A;  1UY6 A;  4JI0 I;  4DR2 E;  1UYK A;  1UDQ A;  4JI4 I;  4KTN A;  1XMO I;  4BA2 B;  1UYI A;  4XKO A;  1OYR A;  2YE3 A;  4LF5 E;  3D0B A;  5FLX C;  2O1U A;  3J81 Q;  1IBK I;  2FTK A;  1ID0 A;  4JI3 I;  4NXN E;  5IDJ A;  2A2D A;  4U3D A;  3CRK A;  5K36 C;  1Y4U A;  3R4M A;  2F4V I;  4PU9 A;  5JEA D;  5CTY A;  4DV3 I;  3INX A;  1AM1 A;  1N34 I;  3TZ2 A;  1TIL A;  4DPX A;  1FI4 A;  4U7N A;  2BM0 A;  2PO0 A;  3V5R A;  5D7C A;  1N0V C;  4YY3 E;  3B78 A;  4OX9 E;  4JV5 E;  4K4O A;  5BOC A;  3TZ5 A;  3P06 A;  4JI1 I;  4BA2 A;  3VHC A;  2GQ0 A;  4QNJ A;  4XCJ A;  2Q8F A;  1UDS A;  5FND A;  1UY7 A;  3H4L A;  1N32 I;  2O1W A;  2BRC A;  4XIP A;  3B82 A;  3DD6 A;  1I5B A;  4JG4 A;  2C39 B;  4LF6 E;  5K36 B;  3TZ0 A;  1Z59 A;  4DUZ E;  5D6Q A;  4BA1 B;  1E3H A;  3PYE A;  4DR4 E;  2HKJ A;  3U67 A;  1AH8 A;  5DRR A;  2XHX A;  3D36 A;  3A0T A;  2IOR A;  4MPC A;  4MOT A;  4QPK A;  4CWF A;  2HFS A;  1Z0V A;  1UYG A;  4YKU A;  1XMO E;  4LCG A;  3S5T A;  4U3B A;  5M4M A;  2E5L I;  4OO1 C;  4XIT A;  2CGF A;  4IZJ B;  4DV5 I;  3JAM Q;  1BYQ A;  2IES A;  2AKP A;  4FW3 A;  5LMU I;  1PKP A;  3K98 A;  2XCM A;  2Q8H A;  2UUA E;  3T1K A;  4W7T A;  4LF4 E;  2C39 A;  4DV3 E;  1ELO A;  3OW6 A;  4EGH A;  2Q8G A;  2YJW A;  4BA1 A;  3LTO A;  4XC0 A;  4HZ0 A;  1F51 A;  1I5D A;  3WU6 A;  4NH7 A;  5JEN A;  2YE5 A;  4DV0 I;  2XK2 A;  1H72 C;  2BYH A;  4DUY I;  2EFG A;  2H8M A;  1YSZ A;  4OO1 B;  4JI1 E;  2VQF I;  2JEB B;  3T2S A;  2ZDX A;  5FNF A;  2YEI A;  4O0B A;  3B24 A;  4LPB A;  4IFD E;  5LMN I;  1N32 E;  4ASB A;  4DR5 E;  4K0K I;  2WI3 A;  3A0X A;  2CCU A;  4IZJ A;  1I5C A;  2Z5B B;  4AID A;  1UYM A;  3RKZ A;  2YKB A;  5IDM A;  4L91 A;  2XDU A;  4X64 I;  4O09 A;  1FWL A;  2QF6 A;  2YE6 A;  1Y8P A;  1FNM A;  4QPJ A;  1OYP A;  1B63 A;  3GCM A;  4LF8 E;  4L93 A;  1VI7 A;  1KIJ A;  4FWG A;  1I94 E;  2PNM A;  2E5L E;  4LFA I;  3PEH A;  1Y8N A;  3Q5L A;  2YI6 A;  3T1H E;  4OO1 A;  1S16 A;  5FLX Q;  2BU2 A;  2PNL A;  3HYZ A;  1IXM A;  1TBW A;  2ZIT A;  4FPP A;  4DR1 I;  2Z5B A;  3B4T A;  3C11 A;  2NN6 F;  2ESA A;  3ZM7 A;  4P7A A;  2VES A;  3R92 A;  2WI1 A;  4H7Q A;  2IOQ A;  2VWC A;  4Z7C A;  1QY8 A;  2E1R A;  4M1K A;  1U2R A;  3F0N A;  2IER A;  1S14 A;  4JAU A;  2WEP A;  3OMU A;  1ZXN A;  3PYG A;  2VQF E;  4O07 A;  1NHI A;  2V8P A;  4X66 E;  1VIS A;  5LMN E;  2JKI A;  3CGY A;  4E00 A;  4K0K E;  2WER A;  3WU4 A;  5M4P A;  4XE2 A;  1Y4S A;  4LF7 I;  2CZ9 A;  2NN6 D;  1P42 A;  5JEA C;  4KQV A;  4X64 E;  1HNZ E;  2UUB E;  1UY8 A;  2YE8 A;  4B3R I;  3B25 A;  4BXI A;  5C93 A;  4FW5 A;  1UYC A;  1BKN A;  2J7K A;  5M4H A;  2BA1 D;  2XDS A;  4DV7 I;  4GKK I;  3FV5 A;  5IN9 A;  4LFA E;  1A4H A;  3CWV A;  2IWX A;  4BAE A;  3QT5 A;  2XJJ A;  4CE2 A;  4B6C A;  3T1Y I;  4LCH A;  4NH8 A;  3EKR A;  4FWD A;  2YI0 A;  4XD8 A;  4AWO A;  1XNR E;  4B3M I;  2C2A A;  2XEX A;  5JEA B;  2YEB A;  2UXC E;  2Q2E B;  4GKJ E;  4DV1 E;  3A0Z A;  3QT7 A;  1UYH A;  2YKC A;  4LF9 E;  4CE1 A;  2YED A;  3FT8 A;  2CCT A;  1AJ6 A;  4MB9 A;  5D6P A;  4LWE A;  4MU4 A;  2VF3 A;  2UU9 E;  2HK3 A;  2C1I A;  4WUB A;  3CGZ A;  1B62 A;  3G7E A;  2VQE E;  4YHH I;  1IBL E;  4DXL A;  1TH8 A;  2PNZ B;  2BU5 A;  3T0Z A;  1YHC A;  1YER A;  4R3M A;  4GGL A;  2HHH I;  3TZ4 A;  3J7A G;  1K47 A;  4X65 E;  4KHP I;  2XJX A;  3D4J A;  5JEA A;  2YI5 A;  1MU5 A;  4YKT A;  2VW5 A;  4GKK E;  4EFT A;  3PYF A;  2XDX A;  1ZM4 A;  2UXD E;  1UYD A;  2XX2 A;  5J71 A;  2YEE A;  2R42 A;  4YKR A;  5CF0 A;  4ZVI A;  3TTZ A;  5F3K A;  4NBQ A;  3GIF A;  2EXL A;  5ELW A;  4IFD F;  3K99 A;  5IWA E;  3J80 C;  2BSM A;  2V34 A;  5GMD A;  4DR6 I;  1BGQ A;  2PNZ A;  2XD6 A;  2JT2 A;  1HNX E;  4HXW A;  5CTU A;  2Z5C A;  1TC0 A;  2CH4 A;  3FT5 A;  3L7Z B;  3BM9 A;  3OPD A;  4Z7Y A;  2NPF A;  2XJG A;  1H74 A;  2VCJ A;  2YE9 A;  2ZBK B;  2QFO A;  4USK A;  2VCI A;  1GKX A;  4EMV A;  2CG9 A;  4IFD D;  1USU A;  4YHH E;  4JI6 I;  5BR8 E;  3GLL A;  5M4E A;  4AQY I;  4EGK A;  4MYU A;  2ZM6 E;  2YE2 A;  1XMQ E;  4GCZ A;  3VAD A;  1A6F A;  4JI0 E;  3H80 A;  4JI4 E;  4KHP E;  4JQL A;  5C0X E;  4JYA I;  4DV6 I;  4GT8 A;  1FKA E;  3L7Z A;  5DRO A;  2BA0 D;  2CGE A;  2J65 A;  1IBK E;  3HJC A;  2JE6 B;  4JI3 E;  1YT1 A;  1ZM3 A;  1Z5B A;  4PRX A;  5EKW A;  3V2U C;  3PS1 A;  2YEH A;  4EEH A;  2F4V E;  4ZKI A;  5K36 A;  3K60 A;  2AE8 A;  2NN6 C;  3EKO A;  1N34 E;  4DR6 E;  3TUH A;  3HUL A;  5DRP A;  1GKZ A;  4URN A;  1N36 I;  4ISA A;  2CVE A;  4DPU A;  2UXB I;  3PYD A;  4CWT A;  4MP7 A;  2LJP A;  4I5S A;  4EFU A;  5J6A A;  2JJC A;  4LWI A;  3PS3 A;  2OI2 A;  4AWQ A;  4JI5 I;  1MG7 A;  2WEQ A;  1UDN A;  2JE6 A;  4O04 A;  1I5A A;  2A2C A;  3D2R A;  1FWK A;  2NN6 B;  3M6A A;  2HCH A;  3U2K A;  4XCL A;  2WI5 A;  4DR5 I;  2BU8 A;  3EHF A;  1S4E A;  1KZN A;  4XIQ A;  4DV4 I;  1I59 A;  2HFU A;  4N3O A;  4FCP A;  4DV5 E;  2DEJ A;  3K17 A;  1NHJ A;  2YGF A;  4X62 I;  2V2V A;  2JEB A;  1Z0T A;  4IS9 A;  5LMU E;  1ZXM A;  4B3T I;  4PL9 A;  1HR0 I;  3M7N D;  3VHA A;  4DU8 A;  1D6T A;  1N33 I;  1OYS A;  4EM7 A;  2GQP A;  4JI7 I;  4BIZ A;  2NN6 A;  2FWZ A;  4URO A;  3J80 Q;  1N36 E;  2HG1 A;  4DV0 E;  4XKA A;  4DUY E;  4DZY A;  1KKH A;  2UXB E;  3CDJ A;  4UT4 A;  4URM A;  2XAB A;  4DPW A;  4DR3 I;  2WI7 A;  4LFC I;  1FJG I;  1UDO A;  4GQT A;  3O2F A;  5DRQ A;  5BOD A;  1Y5Y A;  3WU5 A;  1Z5C A;  2YEA A;  3CRL A;  4E72 A;  2BA0 G;  4ED4 A;  4WUC A;  4WUD A;  1EA6 A;  4P8O A;  4YKZ A;  4ASA A;  3Q5K A;  3PS2 A;  1USV A;  2BR2 B;  1R62 A;  2BYI A; 
#chains in the Genus database with same CATH homology
 2O1T A;  1YT2 A;  4U93 A;  4JI2 I;  4CWO A;  2O1V A;  4EMD A;  2HK2 A;  2YJX A;  4LWH A;  1ZWH A;  3HZ1 A;  1NHH A;  4L90 A;  3EHG A;  4AS9 A;  4DR7 I;  3GIG B;  1OJ4 A;  1WUU A;  2V2Q A;  4DR1 E;  1HNW I;  4JI8 I;  3R4N A;  4H85 A;  1GJV A;  1L0O A;  4CE3 A;  1US7 A;  1YSR A;  2XX4 A;  4DV2 I;  4JI7 E;  2ZDY A;  3EHH A;  4FCR A;  1MX0 A;  3BMY A;  1IBM I;  3B28 A;  3OWB A;  4LF5 I;  5M4N A;  5M4K A;  2BZ5 A;  2DEI A;  4LFC E;  2IWU A;  4HY6 A;  5GME A;  4HYM A;  3R4P A;  3K97 A;  4NXN I;  4LF7 E;  5CPH A;  1TID A;  2GS8 A;  4X9L A;  5FNC A;  2HKE A;  1U2O A;  3B27 A;  1B3Q A;  4B3R E;  3GIG A;  2WI6 A;  4DPY A;  2XX5 A;  4FCQ A;  2QG0 A;  2XDK A;  4DV7 E;  1U0Z A;  2YKJ A;  4LFB I;  2FYP A;  3ZXO A;  3K1J A;  4YY3 I;  2FXS A;  2UWD A;  4JI2 E;  3T1Y E;  4H81 A;  3HHU A;  4EGI A;  1Z0C A;  5FWK A;  4B3S I;  3ZXQ A;  4L94 A;  4B3M E;  1YC1 A;  3Q6N A;  3R91 A;  4P52 A;  4LF6 I;  3JZ3 A;  4DUZ I;  4MBC A;  1QZR A;  4O05 A;  2YEJ A;  2BTZ A;  1H73 A;  2YK9 A;  4DPT A;  3T10 A;  1QYE A;  4MYT A;  1XNQ I;  2V2Z A;  4GEE A;  1Z0B A;  1IBM E;  2Q8I A;  4BQJ A;  3A0Y A;  2XDL A;  5CTW A;  2X7I A;  2PNR A;  4LWF A;  2UUC I;  3LPS A;  1YC4 A;  3O6O A;  4XKK A;  4CWN A;  3HYY A;  4MPN A;  3J7A M;  2GFD A;  1H7S A;  3QT6 A;  2HHH E;  2UUA I;  4LF4 I;  4FN5 A;  4HAC B;  1XHK A;  1RRE A;  3QDD A;  3R4O A;  4LWG A;  4E01 A;  3U2D A;  5A2Q Q;  4LFB E;  3RLR A;  1UYE A;  3NMQ A;  4DUH A;  1THN A;  1AMW A;  4FMT A;  2WI4 A;  1N0U A;  3B8H A;  1YC3 A;  1Y8O A;  4PRV A;  3EHJ A;  2YKI A;  4B3S E;  2E0A A;  3RLQ A;  2BT0 A;  2H55 A;  4HZ5 A;  3WQ9 A;  1HK7 A;  3WHA A;  3KE6 A;  4L8Z A;  4HXZ A;  1XNQ E;  4HAC A;  4LF8 I;  3Q1Q A;  1YT0 A;  1Z5A A;  1I94 I;  3RLP A;  2UUC E;  3OWD A;  2CCS A;  4JI6 E;  1NZ0 A;  4YKQ A;  5GGZ A;  4AQY E;  4B7P A;  4E02 A;  3T1H I;  4XIR A;  1YET A;  4R1F A;  4I3H A;  3ZKB A;  5IT9 C;  2YE7 A;  4URL A;  2AJ4 A;  1ZM9 A;  2WW4 A;  3MNR P;  3VHD A;  4YKY A;  1Z0E A;  5L3J A;  4JYA E;  4DV6 E;  1Z0W A;  4FWH A;  2R3V A;  1H7U A;  3A0W A;  1I58 A;  3HEK A;  4HYP A;  4FW9 A;  2BU6 A;  1UYL A;  2IWS A;  1KTV A;  4KSG A;  4X66 I;  1TC6 A;  2QG2 A;  3QT8 A;  3INW A;  3PRY A;  3ZKD A;  3WU3 A;  4O07 A;  4R3A A;  5D7R A;  2BU7 A;  3K85 A;  1Y6Z A;  1OSF A;  1HNZ I;  2YGE A;  2UUB I;  4XDM A;  4BQG A;  3PEJ A;  3J81 C;  2K5B A;  2X36 A;  5LL6 R;  3T0H A;  4YKW A;  4IZK B;  4JI5 E;  4IZJ D;  4CWS A;  3OTO I;  4CWR A;  5D7D A;  3LNU A;  3ZZT A;  3G75 A;  2FWY A;  4LP0 A;  4NH9 A;  2YEF A;  5A2Q C;  1XNR I;  3G7B A;  4RPF A;  3QTF A;  4KP4 A;  2UXC I;  3GIE A;  1ZM2 A;  4GKJ I;  3C0E A;  4DV1 I;  1JM6 A;  4DV4 E;  4NXM I;  1RR9 A;  4CWQ A;  4LF9 I;  3SL2 A;  2YEG A;  4USM A;  4X62 E;  4MPE A;  1KVK A;  2YEC A;  4B3T E;  2UU9 I;  4JAV A;  1HR0 E;  4GFN A;  1BXD A;  1J5E I;  4IZK A;  2VQE I;  3B26 A;  1IBL I;  1N33 E;  3DGE A;  3ZZU A;  4CWP A;  5CTX A;  2BV3 A;  4DR2 I;  4KFG A;  3HZ5 A;  4X65 I;  3A0R A;  4Q20 A;  3JAM C;  3IED A;  4DR3 E;  1FJG E;  3O0I A;  3OTO E;  2UXD I;  2IOP A;  1PIE A;  4JAS A;  4MP2 A;  1UYF A;  2BRE A;  4V26 A;  4YKX A;  4KSH A;  1DAR A;  3ZZ0 A;  4ASG A;  5IWA I;  1UEK A;  4XTJ A;  1YS3 A;  1ZW9 A;  5IT9 Q;  2YI7 A;  1HNX I;  2WI2 A;  4U7O A;  4BIU A;  2XHT A;  2YGA A;  2ZKJ A;  4OX9 I;  4UTG A;  2Z5E A;  4NXM E;  4JV5 I;  1PVG A;  1YES A;  4ASF A;  2YE4 A;  1EI1 A;  1Z0G A;  1AH6 A;  3Q5J A;  4DR7 E;  4V25 A;  4AWP A;  5F5R A;  1J5E E;  4HY1 A;  3Q6M A;  5BR8 I;  4JI8 E;  4DU7 A;  1HNW E;  2XHR A;  2YKE A;  2YK2 A;  4CWF A;  4DR4 I;  4DV2 E;  2ZM6 I;  2Z5C B;  1UY9 A;  1UY6 A;  1XMQ I;  3GON A;  2BM1 A;  4JI0 I;  4DR2 E;  1UYK A;  4JI4 I;  4KTN A;  1XMO I;  1UYI A;  4XKO A;  2YE3 A;  4LF5 E;  3D0B A;  5FLX C;  2O1U A;  3J81 Q;  1IBK I;  1ID0 A;  4JI3 I;  4NXN E;  5IDJ A;  2A2D A;  3CRK A;  1Y4U A;  3R4M A;  2F4V I;  4PU9 A;  5CTY A;  4DV3 I;  3INX A;  1AM1 A;  1N34 I;  3TZ2 A;  1TIL A;  4DPX A;  1FI4 A;  4U7N A;  2BM0 A;  3V5R A;  5D7C A;  1N0V C;  4YY3 E;  3B78 A;  4OX9 E;  4JV5 E;  4K4O A;  5BOC A;  3TZ5 A;  3P06 A;  4JI1 I;  3VHC A;  2GQ0 A;  4XCJ A;  2Q8F A;  5FND A;  1UY7 A;  3H4L A;  1N32 I;  2O1W A;  2BRC A;  4XIP A;  3B82 A;  1I5B A;  4JG4 A;  4LF6 E;  3TZ0 A;  1Z59 A;  4DUZ E;  5D6Q A;  3PYE A;  4DR4 E;  2HKJ A;  3U67 A;  1AH8 A;  2XHX A;  3D36 A;  4MPC A;  3A0T A;  2IOR A;  4MOT A;  4QPK A;  2HFS A;  1Z0V A;  1UYG A;  4YKU A;  1XMO E;  5M4M A;  2E5L I;  4XIT A;  2CGF A;  4IZJ B;  4DV5 I;  3JAM Q;  1BYQ A;  2AKP A;  5LMU I;  1PKP A;  3K98 A;  2XCM A;  2Q8H A;  2UUA E;  3T1K A;  4W7T A;  4LF4 E;  4EGH A;  4DV3 E;  1ELO A;  3OW6 A;  2Q8G A;  2YJW A;  3LTO A;  4XC0 A;  4HZ0 A;  1I5D A;  3WU6 A;  4NH7 A;  2YE5 A;  4DV0 I;  2XK2 A;  1H72 C;  2BYH A;  4DUY I;  2EFG A;  2H8M A;  1YSZ A;  4JI1 E;  2VQF I;  3T2S A;  5FNF A;  2ZDX A;  2YEI A;  4O0B A;  3B24 A;  4LPB A;  5LMN I;  1N32 E;  4ASB A;  4K0K I;  2WI3 A;  3A0X A;  2CCU A;  4IZJ A;  1I5C A;  2Z5B B;  1UYM A;  3RKZ A;  2YKB A;  5IDM A;  4L91 A;  2XDU A;  4X64 I;  4O09 A;  1FWL A;  2QF6 A;  2YE6 A;  1Y8P A;  1FNM A;  4QPJ A;  1B63 A;  4LF8 E;  4L93 A;  1KIJ A;  4FWG A;  1I94 E;  2PNM A;  2E5L E;  4LFA I;  3PEH A;  1Y8N A;  3Q5L A;  2YI6 A;  3T1H E;  2BU2 A;  1S16 A;  5FLX Q;  2PNL A;  3HYZ A;  1TBW A;  2ZIT A;  4FPP A;  4DR1 I;  2Z5B A;  3C11 A;  2ESA A;  3ZM7 A;  4P7A A;  3R92 A;  2WI1 A;  4H7Q A;  2IOQ A;  2VWC A;  4Z7C A;  1QY8 A;  2E1R A;  4M1K A;  1U2R A;  3F0N A;  1S14 A;  4JAU A;  2WEP A;  3OMU A;  1ZXN A;  3PYG A;  2VQF E;  1NHI A;  2V8P A;  4X66 E;  1VIS A;  5LMN E;  2JKI A;  3CGY A;  4E00 A;  4K0K E;  2WER A;  3WU4 A;  5M4P A;  4XE2 A;  1Y4S A;  4LF7 I;  2CZ9 A;  4X64 E;  1HNZ E;  4KQV A;  2YE8 A;  2UUB E;  1UY8 A;  4B3R I;  3B25 A;  4BXI A;  5C93 A;  1UYC A;  1BKN A;  2J7K A;  5M4H A;  2XDS A;  4DV7 I;  4GKK I;  3FV5 A;  5IN9 A;  4LFA E;  1A4H A;  3CWV A;  2IWX A;  4BAE A;  3QT5 A;  2XJJ A;  4CE2 A;  4B6C A;  3T1Y I;  4NH8 A;  3EKR A;  4FWD A;  2YI0 A;  4XD8 A;  4AWO A;  1XNR E;  4B3M I;  2C2A A;  2XEX A;  2YEB A;  2UXC E;  2Q2E B;  4GKJ E;  4DV1 E;  3A0Z A;  3QT7 A;  1UYH A;  2YKC A;  4LF9 E;  4CE1 A;  2YED A;  3FT8 A;  2CCT A;  1AJ6 A;  4MB9 A;  5D6P A;  4LWE A;  2VF3 A;  2UU9 E;  2HK3 A;  4WUB A;  3CGZ A;  1B62 A;  3G7E A;  2VQE E;  4YHH I;  1IBL E;  4DXL A;  1TH8 A;  2BU5 A;  3T0Z A;  1YER A;  4R3M A;  4GGL A;  2HHH I;  3TZ4 A;  3J7A G;  1K47 A;  4X65 E;  4KHP I;  2XJX A;  3D4J A;  2YI5 A;  1MU5 A;  4YKT A;  2VW5 A;  4GKK E;  4EFT A;  3PYF A;  2XDX A;  1ZM4 A;  2UXD E;  1UYD A;  2XX2 A;  5J71 A;  2YEE A;  2R42 A;  4YKR A;  5CF0 A;  4ZVI A;  3TTZ A;  5F3K A;  3GIF A;  2EXL A;  3K99 A;  5IWA E;  3J80 C;  2BSM A;  2V34 A;  5GMD A;  4DR6 I;  1BGQ A;  2XD6 A;  1HNX E;  4HXW A;  5CTU A;  2Z5C A;  1TC0 A;  2CH4 A;  3FT5 A;  3BM9 A;  3OPD A;  4Z7Y A;  2NPF A;  2XJG A;  1H74 A;  2VCJ A;  2YE9 A;  2ZBK B;  2QFO A;  4USK A;  2VCI A;  1GKX A;  4EMV A;  2CG9 A;  1USU A;  4YHH E;  4JI6 I;  5BR8 E;  5M4E A;  4AQY I;  4EGK A;  4MYU A;  2ZM6 E;  2YE2 A;  1XMQ E;  4GCZ A;  3VAD A;  1A6F A;  4JI0 E;  3H80 A;  4JI4 E;  4KHP E;  4JQL A;  4JYA I;  4DV6 I;  4GT8 A;  1FKA E;  1IBK E;  2CGE A;  3HJC A;  4JI3 E;  1YT1 A;  1ZM3 A;  1Z5B A;  4PRX A;  3V2U C;  2YEH A;  4EEH A;  2F4V E;  4ZKI A;  3K60 A;  3EKO A;  1N34 E;  4DR6 E;  3TUH A;  3HUL A;  1GKZ A;  4URN A;  1N36 I;  4DPU A;  2UXB I;  3PYD A;  4CWT A;  4MP7 A;  2LJP A;  4I5S A;  4EFU A;  5J6A A;  2JJC A;  4LWI A;  2OI2 A;  4AWQ A;  4JI5 I;  1MG7 A;  2WEQ A;  4O04 A;  1I5A A;  2A2C A;  3D2R A;  1FWK A;  3M6A A;  2HCH A;  3U2K A;  4XCL A;  2WI5 A;  4DR5 I;  2BU8 A;  3EHF A;  1S4E A;  1KZN A;  4XIQ A;  4DV4 I;  1I59 A;  2HFU A;  4N3O A;  4FCP A;  4DV5 E;  2DEJ A;  3K17 A;  1NHJ A;  2YGF A;  4X62 I;  2V2V A;  1Z0T A;  5LMU E;  4B3T I;  1ZXM A;  4PL9 A;  1HR0 I;  3VHA A;  4DU8 A;  1D6T A;  1N33 I;  4EM7 A;  2GQP A;  4JI7 I;  4BIZ A;  2FWZ A;  4URO A;  3J80 Q;  1N36 E;  2HG1 A;  4DV0 E;  4XKA A;  4DUY E;  4DZY A;  1KKH A;  2UXB E;  4UT4 A;  4URM A;  2XAB A;  4DPW A;  4DR3 I;  2WI7 A;  4LFC I;  1FJG I;  4GQT A;  3O2F A;  5BOD A;  3WU5 A;  1Z5C A;  2YEA A;  3CRL A;  4ED4 A;  4WUC A;  4WUD A;  1EA6 A;  4P8O A;  4YKZ A;  4ASA A;  3Q5K A;  1USV A;  4DR5 E;  1R62 A;  2BYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...