1QZRA

Crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii bound to icrf-187 (dexrazoxane)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
404
structure length
382
Chain Sequence
b'SASDKYQKISQLEHILKRPDTYIGSVETQEQLQWIYDEETDCMIEKNVTIVPGLFKIFDEILVNAADNKVRDPSMKRIDVNIHAEEHTIEVKNDGKGIPIEIHNKENIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADLNVGQKYVQKWENNMSICHPPKITSYKKGPSYTKVTFKPDLTRFGMKELDNDILGVMRRRVYDINGSVRDINVYLNGKSLKIRNFKNYVELYLKSLIPTILYERINNRWEVAFAVSDISFQQISFVNSIATTMGGTHVNYITDQIVKKISEILKKVKSFQIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCEIPLEYINKIMKTDLATRMFEIADANEEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA topoisomerase II
publication title Structure of the topoisomerase II ATPase region and its mechanism of inhibition by the chemotherapeutic agent ICRF-187
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 125
structure length 382
sequence length 404
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1qzrA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1qzrA01
1TILA 2XJJA 1MG7A 4CE3A 1AH6A 2YEAA 4DUZE 4JI6E 3C0EA 3D0BA 4URMA 1A4HA 2ZKJA 5CF0A 4X64I 3PYDA 4X65E 1QYEA 5CTYA 2WI4A 4DR7I 4R3AA 1YT2A 4BIUA 4DV1I 2VQFE 3O6OA 3GONA 2HKEA 2WERA 2QG0A 1Y8OA 3LPSA 1ELOA 2UUAI 2UXCE 1QY8A 2YEEA 3R4OA 1ZXMA 3T1HI 3G7BA 4DV3E 4OX9E 4K4OA 4XKAA 1J5EI 1XNRE 4L91A 3QT8A 2CCSA 2BZ5A 4DR4I 2LJPA 4BIZA 2BU6A 4X62I 1HNXE 2UXDE 4O05A 3ZXQA 5BODA 3F0NA 4JV5I 4URLA 2A2CA 4DR1E 4LWGA 4HZ0A 1UYGA 2FWZA 5C93A 4EGIA 4DUYE 4DZYA 2VF3A 5GGZA 4O09A 2XJGA 2HK2A 3BMYA 2ZITA 1I94I 5FWKA 4ASBA 4GCZA 2AKPA 2CG9A 1OJ4A 2YEDA 3HZ1A 4AS9A 5BOCA 2HK3A 4DV2E 2E0AA 4HYPA 4CE2A 4B3TE 4JYAE 1BXDA 4KFGA 4Z7CA 4PRXA 2YK9A 3GIGB 4USKA 1UYEA 1Y4UA 5IWAI 2WI3A 4CWRA 2UUBI 1YC3A 1Z0WA 2BREA 4AWOA 1D6TA 1HNWE 2WI1A 1KTVA 4LF9I 4EEHA 5FNFA 1NHIA 4NXME 3C11A 4W7TA 3J7AG 2UU9I 4JI0E 2YEFA 1XMQE 3ZZUA 2WI6A 5FLXC 3T1KA 2E5LE 3OW6A 4GGLA 3QDDA 3OPDA 1K47A 1N36I 4P52A 2BTZA 2HFUA 3PYFA 4JG4A 2CCUA 4AWQA 1TIDA 4XIPA 4DUZI 4JI6I 1AJ6A 3J80Q 2F4VE 1RREA 4DPYA 2WI5A 2ZBKB 2BV3A 4B3RI 4GKJE 2EFGA 3R4MA 2UUCE 1XMOI 5CTXA 1ZM2A 4XCJA 4CWQA 5A2QQ 1FNMA 3K98A 4EFTA 2BYHA 3A0ZA 3OMUA 1IBME 1YESA 1IBKE 1Z59A 1UYIA 1N34I 3EKRA 2YKBA 1Z5BA 3QT5A 4DV4E 1JM6A 3OTOI 3JAMC 4DR2E 1KVKA 1Y8NA 4CWFA 3A0RA 3INXA 2IORA 2EXLA 2YI6A 2QFOA 4DR6E 1XNQI 4YY3I 5FNCA 4JI5I 3CWVA 2XABA 4MPNA 4U7NA 2PNRA 1S14A 4EGHA 4JI3I 4HY6A 3G75A 3HULA 4YKZA 4FCQA 4GKKE 1UYKA 4XKOA 3BM9A 4LF5I 3G7EA 2HHHI 1Z0GA 4LF8I 2X7IA 4YKQA 3U67A 4MYUA 2XX5A 2XHTA 2XK2A 2BU5A 2Q8FA 1HR0I 1ZM3A 5M4PA 1I5CA 1KIJA 5M4MA 4NXNE 4LFBE 4FCRA 2DEIA 2R3VA 5M4EA 1N32E 4LFAI 4XCLA 1FJGI 2V8PA 4HACB 4KHPE 3K17A 2ZDXA 3B82A 2BU8A 4DR3E 2O1UA 4UTGA 1YT0A 4B6CA 4BXIA 1Z5AA 3PYGA 3H4LA 2O1WA 1HNZI 4U7OA 4WUBA 3T1YE 4L90A 3A0WA 3J81C 3GIGA 1I58A 1N0VC 3WU6A 1MU5A 1Y8PA 4JQLA 4MP2A 2VQEI 3ZKBA 1IBLE 4URNA 2Q8GA 2BSMA 3CGYA 4JAVA 4XE2A 2BM0A 4K0KI 2XDXA 1GKZA 2OI2A 2VCJA 3MNRP 4LF7E 3TZ5A 2V2QA 1ZM4A 4R3MA 1UYCA 4JI2E 4CWPA 4JI7E 4DPXA 2UXBI 4HXWA 4DR5E 4XIRA 4YHHE 4DV0I 3R91A 1Z0EA 4JI8E 4KP4A 2YK2A 4DV7E 3B24A 4X66I 4I5SA 3CRKA 4CWSA 2BYIA 1L0OA 3SL2A 3RKZA 2AJ4A 2JKIA 4B3SI 4MPEA 4NH9A 4FWHA 4LP0A 5LMNE 2XHRA 1B63A 2V2VA 2YEJA 2QG2A 4AQYE 3HZ5A 4MOTA 1ZWHA 1US7A 1TC0A 4LF4I 1FKAE 1AMWA 4XIQA 4P7AA 4ED4A 3EKOA 4JI1I 3O2FA 2DEJA 3B25A 1Z0TA 3B8HA 4MYTA 3WU4A 4YKYA 4CWNA 2WEPA 3PEHA 4DPTA 1Z0BA 2QF6A 3R4PA 1Y4SA 3EHFA 4LFCE 4R1FA 4DV5E 5F5RA 4ZKIA 5BR8E 1H74A 4DV6E 1RR9A 2ZM6E 4P8OA 2YE2A 3RLRA 4DU7A 4USMA 5IT9Q 3OWBA 1UY9A 2VWCA 5GMEA 3B28A 4L93A 3B78A 2IWUA 3CGZA 4X65I 3V2UC 4CWTA 3R92A 2VQFI 4B3ME 4LWEA 4LF6E 3LTOA 3NMQA 1DARA 4L94A 2XDKA 4HYMA 4FMTA 4EM7A 2UXCI 3PYEA 3A0TA 3B26A 4YKRA 5D7CA 5M4NA 1NHHA 3EHJA 4DV3I 4OX9I 3ZKDA 4JAUA 1XNRI 1GJVA 1VISA 2X36A 2IOPA 5GMDA 1PKPA 1HNXI 5LMUE 2UXDI 2IOQA 4YKUA 3TZ4A 4UROA 5J71A 2YGAA 2VW5A 4DR1I 3QTFA 4X64E 4HACA 1N33E 2WW4A 3R4NA 2R42A 4DR7E 4DUYI 4FCPA 1S16A 4CWOA 4DV1E 3CRLA 1AM1A 2Q2EB 3EHGA 2WI7A 3GIFA 1NHJA 2UUAE 1BYQA 3H80A 3ZZ0A 4DV2I 4XC0A 3T1HE 2Q8HA 1ZM9A 4B3TI 3LNUA 4AQYI 4JYAI 1ID0A 2IWSA 4CE1A 1XHKA 4DR4E 2YEHA 4X62E 4H7QA 1UY6A 3TZ0A 2XEXA 3U2KA 4JV5E 4ASGA 2YKCA 1U0ZA 2XDSA 3T10A 5D6QA 2JJCA 1FWKA 4LWFA 3A0XA 4LPBA 4O04A 4FW9A 4UT4A 1HNWI 2YGFA 3WHAA 4MPCA 3U2DA 4L8ZA 4NXMI 2J7KA 4FN5A 4JI0I 2YE8A 1XMQI 2XX2A 1YS3A 2E5LI 3O0IA 4MP7A 2ESAA 2HKJA 4RPFA 2K5BA 3KE6A 2YI5A 3OWDA 3J80C 1TC6A 4FWDA 4WUCA 2YE3A 4YKTA 4JASA 2CH4A 3RLPA 4XTJA 2F4VI 5IWAE 4ASFA 2UUBE 4GKJI 2XDUA 5J6AA 2UUCI 5A2QC 4GFNA 1Z0VA 3D2RA 4LF9E 4B7PA 3HEKA 2CGFA 4XDMA 3A0YA 2V2ZA 4M1KA 2NPFA 4MB9A 2UU9E 1IBMI 1H73A 1IBKI 3DGEA 2WI2A 4YKWA 4NH7A 3FT5A 1N36E 4HXZA 5FLXQ 4DV4I 2XJXA 4AWPA 4EMDA 1QZRA 4DR2I 4EFUA 2YKJA 2UWDA 4PU9A 1N33I 2YGEA 2YKEA 2XCMA 2CZ9A 4B3RE 4DR6I 1XMOE 2FWYA 4BQJA 4XKKA 1UYLA 1BGQA 4E00A 2YEBA 4LWHA 4V25A 4EGKA 1H72C 3Q5JA 1N34E 4O07A 4GT8A 4GKKI 2WEQA 3OTOE 4DUHA 1NZ0A 1ZXNA 1BKNA 4Z7YA 1UY8A 4QPJA 4MBCA 3JAMQ 4GQTA 2YI7A 2YEIA 1XNQE 5LL6R 4YY3E 3VHCA 4NXNI 4LFBI 1TBWA 1U2OA 1Z0CA 2HG1A 2BU2A 4JI5E 3WU3A 1N32I 1UYFA 4XD8A 1UYMA 1TH8A 4KQVA 4JI3E 1YETA 4KHPI 4ASAA 3K97A 1U2RA 2HFSA 4DR3I 3ZM7A 3HHUA 3RLQA 4PRVA 3Q5LA 4FWGA 2YE6A 4BQGA 3GIEA 4JI4E 4LF5E 3T1YI 3EHHA 3TUHA 2VCIA 2HHHE 4LF8E 1FI4A 2BM1A 2BU7A 2HCHA 3PEJA 2YE7A 1HR0E 2Q8IA 5IDMA 2FYPA 1IBLI 1YSRA 2GFDA 4I3HA 1I5AA 4PL9A 3WU5A 5CTUA 4U93A 2E1RA 4LFAE 4O0BA 1H7SA 1FJGE 1UYDA 4LF7I 1H7UA 4JI2I 2H8MA 2YI0A 1AH8A 2XD6A 3FV5A 4JI7I 3V5RA 4DR5I 2FXSA 4YHHI 2YJWA 1KZNA 2V34A 4JI8I 2CCTA 2H55A 1HNZE 1YC1A 4DV7I 1MX0A 2BRCA 4V26A 4XITA 3QT6A 5IN9A 4KTNA 4GEEA 3FT8A 3J81Q 3HYYA 2C2AA 4H85A 4HY1A 1YT1A 4FPPA 4QPKA 2VQEE 4NH8A 3JZ3A 5LMNI 5M4HA 4HZ5A 2GQPA 1PIEA 1J5EE 5CTWA 4K0KE 2ZDYA 3B27A 3Q1QA 5IDJA 3D36A 5FNDA 1YERA 4WUDA 1I59A 1B3QA 1ZW9A 2YEGA 4YKXA 3VHDA 3IEDA 4E02A 2UXBE 3INWA 4Q20A 4DV0E 1THNA 3ZXOA 2YE4A 1B62A 2YECA 4X66E 3TZ2A 3ZZTA 2XDLA 3HYZA 3Q5KA 1I94E 5CPHA 3K60A 1WUUA 4ZVIA 4LFCI 1R62A 4DPUA 3TTZA 2IWXA 1YSZA 5D7RA 3K1JA 4DV5I 4B3SE 3T0ZA 5BR8I 4X9LA 4DV6I 5IT9C 2BT0A 2ZM6I 1N0UA 4E01A 3WQ9A 3VADA 2YKIA 1YC4A 2XX4A 4KSHA 4DU8A 2YJXA 4BAEA 1KKHA 4LWIA 3QT7A 1UEKA 4EMVA 2GS8A 4LF4E 1UYHA 3T0HA 1Z5CA 1FWLA 4JI4I 4H81A 2XHXA 4KSGA 5D7DA 4JI1E 1UY7A 3K99A 4B3MI 3M6AA 1OSFA 4LF6I 2YE5A 2YE9A 2A2DA 5D6PA 5F3KA 3D4JA 1A6FA 5L3JA 1S4EA 1EA6A 4DXLA 2O1VA 1I5DA 1GKXA 3T2SA 1I5BA 3VHAA 5M4KA 4DPWA 1PVGA 5LMUI 3J7AM 1EI1A
chains in the Genus database with same CATH superfamily
1TILA 2XJJA 1MG7A 4CE3A 2BA0G 3P3EA 5JEAC 2PO1A 4DUZE 4JI6E 1AH6A 2YEAA 3C0EA 3D0BA 1A4HA 2ZKJA 4LCGA 4X64I 4IFDC 3PYDA 5CF0A 5JENA 4X65E 1QYEA 5CTYA 2WI4A 4DR7I 4R3AA 1YT2A 4BIUA 4DV1I 2VQFE 3P06A 3O6OA 3GONA 2HKEA 2WERA 2QG0A 1Y8OA 3LPSA 1ELOA 2UUAI 5C0XE 2UXCE 1QY8A 2C37A 2YEEA 3R4OA 1ZXMA 4IZJA 4BA1B 3T1HI 3G7BA 4DV3E 4OX9E 4K4OA 4XKAA 1J5EI 1XNRE 4L91A 3QT8A 3UHMA 2BZ5A 1OYPA 2CCSA 4DR4I 2LJPA 4BIZA 2BU6A 4X62I 1HNXE 1RHYA 4AM3A 2UXDE 4O05A 3ZXQA 3F0NA 4JV5I 4URLA 2Z5EA 5BODA 2A2CA 2BA0D 4DR1E 4LWGA 4HZ0A 4MU0A 1UYGA 2FWZA 5C93A 4EGIA 4DUYE 2PNZB 4DZYA 2VF3A 5GGZA 4O09A 2XJGA 2HK2A 3PS2A 2PO2A 2ZITA 5EL9A 5FWKA 1I94I 3BMYA 4GCZA 2CG9A 5C0XC 2AKPA 4ASBA 1OJ4A 2YEDA 3HZ1A 4AS9A 1USVA 5BOCA 2HK3A 4DV2E 2E0AA 4HYPA 4CE2A 4B3TE 4JYAE 1BXDA 4KFGA 4Z7CA 4PRXA 2YK9A 3GIGB 4USKA 1UYEA 2C38B 1Y4UA 2NN6A 5IWAI 2WI3A 4CWRA 2UUBI 1YC3A 1Z0WA 2BREA 5K36A 4AWOA 2C37B 3B4TA 1D6TA 1HNWE 2WI1A 2WP8B 1KTVA 4LF9I 4EEHA 5FNFA 1NHIA 4NXME 3C11A 4W7TA 3J7AG 2UU9I 4JI0E 2YEFA 4OO1F 1XMQE 3ZZUA 2WI6A 5FLXC 3T1KA 2E5LE 3OW6A 4GGLA 3QDDA 3LMMA 4AIMA 1IXMA 3OPDA 1K47A 1N36I 4MQYA 4P52A 2NN6D 2HFUA 3PYFA 4JG4A 2BTZA 2CCUA 1TIDA 4AWQA 4XIPA 4DUZI 4JI6I 3M7ND 5K36D 1AJ6A 4FW3A 1Y60A 3J80Q 4IZKB 2F4VE 1RREA 4DPYA 2WI5A 2ZBKB 2BV3A 4B3RI 4GKJE 2EFGA 3K85A 4OZEA 2C39B 2UUCE 3R4MA 1XMOI 5CTXA 1ZM2A 4XCJA 4CWQA 5A2QQ 1FNMA 3K98A 4EFTA 2BYHA 4IS9A 3A0ZA 3OMUA 1IBME 1YESA 1IBKE 1Z59A 4E72A 2NN6B 2Z5BB 1N34I 1UYIA 3EKRA 2YKBA 1Z5BA 3QT5A 4DV4E 1JM6A 3OTOI 3JAMC 4DR2E 1KVKA 1Y8NA 4CWFA 5K36C 1VI7A 3A0RA 3INXA 2IORA 5ELWA 5EKWA 2EXLA 2YI6A 2QFOA 4DR6E 1XNQI 4YY3I 5FNCA 4MU4A 4JI5I 3CWVA 1R6LA 2XABA 4MPNA 4U7NA 4IFDF 2PNRA 3P76A 1S14A 4EGHA 4JI3I 4HY6A 3G75A 2BR2A 2O3ZA 3HULA 4YKZA 4FCQA 2GQ0A 3HKMA 4BA1A 4GKKE 1UYKA 5JEAE 4XKOA 3BM9A 4LF5I 3G7EA 1XXEA 2HHHI 1OYSA 1Z0GA 4LF8I 2X7IA 4YKQA 3U67A 4MYUA 2XX5A 2XHTA 2XK2A 2BU5A 2Q8FA 1HR0I 1ZM3A 5M4PA 1I5CA 1KIJA 2IERA 2JEBB 5M4MA 4NXNE 3DD6A 3KRNA 4LFBE 4FCRA 2DEIA 2R3VA 5M4EA 2PNZA 1N32E 2AE8A 4LFAI 1YH8A 3U1YA 3M85G 4XCLA 1FJGI 2V8PA 4HACB 4KHPE 3K17A 2ZDXA 3B82A 1OYRA 4DR3E 2BU8A 2O1UA 4UTGA 1YT0A 3Q6MA 4J3DA 4B6CA 1Z5AA 3PYGA 5C0XF 2O1WA 3H4LA 4BXIA 1HNZI 4U7OA 4WUBA 3T1YE 4L90A 3A0WA 3J81C 3GIGA 1I58A 1N0VC 3WU6A 2C38A 1MU5A 1Y8PA 4JQLA 4MP2A 2BR2B 1USUA 2VQEI 3ZKBA 1IBLE 4URNA 4QNKA 2Q8GA 1UDQA 2WP8A 2BSMA 3CGYA 4JAVA 2BM0A 4XE2A 4K0KI 2XDXA 1GKZA 3R91A 2OI2A 2VCJA 4IFDB 4LF7E 3MNRP 2V2QA 1ZM4A 4R3MA 1UYCA 4JI2E 3TZ5A 4CWPA 4JI7E 4DPXA 2UXBI 4HXWA 4DR5E 4XIRA 4YHHE 5DRQA 4DV0I 1Z0EA 3NZKA 4JI8E 4KP4A 2YK2A 2CVEA 4DV7E 3B24A 4X66I 4I5SA 3CRKA 3U1KA 4CWSA 2BYIA 1L0OA 3SL2A 4IZKA 1R6MA 3RKZA 2AJ4A 2JKIA 4B3SI 4MPEA 4NH9A 4FWHA 4LP0A 2C39A 5LMNE 2XHRA 1B63A 4FW6A 2V2VA 2YEJA 2QG2A 4AQYE 3HZ5A 4MOTA 1ZWHA 2BA1G 1US7A 1TC0A 4LF4I 1FKAE 1AMWA 2PNLA 4XIQA 2Z5BA 4P7AA 4ED4A 3EKOA 4JI1I 3O2FA 2DEJA 3B25A 1Z0TA 3B8HA 4MYTA 3WU4A 4YKYA 4CWNA 1Y5YA 2WEPA 3PEHA 4DPTA 1Z0BA 2QF6A 4NBQA 1Y4SA 3R4PA 3EHFA 4LFCE 4R1FA 4DV5E 4LCHA 5F5RA 4ZKIA 5BR8E 1H74A 4DV6E 1RR9A 2ZM6E 5K36F 4P8OA 2YE2A 4OKGA 5DROA 3RLRA 4DU7A 4USMA 5IT9Q 3OWBA 1UY9A 2VWCA 5GMEA 3B28A 4L93A 3B78A 2IWUA 2NN6E 3CGZA 1UDSA 3CYGA 2PO0B 4X65I 5K36E 3V2UC 3S5TA 4LCFA 4CWTA 3R92A 2VQFI 5DRPA 4B3ME 4LF6E 3LTOA 3NMQA 4LWEA 1DARA 4L94A 2XDKA 4URMA 4HYMA 4FMTA 4EM7A 2UXCI 3PYEA 3A0TA 3B26A 4YKRA 5D7CA 2Z5CB 5M4NA 1NHHA 3EHJA 4DV3I 4OX9I 3ZKDA 4JAUA 1XNRI 1GJVA 1VISA 2IOPA 2X36A 2JEBA 5GMDA 1PKPA 2PNMA 3Q6NA 1HNXI 2IOQA 5LMUE 4OO1D 2UXDI 4YKUA 3TZ4A 4UROA 2C1GA 5J71A 2YGAA 2VW5A 2NN6C 4DR1I 3QTFA 4N3OA 4X64E 4HACA 1N33E 2WW4A 3CDIA 3R4NA 2R42A 4DR7E 4DUYI 4FCPA 1S16A 4CWOA 4DV1E 3CRLA 1AM1A 2Q2EB 3EHGA 2WI7A 3GIFA 1NHJA 2UUAE 5JEAF 1BYQA 3H80A 4LPFA 3ZZ0A 4DV2I 4XC0A 3T1HE 2Q8HA 1ZM9A 4B3TI 1HK7A 3LNUA 4AQYI 4JYAI 1ID0A 2IWSA 4OO1B 4CE1A 1XHKA 4DR4E 2YEHA 4GQUA 4X62E 4H7QA 1UY6A 3TZ0A 2XEXA 4FW4A 4JV5E 3U2KA 4ASGA 2YKCA 1U0ZA 2XDSA 3T10A 5D6QA 2JJCA 1FWKA 4IFDA 4LWFA 1Y6ZA 3A0XA 4LPBA 4O04A 3GCMA 3GLLA 4FW9A 4UT4A 1HNWI 2YGFA 3WHAA 4MPCA 3U2DA 4L8ZA 4NXMI 2J7KA 4FN5A 4JI0I 2YE8A 1XMQI 2XX2A 1YS3A 2E5LI 3O0IA 4MP7A 2ESAA 2IESA 2CGEA 2HKJA 4RPFA 4QNJA 1E3PA 2K5BA 3KE6A 2YI5A 3OWDA 3J80C 1TC6A 4FWDA 4U3BA 4WUCA 4IFDD 2YE3A 4JASA 4YKTA 2CH4A 3RLPA 2F1DA 1P42A 3L7ZB 4XTJA 2F4VI 4AIDA 5IWAE 4LOMA 4ASFA 2UUBE 4GKJI 2XDUA 5J6AA 2UUCI 5A2QC 4GFNA 1Z0VA 3D2RA 4LF9E 2WNRB 4B7PA 3HEKA 2CGFA 2JT2A 4XDMA 3A0YA 2V2ZA 4M1KA 2NPFA 4MB9A 2UU9E 1IBMI 1H73A 1IBKI 3DGEA 2WI2A 4YKWA 4NH7A 3FT5A 5JEAB 3M85D 2JEAB 1N36E 4HXZA 5FLXQ 4DV4I 2XJXA 4AWPA 4EMDA 1QZRA 2JE6B 4DR2I 3H1CA 4EFUA 2YKJA 2UWDA 4PU9A 1N33I 2YGEA 2YKEA 2XCMA 2CZ9A 4B3RE 4DR6I 5C0XD 1F51A 1XMOE 2FWYA 4BQJA 4XKKA 1UYLA 2PO0A 1BGQA 4E00A 1UDNA 2HHIA 2YEBA 4BA2B 4LWHA 3P3GA 4V25A 4EGKA 1H72C 3Q5JA 3HJCA 2FTKA 1N34E 4O07A 2Z5CA 4GT8A 4GKKI 2WEQA 3OTOE 4DUHA 1NZ0A 1ZXNA 1BKNA 4Z7YA 1UY8A 4QPJA 4MBCA 3JAMQ 5C0XB 4GQTA 2YI7A 4ISAA 4IZJD 2YEIA 1XNQE 5LL6R 4YY3E 3VHCA 4NXNI 4LFBI 1TBWA 1U2OA 1Z0CA 4MU1A 2GO3A 2BU2A 2HG1A 2NN6F 4JI5E 3WU3A 1N32I 2PO1B 1UYFA 4XD8A 3GMEA 1UYMA 1TH8A 4KQVA 4JI3E 1YETA 4KHPI 4ASAA 3K97A 1U2RA 2HFSA 4DR3I 3ZM7A 3M7NG 3HHUA 2BA1D 2C1IA 3RLQA 4PRVA 3Q5LA 4FWGA 2YE6A 4FW5A 3GIEA 4OO1A 4JI4E 4LF5E 3T1YI 3EHHA 4BQGA 4FW7A 3TUHA 2VCIA 2HHHE 4LF8E 1FI4A 2BM1A 4IZJB 2BU7A 2HCHA 3PEJA 2YE7A 1HR0E 2Q8IA 5IDMA 3CDJA 2FYPA 1IBLI 1YSRA 2GFDA 4I3HA 1I5AA 4PL9A 3P3CA 3WU5A 5CTUA 4U93A 2E1RA 4LFAE 4O0BA 1H7SA 3PS1A 1FJGE 1UYDA 4LF7I 4E02A 2GO4A 1H7UA 4JI2I 2H8MA 2YI0A 1AH8A 2XD6A 3FV5A 4JI7I 3V5RA 4DR5I 2FXSA 4YHHI 4OO1E 2PO2B 2V34A 1KZNA 4JI8I 2CCTA 2YJWA 2H55A 1HNZE 1YC1A 4DV7I 1MX0A 2BRCA 4V26A 4XITA 3QT6A 2VESA 5IN9A 4KTNA 5DNXA 4GEEA 3L7ZA 3FT8A 3J81Q 3HYYA 2C2AA 4H85A 4HY1A 1YT1A 4FPPA 4QPKA 2VQEE 4NH8A 3JZ3A 5LMNI 5M4HA 4HZ5A 2WNRA 1PIEA 1J5EE 2GQPA 5CTWA 4K0KE 2ZDYA 3B27A 3Q1QA 5IDJA 3D36A 5FNDA 5K36B 1YERA 5DRRA 4WUDA 1I59A 4OO1C 1B3QA 4MU3A 1ZW9A 2YEGA 3IEDA 4YKXA 5JEAA 3VHDA 2UXBE 3INWA 4Q20A 4DV0E 1THNA 2JEAA 3ZXOA 2YE4A 1UDOA 1B62A 2JE6A 2YECA 4X66E 3TZ2A 3ZZTA 2XDLA 3HYZA 3Q5KA 1I94E 5CPHA 3K60A 1WUUA 4ZVIA 4LFCI 1R62A 4DPUA 3TTZA 2IWXA 1YSZA 5D7RA 3K1JA 4DV5I 4MDTA 5DNLA 4B3SE 4U3DA 3T0ZA 5BR8I 4X9LA 4DV6I 5IT9C 2BT0A 2ZM6I 1N0UA 4E01A 3WQ9A 3VADA 2YKIA 1YC4A 2XX4A 4KSHA 4DU8A 3PRYA 5JEAD 2YJXA 4BAEA 1KKHA 4LWIA 3QT7A 1UEKA 4BA2A 2GS8A 4LF4E 4EMVA 1UYHA 3T0HA 3PS3A 1Z5CA 1FWLA 4JI4I 4H81A 1E3HA 2XHXA 4IFDE 4KSGA 5D7DA 4JI1E 1UY7A 3K99A 4B3MI 3M6AA 1OSFA 4LF6I 2YE5A 2YE9A 2A2DA 5D6PA 5F3KA 3D4JA 1A6FA 2O1TA 5L3JA 1S4EA 1EA6A 4DXLA 2O1VA 5C0XA 1GKXA 1I5DA 1YHCA 3T2SA 1I5BA 3VHAA 5M4KA 4DPWA 2J65A 1PVGA 5LMUI 3J7AM 1EI1A
chains in the Genus database with same CATH topology
1TILA 2XJJA 1MG7A 4CE3A 1AH6A 2YEAA 4DUZE 4JI6E 3C0EA 3D0BA 4URMA 1A4HA 2ZKJA 5CF0A 4X64I 3PYDA 4X65E 1QYEA 5CTYA 2WI4A 4DR7I 4R3AA 1YT2A 4BIUA 4DV1I 2VQFE 3P06A 3O6OA 3GONA 2HKEA 2WERA 2QG0A 1Y8OA 3LPSA 1ELOA 2UUAI 2UXCE 1QY8A 2YEEA 3R4OA 1ZXMA 4IZJA 3T1HI 3G7BA 4DV3E 4OX9E 4K4OA 4XKAA 1J5EI 1XNRE 4L91A 3QT8A 2CCSA 2BZ5A 4DR4I 2LJPA 4BIZA 2BU6A 4X62I 1HNXE 2UXDE 4O05A 3ZXQA 5BODA 3F0NA 4JV5I 4URLA 2Z5EA 2A2CA 4DR1E 4LWGA 4HZ0A 1UYGA 2FWZA 5C93A 4EGIA 4DUYE 4DZYA 2VF3A 5GGZA 4O09A 2XJGA 2HK2A 3BMYA 2ZITA 1I94I 5FWKA 4ASBA 4GCZA 2CG9A 2AKPA 1OJ4A 2YEDA 3HZ1A 4AS9A 1USVA 5BOCA 2HK3A 4DV2E 2E0AA 4HYPA 4CE2A 4B3TE 4JYAE 1BXDA 4KFGA 4Z7CA 4PRXA 2YK9A 3GIGB 4USKA 1UYEA 1Y4UA 5IWAI 2WI3A 4CWRA 2UUBI 1YC3A 1Z0WA 2BREA 4AWOA 1D6TA 1HNWE 2WI1A 1KTVA 4LF9I 4EEHA 5FNFA 1NHIA 4NXME 3C11A 4W7TA 3J7AG 2UU9I 4JI0E 2YEFA 1XMQE 3ZZUA 2WI6A 5FLXC 3T1KA 2E5LE 3OW6A 4GGLA 3QDDA 3OPDA 1K47A 1N36I 4P52A 2BTZA 2HFUA 3PYFA 4JG4A 2CCUA 4AWQA 1TIDA 4XIPA 4DUZI 4JI6I 1AJ6A 3J80Q 4IZKB 2F4VE 1RREA 4DPYA 2WI5A 2ZBKB 2BV3A 4B3RI 4GKJE 2EFGA 3K85A 3R4MA 2UUCE 1XMOI 5CTXA 1ZM2A 4XCJA 4CWQA 5A2QQ 1FNMA 3K98A 4EFTA 2BYHA 3A0ZA 3OMUA 1IBME 1YESA 1IBKE 1Z59A 2Z5BB 1N34I 1UYIA 3EKRA 2YKBA 1Z5BA 3QT5A 4DV4E 1JM6A 3OTOI 3JAMC 4DR2E 1KVKA 1Y8NA 4CWFA 3A0RA 3INXA 2IORA 2EXLA 2YI6A 2QFOA 4DR6E 1XNQI 4YY3I 5FNCA 4JI5I 3CWVA 2XABA 4MPNA 4U7NA 2PNRA 1S14A 4EGHA 4JI3I 4HY6A 3G75A 3HULA 4YKZA 4FCQA 2GQ0A 4GKKE 1UYKA 4XKOA 3BM9A 4LF5I 3G7EA 2HHHI 1Z0GA 4LF8I 2X7IA 4YKQA 3U67A 4MYUA 2XX5A 2XHTA 2XK2A 2BU5A 2Q8FA 1HR0I 1ZM3A 5M4PA 1I5CA 1KIJA 5M4MA 4NXNE 4LFBE 4FCRA 2DEIA 2R3VA 5M4EA 1N32E 4LFAI 4XCLA 1FJGI 2V8PA 4HACB 4KHPE 3K17A 2ZDXA 3B82A 2BU8A 4DR3E 2O1UA 4UTGA 1YT0A 3Q6MA 4B6CA 4BXIA 1Z5AA 3PYGA 2O1WA 3H4LA 1HNZI 4U7OA 4WUBA 3T1YE 4L90A 3A0WA 3J81C 3GIGA 1I58A 1N0VC 3WU6A 1MU5A 1Y8PA 4JQLA 4MP2A 1USUA 2VQEI 3ZKBA 1IBLE 4URNA 2Q8GA 2BSMA 3CGYA 4JAVA 4XE2A 2BM0A 4K0KI 2XDXA 1GKZA 2OI2A 2VCJA 3MNRP 4LF7E 3TZ5A 2V2QA 1ZM4A 4R3MA 1UYCA 4JI2E 4CWPA 4JI7E 4DPXA 2UXBI 4HXWA 4DR5E 4XIRA 4YHHE 4DV0I 3R91A 1Z0EA 4JI8E 4KP4A 2YK2A 4DV7E 3B24A 4X66I 4I5SA 3CRKA 4CWSA 2BYIA 1L0OA 3SL2A 4IZKA 3RKZA 2AJ4A 2JKIA 4B3SI 4MPEA 4NH9A 4FWHA 4LP0A 5LMNE 2XHRA 1B63A 2V2VA 2YEJA 2QG2A 4AQYE 3HZ5A 4MOTA 1ZWHA 1US7A 1TC0A 4LF4I 1FKAE 1AMWA 2PNLA 4XIQA 2Z5BA 4P7AA 4ED4A 3EKOA 4JI1I 3O2FA 2DEJA 3B25A 1Z0TA 3B8HA 4MYTA 3WU4A 4YKYA 4CWNA 2WEPA 3PEHA 4DPTA 1Z0BA 2QF6A 3R4PA 1Y4SA 3EHFA 4LFCE 4R1FA 4DV5E 5F5RA 4ZKIA 5BR8E 1H74A 4DV6E 1RR9A 2ZM6E 4P8OA 2YE2A 3RLRA 4DU7A 4USMA 5IT9Q 3OWBA 1UY9A 2VWCA 5GMEA 3B28A 4L93A 3B78A 2IWUA 3CGZA 4X65I 3V2UC 4CWTA 3R92A 2VQFI 4B3ME 4LWEA 4LF6E 3LTOA 3NMQA 1DARA 4L94A 2XDKA 4HYMA 4FMTA 4EM7A 2UXCI 3PYEA 3A0TA 3B26A 4YKRA 5D7CA 2Z5CB 5M4NA 1NHHA 3EHJA 4DV3I 4OX9I 3ZKDA 4JAUA 1XNRI 1GJVA 1VISA 2IOPA 2X36A 5GMDA 1PKPA 2PNMA 3Q6NA 1HNXI 2IOQA 5LMUE 2UXDI 4YKUA 3TZ4A 4UROA 5J71A 2YGAA 2VW5A 4DR1I 3QTFA 4N3OA 4X64E 4HACA 1N33E 2WW4A 3R4NA 2R42A 4DR7E 4DUYI 4FCPA 1S16A 4CWOA 4DV1E 3CRLA 1AM1A 2Q2EB 3EHGA 2WI7A 3GIFA 1NHJA 2UUAE 1BYQA 3H80A 3ZZ0A 4DV2I 4XC0A 3T1HE 2Q8HA 1ZM9A 4B3TI 1HK7A 3LNUA 4AQYI 4JYAI 1ID0A 2IWSA 4CE1A 1XHKA 4DR4E 2YEHA 4X62E 4H7QA 1UY6A 3TZ0A 2XEXA 3U2KA 4JV5E 4ASGA 2YKCA 1U0ZA 2XDSA 3T10A 5D6QA 2JJCA 1FWKA 4LWFA 1Y6ZA 3A0XA 4LPBA 4O04A 4FW9A 4UT4A 1HNWI 2YGFA 3WHAA 4MPCA 3U2DA 4L8ZA 4NXMI 2J7KA 4FN5A 4JI0I 2YE8A 1XMQI 2XX2A 1YS3A 2E5LI 3O0IA 4MP7A 2ESAA 2CGEA 2HKJA 4RPFA 2K5BA 3KE6A 2YI5A 3OWDA 3J80C 1TC6A 4FWDA 4WUCA 2YE3A 4YKTA 4JASA 2CH4A 3RLPA 4XTJA 2F4VI 5IWAE 4ASFA 2UUBE 4GKJI 2XDUA 5J6AA 2UUCI 5A2QC 4GFNA 1Z0VA 3D2RA 4LF9E 4B7PA 3HEKA 2CGFA 4XDMA 3A0YA 2V2ZA 4M1KA 2NPFA 4MB9A 2UU9E 1IBMI 1H73A 1IBKI 3DGEA 2WI2A 4YKWA 4NH7A 3FT5A 1N36E 4HXZA 5FLXQ 4DV4I 2XJXA 4AWPA 4EMDA 1QZRA 4DR2I 4EFUA 2YKJA 2UWDA 4PU9A 1N33I 2YGEA 2YKEA 2XCMA 2CZ9A 4B3RE 4DR6I 1XMOE 2FWYA 4BQJA 4XKKA 1UYLA 1BGQA 4E00A 2YEBA 4LWHA 4V25A 4EGKA 1H72C 3Q5JA 3HJCA 1N34E 4O07A 2Z5CA 4GT8A 4GKKI 2WEQA 3OTOE 4DUHA 1NZ0A 1ZXNA 1BKNA 4Z7YA 1UY8A 4QPJA 4MBCA 3JAMQ 4GQTA 2YI7A 4IZJD 2YEIA 1XNQE 5LL6R 4YY3E 3VHCA 4NXNI 4LFBI 1TBWA 1U2OA 1Z0CA 2HG1A 2BU2A 4JI5E 3WU3A 1N32I 1UYFA 4XD8A 1UYMA 1TH8A 4KQVA 4JI3E 1YETA 4KHPI 4ASAA 3K97A 1U2RA 2HFSA 4DR3I 3ZM7A 3HHUA 3RLQA 4PRVA 3Q5LA 4FWGA 2YE6A 4BQGA 3GIEA 4JI4E 4LF5E 3T1YI 3EHHA 3TUHA 2VCIA 2HHHE 4LF8E 1FI4A 2BM1A 4IZJB 2BU7A 2HCHA 3PEJA 2YE7A 1HR0E 2Q8IA 5IDMA 2FYPA 1IBLI 1YSRA 2GFDA 4I3HA 1I5AA 4PL9A 3WU5A 5CTUA 4U93A 2E1RA 4LFAE 4O0BA 1H7SA 1FJGE 1UYDA 4LF7I 1H7UA 4JI2I 2H8MA 2YI0A 1AH8A 2XD6A 3FV5A 4JI7I 3V5RA 4DR5I 2FXSA 4YHHI 2YJWA 1KZNA 2V34A 4JI8I 2CCTA 2H55A 1HNZE 1YC1A 4DV7I 1MX0A 2BRCA 4V26A 4XITA 3QT6A 5IN9A 4KTNA 4GEEA 3FT8A 3J81Q 3HYYA 2C2AA 4H85A 4HY1A 1YT1A 4FPPA 4QPKA 2VQEE 4NH8A 3JZ3A 5LMNI 5M4HA 4HZ5A 2GQPA 1PIEA 1J5EE 5CTWA 4K0KE 2ZDYA 3B27A 3Q1QA 5IDJA 3D36A 5FNDA 1YERA 4WUDA 1I59A 1B3QA 1ZW9A 2YEGA 4YKXA 3VHDA 3IEDA 4E02A 2UXBE 3INWA 4Q20A 4DV0E 1THNA 3ZXOA 2YE4A 1B62A 2YECA 4X66E 3TZ2A 3ZZTA 2XDLA 3HYZA 3Q5KA 1I94E 5CPHA 3K60A 1WUUA 4ZVIA 4LFCI 1R62A 4DPUA 3TTZA 2IWXA 1YSZA 5D7RA 3K1JA 4DV5I 4B3SE 3T0ZA 5BR8I 4X9LA 4DV6I 5IT9C 2BT0A 2ZM6I 1N0UA 4E01A 3WQ9A 3VADA 2YKIA 1YC4A 2XX4A 4KSHA 4DU8A 3PRYA 2YJXA 4BAEA 1KKHA 4LWIA 3QT7A 1UEKA 4EMVA 2GS8A 4LF4E 1UYHA 3T0HA 1Z5CA 1FWLA 4JI4I 4H81A 2XHXA 4KSGA 5D7DA 4JI1E 1UY7A 3K99A 4B3MI 3M6AA 1OSFA 4LF6I 2YE5A 2YE9A 2A2DA 5D6PA 5F3KA 3D4JA 1A6FA 2O1TA 5L3JA 1S4EA 1EA6A 4DXLA 2O1VA 1I5DA 1GKXA 3T2SA 1I5BA 3VHAA 5M4KA 4DPWA 1PVGA 5LMUI 3J7AM 1EI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIL A;  2XJJ A;  1MG7 A;  4CE3 A;  1AH6 A;  2YEA A;  4DUZ E;  4JI6 E;  3C0E A;  3D0B A;  4URM A;  1A4H A;  2ZKJ A;  5CF0 A;  4X64 I;  3PYD A;  4X65 E;  1QYE A;  5CTY A;  2WI4 A;  4DR7 I;  4R3A A;  1YT2 A;  4BIU A;  4DV1 I;  2VQF E;  3O6O A;  3GON A;  2HKE A;  2WER A;  2QG0 A;  1Y8O A;  3LPS A;  1ELO A;  2UUA I;  2UXC E;  1QY8 A;  2YEE A;  3R4O A;  1ZXM A;  3T1H I;  3G7B A;  4DV3 E;  4OX9 E;  4K4O A;  4XKA A;  1J5E I;  1XNR E;  4L91 A;  3QT8 A;  2CCS A;  2BZ5 A;  4DR4 I;  2LJP A;  4BIZ A;  2BU6 A;  4X62 I;  1HNX E;  2UXD E;  4O05 A;  3ZXQ A;  5BOD A;  3F0N A;  4JV5 I;  4URL A;  2A2C A;  4DR1 E;  4LWG A;  4HZ0 A;  1UYG A;  2FWZ A;  5C93 A;  4EGI A;  4DUY E;  4DZY A;  2VF3 A;  5GGZ A;  4O09 A;  2XJG A;  2HK2 A;  3BMY A;  2ZIT A;  1I94 I;  5FWK A;  4ASB A;  4GCZ A;  2AKP A;  2CG9 A;  1OJ4 A;  2YED A;  3HZ1 A;  4AS9 A;  5BOC A;  2HK3 A;  4DV2 E;  2E0A A;  4HYP A;  4CE2 A;  4B3T E;  4JYA E;  1BXD A;  4KFG A;  4Z7C A;  4PRX A;  2YK9 A;  3GIG B;  4USK A;  1UYE A;  1Y4U A;  5IWA I;  2WI3 A;  4CWR A;  2UUB I;  1YC3 A;  1Z0W A;  2BRE A;  4AWO A;  1D6T A;  1HNW E;  2WI1 A;  1KTV A;  4LF9 I;  4EEH A;  5FNF A;  1NHI A;  4NXM E;  3C11 A;  4W7T A;  3J7A G;  2UU9 I;  4JI0 E;  2YEF A;  1XMQ E;  3ZZU A;  2WI6 A;  5FLX C;  3T1K A;  2E5L E;  3OW6 A;  4GGL A;  3QDD A;  3OPD A;  1K47 A;  1N36 I;  4P52 A;  2BTZ A;  2HFU A;  3PYF A;  4JG4 A;  2CCU A;  4AWQ A;  1TID A;  4XIP A;  4DUZ I;  4JI6 I;  1AJ6 A;  3J80 Q;  2F4V E;  1RRE A;  4DPY A;  2WI5 A;  2ZBK B;  2BV3 A;  4B3R I;  4GKJ E;  2EFG A;  3R4M A;  2UUC E;  1XMO I;  5CTX A;  1ZM2 A;  4XCJ A;  4CWQ A;  5A2Q Q;  1FNM A;  3K98 A;  4EFT A;  2BYH A;  3A0Z A;  3OMU A;  1IBM E;  1YES A;  1IBK E;  1Z59 A;  1UYI A;  1N34 I;  3EKR A;  2YKB A;  1Z5B A;  3QT5 A;  4DV4 E;  1JM6 A;  3OTO I;  3JAM C;  4DR2 E;  1KVK A;  1Y8N A;  4CWF A;  3A0R A;  3INX A;  2IOR A;  2EXL A;  2YI6 A;  2QFO A;  4DR6 E;  1XNQ I;  4YY3 I;  5FNC A;  4JI5 I;  3CWV A;  2XAB A;  4MPN A;  4U7N A;  2PNR A;  1S14 A;  4EGH A;  4JI3 I;  4HY6 A;  3G75 A;  3HUL A;  4YKZ A;  4FCQ A;  4GKK E;  1UYK A;  4XKO A;  3BM9 A;  4LF5 I;  3G7E A;  2HHH I;  1Z0G A;  4LF8 I;  2X7I A;  4YKQ A;  3U67 A;  4MYU A;  2XX5 A;  2XHT A;  2XK2 A;  2BU5 A;  2Q8F A;  1HR0 I;  1ZM3 A;  5M4P A;  1I5C A;  1KIJ A;  5M4M A;  4NXN E;  4LFB E;  4FCR A;  2DEI A;  2R3V A;  5M4E A;  1N32 E;  4LFA I;  4XCL A;  1FJG I;  2V8P A;  4HAC B;  4KHP E;  3K17 A;  2ZDX A;  3B82 A;  2BU8 A;  4DR3 E;  2O1U A;  4UTG A;  1YT0 A;  4B6C A;  4BXI A;  1Z5A A;  3PYG A;  3H4L A;  2O1W A;  1HNZ I;  4U7O A;  4WUB A;  3T1Y E;  4L90 A;  3A0W A;  3J81 C;  3GIG A;  1I58 A;  1N0V C;  3WU6 A;  1MU5 A;  1Y8P A;  4JQL A;  4MP2 A;  2VQE I;  3ZKB A;  1IBL E;  4URN A;  2Q8G A;  2BSM A;  3CGY A;  4JAV A;  4XE2 A;  2BM0 A;  4K0K I;  2XDX A;  1GKZ A;  2OI2 A;  2VCJ A;  3MNR P;  4LF7 E;  3TZ5 A;  2V2Q A;  1ZM4 A;  4R3M A;  1UYC A;  4JI2 E;  4CWP A;  4JI7 E;  4DPX A;  2UXB I;  4HXW A;  4DR5 E;  4XIR A;  4YHH E;  4DV0 I;  3R91 A;  1Z0E A;  4JI8 E;  4KP4 A;  2YK2 A;  4DV7 E;  3B24 A;  4X66 I;  4I5S A;  3CRK A;  4CWS A;  2BYI A;  1L0O A;  3SL2 A;  3RKZ A;  2AJ4 A;  2JKI A;  4B3S I;  4MPE A;  4NH9 A;  4FWH A;  4LP0 A;  5LMN E;  2XHR A;  1B63 A;  2V2V A;  2YEJ A;  2QG2 A;  4AQY E;  3HZ5 A;  4MOT A;  1ZWH A;  1US7 A;  1TC0 A;  4LF4 I;  1FKA E;  1AMW A;  4XIQ A;  4P7A A;  4ED4 A;  3EKO A;  4JI1 I;  3O2F A;  2DEJ A;  3B25 A;  1Z0T A;  3B8H A;  4MYT A;  3WU4 A;  4YKY A;  4CWN A;  2WEP A;  3PEH A;  4DPT A;  1Z0B A;  2QF6 A;  3R4P A;  1Y4S A;  3EHF A;  4LFC E;  4R1F A;  4DV5 E;  5F5R A;  4ZKI A;  5BR8 E;  1H74 A;  4DV6 E;  1RR9 A;  2ZM6 E;  4P8O A;  2YE2 A;  3RLR A;  4DU7 A;  4USM A;  5IT9 Q;  3OWB A;  1UY9 A;  2VWC A;  5GME A;  3B28 A;  4L93 A;  3B78 A;  2IWU A;  3CGZ A;  4X65 I;  3V2U C;  4CWT A;  3R92 A;  2VQF I;  4B3M E;  4LWE A;  4LF6 E;  3LTO A;  3NMQ A;  1DAR A;  4L94 A;  2XDK A;  4HYM A;  4FMT A;  4EM7 A;  2UXC I;  3PYE A;  3A0T A;  3B26 A;  4YKR A;  5D7C A;  5M4N A;  1NHH A;  3EHJ A;  4DV3 I;  4OX9 I;  3ZKD A;  4JAU A;  1XNR I;  1GJV A;  1VIS A;  2X36 A;  2IOP A;  5GMD A;  1PKP A;  1HNX I;  5LMU E;  2UXD I;  2IOQ A;  4YKU A;  3TZ4 A;  4URO A;  5J71 A;  2YGA A;  2VW5 A;  4DR1 I;  3QTF A;  4X64 E;  4HAC A;  1N33 E;  2WW4 A;  3R4N A;  2R42 A;  4DR7 E;  4DUY I;  4FCP A;  1S16 A;  4CWO A;  4DV1 E;  3CRL A;  1AM1 A;  2Q2E B;  3EHG A;  2WI7 A;  3GIF A;  1NHJ A;  2UUA E;  1BYQ A;  3H80 A;  3ZZ0 A;  4DV2 I;  4XC0 A;  3T1H E;  2Q8H A;  1ZM9 A;  4B3T I;  3LNU A;  4AQY I;  4JYA I;  1ID0 A;  2IWS A;  4CE1 A;  1XHK A;  4DR4 E;  2YEH A;  4X62 E;  4H7Q A;  1UY6 A;  3TZ0 A;  2XEX A;  3U2K A;  4JV5 E;  4ASG A;  2YKC A;  1U0Z A;  2XDS A;  3T10 A;  5D6Q A;  2JJC A;  1FWK A;  4LWF A;  3A0X A;  4LPB A;  4O04 A;  4FW9 A;  4UT4 A;  1HNW I;  2YGF A;  3WHA A;  4MPC A;  3U2D A;  4L8Z A;  4NXM I;  2J7K A;  4FN5 A;  4JI0 I;  2YE8 A;  1XMQ I;  2XX2 A;  1YS3 A;  2E5L I;  3O0I A;  4MP7 A;  2ESA A;  2HKJ A;  4RPF A;  2K5B A;  3KE6 A;  2YI5 A;  3OWD A;  3J80 C;  1TC6 A;  4FWD A;  4WUC A;  2YE3 A;  4YKT A;  4JAS A;  2CH4 A;  3RLP A;  4XTJ A;  2F4V I;  5IWA E;  4ASF A;  2UUB E;  4GKJ I;  2XDU A;  5J6A A;  2UUC I;  5A2Q C;  4GFN A;  1Z0V A;  3D2R A;  4LF9 E;  4B7P A;  3HEK A;  2CGF A;  4XDM A;  3A0Y A;  2V2Z A;  4M1K A;  2NPF A;  4MB9 A;  2UU9 E;  1IBM I;  1H73 A;  1IBK I;  3DGE A;  2WI2 A;  4YKW A;  4NH7 A;  3FT5 A;  1N36 E;  4HXZ A;  5FLX Q;  4DV4 I;  2XJX A;  4AWP A;  4EMD A;  1QZR A;  4DR2 I;  4EFU A;  2YKJ A;  2UWD A;  4PU9 A;  1N33 I;  2YGE A;  2YKE A;  2XCM A;  2CZ9 A;  4B3R E;  4DR6 I;  1XMO E;  2FWY A;  4BQJ A;  4XKK A;  1UYL A;  1BGQ A;  4E00 A;  2YEB A;  4LWH A;  4V25 A;  4EGK A;  1H72 C;  3Q5J A;  1N34 E;  4O07 A;  4GT8 A;  4GKK I;  2WEQ A;  3OTO E;  4DUH A;  1NZ0 A;  1ZXN A;  1BKN A;  4Z7Y A;  1UY8 A;  4QPJ A;  4MBC A;  3JAM Q;  4GQT A;  2YI7 A;  2YEI A;  1XNQ E;  5LL6 R;  4YY3 E;  3VHC A;  4NXN I;  4LFB I;  1TBW A;  1U2O A;  1Z0C A;  2HG1 A;  2BU2 A;  4JI5 E;  3WU3 A;  1N32 I;  1UYF A;  4XD8 A;  1UYM A;  1TH8 A;  4KQV A;  4JI3 E;  1YET A;  4KHP I;  4ASA A;  3K97 A;  1U2R A;  2HFS A;  4DR3 I;  3ZM7 A;  3HHU A;  3RLQ A;  4PRV A;  3Q5L A;  4FWG A;  2YE6 A;  4BQG A;  3GIE A;  4JI4 E;  4LF5 E;  3T1Y I;  3EHH A;  3TUH A;  2VCI A;  2HHH E;  4LF8 E;  1FI4 A;  2BM1 A;  2BU7 A;  2HCH A;  3PEJ A;  2YE7 A;  1HR0 E;  2Q8I A;  5IDM A;  2FYP A;  1IBL I;  1YSR A;  2GFD A;  4I3H A;  1I5A A;  4PL9 A;  3WU5 A;  5CTU A;  4U93 A;  2E1R A;  4LFA E;  4O0B A;  1H7S A;  1FJG E;  1UYD A;  4LF7 I;  1H7U A;  4JI2 I;  2H8M A;  2YI0 A;  1AH8 A;  2XD6 A;  3FV5 A;  4JI7 I;  3V5R A;  4DR5 I;  2FXS A;  4YHH I;  2YJW A;  1KZN A;  2V34 A;  4JI8 I;  2CCT A;  2H55 A;  1HNZ E;  1YC1 A;  4DV7 I;  1MX0 A;  2BRC A;  4V26 A;  4XIT A;  3QT6 A;  5IN9 A;  4KTN A;  4GEE A;  3FT8 A;  3J81 Q;  3HYY A;  2C2A A;  4H85 A;  4HY1 A;  1YT1 A;  4FPP A;  4QPK A;  2VQE E;  4NH8 A;  3JZ3 A;  5LMN I;  5M4H A;  4HZ5 A;  2GQP A;  1PIE A;  1J5E E;  5CTW A;  4K0K E;  2ZDY A;  3B27 A;  3Q1Q A;  5IDJ A;  3D36 A;  5FND A;  1YER A;  4WUD A;  1I59 A;  1B3Q A;  1ZW9 A;  2YEG A;  4YKX A;  3VHD A;  3IED A;  4E02 A;  2UXB E;  3INW A;  4Q20 A;  4DV0 E;  1THN A;  3ZXO A;  2YE4 A;  1B62 A;  2YEC A;  4X66 E;  3TZ2 A;  3ZZT A;  2XDL A;  3HYZ A;  3Q5K A;  1I94 E;  5CPH A;  3K60 A;  1WUU A;  4ZVI A;  4LFC I;  1R62 A;  4DPU A;  3TTZ A;  2IWX A;  1YSZ A;  5D7R A;  3K1J A;  4DV5 I;  4B3S E;  3T0Z A;  5BR8 I;  4X9L A;  4DV6 I;  5IT9 C;  2BT0 A;  2ZM6 I;  1N0U A;  4E01 A;  3WQ9 A;  3VAD A;  2YKI A;  1YC4 A;  2XX4 A;  4KSH A;  4DU8 A;  2YJX A;  4BAE A;  1KKH A;  4LWI A;  3QT7 A;  1UEK A;  4EMV A;  2GS8 A;  4LF4 E;  1UYH A;  3T0H A;  1Z5C A;  1FWL A;  4JI4 I;  4H81 A;  2XHX A;  4KSG A;  5D7D A;  4JI1 E;  1UY7 A;  3K99 A;  4B3M I;  3M6A A;  1OSF A;  4LF6 I;  2YE5 A;  2YE9 A;  2A2D A;  5D6P A;  5F3K A;  3D4J A;  1A6F A;  5L3J A;  1S4E A;  1EA6 A;  4DXL A;  2O1V A;  1I5D A;  1GKX A;  3T2S A;  1I5B A;  3VHA A;  5M4K A;  4DPW A;  1PVG A;  5LMU I;  3J7A M;  1EI1 A; 
#chains in the Genus database with same CATH topology
 1TIL A;  2XJJ A;  1MG7 A;  4CE3 A;  2BA0 G;  3P3E A;  5JEA C;  2PO1 A;  4DUZ E;  4JI6 E;  1AH6 A;  2YEA A;  3C0E A;  3D0B A;  1A4H A;  2ZKJ A;  4LCG A;  4X64 I;  4IFD C;  3PYD A;  5CF0 A;  5JEN A;  4X65 E;  1QYE A;  5CTY A;  2WI4 A;  4DR7 I;  4R3A A;  1YT2 A;  4BIU A;  4DV1 I;  2VQF E;  3P06 A;  3O6O A;  3GON A;  2HKE A;  2WER A;  2QG0 A;  1Y8O A;  3LPS A;  1ELO A;  2UUA I;  5C0X E;  2UXC E;  1QY8 A;  2C37 A;  2YEE A;  3R4O A;  1ZXM A;  4IZJ A;  4BA1 B;  3T1H I;  3G7B A;  4DV3 E;  4OX9 E;  4K4O A;  4XKA A;  1J5E I;  1XNR E;  4L91 A;  3QT8 A;  3UHM A;  2BZ5 A;  1OYP A;  2CCS A;  4DR4 I;  2LJP A;  4BIZ A;  2BU6 A;  4X62 I;  1HNX E;  1RHY A;  4AM3 A;  2UXD E;  4O05 A;  3ZXQ A;  3F0N A;  4JV5 I;  4URL A;  2Z5E A;  5BOD A;  2A2C A;  2BA0 D;  4DR1 E;  4LWG A;  4HZ0 A;  4MU0 A;  1UYG A;  2FWZ A;  5C93 A;  4EGI A;  4DUY E;  2PNZ B;  4DZY A;  2VF3 A;  5GGZ A;  4O09 A;  2XJG A;  2HK2 A;  3PS2 A;  2PO2 A;  2ZIT A;  5EL9 A;  5FWK A;  1I94 I;  3BMY A;  4GCZ A;  2CG9 A;  5C0X C;  2AKP A;  4ASB A;  1OJ4 A;  2YED A;  3HZ1 A;  4AS9 A;  1USV A;  5BOC A;  2HK3 A;  4DV2 E;  2E0A A;  4HYP A;  4CE2 A;  4B3T E;  4JYA E;  1BXD A;  4KFG A;  4Z7C A;  4PRX A;  2YK9 A;  3GIG B;  4USK A;  1UYE A;  2C38 B;  1Y4U A;  2NN6 A;  5IWA I;  2WI3 A;  4CWR A;  2UUB I;  1YC3 A;  1Z0W A;  2BRE A;  5K36 A;  4AWO A;  2C37 B;  3B4T A;  1D6T A;  1HNW E;  2WI1 A;  2WP8 B;  1KTV A;  4LF9 I;  4EEH A;  5FNF A;  1NHI A;  4NXM E;  3C11 A;  4W7T A;  3J7A G;  2UU9 I;  4JI0 E;  2YEF A;  4OO1 F;  1XMQ E;  3ZZU A;  2WI6 A;  5FLX C;  3T1K A;  2E5L E;  3OW6 A;  4GGL A;  3QDD A;  3LMM A;  4AIM A;  1IXM A;  3OPD A;  1K47 A;  1N36 I;  4MQY A;  4P52 A;  2NN6 D;  2HFU A;  3PYF A;  4JG4 A;  2BTZ A;  2CCU A;  1TID A;  4AWQ A;  4XIP A;  4DUZ I;  4JI6 I;  3M7N D;  5K36 D;  1AJ6 A;  4FW3 A;  1Y60 A;  3J80 Q;  4IZK B;  2F4V E;  1RRE A;  4DPY A;  2WI5 A;  2ZBK B;  2BV3 A;  4B3R I;  4GKJ E;  2EFG A;  3K85 A;  4OZE A;  2C39 B;  2UUC E;  3R4M A;  1XMO I;  5CTX A;  1ZM2 A;  4XCJ A;  4CWQ A;  5A2Q Q;  1FNM A;  3K98 A;  4EFT A;  2BYH A;  4IS9 A;  3A0Z A;  3OMU A;  1IBM E;  1YES A;  1IBK E;  1Z59 A;  4E72 A;  2NN6 B;  2Z5B B;  1N34 I;  1UYI A;  3EKR A;  2YKB A;  1Z5B A;  3QT5 A;  4DV4 E;  1JM6 A;  3OTO I;  3JAM C;  4DR2 E;  1KVK A;  1Y8N A;  4CWF A;  5K36 C;  1VI7 A;  3A0R A;  3INX A;  2IOR A;  5ELW A;  5EKW A;  2EXL A;  2YI6 A;  2QFO A;  4DR6 E;  1XNQ I;  4YY3 I;  5FNC A;  4MU4 A;  4JI5 I;  3CWV A;  1R6L A;  2XAB A;  4MPN A;  4U7N A;  4IFD F;  2PNR A;  3P76 A;  1S14 A;  4EGH A;  4JI3 I;  4HY6 A;  3G75 A;  2BR2 A;  2O3Z A;  3HUL A;  4YKZ A;  4FCQ A;  2GQ0 A;  3HKM A;  4BA1 A;  4GKK E;  1UYK A;  5JEA E;  4XKO A;  3BM9 A;  4LF5 I;  3G7E A;  1XXE A;  2HHH I;  1OYS A;  1Z0G A;  4LF8 I;  2X7I A;  4YKQ A;  3U67 A;  4MYU A;  2XX5 A;  2XHT A;  2XK2 A;  2BU5 A;  2Q8F A;  1HR0 I;  1ZM3 A;  5M4P A;  1I5C A;  1KIJ A;  2IER A;  2JEB B;  5M4M A;  4NXN E;  3DD6 A;  3KRN A;  4LFB E;  4FCR A;  2DEI A;  2R3V A;  5M4E A;  2PNZ A;  1N32 E;  2AE8 A;  4LFA I;  1YH8 A;  3U1Y A;  3M85 G;  4XCL A;  1FJG I;  2V8P A;  4HAC B;  4KHP E;  3K17 A;  2ZDX A;  3B82 A;  1OYR A;  4DR3 E;  2BU8 A;  2O1U A;  4UTG A;  1YT0 A;  3Q6M A;  4J3D A;  4B6C A;  1Z5A A;  3PYG A;  5C0X F;  2O1W A;  3H4L A;  4BXI A;  1HNZ I;  4U7O A;  4WUB A;  3T1Y E;  4L90 A;  3A0W A;  3J81 C;  3GIG A;  1I58 A;  1N0V C;  3WU6 A;  2C38 A;  1MU5 A;  1Y8P A;  4JQL A;  4MP2 A;  2BR2 B;  1USU A;  2VQE I;  3ZKB A;  1IBL E;  4URN A;  4QNK A;  2Q8G A;  1UDQ A;  2WP8 A;  2BSM A;  3CGY A;  4JAV A;  2BM0 A;  4XE2 A;  4K0K I;  2XDX A;  1GKZ A;  3R91 A;  2OI2 A;  2VCJ A;  4IFD B;  4LF7 E;  3MNR P;  2V2Q A;  1ZM4 A;  4R3M A;  1UYC A;  4JI2 E;  3TZ5 A;  4CWP A;  4JI7 E;  4DPX A;  2UXB I;  4HXW A;  4DR5 E;  4XIR A;  4YHH E;  5DRQ A;  4DV0 I;  1Z0E A;  3NZK A;  4JI8 E;  4KP4 A;  2YK2 A;  2CVE A;  4DV7 E;  3B24 A;  4X66 I;  4I5S A;  3CRK A;  3U1K A;  4CWS A;  2BYI A;  1L0O A;  3SL2 A;  4IZK A;  1R6M A;  3RKZ A;  2AJ4 A;  2JKI A;  4B3S I;  4MPE A;  4NH9 A;  4FWH A;  4LP0 A;  2C39 A;  5LMN E;  2XHR A;  1B63 A;  4FW6 A;  2V2V A;  2YEJ A;  2QG2 A;  4AQY E;  3HZ5 A;  4MOT A;  1ZWH A;  2BA1 G;  1US7 A;  1TC0 A;  4LF4 I;  1FKA E;  1AMW A;  2PNL A;  4XIQ A;  2Z5B A;  4P7A A;  4ED4 A;  3EKO A;  4JI1 I;  3O2F A;  2DEJ A;  3B25 A;  1Z0T A;  3B8H A;  4MYT A;  3WU4 A;  4YKY A;  4CWN A;  1Y5Y A;  2WEP A;  3PEH A;  4DPT A;  1Z0B A;  2QF6 A;  4NBQ A;  1Y4S A;  3R4P A;  3EHF A;  4LFC E;  4R1F A;  4DV5 E;  4LCH A;  5F5R A;  4ZKI A;  5BR8 E;  1H74 A;  4DV6 E;  1RR9 A;  2ZM6 E;  5K36 F;  4P8O A;  2YE2 A;  4OKG A;  5DRO A;  3RLR A;  4DU7 A;  4USM A;  5IT9 Q;  3OWB A;  1UY9 A;  2VWC A;  5GME A;  3B28 A;  4L93 A;  3B78 A;  2IWU A;  2NN6 E;  3CGZ A;  1UDS A;  3CYG A;  2PO0 B;  4X65 I;  5K36 E;  3V2U C;  3S5T A;  4LCF A;  4CWT A;  3R92 A;  2VQF I;  5DRP A;  4B3M E;  4LF6 E;  3LTO A;  3NMQ A;  4LWE A;  1DAR A;  4L94 A;  2XDK A;  4URM A;  4HYM A;  4FMT A;  4EM7 A;  2UXC I;  3PYE A;  3A0T A;  3B26 A;  4YKR A;  5D7C A;  2Z5C B;  5M4N A;  1NHH A;  3EHJ A;  4DV3 I;  4OX9 I;  3ZKD A;  4JAU A;  1XNR I;  1GJV A;  1VIS A;  2IOP A;  2X36 A;  2JEB A;  5GMD A;  1PKP A;  2PNM A;  3Q6N A;  1HNX I;  2IOQ A;  5LMU E;  4OO1 D;  2UXD I;  4YKU A;  3TZ4 A;  4URO A;  2C1G A;  5J71 A;  2YGA A;  2VW5 A;  2NN6 C;  4DR1 I;  3QTF A;  4N3O A;  4X64 E;  4HAC A;  1N33 E;  2WW4 A;  3CDI A;  3R4N A;  2R42 A;  4DR7 E;  4DUY I;  4FCP A;  1S16 A;  4CWO A;  4DV1 E;  3CRL A;  1AM1 A;  2Q2E B;  3EHG A;  2WI7 A;  3GIF A;  1NHJ A;  2UUA E;  5JEA F;  1BYQ A;  3H80 A;  4LPF A;  3ZZ0 A;  4DV2 I;  4XC0 A;  3T1H E;  2Q8H A;  1ZM9 A;  4B3T I;  1HK7 A;  3LNU A;  4AQY I;  4JYA I;  1ID0 A;  2IWS A;  4OO1 B;  4CE1 A;  1XHK A;  4DR4 E;  2YEH A;  4GQU A;  4X62 E;  4H7Q A;  1UY6 A;  3TZ0 A;  2XEX A;  4FW4 A;  4JV5 E;  3U2K A;  4ASG A;  2YKC A;  1U0Z A;  2XDS A;  3T10 A;  5D6Q A;  2JJC A;  1FWK A;  4IFD A;  4LWF A;  1Y6Z A;  3A0X A;  4LPB A;  4O04 A;  3GCM A;  3GLL A;  4FW9 A;  4UT4 A;  1HNW I;  2YGF A;  3WHA A;  4MPC A;  3U2D A;  4L8Z A;  4NXM I;  2J7K A;  4FN5 A;  4JI0 I;  2YE8 A;  1XMQ I;  2XX2 A;  1YS3 A;  2E5L I;  3O0I A;  4MP7 A;  2ESA A;  2IES A;  2CGE A;  2HKJ A;  4RPF A;  4QNJ A;  1E3P A;  2K5B A;  3KE6 A;  2YI5 A;  3OWD A;  3J80 C;  1TC6 A;  4FWD A;  4U3B A;  4WUC A;  4IFD D;  2YE3 A;  4JAS A;  4YKT A;  2CH4 A;  3RLP A;  2F1D A;  1P42 A;  3L7Z B;  4XTJ A;  2F4V I;  4AID A;  5IWA E;  4LOM A;  4ASF A;  2UUB E;  4GKJ I;  2XDU A;  5J6A A;  2UUC I;  5A2Q C;  4GFN A;  1Z0V A;  3D2R A;  4LF9 E;  2WNR B;  4B7P A;  3HEK A;  2CGF A;  2JT2 A;  4XDM A;  3A0Y A;  2V2Z A;  4M1K A;  2NPF A;  4MB9 A;  2UU9 E;  1IBM I;  1H73 A;  1IBK I;  3DGE A;  2WI2 A;  4YKW A;  4NH7 A;  3FT5 A;  5JEA B;  3M85 D;  2JEA B;  1N36 E;  4HXZ A;  5FLX Q;  4DV4 I;  2XJX A;  4AWP A;  4EMD A;  1QZR A;  2JE6 B;  4DR2 I;  3H1C A;  4EFU A;  2YKJ A;  2UWD A;  4PU9 A;  1N33 I;  2YGE A;  2YKE A;  2XCM A;  2CZ9 A;  4B3R E;  4DR6 I;  5C0X D;  1F51 A;  1XMO E;  2FWY A;  4BQJ A;  4XKK A;  1UYL A;  2PO0 A;  1BGQ A;  4E00 A;  1UDN A;  2HHI A;  2YEB A;  4BA2 B;  4LWH A;  3P3G A;  4V25 A;  4EGK A;  1H72 C;  3Q5J A;  3HJC A;  2FTK A;  1N34 E;  4O07 A;  2Z5C A;  4GT8 A;  4GKK I;  2WEQ A;  3OTO E;  4DUH A;  1NZ0 A;  1ZXN A;  1BKN A;  4Z7Y A;  1UY8 A;  4QPJ A;  4MBC A;  3JAM Q;  5C0X B;  4GQT A;  2YI7 A;  4ISA A;  4IZJ D;  2YEI A;  1XNQ E;  5LL6 R;  4YY3 E;  3VHC A;  4NXN I;  4LFB I;  1TBW A;  1U2O A;  1Z0C A;  4MU1 A;  2GO3 A;  2BU2 A;  2HG1 A;  2NN6 F;  4JI5 E;  3WU3 A;  1N32 I;  2PO1 B;  1UYF A;  4XD8 A;  3GME A;  1UYM A;  1TH8 A;  4KQV A;  4JI3 E;  1YET A;  4KHP I;  4ASA A;  3K97 A;  1U2R A;  2HFS A;  4DR3 I;  3ZM7 A;  3M7N G;  3HHU A;  2BA1 D;  2C1I A;  3RLQ A;  4PRV A;  3Q5L A;  4FWG A;  2YE6 A;  4FW5 A;  3GIE A;  4OO1 A;  4JI4 E;  4LF5 E;  3T1Y I;  3EHH A;  4BQG A;  4FW7 A;  3TUH A;  2VCI A;  2HHH E;  4LF8 E;  1FI4 A;  2BM1 A;  4IZJ B;  2BU7 A;  2HCH A;  3PEJ A;  2YE7 A;  1HR0 E;  2Q8I A;  5IDM A;  3CDJ A;  2FYP A;  1IBL I;  1YSR A;  2GFD A;  4I3H A;  1I5A A;  4PL9 A;  3P3C A;  3WU5 A;  5CTU A;  4U93 A;  2E1R A;  4LFA E;  4O0B A;  1H7S A;  3PS1 A;  1FJG E;  1UYD A;  4LF7 I;  4E02 A;  2GO4 A;  1H7U A;  4JI2 I;  2H8M A;  2YI0 A;  1AH8 A;  2XD6 A;  3FV5 A;  4JI7 I;  3V5R A;  4DR5 I;  2FXS A;  4YHH I;  4OO1 E;  2PO2 B;  2V34 A;  1KZN A;  4JI8 I;  2CCT A;  2YJW A;  2H55 A;  1HNZ E;  1YC1 A;  4DV7 I;  1MX0 A;  2BRC A;  4V26 A;  4XIT A;  3QT6 A;  2VES A;  5IN9 A;  4KTN A;  5DNX A;  4GEE A;  3L7Z A;  3FT8 A;  3J81 Q;  3HYY A;  2C2A A;  4H85 A;  4HY1 A;  1YT1 A;  4FPP A;  4QPK A;  2VQE E;  4NH8 A;  3JZ3 A;  5LMN I;  5M4H A;  4HZ5 A;  2WNR A;  1PIE A;  1J5E E;  2GQP A;  5CTW A;  4K0K E;  2ZDY A;  3B27 A;  3Q1Q A;  5IDJ A;  3D36 A;  5FND A;  5K36 B;  1YER A;  5DRR A;  4WUD A;  1I59 A;  4OO1 C;  1B3Q A;  4MU3 A;  1ZW9 A;  2YEG A;  3IED A;  4YKX A;  5JEA A;  3VHD A;  2UXB E;  3INW A;  4Q20 A;  4DV0 E;  1THN A;  2JEA A;  3ZXO A;  2YE4 A;  1UDO A;  1B62 A;  2JE6 A;  2YEC A;  4X66 E;  3TZ2 A;  3ZZT A;  2XDL A;  3HYZ A;  3Q5K A;  1I94 E;  5CPH A;  3K60 A;  1WUU A;  4ZVI A;  4LFC I;  1R62 A;  4DPU A;  3TTZ A;  2IWX A;  1YSZ A;  5D7R A;  3K1J A;  4DV5 I;  4MDT A;  5DNL A;  4B3S E;  4U3D A;  3T0Z A;  5BR8 I;  4X9L A;  4DV6 I;  5IT9 C;  2BT0 A;  2ZM6 I;  1N0U A;  4E01 A;  3WQ9 A;  3VAD A;  2YKI A;  1YC4 A;  2XX4 A;  4KSH A;  4DU8 A;  3PRY A;  5JEA D;  2YJX A;  4BAE A;  1KKH A;  4LWI A;  3QT7 A;  1UEK A;  4BA2 A;  2GS8 A;  4LF4 E;  4EMV A;  1UYH A;  3T0H A;  3PS3 A;  1Z5C A;  1FWL A;  4JI4 I;  4H81 A;  1E3H A;  2XHX A;  4IFD E;  4KSG A;  5D7D A;  4JI1 E;  1UY7 A;  3K99 A;  4B3M I;  3M6A A;  1OSF A;  4LF6 I;  2YE5 A;  2YE9 A;  2A2D A;  5D6P A;  5F3K A;  3D4J A;  1A6F A;  2O1T A;  5L3J A;  1S4E A;  1EA6 A;  4DXL A;  2O1V A;  5C0X A;  1GKX A;  1I5D A;  1YHC A;  3T2S A;  1I5B A;  3VHA A;  5M4K A;  4DPW A;  2J65 A;  1PVG A;  5LMU I;  3J7A M;  1EI1 A; 
#chains in the Genus database with same CATH homology
 1TIL A;  2XJJ A;  1MG7 A;  4CE3 A;  1AH6 A;  2YEA A;  4DUZ E;  4JI6 E;  3C0E A;  3D0B A;  4URM A;  1A4H A;  2ZKJ A;  5CF0 A;  4X64 I;  3PYD A;  4X65 E;  1QYE A;  5CTY A;  2WI4 A;  4DR7 I;  4R3A A;  1YT2 A;  4BIU A;  4DV1 I;  2VQF E;  3P06 A;  3O6O A;  3GON A;  2HKE A;  2WER A;  2QG0 A;  1Y8O A;  3LPS A;  1ELO A;  2UUA I;  2UXC E;  1QY8 A;  2YEE A;  3R4O A;  1ZXM A;  4IZJ A;  3T1H I;  3G7B A;  4DV3 E;  4OX9 E;  4K4O A;  4XKA A;  1J5E I;  1XNR E;  4L91 A;  3QT8 A;  2CCS A;  2BZ5 A;  4DR4 I;  2LJP A;  4BIZ A;  2BU6 A;  4X62 I;  1HNX E;  2UXD E;  4O05 A;  3ZXQ A;  5BOD A;  3F0N A;  4JV5 I;  4URL A;  2Z5E A;  2A2C A;  4DR1 E;  4LWG A;  4HZ0 A;  1UYG A;  2FWZ A;  5C93 A;  4EGI A;  4DUY E;  4DZY A;  2VF3 A;  5GGZ A;  4O09 A;  2XJG A;  2HK2 A;  3BMY A;  2ZIT A;  1I94 I;  5FWK A;  4ASB A;  4GCZ A;  2CG9 A;  2AKP A;  1OJ4 A;  2YED A;  3HZ1 A;  4AS9 A;  1USV A;  5BOC A;  2HK3 A;  4DV2 E;  2E0A A;  4HYP A;  4CE2 A;  4B3T E;  4JYA E;  1BXD A;  4KFG A;  4Z7C A;  4PRX A;  2YK9 A;  3GIG B;  4USK A;  1UYE A;  1Y4U A;  5IWA I;  2WI3 A;  4CWR A;  2UUB I;  1YC3 A;  1Z0W A;  2BRE A;  4AWO A;  1D6T A;  1HNW E;  2WI1 A;  1KTV A;  4LF9 I;  4EEH A;  5FNF A;  1NHI A;  4NXM E;  3C11 A;  4W7T A;  3J7A G;  2UU9 I;  4JI0 E;  2YEF A;  1XMQ E;  3ZZU A;  2WI6 A;  5FLX C;  3T1K A;  2E5L E;  3OW6 A;  4GGL A;  3QDD A;  3OPD A;  1K47 A;  1N36 I;  4P52 A;  2BTZ A;  2HFU A;  3PYF A;  4JG4 A;  2CCU A;  4AWQ A;  1TID A;  4XIP A;  4DUZ I;  4JI6 I;  1AJ6 A;  3J80 Q;  4IZK B;  2F4V E;  1RRE A;  4DPY A;  2WI5 A;  2ZBK B;  2BV3 A;  4B3R I;  4GKJ E;  2EFG A;  3K85 A;  3R4M A;  2UUC E;  1XMO I;  5CTX A;  1ZM2 A;  4XCJ A;  4CWQ A;  5A2Q Q;  1FNM A;  3K98 A;  4EFT A;  2BYH A;  3A0Z A;  3OMU A;  1IBM E;  1YES A;  1IBK E;  1Z59 A;  2Z5B B;  1N34 I;  1UYI A;  3EKR A;  2YKB A;  1Z5B A;  3QT5 A;  4DV4 E;  1JM6 A;  3OTO I;  3JAM C;  4DR2 E;  1KVK A;  1Y8N A;  4CWF A;  3A0R A;  3INX A;  2IOR A;  2EXL A;  2YI6 A;  2QFO A;  4DR6 E;  1XNQ I;  4YY3 I;  5FNC A;  4JI5 I;  3CWV A;  2XAB A;  4MPN A;  4U7N A;  2PNR A;  1S14 A;  4EGH A;  4JI3 I;  4HY6 A;  3G75 A;  3HUL A;  4YKZ A;  4FCQ A;  2GQ0 A;  4GKK E;  1UYK A;  4XKO A;  3BM9 A;  4LF5 I;  3G7E A;  2HHH I;  1Z0G A;  4LF8 I;  2X7I A;  4YKQ A;  3U67 A;  4MYU A;  2XX5 A;  2XHT A;  2XK2 A;  2BU5 A;  2Q8F A;  1HR0 I;  1ZM3 A;  5M4P A;  1I5C A;  1KIJ A;  5M4M A;  4NXN E;  4LFB E;  4FCR A;  2DEI A;  2R3V A;  5M4E A;  1N32 E;  4LFA I;  4XCL A;  1FJG I;  2V8P A;  4HAC B;  4KHP E;  3K17 A;  2ZDX A;  3B82 A;  2BU8 A;  4DR3 E;  2O1U A;  4UTG A;  1YT0 A;  3Q6M A;  4B6C A;  4BXI A;  1Z5A A;  3PYG A;  2O1W A;  3H4L A;  1HNZ I;  4U7O A;  4WUB A;  3T1Y E;  4L90 A;  3A0W A;  3J81 C;  3GIG A;  1I58 A;  1N0V C;  3WU6 A;  1MU5 A;  1Y8P A;  4JQL A;  4MP2 A;  1USU A;  2VQE I;  3ZKB A;  1IBL E;  4URN A;  2Q8G A;  2BSM A;  3CGY A;  4JAV A;  4XE2 A;  2BM0 A;  4K0K I;  2XDX A;  1GKZ A;  2OI2 A;  2VCJ A;  3MNR P;  4LF7 E;  3TZ5 A;  2V2Q A;  1ZM4 A;  4R3M A;  1UYC A;  4JI2 E;  4CWP A;  4JI7 E;  4DPX A;  2UXB I;  4HXW A;  4DR5 E;  4XIR A;  4YHH E;  4DV0 I;  3R91 A;  1Z0E A;  4JI8 E;  4KP4 A;  2YK2 A;  4DV7 E;  3B24 A;  4X66 I;  4I5S A;  3CRK A;  4CWS A;  2BYI A;  1L0O A;  3SL2 A;  4IZK A;  3RKZ A;  2AJ4 A;  2JKI A;  4B3S I;  4MPE A;  4NH9 A;  4FWH A;  4LP0 A;  5LMN E;  2XHR A;  1B63 A;  2V2V A;  2YEJ A;  2QG2 A;  4AQY E;  3HZ5 A;  4MOT A;  1ZWH A;  1US7 A;  1TC0 A;  4LF4 I;  1FKA E;  1AMW A;  2PNL A;  4XIQ A;  2Z5B A;  4P7A A;  4ED4 A;  3EKO A;  4JI1 I;  3O2F A;  2DEJ A;  3B25 A;  1Z0T A;  3B8H A;  4MYT A;  3WU4 A;  4YKY A;  4CWN A;  2WEP A;  3PEH A;  4DPT A;  1Z0B A;  2QF6 A;  3R4P A;  1Y4S A;  3EHF A;  4LFC E;  4R1F A;  4DV5 E;  5F5R A;  4ZKI A;  5BR8 E;  1H74 A;  4DV6 E;  1RR9 A;  2ZM6 E;  4P8O A;  2YE2 A;  3RLR A;  4DU7 A;  4USM A;  5IT9 Q;  3OWB A;  1UY9 A;  2VWC A;  5GME A;  3B28 A;  4L93 A;  3B78 A;  2IWU A;  3CGZ A;  4X65 I;  3V2U C;  4CWT A;  3R92 A;  2VQF I;  4B3M E;  4LWE A;  4LF6 E;  3LTO A;  3NMQ A;  1DAR A;  4L94 A;  2XDK A;  4HYM A;  4FMT A;  4EM7 A;  2UXC I;  3PYE A;  3A0T A;  3B26 A;  4YKR A;  5D7C A;  2Z5C B;  5M4N A;  1NHH A;  3EHJ A;  4DV3 I;  4OX9 I;  3ZKD A;  4JAU A;  1XNR I;  1GJV A;  1VIS A;  2IOP A;  2X36 A;  5GMD A;  1PKP A;  2PNM A;  3Q6N A;  1HNX I;  2IOQ A;  5LMU E;  2UXD I;  4YKU A;  3TZ4 A;  4URO A;  5J71 A;  2YGA A;  2VW5 A;  4DR1 I;  3QTF A;  4N3O A;  4X64 E;  4HAC A;  1N33 E;  2WW4 A;  3R4N A;  2R42 A;  4DR7 E;  4DUY I;  4FCP A;  1S16 A;  4CWO A;  4DV1 E;  3CRL A;  1AM1 A;  2Q2E B;  3EHG A;  2WI7 A;  3GIF A;  1NHJ A;  2UUA E;  1BYQ A;  3H80 A;  3ZZ0 A;  4DV2 I;  4XC0 A;  3T1H E;  2Q8H A;  1ZM9 A;  4B3T I;  1HK7 A;  3LNU A;  4AQY I;  4JYA I;  1ID0 A;  2IWS A;  4CE1 A;  1XHK A;  4DR4 E;  2YEH A;  4X62 E;  4H7Q A;  1UY6 A;  3TZ0 A;  2XEX A;  3U2K A;  4JV5 E;  4ASG A;  2YKC A;  1U0Z A;  2XDS A;  3T10 A;  5D6Q A;  2JJC A;  1FWK A;  4LWF A;  1Y6Z A;  3A0X A;  4LPB A;  4O04 A;  4FW9 A;  4UT4 A;  1HNW I;  2YGF A;  3WHA A;  4MPC A;  3U2D A;  4L8Z A;  4NXM I;  2J7K A;  4FN5 A;  4JI0 I;  2YE8 A;  1XMQ I;  2XX2 A;  1YS3 A;  2E5L I;  3O0I A;  4MP7 A;  2ESA A;  2CGE A;  2HKJ A;  4RPF A;  2K5B A;  3KE6 A;  2YI5 A;  3OWD A;  3J80 C;  1TC6 A;  4FWD A;  4WUC A;  2YE3 A;  4YKT A;  4JAS A;  2CH4 A;  3RLP A;  4XTJ A;  2F4V I;  5IWA E;  4ASF A;  2UUB E;  4GKJ I;  2XDU A;  5J6A A;  2UUC I;  5A2Q C;  4GFN A;  1Z0V A;  3D2R A;  4LF9 E;  4B7P A;  3HEK A;  2CGF A;  4XDM A;  3A0Y A;  2V2Z A;  4M1K A;  2NPF A;  4MB9 A;  2UU9 E;  1IBM I;  1H73 A;  1IBK I;  3DGE A;  2WI2 A;  4YKW A;  4NH7 A;  3FT5 A;  1N36 E;  4HXZ A;  5FLX Q;  4DV4 I;  2XJX A;  4AWP A;  4EMD A;  1QZR A;  4DR2 I;  4EFU A;  2YKJ A;  2UWD A;  4PU9 A;  1N33 I;  2YGE A;  2YKE A;  2XCM A;  2CZ9 A;  4B3R E;  4DR6 I;  1XMO E;  2FWY A;  4BQJ A;  4XKK A;  1UYL A;  1BGQ A;  4E00 A;  2YEB A;  4LWH A;  4V25 A;  4EGK A;  1H72 C;  3Q5J A;  3HJC A;  1N34 E;  4O07 A;  2Z5C A;  4GT8 A;  4GKK I;  2WEQ A;  3OTO E;  4DUH A;  1NZ0 A;  1ZXN A;  1BKN A;  4Z7Y A;  1UY8 A;  4QPJ A;  4MBC A;  3JAM Q;  4GQT A;  2YI7 A;  4IZJ D;  2YEI A;  1XNQ E;  5LL6 R;  4YY3 E;  3VHC A;  4NXN I;  4LFB I;  1TBW A;  1U2O A;  1Z0C A;  2HG1 A;  2BU2 A;  4JI5 E;  3WU3 A;  1N32 I;  1UYF A;  4XD8 A;  1UYM A;  1TH8 A;  4KQV A;  4JI3 E;  1YET A;  4KHP I;  4ASA A;  3K97 A;  1U2R A;  2HFS A;  4DR3 I;  3ZM7 A;  3HHU A;  3RLQ A;  4PRV A;  3Q5L A;  4FWG A;  2YE6 A;  4BQG A;  3GIE A;  4JI4 E;  4LF5 E;  3T1Y I;  3EHH A;  3TUH A;  2VCI A;  2HHH E;  4LF8 E;  1FI4 A;  2BM1 A;  4IZJ B;  2BU7 A;  2HCH A;  3PEJ A;  2YE7 A;  1HR0 E;  2Q8I A;  5IDM A;  2FYP A;  1IBL I;  1YSR A;  2GFD A;  4I3H A;  1I5A A;  4PL9 A;  3WU5 A;  5CTU A;  4U93 A;  2E1R A;  4LFA E;  4O0B A;  1H7S A;  1FJG E;  1UYD A;  4LF7 I;  1H7U A;  4JI2 I;  2H8M A;  2YI0 A;  1AH8 A;  2XD6 A;  3FV5 A;  4JI7 I;  3V5R A;  4DR5 I;  2FXS A;  4YHH I;  2YJW A;  1KZN A;  2V34 A;  4JI8 I;  2CCT A;  2H55 A;  1HNZ E;  1YC1 A;  4DV7 I;  1MX0 A;  2BRC A;  4V26 A;  4XIT A;  3QT6 A;  5IN9 A;  4KTN A;  4GEE A;  3FT8 A;  3J81 Q;  3HYY A;  2C2A A;  4H85 A;  4HY1 A;  1YT1 A;  4FPP A;  4QPK A;  2VQE E;  4NH8 A;  3JZ3 A;  5LMN I;  5M4H A;  4HZ5 A;  2GQP A;  1PIE A;  1J5E E;  5CTW A;  4K0K E;  2ZDY A;  3B27 A;  3Q1Q A;  5IDJ A;  3D36 A;  5FND A;  1YER A;  4WUD A;  1I59 A;  1B3Q A;  1ZW9 A;  2YEG A;  4YKX A;  3VHD A;  3IED A;  4E02 A;  2UXB E;  3INW A;  4Q20 A;  4DV0 E;  1THN A;  3ZXO A;  2YE4 A;  1B62 A;  2YEC A;  4X66 E;  3TZ2 A;  3ZZT A;  2XDL A;  3HYZ A;  3Q5K A;  1I94 E;  5CPH A;  3K60 A;  1WUU A;  4ZVI A;  4LFC I;  1R62 A;  4DPU A;  3TTZ A;  2IWX A;  1YSZ A;  5D7R A;  3K1J A;  4DV5 I;  4B3S E;  3T0Z A;  5BR8 I;  4X9L A;  4DV6 I;  5IT9 C;  2BT0 A;  2ZM6 I;  1N0U A;  4E01 A;  3WQ9 A;  3VAD A;  2YKI A;  1YC4 A;  2XX4 A;  4KSH A;  4DU8 A;  3PRY A;  2YJX A;  4BAE A;  1KKH A;  4LWI A;  3QT7 A;  1UEK A;  4EMV A;  2GS8 A;  4LF4 E;  1UYH A;  3T0H A;  1Z5C A;  1FWL A;  4JI4 I;  4H81 A;  2XHX A;  4KSG A;  5D7D A;  4JI1 E;  1UY7 A;  3K99 A;  4B3M I;  3M6A A;  1OSF A;  4LF6 I;  2YE5 A;  2YE9 A;  2A2D A;  5D6P A;  5F3K A;  3D4J A;  1A6F A;  2O1T A;  5L3J A;  1S4E A;  1EA6 A;  4DXL A;  2O1V A;  1I5D A;  1GKX A;  3T2S A;  1I5B A;  3VHA A;  5M4K A;  4DPW A;  1PVG A;  5LMU I;  3J7A M;  1EI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...