1QZRA

Crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii bound to icrf-187 (dexrazoxane)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
404
structure length
382
Chain Sequence
SASDKYQKISQLEHILKRPDTYIGSVETQEQLQWIYDEETDCMIEKNVTIVPGLFKIFDEILVNAADNKVRDPSMKRIDVNIHAEEHTIEVKNDGKGIPIEIHNKENIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADLNVGQKYVQKWENNMSICHPPKITSYKKGPSYTKVTFKPDLTRFGMKELDNDILGVMRRRVYDINGSVRDINVYLNGKSLKIRNFKNYVELYLKSLIPTILYERINNRWEVAFAVSDISFQQISFVNSIATTMGGTHVNYITDQIVKKISEILKKVKSFQIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCEIPLEYINKIMKTDLATRMFEIADANEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA topoisomerase II
publication title Structure of the topoisomerase II ATPase region and its mechanism of inhibition by the chemotherapeutic agent ICRF-187
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 125
structure length 382
sequence length 404
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1qzrA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1qzrA01
3R4PA 2WI3A 2CG9A 4MBCA 2VQEE 4X66E 4JAUA 1I5BA 2BU2A 4HXWA 3B78A 2Q8GA 3TZ0A 1THNA 4PL9A 3CRLA 1I94E 5FLXQ 2Q8FA 4K4OA 3J81C 2CCUA 3TZ4A 4P7AA 2YKJA 1RR9A 4M1KA 4X65E 2JJCA 2UWDA 2IWUA 1R62A 4X64E 2WI2A 4KSHA 3O2FA 4BIUA 2YEBA 4DZYA 2BM0A 1N34I 2XABA 2YGAA 1Y8PA 4MP7A 4CE3A 4LF5I 2YE2A 4LFBE 4XKKA 4YKZA 3INXA 1FJGI 2E5LI 1HNWE 1H7UA 3WU3A 4LF7I 2HKJA 1ZXNA 4JYAI 4DV0I 5FWKA 1Z0CA 2PNRA 3R92A 4NH8A 4DPXA 1IBLI 4FMTA 1Z5AA 2F4VI 2BU5A 3K17A 2XCMA 1A6FA 1KIJA 3K98A 4E00A 3JZ3A 2YKCA 1HNZE 1ZW9A 2EXLA 1UYMA 2YK9A 3HZ1A 4R3AA 4CWTA 4DR4I 3T10A 3B82A 4FWHA 2O1UA 1N32I 3A0TA 1TBWA 4LWGA 3PEJA 4BIZA 1UYCA 4DV3I 4XD8A 1XMQE 3J7AM 2UU9E 1QY8A 5IWAE 3VHAA 4HXZA 1XNRE 4FPPA 4BAEA 2HK2A 2YEHA 5IT9Q 3QDDA 4DPYA 4KTNA 4CWOA 3RLQA 2XDKA 4U7OA 3PYDA 2HCHA 3ZKDA 4JI1E 1I5AA 3B26A 3K97A 1B63A 4EM7A 4LF8E 1L0OA 4NXMI 4RPFA 1XNQE 1BGQA 2XHTA 2ZDXA 4NH7A 5CF0A 3D36A 4YHHI 3K1JA 1UYFA 3K60A 1Z5BA 4PU9A 1Z0BA 5IT9C 2XJXA 3B25A 4ASAA 4L94A 1IBMI 1Z59A 4DR2I 2UUCI 4MYTA 4LF6I 2CCSA 3HEKA 2H8MA 2YEIA 4B7PA 1YETA 4GKKI 5GMDA 3FV5A 4UROA 3CWVA 1YC4A 2YE7A 3OPDA 3T0ZA 1YESA 4JI2E 4LF9E 2IWSA 4XIPA 2E0AA 4DV6E 4YY3I 4DUYE 5F5RA 4DR6I 2WEQA 2AKPA 2ZITA 4ZVIA 3HZ5A 3T1HE 4B3MI 1OSFA 1H73A 2IOPA 3INWA 4XITA 3R91A 3PYFA 3C0EA 2HHHE 1MG7A 1QZRA 4JI0E 4Q20A 2ZDYA 2WERA 5C93A 4JI7I 3G7BA 1UYIA 4CWRA 1KKHA 2QFOA 2WEPA 5GGZA 5D7RA 4AWOA 3ZXQA 4DU8A 4YKUA 4ASBA 2YEJA 4WUCA 4YKYA 4EFUA 4MPNA 3QT6A 3WU6A 4GGLA 1I5CA 5J6AA 1JM6A 2XX2A 2XHXA 2J7KA 4DUZI 1US7A 4JASA 3CRKA 1UYLA 4EFTA 3CGZA 2VCIA 3EKRA 1AH8A 3R4OA 4KP4A 1PKPA 4YKXA 1GJVA 1BKNA 3LNUA 4YKWA 1Z0TA 5F3KA 4JI5I 4NH9A 3TZ2A 2GS8A 4X62E 4HACA 3CGYA 3GIGA 3C11A 5LMNE 4DPWA 4XE2A 2QF6A 2VQFE 4DV5E 4B3SI 5BODA 4DV7E 3WHAA 2YI6A 2LJPA 1GKXA 5M4KA 2VF3A 1WUUA 4GKJE 1MX0A 1KTVA 2HKEA 1ID0A 4EEHA 2UUBE 1FNMA 4DR1E 1FWKA 1HNXI 3FT5A 4LWEA 4V26A 4DV2E 4NXNE 2IWXA 4XCLA 1ZM3A 4AWQA 4DR3E 2CZ9A 4LWHA 2R3VA 2YI7A 1N0VC 4JI8E 1XMOE 5CTUA 1N33I 4JI6E 4JV5E 2XX5A 3V5RA 2DEJA 4JI3E 4XIQA 3T1KA 4UT4A 1H7SA 1UY8A 4XTJA 1U2OA 3WQ9A 4LFAE 3EHHA 1IBKE 3RLPA 3A0ZA 3BM9A 2UXDE 4DV4I 3K99A 4L93A 1TIDA 2YI0A 4MOTA 2BV3A 2YE9A 1KZNA 4CWSA 1TC0A 2YE5A 4XC0A 1YS3A 2O1WA 1UEKA 4KHPE 4URMA 5FLXC 3EHJA 4O05A 3DGEA 1TH8A 5CTXA 5CTWA 3KE6A 2ZM6I 4L8ZA 2YEAA 1ZM4A 4MB9A 4DR5I 2XJJA 2YK2A 4CWQA 3B27A 3T0HA 2CCTA 1OJ4A 2DEIA 1YC3A 4B3RI 1AMWA 1UY6A 3F0NA 2HFSA 2CH4A 2UXCE 2VWCA 4LF4I 2ESAA 1Z0GA 4JI1I 2E1RA 1N34E 4LF8I 1NHJA 1D6TA 4LF5E 2BRCA 1FKAE 1FJGE 2E5LE 4O07A 1UYHA 2BYHA 4LF7E 3Q5LA 1QYEA 4JYAE 4DV0E 2XDSA 1HR0I 2VCJA 4H85A 1U2RA 5CPHA 1IBLE 3EHFA 3M6AA 2F4VE 4BQGA 1ZM9A 4I3HA 2XHRA 2UUAI 2Q8HA 2YGFA 2YJXA 4XKAA 4R3MA 4OX9I 2CGFA 3O0IA 2HK3A 1UY9A 4K0KE 2XDLA 2XDUA 4DR4E 2YEEA 4O0BA 1N32E 4DUYI 4JG4A 4H7QA 3ZZ0A 3T1YE 1EI1A 2WI4A 4AS9A 3J80Q 3G75A 5LMUI 1I5DA 2V2ZA 1Y4SA 3R4NA 3B8HA 5GMEA 2YJWA 3A0RA 1YT2A 3WU5A 1S4EA 4USMA 1PVGA 3OTOI 4B3TE 4WUBA 4LFCI 2BU7A 3ZZTA 2BZ5A 1H72C 4CE1A 4NXME 3O6OA 2X36A 4YHHE 1YSRA 4MP2A 5FNFA 4DPUA 4FN5A 2YGEA 4ASGA 4JI4I 2WI7A 1IBME 4DR2E 3QT8A 2UUCE 4LF6E 1YT1A 1N0UA 2IOQA 2JKIA 4KSGA 1AH6A 1UYDA 2R42A 3V2UC 4DPTA 4GKKE 5M4PA 1ELOA 4HZ5A 1TC6A 4DV1I 2YEFA 3VADA 4B6CA 4PRVA 4YY3E 1J5EI 1Z0WA 4FCQA 1N36I 5BOCA 1GKZA 2YKEA 4DR6E 5BR8I 4JAVA 4DR7I 3OMUA 2EFGA 1S14A 2BU6A 4B3ME 2UXBI 5D7CA 3A0XA 1Z5CA 1NHIA 4AQYI 2VQFI 1UYEA 4JI7E 4AWPA 5M4MA 1BYQA 1XHKA 2HG1A 2BREA 1Z0EA 3LPSA 2K5BA 2YE6A 1MU5A 4DR1I 3PYEA 2UUBI 1NHHA 3OWDA 3R4MA 2VQEI 4X66I 3T2SA 3QT7A 4LP0A 1RREA 2WI6A 1YC1A 4MPEA 4DUZE 4CWPA 3EHGA 5J71A 3IEDA 2AJ4A 1I94I 1UYKA 1UYGA 3JAMQ 2YECA 4HYPA 2XJGA 2BU8A 1Z0VA 4X65I 1EA6A 2Q2EB 3RKZA 4UTGA 4X64I 1ZXMA 3LTOA 2QG2A 4JI5E 4YKRA 1UY7A 4LFBI 1PIEA 4YKQA 1VISA 4Z7YA 1KVKA 3G7EA 3JAMC 3J7AG 1HNWI 3PYGA 4B3SE 2Q8IA 2BTZA 2FYPA 4HY6A 4XDMA 4FWDA 1U0ZA 4URNA 4GQTA 3ZM7A 4LPBA 4KQVA 1HNXE 1Y8NA 1YT0A 3A0YA 5M4HA 3GIFA 4EMDA 1HNZI 5M4EA 4EGHA 4MPCA 3Q1QA 2XD6A 5IDJA 4JQLA 2UXCI 1N33E 5D6QA 3GONA 1XMQI 1AJ6A 4USKA 2UU9I 5IWAI 4PRXA 1XNRI 3A0WA 2C2AA 2XDXA 4DU7A 3ZKBA 2V34A 5FNCA 2NPFA 4EMVA 2FWZA 5D6PA 3HHUA 4DV4E 4YKTA 4Z7CA 3PEHA 5IDMA 2A2DA 4GFNA 2WI5A 3B24A 4EGIA 5D7DA 1XNQI 1AM1A 4XIRA 2X7IA 2YEDA 2YKBA 2ZM6E 2YE8A 1ZWHA 4HYMA 1K47A 3D2RA 3MNRP 4DR5E 2YEGA 4K0KI 3U2DA 2FXSA 4CWFA 5L3JA 2GFDA 4BQJA 3T1YI 4B3RE 2XEXA 4FCPA 3EKOA 2QG0A 4JI2I 4LF9I 2A2CA 4DV6I 3Q5KA 4P8OA 4HZ0A 4O09A 4LF4E 1ZM2A 4DV3E 1B3QA 1Y4UA 4I5SA 3T1HI 3H4LA 4FWGA 3ZZUA 5CTYA 4B3TI 1TILA 2HHHI 4ED4A 3VHCA 4JI0I 3TUHA 4HY1A 3RLRA 3SL2A 2BSMA 1H74A 1NZ0A 3QT5A 4MYUA 1I58A 1HR0E 2WI1A 3QTFA 3J80C 4X9LA 2UUAE 2V8PA 2V2VA 3NMQA 4OX9E 4V25A 4QPKA 4FW9A 1YSZA 3TZ5A 3H80A 5IN9A 4FCRA 3GIEA 4LWFA 1S16A 4KFGA 4O04A 1I59A 4GCZA 5LMUE 2OI2A 5FNDA 4BXIA 1A4HA 2IORA 2HFUA 2VW5A 1FI4A 3OW6A 3B28A 4U93A 3OTOE 1YERA 1B62A 4X62I 3U2KA 4LFCE 4HACB 5LMNI 3HYZA 3GIGB 1Y8OA 4XKOA 4U7NA 4W7TA 3OWBA 4DV5I 2V2QA 4L90A 4DV7I 3ZXOA 4E02A 4R1FA 4GKJI 5A2QQ 4E01A 4P52A 1DARA 4XCJA 4H81A 4CE2A 4JI4E 4EGKA 2BT0A 3U67A 4DV2I 4NXNI 2BYIA 2XX4A 3TTZA 4WUDA 4DR3I 2YI5A 1FWLA 4GEEA 2YE4A 2ZBKB 2BM1A 4JI8I 1XMOI 2WW4A 3HULA 4DV1E 1J5EE 4JI6I 2H55A 4GT8A 4JV5I 1N36E 4ASFA 3FT8A 4DUHA 5A2QC 5BR8E 2YKIA 4JI3I 4DR7E 3D0BA 2ZKJA 4LWIA 4LFAI 2UXBE 1IBKI 3WU4A 1BXDA 5LL6R 2XK2A 2UXDI 2GQPA 2O1VA 4DXLA 4AQYE 4QPJA 4CWNA 5M4NA 4ZKIA 2FWYA 3J81Q 3D4JA 3Q5JA 4L91A 4URLA 3HYYA 4KHPI 3VHDA 3BMYA 2YE3A
chains in the Genus database with same CATH superfamily
3R4PA 2WI3A 4LCHA 2CG9A 4MBCA 2VQEE 4X66E 4JAUA 1I5BA 2C39A 2BU2A 4HXWA 3B78A 2Q8GA 3TZ0A 2PO2B 1UDNA 1THNA 3HKMA 4PL9A 3CRLA 2GQ0A 2VESA 1I94E 5FLXQ 2Q8FA 4K4OA 3J81C 4LPFA 1IXMA 2CCUA 3TZ4A 4P7AA 2YKJA 1RR9A 4M1KA 4X65E 2JJCA 2UWDA 3CYGA 2IWUA 1R62A 4X64E 2WI2A 4KSHA 3O2FA 4BIUA 2YEBA 4DZYA 2BM0A 1N34I 2XABA 2YGAA 1Y8PA 3U1YA 4MP7A 5K36D 4CE3A 3CDJA 4LF5I 2YE2A 4LFBE 4XKKA 4YKZA 3INXA 1FJGI 2E5LI 1HNWE 1H7UA 3WU3A 4LF7I 2HKJA 1ZXNA 4JYAI 5FWKA 4DV0I 1Z0CA 1VI7A 2PNRA 3R92A 2PO2A 4NH8A 4DPXA 1IBLI 4FMTA 1Z5AA 2F4VI 2BU5A 3K17A 2XCMA 2C1IA 1A6FA 1KIJA 3PS2A 3K98A 4E00A 3JZ3A 2YKCA 5DRRA 1HNZE 1ZW9A 2EXLA 1UYMA 2YK9A 3HZ1A 4OO1C 4R3AA 4CWTA 4DR4I 3T10A 2O1UA 3B82A 4FWHA 1N32I 3A0TA 1TBWA 4LWGA 4IZJD 3PEJA 1UYCA 4DV3I 4XD8A 4BIZA 1XMQE 3J7AM 4FW6A 2UU9E 1QY8A 5IWAE 3VHAA 4HXZA 1XNRE 4FPPA 4BAEA 2HK2A 2YEHA 5IT9Q 3QDDA 4DPYA 4KTNA 4CWOA 4OZEA 3RLQA 2XDKA 4U7OA 2GO3A 3H1CA 3PYDA 2HCHA 3ZKDA 4JI1E 1I5AA 3B26A 3K97A 1B63A 4EM7A 4LF8E 1L0OA 4NXMI 4RPFA 1XNQE 1BGQA 2XHTA 2ZDXA 4NH7A 5CF0A 3D36A 2Z5BB 4YHHI 2NN6F 4FW5A 3K1JA 3Q6NA 1UYFA 3K60A 4PU9A 1Z5BA 1Z0BA 4IZKA 5IT9C 2XJXA 2WP8A 4MDTA 3B25A 2BA1D 4L94A 1IBMI 1Z59A 4DR2I 4ISAA 4MYTA 2UUCI 4LF6I 2CCSA 2H8MA 2YEIA 3P3GA 3HEKA 4B7PA 1YETA 4GKKI 2Z5CB 5GMDA 2O1TA 3FV5A 2PNMA 4UROA 3CWVA 2IESA 4BA2A 1YC4A 2YE7A 1YESA 3OPDA 4JI2E 4LF9E 2IWSA 4XIPA 2E0AA 4DV6E 4YY3I 3T0ZA 4DUYE 5F5RA 4IZJB 4AIMA 4DR6I 4BA1B 2WEQA 2AKPA 2ZITA 4ZVIA 2O3ZA 3T1HE 3HZ5A 1R6LA 1R6MA 3CDIA 1H73A 2IOPA 3L7ZA 5EKWA 4B3MI 1OSFA 3PYFA 3C0EA 2HHHE 3INWA 1MG7A 1QZRA 5JEAC 4JI0E 4Q20A 2ZDYA 2WERA 5C93A 4OO1A 4JI7I 3G7BA 4MQYA 2Z5BA 1XXEA 1KKHA 1UYIA 2QFOA 2WEPA 5GGZA 4CWRA 5D7RA 4AWOA 3ZXQA 4DU8A 4YKUA 4ASBA 2YEJA 4WUCA 4YKYA 4EFUA 4MPNA 3QT6A 4MU4A 3WU6A 1I5CA 4GGLA 2NN6D 5J6AA 2Z5CA 2BA0D 1JM6A 2XX2A 2XHXA 2J7KA 4DUZI 1US7A 4JASA 3CRKA 5C0XE 1UYLA 4EFTA 3CGZA 4IZJA 2VCIA 3EKRA 4BA1A 2GO4A 1AH8A 3R4OA 4ASAA 4KP4A 1PKPA 5EL9A 4YKXA 1GJVA 1UDOA 1BKNA 5C0XF 3LNUA 4YKWA 1Z0TA 5F3KA 2Z5EA 4JI5I 4NH9A 3TZ2A 3GLLA 2GS8A 5DRPA 4X62E 4HACA 3CGYA 3GIGA 3C11A 5LMNE 4DPWA 4XE2A 2QF6A 2VQFE 4DV5E 4B3SI 5BODA 2JE6A 2BA0G 4DV7E 3WHAA 2YI6A 2LJPA 1GKXA 5M4KA 2VF3A 1WUUA 2PNLA 4GKJE 1MX0A 1KTVA 2HKEA 1ID0A 2JEAB 4EEHA 2UUBE 1FNMA 4DR1E 1FWKA 1HNXI 3FT5A 4LWEA 4V26A 4E72A 4DV2E 5DNLA 4NXNE 4OO1E 5JEAA 1ZM3A 2IWXA 4XCLA 2NN6B 4DR3E 4AWQA 2CZ9A 4LWHA 2R3VA 2YI7A 4MU0A 4OKGA 1N0VC 4JI8E 1XMOE 5CTUA 1N33I 4JI6E 2CGEA 4JV5E 2XX5A 3V5RA 2DEJA 4JI3E 4XIQA 3T1KA 4UT4A 1H7SA 1UY8A 4XTJA 1U2OA 3WQ9A 4LFAE 1F51A 1IBKE 3EHHA 3RLPA 3A0ZA 3BM9A 2UXDE 4DV4I 3K99A 4L93A 1TIDA 2WNRA 2YI0A 4MOTA 2BV3A 2YE9A 1KZNA 3PRYA 4CWSA 1TC0A 2YE5A 4XC0A 1YS3A 2O1WA 1UEKA 4KHPE 4URMA 5FLXC 3EHJA 4O05A 3DGEA 1TH8A 5CTXA 5CTWA 3KE6A 2ZM6I 4IFDE 3U1KA 2YEAA 1ZM4A 4L8ZA 4MB9A 4DR5I 2XJJA 5DNXA 2YK2A 4CWQA 3B4TA 2F1DA 3B27A 2CCTA 2C37B 1OJ4A 5K36C 2DEIA 3LMMA 1YC3A 4B3RI 3T0HA 1USVA 1AMWA 4IFDF 1UY6A 3F0NA 4MU1A 2HFSA 3P3EA 2CH4A 2UXCE 2VWCA 4LF4I 2ESAA 1Z0GA 5JEAE 4JI1I 2E1RA 1N34E 3PS1A 4LF8I 1NHJA 1D6TA 4LF5E 2BRCA 2C38B 1FKAE 1FJGE 2E5LE 1RHYA 4O07A 1UYHA 5K36B 2BYHA 4LF7E 3Q5LA 1QYEA 1E3PA 4JYAE 2CVEA 4DV0E 2XDSA 1HR0I 2VCJA 4H85A 1U2RA 5CPHA 1IBLE 3EHFA 3M6AA 2F4VE 4BQGA 1ZM9A 4I3HA 3P3CA 2XHRA 2UUAI 2Q8HA 2YGFA 2YJXA 4XKAA 4R3MA 4OX9I 2HHIA 2CGFA 3O0IA 2HK3A 1UY9A 2JEBB 2PNZB 4K0KE 2XDLA 2XDUA 4DR4E 2YEEA 4O0BA 1N32E 4DUYI 4JG4A 4H7QA 5DRQA 3ZZ0A 3T1YE 1EI1A 2WI4A 4AS9A 3J80Q 3G75A 5LMUI 1I5DA 1Y4SA 2V2ZA 3R4NA 3B8HA 5GMEA 2YJWA 3A0RA 1YT2A 3WU5A 1S4EA 4QNKA 2BR2B 1PVGA 4USMA 3OTOI 5K36A 3GMEA 4WUBA 4LFCI 4B3TE 2BU7A 3ZZTA 2BZ5A 1H72C 4AM3A 4CE1A 4NXME 3O6OA 2X36A 4YHHE 1YSRA 1HK7A 4MP2A 5FNFA 4DPUA 4FN5A 1YHCA 2BA1G 3HJCA 4JI4I 2YGEA 4ASGA 2WI7A 1IBME 2IOQA 3QT8A 4DR2E 2UUCE 4LF6E 1N0UA 1YT1A 5ELWA 2JKIA 1AH6A 1UYDA 2R42A 3V2UC 4DPTA 4KSGA 4GKKE 5M4PA 1ELOA 4HZ5A 1TC6A 4MU3A 4DV1I 2YEFA 3VADA 4B6CA 3DD6A 4PRVA 4YY3E 1J5EI 1YH8A 1Z0WA 4FCQA 1N36I 5BOCA 1GKZA 2YKEA 4DR6E 1UDQA 5BR8I 4JAVA 4DR7I 3OMUA 2EFGA 1S14A 2BU6A 4B3ME 3GCMA 3M7ND 2UXBI 5D7CA 3A0XA 2NN6C 1Z5CA 1NHIA 4AQYI 2VQFI 1UYEA 4JI7E 4AWPA 5M4MA 1BYQA 1XHKA 2HG1A 2BREA 1Z0EA 3LPSA 2K5BA 2YE6A 1MU5A 4DR1I 3PYEA 2UUBI 1NHHA 3OWDA 3R4MA 2VQEI 4X66I 3T2SA 3QT7A 4LP0A 1RREA 2C39B 1YC1A 2WI6A 5K36E 4MPEA 4DUZE 4CWPA 3EHGA 5J71A 1Y6ZA 3IEDA 2AJ4A 1I94I 1UYKA 1UYGA 3JAMQ 2YECA 1USUA 4HYPA 2XJGA 2BU8A 1Z0VA 2PO0B 4X65I 1EA6A 2Q2EB 3RKZA 4UTGA 4AIDA 4X64I 4OO1F 1ZXMA 3LTOA 2QG2A 4IS9A 4XITA 4JI5E 4YKRA 1UY7A 4LFBI 1PIEA 4YKQA 4Z7YA 1VISA 1P42A 1KVKA 3PS3A 5C0XD 3G7EA 3JAMC 3J7AG 1HNWI 3PYGA 4B3SE 2Q8IA 2BTZA 2FYPA 3P76A 4HY6A 4XDMA 4FWDA 1U0ZA 4URNA 2JEAA 4GQTA 3ZM7A 4LPBA 4KQVA 1HNXE 1Y8NA 1YT0A 3A0YA 5M4HA 2NN6A 3GIFA 4EMDA 1HNZI 5M4EA 5C0XC 4EGHA 2PO0A 4MPCA 3Q1QA 2XD6A 5IDJA 4JQLA 2UXCI 1N33E 5D6QA 2AE8A 3GONA 4N3OA 1XMQI 1AJ6A 4USKA 2UU9I 5IWAI 4PRXA 1XNRI 3A0WA 2C2AA 2XDXA 4DU7A 3ZKBA 2V34A 5FNCA 2NPFA 4EMVA 2FWZA 5D6PA 3HHUA 4OO1D 4DV4E 4YKTA 4Z7CA 3PEHA 5IDMA 2A2DA 3NZKA 4GFNA 2WI5A 3B24A 4EGIA 4NBQA 2J65A 5D7DA 1XNQI 5C0XB 3R91A 1AM1A 5JEAF 4XIRA 2X7IA 2YEDA 2YKBA 2ZM6E 2YE8A 1ZWHA 4HYMA 1K47A 4IZKB 3D2RA 4DR5E 3MNRP 2WP8B 2YEGA 4K0KI 3U2DA 2FXSA 4CWFA 4GQUA 2C37A 5L3JA 2GFDA 4BQJA 3T1YI 4B3RE 4J3DA 2XEXA 4FCPA 3EKOA 2QG0A 4JI2I 4LF9I 4BA2B 2A2CA 4U3DA 4DV6I 3Q5KA 4P8OA 4HZ0A 4O09A 1UDSA 4LF4E 1ZM2A 4DV3E 1Y4UA 1B3QA 4I5SA 3M85D 2NN6E 3H4LA 4FWGA 3ZZUA 3T1HI 4IFDD 2FTKA 5CTYA 4B3TI 1TILA 3L7ZB 2HHHI 4ED4A 3VHCA 4JI0I 3TUHA 2C38A 4HY1A 5C0XA 3RLRA 3SL2A 4OO1B 2BSMA 2C1GA 4FW7A 1H74A 1NZ0A 3QT5A 4MYUA 1E3HA 1I58A 1HR0E 2WI1A 4IFDC 3QTFA 3J80C 4X9LA 5JEAD 4FW3A 2V8PA 2UUAE 2V2VA 3NMQA 2JT2A 2JEBA 2PNZA 5DROA 4OX9E 4V25A 4QPKA 4FW9A 1YSZA 3TZ5A 3H80A 5IN9A 4FCRA 3M85G 3GIEA 4LWFA 1OYSA 1S16A 4KFGA 4O04A 1I59A 4GCZA 5LMUE 2OI2A 2IERA 5FNDA 2PO1B 1A4HA 4BXIA 2IORA 2HFUA 2VW5A 1FI4A 2BR2A 3B28A 3OW6A 4IFDB 4U93A 3OTOE 1YERA 1B62A 4X62I 3U2KA 3S5TA 4LFCE 4HACB 5LMNI 3HYZA 3GIGB 1Y8OA 4XKOA 4U7NA 4W7TA 3OWBA 4DV5I 2V2QA 4L90A 1OYPA 4DV7I 3ZXOA 4E02A 2JE6B 4R1FA 1OYRA 4GKJI 5A2QQ 4E01A 4P52A 4LCFA 1DARA 3K85A 4H81A 4JI4E 4XCJA 1Y5YA 4CE2A 4EGKA 2BT0A 3U67A 3KRNA 4DV2I 4NXNI 2BYIA 1Y60A 2XX4A 4WUDA 3TTZA 4DR3I 5JEAB 1FWLA 2YI5A 4GEEA 2YE4A 2ZBKB 5JENA 2BM1A 4JI8I 1XMOI 2WW4A 3HULA 4DV1E 2PO1A 3P06A 1J5EE 4JI6I 2H55A 4GT8A 4JV5I 1N36E 4ASFA 3FT8A 4DUHA 3M7NG 5A2QC 3Q6MA 5BR8E 4IFDA 4JI3I 4DR7E 5K36F 2YKIA 3D0BA 2ZKJA 4LWIA 4FW4A 4LFAI 2UXBE 1IBKI 3WU4A 1BXDA 4QNJA 5LL6R 2XK2A 2UXDI 4U3BA 2GQPA 2O1VA 4LCGA 4DXLA 4AQYE 4QPJA 2WNRB 4CWNA 5M4NA 3UHMA 4ZKIA 2FWYA 3J81Q 3D4JA 3Q5JA 4L91A 4URLA 3HYYA 4KHPI 3VHDA 3BMYA 2YE3A 4LOMA
chains in the Genus database with same CATH topology
3R4PA 2WI3A 2CG9A 4MBCA 2VQEE 4X66E 4JAUA 1I5BA 2BU2A 4HXWA 3B78A 2Q8GA 3TZ0A 1THNA 4PL9A 3CRLA 2GQ0A 1I94E 5FLXQ 2Q8FA 4K4OA 3J81C 2CCUA 3TZ4A 4P7AA 2YKJA 1RR9A 4M1KA 4X65E 2JJCA 2UWDA 2IWUA 1R62A 4X64E 2WI2A 4KSHA 3O2FA 4BIUA 2YEBA 4DZYA 2BM0A 1N34I 2XABA 2YGAA 1Y8PA 4MP7A 4CE3A 4LF5I 2YE2A 4LFBE 4XKKA 4YKZA 3INXA 1FJGI 2E5LI 1HNWE 1H7UA 3WU3A 4LF7I 2HKJA 1ZXNA 4JYAI 5FWKA 4DV0I 1Z0CA 2PNRA 3R92A 4NH8A 4DPXA 1IBLI 4FMTA 1Z5AA 2F4VI 2BU5A 3K17A 2XCMA 1A6FA 1KIJA 3K98A 4E00A 3JZ3A 2YKCA 1HNZE 1ZW9A 2EXLA 1UYMA 2YK9A 3HZ1A 4R3AA 4CWTA 4DR4I 3T10A 2O1UA 3B82A 4FWHA 1N32I 3A0TA 1TBWA 4LWGA 4IZJD 3PEJA 1UYCA 4DV3I 4XD8A 4BIZA 1XMQE 3J7AM 2UU9E 1QY8A 5IWAE 3VHAA 4HXZA 1XNRE 4FPPA 4BAEA 2HK2A 2YEHA 5IT9Q 3QDDA 4DPYA 4KTNA 4CWOA 3RLQA 2XDKA 4U7OA 3PYDA 2HCHA 3ZKDA 4JI1E 1I5AA 3B26A 3K97A 1B63A 4EM7A 4LF8E 1L0OA 4NXMI 4RPFA 1XNQE 1BGQA 2XHTA 2ZDXA 4NH7A 5CF0A 3D36A 2Z5BB 4YHHI 3K1JA 3Q6NA 1UYFA 3K60A 1Z5BA 4IZKA 1Z0BA 4PU9A 5IT9C 2XJXA 3B25A 4ASAA 4L94A 1IBMI 1Z59A 4DR2I 2UUCI 4MYTA 4LF6I 2CCSA 3HEKA 2H8MA 2YEIA 4B7PA 1YETA 4GKKI 2Z5CB 5GMDA 2O1TA 3FV5A 2PNMA 4UROA 3CWVA 1YC4A 2YE7A 3OPDA 3T0ZA 1YESA 4JI2E 4LF9E 2IWSA 4XIPA 2E0AA 4DV6E 4YY3I 4DUYE 5F5RA 4IZJB 4DR6I 2WEQA 2AKPA 2ZITA 4ZVIA 3HZ5A 3T1HE 4B3MI 1OSFA 1H73A 2IOPA 3INWA 4XITA 3R91A 3PYFA 3C0EA 2HHHE 1MG7A 1QZRA 4JI0E 4Q20A 2ZDYA 2WERA 5C93A 4JI7I 3G7BA 1UYIA 2Z5BA 4CWRA 1KKHA 2QFOA 2WEPA 5GGZA 5D7RA 4AWOA 3ZXQA 4DU8A 4YKUA 4ASBA 2YEJA 4WUCA 4YKYA 4EFUA 4MPNA 3QT6A 3WU6A 4GGLA 1I5CA 5J6AA 2Z5CA 1JM6A 2XX2A 2XHXA 2J7KA 4DUZI 1US7A 4JASA 3CRKA 1UYLA 4EFTA 3CGZA 4IZJA 2VCIA 3EKRA 1AH8A 3R4OA 4KP4A 1PKPA 4YKXA 1GJVA 1BKNA 3LNUA 4YKWA 1Z0TA 5F3KA 2Z5EA 4JI5I 4NH9A 3TZ2A 2GS8A 4X62E 4HACA 3CGYA 3GIGA 3C11A 5LMNE 4DPWA 4XE2A 2QF6A 2VQFE 4DV5E 4B3SI 5BODA 4DV7E 3WHAA 2YI6A 2LJPA 1GKXA 5M4KA 2VF3A 1WUUA 2PNLA 4GKJE 1MX0A 1KTVA 2HKEA 1ID0A 4EEHA 2UUBE 1FNMA 4DR1E 1FWKA 1HNXI 3FT5A 4LWEA 4V26A 4DV2E 4NXNE 2IWXA 4XCLA 1ZM3A 4AWQA 4DR3E 2CZ9A 4LWHA 2R3VA 2YI7A 1N0VC 4JI8E 1XMOE 5CTUA 1N33I 4JI6E 2CGEA 4JV5E 2XX5A 3V5RA 2DEJA 4JI3E 4XIQA 3T1KA 4UT4A 1H7SA 1UY8A 4XTJA 1U2OA 3WQ9A 4LFAE 3EHHA 1IBKE 3RLPA 3A0ZA 3BM9A 2UXDE 4DV4I 3K99A 4L93A 1TIDA 2YI0A 4MOTA 2BV3A 2YE9A 1KZNA 3PRYA 4CWSA 1TC0A 2YE5A 4XC0A 1YS3A 2O1WA 1UEKA 4KHPE 4URMA 5FLXC 3EHJA 4O05A 3DGEA 1TH8A 5CTXA 5CTWA 3KE6A 2ZM6I 4L8ZA 2YEAA 1ZM4A 4MB9A 4DR5I 2XJJA 2YK2A 4CWQA 3B27A 3T0HA 2CCTA 1OJ4A 2DEIA 1YC3A 4B3RI 1USVA 1AMWA 1UY6A 3F0NA 2HFSA 2CH4A 2UXCE 2VWCA 4LF4I 2ESAA 1Z0GA 4JI1I 2E1RA 1N34E 4LF8I 1NHJA 1D6TA 4LF5E 2BRCA 1FKAE 1FJGE 2E5LE 4O07A 1UYHA 2BYHA 4LF7E 3Q5LA 1QYEA 4JYAE 4DV0E 2XDSA 1HR0I 2VCJA 4H85A 1U2RA 5CPHA 1IBLE 3EHFA 3M6AA 2F4VE 4BQGA 1ZM9A 4I3HA 2XHRA 2UUAI 2Q8HA 2YGFA 2YJXA 4XKAA 4R3MA 4OX9I 2CGFA 3O0IA 2HK3A 1UY9A 4K0KE 2XDLA 2XDUA 4DR4E 2YEEA 4O0BA 1N32E 4DUYI 4JG4A 4H7QA 3ZZ0A 3T1YE 1EI1A 2WI4A 4AS9A 3J80Q 3G75A 5LMUI 1I5DA 1Y4SA 2V2ZA 3R4NA 3B8HA 5GMEA 2YJWA 3A0RA 1YT2A 3WU5A 1S4EA 4USMA 1PVGA 3OTOI 4B3TE 4WUBA 4LFCI 2BU7A 3ZZTA 2BZ5A 1H72C 4CE1A 4NXME 3O6OA 2X36A 4YHHE 1YSRA 1HK7A 4MP2A 5FNFA 4DPUA 4FN5A 2YGEA 3HJCA 4JI4I 4ASGA 2WI7A 1IBME 2IOQA 3QT8A 4DR2E 2UUCE 4LF6E 1N0UA 1YT1A 2JKIA 4KSGA 1AH6A 1UYDA 2R42A 3V2UC 4DPTA 4GKKE 5M4PA 1ELOA 4HZ5A 1TC6A 4DV1I 2YEFA 3VADA 4B6CA 4PRVA 4YY3E 1J5EI 1Z0WA 4FCQA 1N36I 5BOCA 1GKZA 2YKEA 4DR6E 5BR8I 4JAVA 4DR7I 3OMUA 2EFGA 1S14A 2BU6A 4B3ME 2UXBI 5D7CA 3A0XA 1Z5CA 1NHIA 4AQYI 2VQFI 1UYEA 4JI7E 4AWPA 5M4MA 1BYQA 1XHKA 2HG1A 2BREA 1Z0EA 3LPSA 2K5BA 2YE6A 1MU5A 4DR1I 3PYEA 2UUBI 1NHHA 3OWDA 3R4MA 2VQEI 4X66I 3T2SA 3QT7A 4LP0A 1RREA 2WI6A 1YC1A 4MPEA 4DUZE 4CWPA 3EHGA 5J71A 1Y6ZA 3IEDA 2AJ4A 1I94I 1UYKA 1UYGA 3JAMQ 2YECA 1USUA 4HYPA 2XJGA 2BU8A 1Z0VA 4X65I 1EA6A 2Q2EB 3RKZA 4UTGA 4X64I 1ZXMA 3LTOA 2QG2A 4JI5E 4YKRA 1UY7A 4LFBI 1PIEA 4YKQA 1VISA 4Z7YA 1KVKA 3G7EA 3JAMC 3J7AG 1HNWI 3PYGA 4B3SE 2Q8IA 2BTZA 2FYPA 4HY6A 4XDMA 4FWDA 1U0ZA 4URNA 4GQTA 3ZM7A 4LPBA 4KQVA 1HNXE 1Y8NA 1YT0A 3A0YA 5M4HA 3GIFA 4EMDA 1HNZI 5M4EA 4EGHA 4MPCA 3Q1QA 2XD6A 5IDJA 4JQLA 2UXCI 1N33E 5D6QA 3GONA 4N3OA 1XMQI 1AJ6A 4USKA 2UU9I 5IWAI 4PRXA 1XNRI 3A0WA 2C2AA 2XDXA 4DU7A 3ZKBA 2V34A 5FNCA 2NPFA 4EMVA 2FWZA 5D6PA 3HHUA 4DV4E 4YKTA 4Z7CA 3PEHA 5IDMA 2A2DA 4GFNA 2WI5A 3B24A 4EGIA 5D7DA 1XNQI 1AM1A 4XIRA 2X7IA 2YEDA 2YKBA 2ZM6E 2YE8A 1ZWHA 4HYMA 1K47A 4IZKB 3D2RA 4DR5E 3MNRP 2YEGA 4K0KI 3U2DA 2FXSA 4CWFA 5L3JA 2GFDA 4BQJA 3T1YI 4B3RE 2XEXA 4FCPA 3EKOA 2QG0A 4JI2I 4LF9I 2A2CA 4DV6I 3Q5KA 4P8OA 4HZ0A 4O09A 4LF4E 1ZM2A 4DV3E 1Y4UA 1B3QA 4I5SA 3T1HI 3H4LA 4FWGA 3ZZUA 5CTYA 4B3TI 1TILA 2HHHI 4ED4A 3VHCA 4JI0I 3TUHA 4HY1A 3RLRA 3SL2A 2BSMA 1H74A 1NZ0A 3QT5A 4MYUA 1I58A 1HR0E 2WI1A 3QTFA 3J80C 4X9LA 2UUAE 2V8PA 2V2VA 3NMQA 4OX9E 4V25A 4QPKA 4FW9A 1YSZA 3TZ5A 3H80A 5IN9A 4FCRA 3GIEA 4LWFA 1S16A 4KFGA 4O04A 1I59A 4GCZA 5LMUE 2OI2A 5FNDA 4BXIA 1A4HA 2IORA 2HFUA 2VW5A 1FI4A 3OW6A 3B28A 4U93A 3OTOE 1YERA 1B62A 4X62I 3U2KA 4LFCE 4HACB 5LMNI 3HYZA 3GIGB 1Y8OA 4XKOA 4U7NA 4W7TA 3OWBA 4DV5I 2V2QA 4L90A 4DV7I 3ZXOA 4E02A 4R1FA 4GKJI 5A2QQ 4E01A 4P52A 1DARA 3K85A 4H81A 4XCJA 4JI4E 4CE2A 4EGKA 2BT0A 3U67A 4DV2I 4NXNI 2BYIA 2XX4A 3TTZA 4WUDA 4DR3I 2YI5A 1FWLA 4GEEA 2YE4A 2ZBKB 2BM1A 4JI8I 1XMOI 2WW4A 3HULA 4DV1E 3P06A 1J5EE 4JI6I 2H55A 4GT8A 4JV5I 1N36E 4ASFA 3FT8A 4DUHA 5A2QC 3Q6MA 5BR8E 2YKIA 4JI3I 4DR7E 3D0BA 2ZKJA 4LWIA 4LFAI 2UXBE 1IBKI 3WU4A 1BXDA 5LL6R 2XK2A 2UXDI 2GQPA 2O1VA 4DXLA 4AQYE 4QPJA 4CWNA 5M4NA 4ZKIA 2FWYA 3J81Q 3D4JA 3Q5JA 4L91A 4URLA 3HYYA 4KHPI 3VHDA 3BMYA 2YE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R4P A;  2WI3 A;  2CG9 A;  4MBC A;  2VQE E;  4X66 E;  4JAU A;  1I5B A;  2BU2 A;  4HXW A;  3B78 A;  2Q8G A;  3TZ0 A;  1THN A;  4PL9 A;  3CRL A;  1I94 E;  5FLX Q;  2Q8F A;  4K4O A;  3J81 C;  2CCU A;  3TZ4 A;  4P7A A;  2YKJ A;  1RR9 A;  4M1K A;  4X65 E;  2JJC A;  2UWD A;  2IWU A;  1R62 A;  4X64 E;  2WI2 A;  4KSH A;  3O2F A;  4BIU A;  2YEB A;  4DZY A;  2BM0 A;  1N34 I;  2XAB A;  2YGA A;  1Y8P A;  4MP7 A;  4CE3 A;  4LF5 I;  2YE2 A;  4LFB E;  4XKK A;  4YKZ A;  3INX A;  1FJG I;  2E5L I;  1HNW E;  1H7U A;  3WU3 A;  4LF7 I;  2HKJ A;  1ZXN A;  4JYA I;  4DV0 I;  5FWK A;  1Z0C A;  2PNR A;  3R92 A;  4NH8 A;  4DPX A;  1IBL I;  4FMT A;  1Z5A A;  2F4V I;  2BU5 A;  3K17 A;  2XCM A;  1A6F A;  1KIJ A;  3K98 A;  4E00 A;  3JZ3 A;  2YKC A;  1HNZ E;  1ZW9 A;  2EXL A;  1UYM A;  2YK9 A;  3HZ1 A;  4R3A A;  4CWT A;  4DR4 I;  3T10 A;  3B82 A;  4FWH A;  2O1U A;  1N32 I;  3A0T A;  1TBW A;  4LWG A;  3PEJ A;  4BIZ A;  1UYC A;  4DV3 I;  4XD8 A;  1XMQ E;  3J7A M;  2UU9 E;  1QY8 A;  5IWA E;  3VHA A;  4HXZ A;  1XNR E;  4FPP A;  4BAE A;  2HK2 A;  2YEH A;  5IT9 Q;  3QDD A;  4DPY A;  4KTN A;  4CWO A;  3RLQ A;  2XDK A;  4U7O A;  3PYD A;  2HCH A;  3ZKD A;  4JI1 E;  1I5A A;  3B26 A;  3K97 A;  1B63 A;  4EM7 A;  4LF8 E;  1L0O A;  4NXM I;  4RPF A;  1XNQ E;  1BGQ A;  2XHT A;  2ZDX A;  4NH7 A;  5CF0 A;  3D36 A;  4YHH I;  3K1J A;  1UYF A;  3K60 A;  1Z5B A;  4PU9 A;  1Z0B A;  5IT9 C;  2XJX A;  3B25 A;  4ASA A;  4L94 A;  1IBM I;  1Z59 A;  4DR2 I;  2UUC I;  4MYT A;  4LF6 I;  2CCS A;  3HEK A;  2H8M A;  2YEI A;  4B7P A;  1YET A;  4GKK I;  5GMD A;  3FV5 A;  4URO A;  3CWV A;  1YC4 A;  2YE7 A;  3OPD A;  3T0Z A;  1YES A;  4JI2 E;  4LF9 E;  2IWS A;  4XIP A;  2E0A A;  4DV6 E;  4YY3 I;  4DUY E;  5F5R A;  4DR6 I;  2WEQ A;  2AKP A;  2ZIT A;  4ZVI A;  3HZ5 A;  3T1H E;  4B3M I;  1OSF A;  1H73 A;  2IOP A;  3INW A;  4XIT A;  3R91 A;  3PYF A;  3C0E A;  2HHH E;  1MG7 A;  1QZR A;  4JI0 E;  4Q20 A;  2ZDY A;  2WER A;  5C93 A;  4JI7 I;  3G7B A;  1UYI A;  4CWR A;  1KKH A;  2QFO A;  2WEP A;  5GGZ A;  5D7R A;  4AWO A;  3ZXQ A;  4DU8 A;  4YKU A;  4ASB A;  2YEJ A;  4WUC A;  4YKY A;  4EFU A;  4MPN A;  3QT6 A;  3WU6 A;  4GGL A;  1I5C A;  5J6A A;  1JM6 A;  2XX2 A;  2XHX A;  2J7K A;  4DUZ I;  1US7 A;  4JAS A;  3CRK A;  1UYL A;  4EFT A;  3CGZ A;  2VCI A;  3EKR A;  1AH8 A;  3R4O A;  4KP4 A;  1PKP A;  4YKX A;  1GJV A;  1BKN A;  3LNU A;  4YKW A;  1Z0T A;  5F3K A;  4JI5 I;  4NH9 A;  3TZ2 A;  2GS8 A;  4X62 E;  4HAC A;  3CGY A;  3GIG A;  3C11 A;  5LMN E;  4DPW A;  4XE2 A;  2QF6 A;  2VQF E;  4DV5 E;  4B3S I;  5BOD A;  4DV7 E;  3WHA A;  2YI6 A;  2LJP A;  1GKX A;  5M4K A;  2VF3 A;  1WUU A;  4GKJ E;  1MX0 A;  1KTV A;  2HKE A;  1ID0 A;  4EEH A;  2UUB E;  1FNM A;  4DR1 E;  1FWK A;  1HNX I;  3FT5 A;  4LWE A;  4V26 A;  4DV2 E;  4NXN E;  2IWX A;  4XCL A;  1ZM3 A;  4AWQ A;  4DR3 E;  2CZ9 A;  4LWH A;  2R3V A;  2YI7 A;  1N0V C;  4JI8 E;  1XMO E;  5CTU A;  1N33 I;  4JI6 E;  4JV5 E;  2XX5 A;  3V5R A;  2DEJ A;  4JI3 E;  4XIQ A;  3T1K A;  4UT4 A;  1H7S A;  1UY8 A;  4XTJ A;  1U2O A;  3WQ9 A;  4LFA E;  3EHH A;  1IBK E;  3RLP A;  3A0Z A;  3BM9 A;  2UXD E;  4DV4 I;  3K99 A;  4L93 A;  1TID A;  2YI0 A;  4MOT A;  2BV3 A;  2YE9 A;  1KZN A;  4CWS A;  1TC0 A;  2YE5 A;  4XC0 A;  1YS3 A;  2O1W A;  1UEK A;  4KHP E;  4URM A;  5FLX C;  3EHJ A;  4O05 A;  3DGE A;  1TH8 A;  5CTX A;  5CTW A;  3KE6 A;  2ZM6 I;  4L8Z A;  2YEA A;  1ZM4 A;  4MB9 A;  4DR5 I;  2XJJ A;  2YK2 A;  4CWQ A;  3B27 A;  3T0H A;  2CCT A;  1OJ4 A;  2DEI A;  1YC3 A;  4B3R I;  1AMW A;  1UY6 A;  3F0N A;  2HFS A;  2CH4 A;  2UXC E;  2VWC A;  4LF4 I;  2ESA A;  1Z0G A;  4JI1 I;  2E1R A;  1N34 E;  4LF8 I;  1NHJ A;  1D6T A;  4LF5 E;  2BRC A;  1FKA E;  1FJG E;  2E5L E;  4O07 A;  1UYH A;  2BYH A;  4LF7 E;  3Q5L A;  1QYE A;  4JYA E;  4DV0 E;  2XDS A;  1HR0 I;  2VCJ A;  4H85 A;  1U2R A;  5CPH A;  1IBL E;  3EHF A;  3M6A A;  2F4V E;  4BQG A;  1ZM9 A;  4I3H A;  2XHR A;  2UUA I;  2Q8H A;  2YGF A;  2YJX A;  4XKA A;  4R3M A;  4OX9 I;  2CGF A;  3O0I A;  2HK3 A;  1UY9 A;  4K0K E;  2XDL A;  2XDU A;  4DR4 E;  2YEE A;  4O0B A;  1N32 E;  4DUY I;  4JG4 A;  4H7Q A;  3ZZ0 A;  3T1Y E;  1EI1 A;  2WI4 A;  4AS9 A;  3J80 Q;  3G75 A;  5LMU I;  1I5D A;  2V2Z A;  1Y4S A;  3R4N A;  3B8H A;  5GME A;  2YJW A;  3A0R A;  1YT2 A;  3WU5 A;  1S4E A;  4USM A;  1PVG A;  3OTO I;  4B3T E;  4WUB A;  4LFC I;  2BU7 A;  3ZZT A;  2BZ5 A;  1H72 C;  4CE1 A;  4NXM E;  3O6O A;  2X36 A;  4YHH E;  1YSR A;  4MP2 A;  5FNF A;  4DPU A;  4FN5 A;  2YGE A;  4ASG A;  4JI4 I;  2WI7 A;  1IBM E;  4DR2 E;  3QT8 A;  2UUC E;  4LF6 E;  1YT1 A;  1N0U A;  2IOQ A;  2JKI A;  4KSG A;  1AH6 A;  1UYD A;  2R42 A;  3V2U C;  4DPT A;  4GKK E;  5M4P A;  1ELO A;  4HZ5 A;  1TC6 A;  4DV1 I;  2YEF A;  3VAD A;  4B6C A;  4PRV A;  4YY3 E;  1J5E I;  1Z0W A;  4FCQ A;  1N36 I;  5BOC A;  1GKZ A;  2YKE A;  4DR6 E;  5BR8 I;  4JAV A;  4DR7 I;  3OMU A;  2EFG A;  1S14 A;  2BU6 A;  4B3M E;  2UXB I;  5D7C A;  3A0X A;  1Z5C A;  1NHI A;  4AQY I;  2VQF I;  1UYE A;  4JI7 E;  4AWP A;  5M4M A;  1BYQ A;  1XHK A;  2HG1 A;  2BRE A;  1Z0E A;  3LPS A;  2K5B A;  2YE6 A;  1MU5 A;  4DR1 I;  3PYE A;  2UUB I;  1NHH A;  3OWD A;  3R4M A;  2VQE I;  4X66 I;  3T2S A;  3QT7 A;  4LP0 A;  1RRE A;  2WI6 A;  1YC1 A;  4MPE A;  4DUZ E;  4CWP A;  3EHG A;  5J71 A;  3IED A;  2AJ4 A;  1I94 I;  1UYK A;  1UYG A;  3JAM Q;  2YEC A;  4HYP A;  2XJG A;  2BU8 A;  1Z0V A;  4X65 I;  1EA6 A;  2Q2E B;  3RKZ A;  4UTG A;  4X64 I;  1ZXM A;  3LTO A;  2QG2 A;  4JI5 E;  4YKR A;  1UY7 A;  4LFB I;  1PIE A;  4YKQ A;  1VIS A;  4Z7Y A;  1KVK A;  3G7E A;  3JAM C;  3J7A G;  1HNW I;  3PYG A;  4B3S E;  2Q8I A;  2BTZ A;  2FYP A;  4HY6 A;  4XDM A;  4FWD A;  1U0Z A;  4URN A;  4GQT A;  3ZM7 A;  4LPB A;  4KQV A;  1HNX E;  1Y8N A;  1YT0 A;  3A0Y A;  5M4H A;  3GIF A;  4EMD A;  1HNZ I;  5M4E A;  4EGH A;  4MPC A;  3Q1Q A;  2XD6 A;  5IDJ A;  4JQL A;  2UXC I;  1N33 E;  5D6Q A;  3GON A;  1XMQ I;  1AJ6 A;  4USK A;  2UU9 I;  5IWA I;  4PRX A;  1XNR I;  3A0W A;  2C2A A;  2XDX A;  4DU7 A;  3ZKB A;  2V34 A;  5FNC A;  2NPF A;  4EMV A;  2FWZ A;  5D6P A;  3HHU A;  4DV4 E;  4YKT A;  4Z7C A;  3PEH A;  5IDM A;  2A2D A;  4GFN A;  2WI5 A;  3B24 A;  4EGI A;  5D7D A;  1XNQ I;  1AM1 A;  4XIR A;  2X7I A;  2YED A;  2YKB A;  2ZM6 E;  2YE8 A;  1ZWH A;  4HYM A;  1K47 A;  3D2R A;  3MNR P;  4DR5 E;  2YEG A;  4K0K I;  3U2D A;  2FXS A;  4CWF A;  5L3J A;  2GFD A;  4BQJ A;  3T1Y I;  4B3R E;  2XEX A;  4FCP A;  3EKO A;  2QG0 A;  4JI2 I;  4LF9 I;  2A2C A;  4DV6 I;  3Q5K A;  4P8O A;  4HZ0 A;  4O09 A;  4LF4 E;  1ZM2 A;  4DV3 E;  1B3Q A;  1Y4U A;  4I5S A;  3T1H I;  3H4L A;  4FWG A;  3ZZU A;  5CTY A;  4B3T I;  1TIL A;  2HHH I;  4ED4 A;  3VHC A;  4JI0 I;  3TUH A;  4HY1 A;  3RLR A;  3SL2 A;  2BSM A;  1H74 A;  1NZ0 A;  3QT5 A;  4MYU A;  1I58 A;  1HR0 E;  2WI1 A;  3QTF A;  3J80 C;  4X9L A;  2UUA E;  2V8P A;  2V2V A;  3NMQ A;  4OX9 E;  4V25 A;  4QPK A;  4FW9 A;  1YSZ A;  3TZ5 A;  3H80 A;  5IN9 A;  4FCR A;  3GIE A;  4LWF A;  1S16 A;  4KFG A;  4O04 A;  1I59 A;  4GCZ A;  5LMU E;  2OI2 A;  5FND A;  4BXI A;  1A4H A;  2IOR A;  2HFU A;  2VW5 A;  1FI4 A;  3OW6 A;  3B28 A;  4U93 A;  3OTO E;  1YER A;  1B62 A;  4X62 I;  3U2K A;  4LFC E;  4HAC B;  5LMN I;  3HYZ A;  3GIG B;  1Y8O A;  4XKO A;  4U7N A;  4W7T A;  3OWB A;  4DV5 I;  2V2Q A;  4L90 A;  4DV7 I;  3ZXO A;  4E02 A;  4R1F A;  4GKJ I;  5A2Q Q;  4E01 A;  4P52 A;  1DAR A;  4XCJ A;  4H81 A;  4CE2 A;  4JI4 E;  4EGK A;  2BT0 A;  3U67 A;  4DV2 I;  4NXN I;  2BYI A;  2XX4 A;  3TTZ A;  4WUD A;  4DR3 I;  2YI5 A;  1FWL A;  4GEE A;  2YE4 A;  2ZBK B;  2BM1 A;  4JI8 I;  1XMO I;  2WW4 A;  3HUL A;  4DV1 E;  1J5E E;  4JI6 I;  2H55 A;  4GT8 A;  4JV5 I;  1N36 E;  4ASF A;  3FT8 A;  4DUH A;  5A2Q C;  5BR8 E;  2YKI A;  4JI3 I;  4DR7 E;  3D0B A;  2ZKJ A;  4LWI A;  4LFA I;  2UXB E;  1IBK I;  3WU4 A;  1BXD A;  5LL6 R;  2XK2 A;  2UXD I;  2GQP A;  2O1V A;  4DXL A;  4AQY E;  4QPJ A;  4CWN A;  5M4N A;  4ZKI A;  2FWY A;  3J81 Q;  3D4J A;  3Q5J A;  4L91 A;  4URL A;  3HYY A;  4KHP I;  3VHD A;  3BMY A;  2YE3 A; 
#chains in the Genus database with same CATH topology
 3R4P A;  2WI3 A;  4LCH A;  2CG9 A;  4MBC A;  2VQE E;  4X66 E;  4JAU A;  1I5B A;  2C39 A;  2BU2 A;  4HXW A;  3B78 A;  2Q8G A;  3TZ0 A;  2PO2 B;  1UDN A;  1THN A;  3HKM A;  4PL9 A;  3CRL A;  2GQ0 A;  2VES A;  1I94 E;  5FLX Q;  2Q8F A;  4K4O A;  3J81 C;  4LPF A;  1IXM A;  2CCU A;  3TZ4 A;  4P7A A;  2YKJ A;  1RR9 A;  4M1K A;  4X65 E;  2JJC A;  2UWD A;  3CYG A;  2IWU A;  1R62 A;  4X64 E;  2WI2 A;  4KSH A;  3O2F A;  4BIU A;  2YEB A;  4DZY A;  2BM0 A;  1N34 I;  2XAB A;  2YGA A;  1Y8P A;  3U1Y A;  4MP7 A;  5K36 D;  4CE3 A;  3CDJ A;  4LF5 I;  2YE2 A;  4LFB E;  4XKK A;  4YKZ A;  3INX A;  1FJG I;  2E5L I;  1HNW E;  1H7U A;  3WU3 A;  4LF7 I;  2HKJ A;  1ZXN A;  4JYA I;  5FWK A;  4DV0 I;  1Z0C A;  1VI7 A;  2PNR A;  3R92 A;  2PO2 A;  4NH8 A;  4DPX A;  1IBL I;  4FMT A;  1Z5A A;  2F4V I;  2BU5 A;  3K17 A;  2XCM A;  2C1I A;  1A6F A;  1KIJ A;  3PS2 A;  3K98 A;  4E00 A;  3JZ3 A;  2YKC A;  5DRR A;  1HNZ E;  1ZW9 A;  2EXL A;  1UYM A;  2YK9 A;  3HZ1 A;  4OO1 C;  4R3A A;  4CWT A;  4DR4 I;  3T10 A;  2O1U A;  3B82 A;  4FWH A;  1N32 I;  3A0T A;  1TBW A;  4LWG A;  4IZJ D;  3PEJ A;  1UYC A;  4DV3 I;  4XD8 A;  4BIZ A;  1XMQ E;  3J7A M;  4FW6 A;  2UU9 E;  1QY8 A;  5IWA E;  3VHA A;  4HXZ A;  1XNR E;  4FPP A;  4BAE A;  2HK2 A;  2YEH A;  5IT9 Q;  3QDD A;  4DPY A;  4KTN A;  4CWO A;  4OZE A;  3RLQ A;  2XDK A;  4U7O A;  2GO3 A;  3H1C A;  3PYD A;  2HCH A;  3ZKD A;  4JI1 E;  1I5A A;  3B26 A;  3K97 A;  1B63 A;  4EM7 A;  4LF8 E;  1L0O A;  4NXM I;  4RPF A;  1XNQ E;  1BGQ A;  2XHT A;  2ZDX A;  4NH7 A;  5CF0 A;  3D36 A;  2Z5B B;  4YHH I;  2NN6 F;  4FW5 A;  3K1J A;  3Q6N A;  1UYF A;  3K60 A;  4PU9 A;  1Z5B A;  1Z0B A;  4IZK A;  5IT9 C;  2XJX A;  2WP8 A;  4MDT A;  3B25 A;  2BA1 D;  4L94 A;  1IBM I;  1Z59 A;  4DR2 I;  4ISA A;  4MYT A;  2UUC I;  4LF6 I;  2CCS A;  2H8M A;  2YEI A;  3P3G A;  3HEK A;  4B7P A;  1YET A;  4GKK I;  2Z5C B;  5GMD A;  2O1T A;  3FV5 A;  2PNM A;  4URO A;  3CWV A;  2IES A;  4BA2 A;  1YC4 A;  2YE7 A;  1YES A;  3OPD A;  4JI2 E;  4LF9 E;  2IWS A;  4XIP A;  2E0A A;  4DV6 E;  4YY3 I;  3T0Z A;  4DUY E;  5F5R A;  4IZJ B;  4AIM A;  4DR6 I;  4BA1 B;  2WEQ A;  2AKP A;  2ZIT A;  4ZVI A;  2O3Z A;  3T1H E;  3HZ5 A;  1R6L A;  1R6M A;  3CDI A;  1H73 A;  2IOP A;  3L7Z A;  5EKW A;  4B3M I;  1OSF A;  3PYF A;  3C0E A;  2HHH E;  3INW A;  1MG7 A;  1QZR A;  5JEA C;  4JI0 E;  4Q20 A;  2ZDY A;  2WER A;  5C93 A;  4OO1 A;  4JI7 I;  3G7B A;  4MQY A;  2Z5B A;  1XXE A;  1KKH A;  1UYI A;  2QFO A;  2WEP A;  5GGZ A;  4CWR A;  5D7R A;  4AWO A;  3ZXQ A;  4DU8 A;  4YKU A;  4ASB A;  2YEJ A;  4WUC A;  4YKY A;  4EFU A;  4MPN A;  3QT6 A;  4MU4 A;  3WU6 A;  1I5C A;  4GGL A;  2NN6 D;  5J6A A;  2Z5C A;  2BA0 D;  1JM6 A;  2XX2 A;  2XHX A;  2J7K A;  4DUZ I;  1US7 A;  4JAS A;  3CRK A;  5C0X E;  1UYL A;  4EFT A;  3CGZ A;  4IZJ A;  2VCI A;  3EKR A;  4BA1 A;  2GO4 A;  1AH8 A;  3R4O A;  4ASA A;  4KP4 A;  1PKP A;  5EL9 A;  4YKX A;  1GJV A;  1UDO A;  1BKN A;  5C0X F;  3LNU A;  4YKW A;  1Z0T A;  5F3K A;  2Z5E A;  4JI5 I;  4NH9 A;  3TZ2 A;  3GLL A;  2GS8 A;  5DRP A;  4X62 E;  4HAC A;  3CGY A;  3GIG A;  3C11 A;  5LMN E;  4DPW A;  4XE2 A;  2QF6 A;  2VQF E;  4DV5 E;  4B3S I;  5BOD A;  2JE6 A;  2BA0 G;  4DV7 E;  3WHA A;  2YI6 A;  2LJP A;  1GKX A;  5M4K A;  2VF3 A;  1WUU A;  2PNL A;  4GKJ E;  1MX0 A;  1KTV A;  2HKE A;  1ID0 A;  2JEA B;  4EEH A;  2UUB E;  1FNM A;  4DR1 E;  1FWK A;  1HNX I;  3FT5 A;  4LWE A;  4V26 A;  4E72 A;  4DV2 E;  5DNL A;  4NXN E;  4OO1 E;  5JEA A;  1ZM3 A;  2IWX A;  4XCL A;  2NN6 B;  4DR3 E;  4AWQ A;  2CZ9 A;  4LWH A;  2R3V A;  2YI7 A;  4MU0 A;  4OKG A;  1N0V C;  4JI8 E;  1XMO E;  5CTU A;  1N33 I;  4JI6 E;  2CGE A;  4JV5 E;  2XX5 A;  3V5R A;  2DEJ A;  4JI3 E;  4XIQ A;  3T1K A;  4UT4 A;  1H7S A;  1UY8 A;  4XTJ A;  1U2O A;  3WQ9 A;  4LFA E;  1F51 A;  1IBK E;  3EHH A;  3RLP A;  3A0Z A;  3BM9 A;  2UXD E;  4DV4 I;  3K99 A;  4L93 A;  1TID A;  2WNR A;  2YI0 A;  4MOT A;  2BV3 A;  2YE9 A;  1KZN A;  3PRY A;  4CWS A;  1TC0 A;  2YE5 A;  4XC0 A;  1YS3 A;  2O1W A;  1UEK A;  4KHP E;  4URM A;  5FLX C;  3EHJ A;  4O05 A;  3DGE A;  1TH8 A;  5CTX A;  5CTW A;  3KE6 A;  2ZM6 I;  4IFD E;  3U1K A;  2YEA A;  1ZM4 A;  4L8Z A;  4MB9 A;  4DR5 I;  2XJJ A;  5DNX A;  2YK2 A;  4CWQ A;  3B4T A;  2F1D A;  3B27 A;  2CCT A;  2C37 B;  1OJ4 A;  5K36 C;  2DEI A;  3LMM A;  1YC3 A;  4B3R I;  3T0H A;  1USV A;  1AMW A;  4IFD F;  1UY6 A;  3F0N A;  4MU1 A;  2HFS A;  3P3E A;  2CH4 A;  2UXC E;  2VWC A;  4LF4 I;  2ESA A;  1Z0G A;  5JEA E;  4JI1 I;  2E1R A;  1N34 E;  3PS1 A;  4LF8 I;  1NHJ A;  1D6T A;  4LF5 E;  2BRC A;  2C38 B;  1FKA E;  1FJG E;  2E5L E;  1RHY A;  4O07 A;  1UYH A;  5K36 B;  2BYH A;  4LF7 E;  3Q5L A;  1QYE A;  1E3P A;  4JYA E;  2CVE A;  4DV0 E;  2XDS A;  1HR0 I;  2VCJ A;  4H85 A;  1U2R A;  5CPH A;  1IBL E;  3EHF A;  3M6A A;  2F4V E;  4BQG A;  1ZM9 A;  4I3H A;  3P3C A;  2XHR A;  2UUA I;  2Q8H A;  2YGF A;  2YJX A;  4XKA A;  4R3M A;  4OX9 I;  2HHI A;  2CGF A;  3O0I A;  2HK3 A;  1UY9 A;  2JEB B;  2PNZ B;  4K0K E;  2XDL A;  2XDU A;  4DR4 E;  2YEE A;  4O0B A;  1N32 E;  4DUY I;  4JG4 A;  4H7Q A;  5DRQ A;  3ZZ0 A;  3T1Y E;  1EI1 A;  2WI4 A;  4AS9 A;  3J80 Q;  3G75 A;  5LMU I;  1I5D A;  1Y4S A;  2V2Z A;  3R4N A;  3B8H A;  5GME A;  2YJW A;  3A0R A;  1YT2 A;  3WU5 A;  1S4E A;  4QNK A;  2BR2 B;  1PVG A;  4USM A;  3OTO I;  5K36 A;  3GME A;  4WUB A;  4LFC I;  4B3T E;  2BU7 A;  3ZZT A;  2BZ5 A;  1H72 C;  4AM3 A;  4CE1 A;  4NXM E;  3O6O A;  2X36 A;  4YHH E;  1YSR A;  1HK7 A;  4MP2 A;  5FNF A;  4DPU A;  4FN5 A;  1YHC A;  2BA1 G;  3HJC A;  4JI4 I;  2YGE A;  4ASG A;  2WI7 A;  1IBM E;  2IOQ A;  3QT8 A;  4DR2 E;  2UUC E;  4LF6 E;  1N0U A;  1YT1 A;  5ELW A;  2JKI A;  1AH6 A;  1UYD A;  2R42 A;  3V2U C;  4DPT A;  4KSG A;  4GKK E;  5M4P A;  1ELO A;  4HZ5 A;  1TC6 A;  4MU3 A;  4DV1 I;  2YEF A;  3VAD A;  4B6C A;  3DD6 A;  4PRV A;  4YY3 E;  1J5E I;  1YH8 A;  1Z0W A;  4FCQ A;  1N36 I;  5BOC A;  1GKZ A;  2YKE A;  4DR6 E;  1UDQ A;  5BR8 I;  4JAV A;  4DR7 I;  3OMU A;  2EFG A;  1S14 A;  2BU6 A;  4B3M E;  3GCM A;  3M7N D;  2UXB I;  5D7C A;  3A0X A;  2NN6 C;  1Z5C A;  1NHI A;  4AQY I;  2VQF I;  1UYE A;  4JI7 E;  4AWP A;  5M4M A;  1BYQ A;  1XHK A;  2HG1 A;  2BRE A;  1Z0E A;  3LPS A;  2K5B A;  2YE6 A;  1MU5 A;  4DR1 I;  3PYE A;  2UUB I;  1NHH A;  3OWD A;  3R4M A;  2VQE I;  4X66 I;  3T2S A;  3QT7 A;  4LP0 A;  1RRE A;  2C39 B;  1YC1 A;  2WI6 A;  5K36 E;  4MPE A;  4DUZ E;  4CWP A;  3EHG A;  5J71 A;  1Y6Z A;  3IED A;  2AJ4 A;  1I94 I;  1UYK A;  1UYG A;  3JAM Q;  2YEC A;  1USU A;  4HYP A;  2XJG A;  2BU8 A;  1Z0V A;  2PO0 B;  4X65 I;  1EA6 A;  2Q2E B;  3RKZ A;  4UTG A;  4AID A;  4X64 I;  4OO1 F;  1ZXM A;  3LTO A;  2QG2 A;  4IS9 A;  4XIT A;  4JI5 E;  4YKR A;  1UY7 A;  4LFB I;  1PIE A;  4YKQ A;  4Z7Y A;  1VIS A;  1P42 A;  1KVK A;  3PS3 A;  5C0X D;  3G7E A;  3JAM C;  3J7A G;  1HNW I;  3PYG A;  4B3S E;  2Q8I A;  2BTZ A;  2FYP A;  3P76 A;  4HY6 A;  4XDM A;  4FWD A;  1U0Z A;  4URN A;  2JEA A;  4GQT A;  3ZM7 A;  4LPB A;  4KQV A;  1HNX E;  1Y8N A;  1YT0 A;  3A0Y A;  5M4H A;  2NN6 A;  3GIF A;  4EMD A;  1HNZ I;  5M4E A;  5C0X C;  4EGH A;  2PO0 A;  4MPC A;  3Q1Q A;  2XD6 A;  5IDJ A;  4JQL A;  2UXC I;  1N33 E;  5D6Q A;  2AE8 A;  3GON A;  4N3O A;  1XMQ I;  1AJ6 A;  4USK A;  2UU9 I;  5IWA I;  4PRX A;  1XNR I;  3A0W A;  2C2A A;  2XDX A;  4DU7 A;  3ZKB A;  2V34 A;  5FNC A;  2NPF A;  4EMV A;  2FWZ A;  5D6P A;  3HHU A;  4OO1 D;  4DV4 E;  4YKT A;  4Z7C A;  3PEH A;  5IDM A;  2A2D A;  3NZK A;  4GFN A;  2WI5 A;  3B24 A;  4EGI A;  4NBQ A;  2J65 A;  5D7D A;  1XNQ I;  5C0X B;  3R91 A;  1AM1 A;  5JEA F;  4XIR A;  2X7I A;  2YED A;  2YKB A;  2ZM6 E;  2YE8 A;  1ZWH A;  4HYM A;  1K47 A;  4IZK B;  3D2R A;  4DR5 E;  3MNR P;  2WP8 B;  2YEG A;  4K0K I;  3U2D A;  2FXS A;  4CWF A;  4GQU A;  2C37 A;  5L3J A;  2GFD A;  4BQJ A;  3T1Y I;  4B3R E;  4J3D A;  2XEX A;  4FCP A;  3EKO A;  2QG0 A;  4JI2 I;  4LF9 I;  4BA2 B;  2A2C A;  4U3D A;  4DV6 I;  3Q5K A;  4P8O A;  4HZ0 A;  4O09 A;  1UDS A;  4LF4 E;  1ZM2 A;  4DV3 E;  1Y4U A;  1B3Q A;  4I5S A;  3M85 D;  2NN6 E;  3H4L A;  4FWG A;  3ZZU A;  3T1H I;  4IFD D;  2FTK A;  5CTY A;  4B3T I;  1TIL A;  3L7Z B;  2HHH I;  4ED4 A;  3VHC A;  4JI0 I;  3TUH A;  2C38 A;  4HY1 A;  5C0X A;  3RLR A;  3SL2 A;  4OO1 B;  2BSM A;  2C1G A;  4FW7 A;  1H74 A;  1NZ0 A;  3QT5 A;  4MYU A;  1E3H A;  1I58 A;  1HR0 E;  2WI1 A;  4IFD C;  3QTF A;  3J80 C;  4X9L A;  5JEA D;  4FW3 A;  2V8P A;  2UUA E;  2V2V A;  3NMQ A;  2JT2 A;  2JEB A;  2PNZ A;  5DRO A;  4OX9 E;  4V25 A;  4QPK A;  4FW9 A;  1YSZ A;  3TZ5 A;  3H80 A;  5IN9 A;  4FCR A;  3M85 G;  3GIE A;  4LWF A;  1OYS A;  1S16 A;  4KFG A;  4O04 A;  1I59 A;  4GCZ A;  5LMU E;  2OI2 A;  2IER A;  5FND A;  2PO1 B;  1A4H A;  4BXI A;  2IOR A;  2HFU A;  2VW5 A;  1FI4 A;  2BR2 A;  3B28 A;  3OW6 A;  4IFD B;  4U93 A;  3OTO E;  1YER A;  1B62 A;  4X62 I;  3U2K A;  3S5T A;  4LFC E;  4HAC B;  5LMN I;  3HYZ A;  3GIG B;  1Y8O A;  4XKO A;  4U7N A;  4W7T A;  3OWB A;  4DV5 I;  2V2Q A;  4L90 A;  1OYP A;  4DV7 I;  3ZXO A;  4E02 A;  2JE6 B;  4R1F A;  1OYR A;  4GKJ I;  5A2Q Q;  4E01 A;  4P52 A;  4LCF A;  1DAR A;  3K85 A;  4H81 A;  4JI4 E;  4XCJ A;  1Y5Y A;  4CE2 A;  4EGK A;  2BT0 A;  3U67 A;  3KRN A;  4DV2 I;  4NXN I;  2BYI A;  1Y60 A;  2XX4 A;  4WUD A;  3TTZ A;  4DR3 I;  5JEA B;  1FWL A;  2YI5 A;  4GEE A;  2YE4 A;  2ZBK B;  5JEN A;  2BM1 A;  4JI8 I;  1XMO I;  2WW4 A;  3HUL A;  4DV1 E;  2PO1 A;  3P06 A;  1J5E E;  4JI6 I;  2H55 A;  4GT8 A;  4JV5 I;  1N36 E;  4ASF A;  3FT8 A;  4DUH A;  3M7N G;  5A2Q C;  3Q6M A;  5BR8 E;  4IFD A;  4JI3 I;  4DR7 E;  5K36 F;  2YKI A;  3D0B A;  2ZKJ A;  4LWI A;  4FW4 A;  4LFA I;  2UXB E;  1IBK I;  3WU4 A;  1BXD A;  4QNJ A;  5LL6 R;  2XK2 A;  2UXD I;  4U3B A;  2GQP A;  2O1V A;  4LCG A;  4DXL A;  4AQY E;  4QPJ A;  2WNR B;  4CWN A;  5M4N A;  3UHM A;  4ZKI A;  2FWY A;  3J81 Q;  3D4J A;  3Q5J A;  4L91 A;  4URL A;  3HYY A;  4KHP I;  3VHD A;  3BMY A;  2YE3 A;  4LOM A; 
#chains in the Genus database with same CATH homology
 3R4P A;  2WI3 A;  2CG9 A;  4MBC A;  2VQE E;  4X66 E;  4JAU A;  1I5B A;  2BU2 A;  4HXW A;  3B78 A;  2Q8G A;  3TZ0 A;  1THN A;  4PL9 A;  3CRL A;  2GQ0 A;  1I94 E;  5FLX Q;  2Q8F A;  4K4O A;  3J81 C;  2CCU A;  3TZ4 A;  4P7A A;  2YKJ A;  1RR9 A;  4M1K A;  4X65 E;  2JJC A;  2UWD A;  2IWU A;  1R62 A;  4X64 E;  2WI2 A;  4KSH A;  3O2F A;  4BIU A;  2YEB A;  4DZY A;  2BM0 A;  1N34 I;  2XAB A;  2YGA A;  1Y8P A;  4MP7 A;  4CE3 A;  4LF5 I;  2YE2 A;  4LFB E;  4XKK A;  4YKZ A;  3INX A;  1FJG I;  2E5L I;  1HNW E;  1H7U A;  3WU3 A;  4LF7 I;  2HKJ A;  1ZXN A;  4JYA I;  5FWK A;  4DV0 I;  1Z0C A;  2PNR A;  3R92 A;  4NH8 A;  4DPX A;  1IBL I;  4FMT A;  1Z5A A;  2F4V I;  2BU5 A;  3K17 A;  2XCM A;  1A6F A;  1KIJ A;  3K98 A;  4E00 A;  3JZ3 A;  2YKC A;  1HNZ E;  1ZW9 A;  2EXL A;  1UYM A;  2YK9 A;  3HZ1 A;  4R3A A;  4CWT A;  4DR4 I;  3T10 A;  2O1U A;  3B82 A;  4FWH A;  1N32 I;  3A0T A;  1TBW A;  4LWG A;  4IZJ D;  3PEJ A;  1UYC A;  4DV3 I;  4XD8 A;  4BIZ A;  1XMQ E;  3J7A M;  2UU9 E;  1QY8 A;  5IWA E;  3VHA A;  4HXZ A;  1XNR E;  4FPP A;  4BAE A;  2HK2 A;  2YEH A;  5IT9 Q;  3QDD A;  4DPY A;  4KTN A;  4CWO A;  3RLQ A;  2XDK A;  4U7O A;  3PYD A;  2HCH A;  3ZKD A;  4JI1 E;  1I5A A;  3B26 A;  3K97 A;  1B63 A;  4EM7 A;  4LF8 E;  1L0O A;  4NXM I;  4RPF A;  1XNQ E;  1BGQ A;  2XHT A;  2ZDX A;  4NH7 A;  5CF0 A;  3D36 A;  2Z5B B;  4YHH I;  3K1J A;  3Q6N A;  1UYF A;  3K60 A;  1Z5B A;  4IZK A;  1Z0B A;  4PU9 A;  5IT9 C;  2XJX A;  3B25 A;  4ASA A;  4L94 A;  1IBM I;  1Z59 A;  4DR2 I;  2UUC I;  4MYT A;  4LF6 I;  2CCS A;  3HEK A;  2H8M A;  2YEI A;  4B7P A;  1YET A;  4GKK I;  2Z5C B;  5GMD A;  2O1T A;  3FV5 A;  2PNM A;  4URO A;  3CWV A;  1YC4 A;  2YE7 A;  3OPD A;  3T0Z A;  1YES A;  4JI2 E;  4LF9 E;  2IWS A;  4XIP A;  2E0A A;  4DV6 E;  4YY3 I;  4DUY E;  5F5R A;  4IZJ B;  4DR6 I;  2WEQ A;  2AKP A;  2ZIT A;  4ZVI A;  3HZ5 A;  3T1H E;  4B3M I;  1OSF A;  1H73 A;  2IOP A;  3INW A;  4XIT A;  3R91 A;  3PYF A;  3C0E A;  2HHH E;  1MG7 A;  1QZR A;  4JI0 E;  4Q20 A;  2ZDY A;  2WER A;  5C93 A;  4JI7 I;  3G7B A;  1UYI A;  2Z5B A;  4CWR A;  1KKH A;  2QFO A;  2WEP A;  5GGZ A;  5D7R A;  4AWO A;  3ZXQ A;  4DU8 A;  4YKU A;  4ASB A;  2YEJ A;  4WUC A;  4YKY A;  4EFU A;  4MPN A;  3QT6 A;  3WU6 A;  4GGL A;  1I5C A;  5J6A A;  2Z5C A;  1JM6 A;  2XX2 A;  2XHX A;  2J7K A;  4DUZ I;  1US7 A;  4JAS A;  3CRK A;  1UYL A;  4EFT A;  3CGZ A;  4IZJ A;  2VCI A;  3EKR A;  1AH8 A;  3R4O A;  4KP4 A;  1PKP A;  4YKX A;  1GJV A;  1BKN A;  3LNU A;  4YKW A;  1Z0T A;  5F3K A;  2Z5E A;  4JI5 I;  4NH9 A;  3TZ2 A;  2GS8 A;  4X62 E;  4HAC A;  3CGY A;  3GIG A;  3C11 A;  5LMN E;  4DPW A;  4XE2 A;  2QF6 A;  2VQF E;  4DV5 E;  4B3S I;  5BOD A;  4DV7 E;  3WHA A;  2YI6 A;  2LJP A;  1GKX A;  5M4K A;  2VF3 A;  1WUU A;  2PNL A;  4GKJ E;  1MX0 A;  1KTV A;  2HKE A;  1ID0 A;  4EEH A;  2UUB E;  1FNM A;  4DR1 E;  1FWK A;  1HNX I;  3FT5 A;  4LWE A;  4V26 A;  4DV2 E;  4NXN E;  2IWX A;  4XCL A;  1ZM3 A;  4AWQ A;  4DR3 E;  2CZ9 A;  4LWH A;  2R3V A;  2YI7 A;  1N0V C;  4JI8 E;  1XMO E;  5CTU A;  1N33 I;  4JI6 E;  2CGE A;  4JV5 E;  2XX5 A;  3V5R A;  2DEJ A;  4JI3 E;  4XIQ A;  3T1K A;  4UT4 A;  1H7S A;  1UY8 A;  4XTJ A;  1U2O A;  3WQ9 A;  4LFA E;  3EHH A;  1IBK E;  3RLP A;  3A0Z A;  3BM9 A;  2UXD E;  4DV4 I;  3K99 A;  4L93 A;  1TID A;  2YI0 A;  4MOT A;  2BV3 A;  2YE9 A;  1KZN A;  3PRY A;  4CWS A;  1TC0 A;  2YE5 A;  4XC0 A;  1YS3 A;  2O1W A;  1UEK A;  4KHP E;  4URM A;  5FLX C;  3EHJ A;  4O05 A;  3DGE A;  1TH8 A;  5CTX A;  5CTW A;  3KE6 A;  2ZM6 I;  4L8Z A;  2YEA A;  1ZM4 A;  4MB9 A;  4DR5 I;  2XJJ A;  2YK2 A;  4CWQ A;  3B27 A;  3T0H A;  2CCT A;  1OJ4 A;  2DEI A;  1YC3 A;  4B3R I;  1USV A;  1AMW A;  1UY6 A;  3F0N A;  2HFS A;  2CH4 A;  2UXC E;  2VWC A;  4LF4 I;  2ESA A;  1Z0G A;  4JI1 I;  2E1R A;  1N34 E;  4LF8 I;  1NHJ A;  1D6T A;  4LF5 E;  2BRC A;  1FKA E;  1FJG E;  2E5L E;  4O07 A;  1UYH A;  2BYH A;  4LF7 E;  3Q5L A;  1QYE A;  4JYA E;  4DV0 E;  2XDS A;  1HR0 I;  2VCJ A;  4H85 A;  1U2R A;  5CPH A;  1IBL E;  3EHF A;  3M6A A;  2F4V E;  4BQG A;  1ZM9 A;  4I3H A;  2XHR A;  2UUA I;  2Q8H A;  2YGF A;  2YJX A;  4XKA A;  4R3M A;  4OX9 I;  2CGF A;  3O0I A;  2HK3 A;  1UY9 A;  4K0K E;  2XDL A;  2XDU A;  4DR4 E;  2YEE A;  4O0B A;  1N32 E;  4DUY I;  4JG4 A;  4H7Q A;  3ZZ0 A;  3T1Y E;  1EI1 A;  2WI4 A;  4AS9 A;  3J80 Q;  3G75 A;  5LMU I;  1I5D A;  1Y4S A;  2V2Z A;  3R4N A;  3B8H A;  5GME A;  2YJW A;  3A0R A;  1YT2 A;  3WU5 A;  1S4E A;  4USM A;  1PVG A;  3OTO I;  4B3T E;  4WUB A;  4LFC I;  2BU7 A;  3ZZT A;  2BZ5 A;  1H72 C;  4CE1 A;  4NXM E;  3O6O A;  2X36 A;  4YHH E;  1YSR A;  1HK7 A;  4MP2 A;  5FNF A;  4DPU A;  4FN5 A;  2YGE A;  3HJC A;  4JI4 I;  4ASG A;  2WI7 A;  1IBM E;  2IOQ A;  3QT8 A;  4DR2 E;  2UUC E;  4LF6 E;  1N0U A;  1YT1 A;  2JKI A;  4KSG A;  1AH6 A;  1UYD A;  2R42 A;  3V2U C;  4DPT A;  4GKK E;  5M4P A;  1ELO A;  4HZ5 A;  1TC6 A;  4DV1 I;  2YEF A;  3VAD A;  4B6C A;  4PRV A;  4YY3 E;  1J5E I;  1Z0W A;  4FCQ A;  1N36 I;  5BOC A;  1GKZ A;  2YKE A;  4DR6 E;  5BR8 I;  4JAV A;  4DR7 I;  3OMU A;  2EFG A;  1S14 A;  2BU6 A;  4B3M E;  2UXB I;  5D7C A;  3A0X A;  1Z5C A;  1NHI A;  4AQY I;  2VQF I;  1UYE A;  4JI7 E;  4AWP A;  5M4M A;  1BYQ A;  1XHK A;  2HG1 A;  2BRE A;  1Z0E A;  3LPS A;  2K5B A;  2YE6 A;  1MU5 A;  4DR1 I;  3PYE A;  2UUB I;  1NHH A;  3OWD A;  3R4M A;  2VQE I;  4X66 I;  3T2S A;  3QT7 A;  4LP0 A;  1RRE A;  2WI6 A;  1YC1 A;  4MPE A;  4DUZ E;  4CWP A;  3EHG A;  5J71 A;  1Y6Z A;  3IED A;  2AJ4 A;  1I94 I;  1UYK A;  1UYG A;  3JAM Q;  2YEC A;  1USU A;  4HYP A;  2XJG A;  2BU8 A;  1Z0V A;  4X65 I;  1EA6 A;  2Q2E B;  3RKZ A;  4UTG A;  4X64 I;  1ZXM A;  3LTO A;  2QG2 A;  4JI5 E;  4YKR A;  1UY7 A;  4LFB I;  1PIE A;  4YKQ A;  1VIS A;  4Z7Y A;  1KVK A;  3G7E A;  3JAM C;  3J7A G;  1HNW I;  3PYG A;  4B3S E;  2Q8I A;  2BTZ A;  2FYP A;  4HY6 A;  4XDM A;  4FWD A;  1U0Z A;  4URN A;  4GQT A;  3ZM7 A;  4LPB A;  4KQV A;  1HNX E;  1Y8N A;  1YT0 A;  3A0Y A;  5M4H A;  3GIF A;  4EMD A;  1HNZ I;  5M4E A;  4EGH A;  4MPC A;  3Q1Q A;  2XD6 A;  5IDJ A;  4JQL A;  2UXC I;  1N33 E;  5D6Q A;  3GON A;  4N3O A;  1XMQ I;  1AJ6 A;  4USK A;  2UU9 I;  5IWA I;  4PRX A;  1XNR I;  3A0W A;  2C2A A;  2XDX A;  4DU7 A;  3ZKB A;  2V34 A;  5FNC A;  2NPF A;  4EMV A;  2FWZ A;  5D6P A;  3HHU A;  4DV4 E;  4YKT A;  4Z7C A;  3PEH A;  5IDM A;  2A2D A;  4GFN A;  2WI5 A;  3B24 A;  4EGI A;  5D7D A;  1XNQ I;  1AM1 A;  4XIR A;  2X7I A;  2YED A;  2YKB A;  2ZM6 E;  2YE8 A;  1ZWH A;  4HYM A;  1K47 A;  4IZK B;  3D2R A;  4DR5 E;  3MNR P;  2YEG A;  4K0K I;  3U2D A;  2FXS A;  4CWF A;  5L3J A;  2GFD A;  4BQJ A;  3T1Y I;  4B3R E;  2XEX A;  4FCP A;  3EKO A;  2QG0 A;  4JI2 I;  4LF9 I;  2A2C A;  4DV6 I;  3Q5K A;  4P8O A;  4HZ0 A;  4O09 A;  4LF4 E;  1ZM2 A;  4DV3 E;  1Y4U A;  1B3Q A;  4I5S A;  3T1H I;  3H4L A;  4FWG A;  3ZZU A;  5CTY A;  4B3T I;  1TIL A;  2HHH I;  4ED4 A;  3VHC A;  4JI0 I;  3TUH A;  4HY1 A;  3RLR A;  3SL2 A;  2BSM A;  1H74 A;  1NZ0 A;  3QT5 A;  4MYU A;  1I58 A;  1HR0 E;  2WI1 A;  3QTF A;  3J80 C;  4X9L A;  2UUA E;  2V8P A;  2V2V A;  3NMQ A;  4OX9 E;  4V25 A;  4QPK A;  4FW9 A;  1YSZ A;  3TZ5 A;  3H80 A;  5IN9 A;  4FCR A;  3GIE A;  4LWF A;  1S16 A;  4KFG A;  4O04 A;  1I59 A;  4GCZ A;  5LMU E;  2OI2 A;  5FND A;  4BXI A;  1A4H A;  2IOR A;  2HFU A;  2VW5 A;  1FI4 A;  3OW6 A;  3B28 A;  4U93 A;  3OTO E;  1YER A;  1B62 A;  4X62 I;  3U2K A;  4LFC E;  4HAC B;  5LMN I;  3HYZ A;  3GIG B;  1Y8O A;  4XKO A;  4U7N A;  4W7T A;  3OWB A;  4DV5 I;  2V2Q A;  4L90 A;  4DV7 I;  3ZXO A;  4E02 A;  4R1F A;  4GKJ I;  5A2Q Q;  4E01 A;  4P52 A;  1DAR A;  3K85 A;  4H81 A;  4XCJ A;  4JI4 E;  4CE2 A;  4EGK A;  2BT0 A;  3U67 A;  4DV2 I;  4NXN I;  2BYI A;  2XX4 A;  3TTZ A;  4WUD A;  4DR3 I;  2YI5 A;  1FWL A;  4GEE A;  2YE4 A;  2ZBK B;  2BM1 A;  4JI8 I;  1XMO I;  2WW4 A;  3HUL A;  4DV1 E;  3P06 A;  1J5E E;  4JI6 I;  2H55 A;  4GT8 A;  4JV5 I;  1N36 E;  4ASF A;  3FT8 A;  4DUH A;  5A2Q C;  3Q6M A;  5BR8 E;  2YKI A;  4JI3 I;  4DR7 E;  3D0B A;  2ZKJ A;  4LWI A;  4LFA I;  2UXB E;  1IBK I;  3WU4 A;  1BXD A;  5LL6 R;  2XK2 A;  2UXD I;  2GQP A;  2O1V A;  4DXL A;  4AQY E;  4QPJ A;  4CWN A;  5M4N A;  4ZKI A;  2FWY A;  3J81 Q;  3D4J A;  3Q5J A;  4L91 A;  4URL A;  3HYY A;  4KHP I;  3VHD A;  3BMY A;  2YE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...