1QZTA

Phosphotransacetylase from methanosarcina thermophila
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
332
Chain Sequence
b'VTFLEKISERAKKLNKTIALPETEDIRTLQAAAKILERGIADIVLVGNEADIKALAGDLDLSKAKIVDPKTYEKKDEYINAFYELRKHKGITLENAAEIMSDYVYFAVMMAKLGEVDGVVSGAAHSSSDTLRPAVQIVKTAKGAALASAFFIISVPDCEYGSDGTFLFADSGMVEMPSVEDVANIAVISAKTFELLVQDVPKVAMLSYSTKGSAKSKLTEATIASTKLAQELAPDIAIDGELQVDAAIVPKVAASKAPGSPVAGKANVFIFPDLNCGNIAYKIAQRLAKAEAYGPITQGLAKPINDLSRGCSDEDIVGAVAITCVQAAAQDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate acetyltransferase
publication title Crystal structure of phosphotransacetylase from the methanogenic archaeon Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Transferase
total genus 111
structure length 332
sequence length 332
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.8: Phosphate acetyltransferase.
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01515 PTA_PTB Phosphate acetyl/butaryl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10750 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isocitrate/Isopropylmalate dehydrogenase-like 1qztA02
3.40.50.10950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qztA01
4E4RA 2AF4C 1QZTA 2AF3C 1XCOA 1TD9A 1R5JA 1VMIA
chains in the Genus database with same CATH superfamily
1IM5A 4O1IA 1NLUA 1A9XA 1DPFA 1Y7PA 1ZBDA 1A5SB 2H4XA 3C43A 1V8BA 3DOHA 3U7QB 4A6EA 5L51A 2YV4A 5E2AA 3KHUA 4HH3C 3LO5A 2Y1CA 4E51A 1RBMA 2GZ1A 2IBMA 2HWWA 2EJWA 3AF5A 2JLCA 2WIDA 3IVGA 1C0KA 1PZXA 3CT4A 5LDDC 4ETWA 1O96B 3IEMA 1U2GA 4H6XA 1GTJ1 3QE9Y 2I03A 1GDDA 2GBCA 1RADA 3AWDA 3L6CA 4BAZA 4DLAA 3W06A 2AJTA 4F12A 3CNEA 5CH8A 3IQGX 3WGTA 1XTPA 4DUGA 1OLXB 2X1LA 1CF2O 1D9XA 2DBVO 1E9FA 1UC5B 4LPKA 4BNDA 4D9NA 5AW6A 5CTAA 5JNUA 1KOFA 3STHA 3DTNA 2D5IA 1B7GO 4H59A 2NUAB 1Z2EA 4C2UA 3FE2A 4HAVA 1NNSA 2CMFA 4P36A 1OLOA 4J0KA 2TSYB 1KP2A 4QSMA 4AZ0B 2NVBA 5JSUA 4C07A 1T0HB 5CDSA 3LHSA 4QIHA 1AKMA 3TVYA 5HDBB 4FYHA 1NI5A 1VLHA 2AVDA 2VHQA 2XLCA 2KM1A 1QGOA 3EBOA 3N58A 3NTRA 3P9IA 4JJZA 4BKQA 1ZIPA 2BGWA 1GUAA 1UJBA 4L8FA 4P7FA 5JZSA 3NM5A 4GI5A 2BF4A 4H18A 2PNJA 3FBGA 2CCKA 1Z5UA 3R77A 3GZNA 3DA8A 4K87A 3IQFA 1MAHA 1M10A 1J8VA 4MB6A 1Y1PA 2Q5EA 1OX6A 2PX0A 2B83A 3T15A 2B4YA 4GBED 5LYJF 3OQJA 2VPIA 5IH3A 3G88A 4I8XA 3FPKA 3LBIA 3B8EA 4M1QA 3H97A 5AHRA 3G2JA 3WRWA 2HK7A 2VYND 1DKOA 2HDNB 4DV5B 2CNWD 4WACA 4FZVA 1F8YA 3JASA 4IX9A 4K2HA 4DJ5X 1N0UA 3DDWA 5FF9A 2WU3A 2J41A 1X7GA 2JLBA 4FYVA 5BRJA 2CDCA 4XYGA 1XJ5A 3BFKA 3AHDA 2TYSB 5ALTA 2PYIA 4CV1A 1VKZA 3MQFA 4YRMA 2I7CA 1SWWA 4B40A 2CJWB 3MYRA 2QL7A 4GZMA 4A2QA 1B15A 3F6BX 3FF1A 3IDAA 4JLBA 4B31A 2ZFUA 5JJBA 1DTEA 1XFAA 3KBOA 3USCS 4ZK6A 4S35A 1SCJA 3H4MA 3PFKA 4ZYZA 4BXOB 1SB8A 5G2OA 1C1HA 3MWEA 5H81A 5KNCA 3DV9A 1R8XA 1S2OA 1J5EB 2X23A 1QGDA 3A2LA 1LDMA 1YAJA 4NR0A 3C1TA 1B0UA 2HA0A 2XYGA 4ZMSA 4DCSA 4XVUA 4G85A 2QD5A 1IWBB 1TVKA 1GUYA 3ZY5A 1WV0A 2JLAA 2OORA 5G02A 3V1LA 1FTSA 2V9CA 1D5WA 1GU0A 3GPBA 3U49A 4E5UA 3PHCA 3SHTA 1QU2A 3I6IA 5KQSA 4UBNA 1NVUQ 3G2LA 1O97C 4S1VA 2ZJZA 2SECE 2GSDA 3I6YA 1ZOSA 2HHJA 1FU4A 1YA8A 4ATNA 2D00A 4BJ6A 1A9QA 5TPWB 3NRJA 5DWVA 4IVPA 4BO5A 5JMPA 5HZMA 3C87A 2DR2A 5IF9A 1EH5A 4C7JA 3HVHA 4DWVA 2X0EA 5UKDA 2QLNA 2JLZA 1RJWA 2B20A 2BFMA 2FFHA 4BN0A 1JALA 2PT6A 4X3CA 4AC9A 3C39A 2AJCA 4IIJB 3IMKA 5FTKA 5EG5A 2QU7A 5AUOB 3IDOA 3LXXA 3VPSA 2FHPA 4OY3A 4WOCA 4D9EA 2OZLB 3HFSA 3LC1O 4O4JF 3W5CA 3I34X 1KY3A 2Z5GA 3GLRA 3LP5A 1X0XA 4KLZA 4P81A 5AJHA 2EG5A 3SEZA 5JSQA 4BYGA 3GGPA 5EUBA 4EKDA 7ABPA 5JCPA 2R96A 3NHSA 1T1EA 3PP8A 1DIAA 4PLZA 1JFFA 4B80A 1G5FA 1JE0A 3WYGA 1P17A 2AN3A 4LMAA 4LJ8A 1X7ZB 3BICA 2NXNA 2VWQA 2Z43A 2HF7A 3KP1A 2WJVA 4IW3B 4G25A 3K8OE 2CLOB 1ODLA 4GM1A 4X20B 3B12A 1KOGA 3KYCB 1XJ0A 2DG2A 3H7IA 1JA1A 1Z0AA 1Z0JA 4ZHSA 4ZCRA 4RDIA 3UMSA 2Y76A 3AUXA 2X19A 4ROTA 3C3MA 1U2EA 1GV1A 3C3WA 2V7GA 1I33A 2QLFA 3OX3A 4UCXA 4EHNA 3EFBA 1OI4A 1RM3A 4DWWA 5DTMA 4HRAA 4WZZA 1CCWA 4LYGA 4MVJH 3VZSA 4CLXA 4HX5A 1A2KC 1Q7RA 2Q9CA 3EY9A 1G42A 5EYPB 2XT6A 1J8DA 1P2TA 3DLAA 1AV7A 3ZE7A 4BO8A 2XMBA 4NESA 1ZD5A 3WK5A 1E2NA 3K1YA 5H70A 2FSIA 4PTLA 4E1VA 5I4KA 3ZKAA 1QG6A 3QYAA 1ULAA 1JJVA 2GYVA 4KACA 3SVTA 4CF6A 1ZXLA 1ZOPA 2EFEB 1ZS9A 2VF8A 1L6RA 2M98A 2P30A 2ZJ8A 4J0IA 5IJ0B 4ZPJA 5SZKB 1GUDA 4D0LB 4XB2A 4JBNA 1EG7A 2G83A 3EWIA 3IBYA 5FT9A 5FNZA 2P6NA 1VHDA 2E18A 3N8GA 3UUWA 3NIFB 5TF0A 3HRIA 4DYVA 2APJA 1NQAO 4JMPA 3CGGA 3YASA 3CZ5A 1CK4A 2G08A 2B92A 3TZHA 3EZ9A 1I6KA 1P39A 1XQYA 1TA9A 4MPDA 5EOVA 2BP7A 3KKPA 4I9HA 2VH1A 1H2XA 2XUOA 5F1PA 4PC3A 3VXKA 1W8DA 4Q1FA 1R6TA 2HFJA 3OIVA 2YNMA 1Y3BE 1PJSA 3PGA1 4D98A 4M9XA 1N3IA 2IV7A 3AHGA 4Q1BA 5H9VA 2WHXA 3DE6X 1SUAA 3GP3A 1N2OA 2X5NA 4NV1A 1G5TA 3MS4A 4HTFA 2EF1A 1QLJA 1LVHA 1U1FA 2I7DA 3L1UA 1WQ1R 4PFKA 3K70D 3GP8A 4MGHA 1M74A 2NZYA 1NWCA 4XVHA 5CJ2A 4HADA 2GPAA 3VSAA 1E9RA 4V0SA 1KVTA 3NHKA 3RAJA 2J3HA 2ZRLA 1IK6A 2IYNA 2E4XA 4PYOA 3WADA 1YA6A 4J6FA 1Q0QA 4N3BA 4R54A 4RQAA 4D8YA 1PR3A 1RIFA 2BFFA 1Z6PA 4HAXA 4MRRA 4X44A 5D01A 2K7ZA 3NKFA 2OPHA 2CGEA 3SVLA 1QPZA 2ZKLA 5EWMA 3P9YA 4D8WA 1UT8A 3L6UA 3ABIA 1CJSA 5BQXA 2I6GA 2Y1DA 1UH5A 2FEKA 2YYSA 3HBFA 1KI7A 2ZXUA 1HFKA 1BW9A 4BVFA 3CRMA 4EPYA 3ZZNA 2GERA 1T0UA 4ZOLA 4N3CA 2VYNA 2IBSA 3IOEA 3G0DA 1R0KA 2CNWA 5CX1B 1XROA 1Y98A 1S96A 1Y6RA 2IY8A 1UDBA 4LDRA 3A2NA 2BKXA 4N5IX 3WOVA 5JXJA 2G80A 1W1UA 1SEPA 5DM1A 5A5EA 5BUZA 4TWIA 2XBMA 3EJWA 3T5BA 4LC1A 4XIJA 3JQDA 3EEYA 1I0IA 1E79D 1NXXA 2CXHA 2I67A 1NVWQ 2TECE 2MJLA 4NFYA 3I4CA 4V2UA 1W1WA 1P45A 4KYIB 2JAQA 3UF0A 4NENB 3HK2A 1HXHA 4EPTA 3NIDB 5FWAA 5C8DA 5IM5A 1M1NB 3DOFA 3GUVA 1TTQB 3P32A 4IOLA 4Y1RB 4HDOB 1GCIA 1W88A 4FYYA 1P5HA 2XB9A 1XYVA 3IQIX 1RI1A 4FDLA 2FAXA 4EKIA 2V6GA 4FNMA 3L1JA 5D3QA 1RDFA 5FLKA 4QWMA 1XQ9A 2UVPB 1H2WA 1GG8A 1WCYA 2IZ6A 3N2GB 5DV9A 2XBLA 3PC3A 4IVQA 4ZAYA 1VE7A 5MGNA 2FWJA 3F5SA 1J0EA 1UC9A 4TTVA 4X7BA 4PIVA 3QKRB 2Y1KA 1OAAA 4IY1A 4M0PA 2C8KA 2JIZA 3HABA 4ERNA 2WVJA 3ELYA 2VFAA 5BQ3A 3G02A 3B6KA 5ARCA 2G7ZA 3F46A 5LVAA 1RXCA 3ETDA 4U6SA 4JLWA 4NZ9A 3PNLA 3WGNA 5EFOA 4J1QA 3DVAB 1SBNE 4PU0A 2TMDA 2GM5A 1AXEA 1GZ7A 2HMTA 3FZQA 4TXMA 2VBGA 2M1XA 4WL0A 3WNCA 2IHBA 1CR6A 4GOXA 3OJFA 3T0GA 2KBFA 3LHFA 5B4TA 4ZAWA 3EGDA 3ZN2A 3LDAA 4F5DA 1VG9B 5E2IA 3NANA 4IFTA 4P8RA 1CNFA 2WNSA 3PQ4A 4DIEA 1PLLA 1T91A 1UDXA 4K8OA 5CYOA 3ZU3A 3N07A 1QGZA 1ZMTA 5JZMA 2Q3CA 3K5HA 4XR4A 3TGWA 4WADA 1XMQB 1SR8A 2VHUA 1U6JA 3JQ9A 3RHZA 3M4ZA 4FCCA 1JEAA 1FQKA 3AOEA 1S9HA 5HXAA 4OLJA 4BNWA 3MC1A 2Z5LA 3M5DA 5IBPA 3CUYA 4LJ7A 2JJ8A 4YJFB 4UTRA 2W2OA 1BTOA 2VDUE 2V59A 3T5MA 1F4PA 1P5RA 1LBIA 3ISJA 3PJFA 2VA9A 2Y1XA 3DZIA 4QBFA 4I0WB 1MW8X 4Q00A 1BD3A 2AEFA 3G23A 4ID9A 4LHYA 2VQ6A 2V7UA 4YN3A 1NOIA 5CVCA 3REQB 1DCMA 1QG4A 4CN9A 1ORWA 5IBQA 4X1IA 3TUJC 1FW8A 2XMGA 4LRYA 3WK4A 1PV2A 4CPDA 4L2IA 3DKRA 4M9RA 1N6RA 1CC1S 3L6DA 4LYDA 4MKGA 4Y9SA 4C87A 4CL3A 5K0ZA 3ZE1B 1L5LA 3L4BA 3MBIA 2FZVA 3PR1A 3IX7A 3TQOA 3CEAA 1U3TA 3LUPA 1CJCA 2X58A 2YV3A 3N8IA 2EVWX 5SZJA 1E4EB 3BJEA 4H15A 4I9NA 2WTMA 4UEQA 4IQGA 4RE5A 3RD5A 4WNYA 5LXTF 1R8SA 4O2LA 1QBGA 3RNLA 1GQQA 4BO3A 1YR7A 4DUPA 1FDSA 4M36A 2EZ9A 5HFNA 1TCBA 2WG0A 4YRIA 4B09A 1T2AA 4TWAA 2RGRA 1P5ZB 2ZETA 1Q7TA 5DM60 1QTQA 4C4XA 4TTRA 1U7XA 1IBKB 1LI4A 4M9UA 4RMNA 5BW5A 4KWCA 2CEKA 2JI6A 4BJ1A 2VQ3A 5CG1A 2QUIA 2JC3A 2PM8A 4KAXA 4BNUA 4D9KA 4YJ2F 4B2YA 3CSSA 1BDJA 1GQSA 5CFQA 3DQQA 1SKMA 3PXUA 4DZRA 2ZAOA 1Q0UA 2PZFA 3DEZA 3C98A 3OJ0A 4GYJA 4HDMA 1XAHA 1ZPDA 5M5BA 3A1EA 2WYVA 1ZIYA 4FDUA 3UATA 5IAAA 3OQOA 9GPBA 3H2ZA 3L8MA 4F84A 2ZGVA 3L8ZA 4WE3A 1PF7E 4EIWA 4GH5A 3PHLA 1NC3A 1KZ9A 4M1SA 1E6EA 3VNBA 3IH5A 2JAXA 2V6BA 5EJAA 1VA4A 3ZV4A 4F6CA 1TA0A 2XWJI 2OCBA 4B6JA 1KL7A 1XZGA 3JATA 2F17A 3CO5A 3DBOB 2A0XA 3VDXA 1NYRA 1UMBB 1IM2A 1E99A 1Z7BA 1PVDA 1ZY2A 2NSJA 2W4MA 3KOWA 3FGPA 4G26A 4JDUA 3NOVA 3K9QO 5CHEA 3I9KA 4AMVA 3DZBA 3P4YA 4AAYA 5JAQA 2ZI9A 4C0KA 1M9NA 2W43A 4CIYA 3MWGA 3PGVA 2F3TA 1TZCA 4KN6A 3TLYA 2JZNA 4UFNA 4NOKA 3J7AC 5J1SB 1DRVA 4R51A 2XJ9A 1ISGA 3WWDA 1M2GA 3RC1A 3JQQA 4KH0A 4KE6A 4R9SA 5A7GA 1LPBB 2AMYA 4H77A 3UJBA 3ZWXA 3VUEA 3OE4A 5BV2P 4BNZA 1R6UA 2WVAA 5AQEA 5EP1A 2E4WA 5EZ5A 4G4GA 3O3OB 3SG0A 4Z4IA 1J6UA 1GSIA 3OOSA 3DZGA 4IIXA 1K1EA 1OREA 4KR3A 1MO3A 4HL6A 2QP9X 4GP9A 3VR0A 1X7WB 4M8KA 3EPKA 3LY5A 3OZCA 2A9OA 2HA4A 3JALB 3UB2A 2DGDA 2X7XA 1E8DA 4AKIA 1G21B 4JJKA 2OGZA 4ML3A 1K9VF 4WJKB 2J5KA 4ZQHA 3NJ8A 1WY5A 1X80A 2XIQA 5TPZD 1THTA 3E9ZA 4O4JA 2O1SA 2Y77A 1GKLA 3WKAA 3CRRA 2ILVA 2DUWA 4ZV9A 1NSFA 3P8ZA 4UDNA 4HO1X 5FBKA 4CU2A 1XDUA 2FF5A 2JL1A 2V9ZA 1A96A 1U2DC 1Q1ZA 4KB5A 1Y81A 2WUDA 4TLBA 4BNMA 3TRDA 1E79A 2JIDA 3JWHA 2BM9A 2BELA 2EYQA 1R5BA 2FWBA 2YYAA 3KXKA 3OX1A 2C3UA 4US0R 1ABFA 1A2BA 2OXFA 1KF0A 2VDKB 4BMSA 4QUBA 5AW2A 4OEHA 5GY7A 3ESDA 4DSOA 1SC1A 3B3FA 3DMTC 3FETA 1P29A 2FEOA 1G3RA 3G0BA 1LGYA 2E6UX 5HIMA 4AKGA 1W85B 4LOKA 5DKFA 3UOWA 1KS2A 3WWCA 1ZICA 4X00A 5A3QA 2FG5A 1P0MA 3S55A 1V6CA 4LISA 2XTNA 4BQEA 1YE5A 1G8MA 1Z6YA 4MUIA 3G1WA 1UBUS 1TMGE 1EK5A 3C5WP 4G0YA 4BOYA 4F2WA 1QU3A 1EDOA 3BRCA 3NBYC 4N39A 4WLNA 1SQSA 1JIQA 1ORTA 1FXWA 2GZAA 2B8NA 3LQQA 4NE2A 2OXEA 1GQOA 1OT3A 1XZKA 4BWFB 3RRFA 3AOGA 4L57A 3M8KA 5EE3A 1R7RA 4L4RA 1DUVG 3L7DA 6LDHA 1R9JA 4ZVRA 1M0EA 5KI6A 1PFYA 4C0XA 3HCPA 4CMEC 1NPDA 4MJXA 1Q20A 2DH5A 2JFFA 3K92A 4KIFA 4FHGA 4Q01A 3U3OA 3FSJX 4CT0A 4DJJA 1C2YA 2FPGA 1AF7A 3O6VA 3RC2A 5CRIA 4ZT5A 1HDYA 3NT5A 4EUFA 1A98A 5AUPB 5GZ3A 1KFJB 1XA0A 3KQMA 4EF4A 3SBEA 1PSZA 1NR5A 4CCWA 2Z56A 4YP5A 1KJYA 1TIPA 2VP6A 3T95A 2QN3A 5L6LB 1NJFA 1RKQA 2J67A 4QT0A 3NALA 2ZUSA 3EISA 3P96A 3WWPA 4HNTA 1DCFA 2R6JA 4ENWA 1SCUA 4DJAA 1M34A 2WKRA 1MZVA 4J3NA 2DJIA 4Z7OB 1DG1G 4M7RA 1MC4A 1JXMA 2O50A 4KE8A 3GA7A 4XVRA 4BJ5A 4DSTA 4DR7B 1AIPA 4RGVA 1L5QA 4S1TA 2FGKA 1PT7A 2XTAA 4IXDA 2WSLA 3GELA 3LRTA 1SOAA 3EWAA 3MTQA 1KRHA 1XP8A 5CR9A 5ED0A 5JDIC 4MI6A 4YMVA 5U1PA 3ZH2A 4L3WA 2W48A 1YJQA 4W63A 4DCCA 4ZEVA 3EPHA 5F3RA 1NTRA 1TOAA 1H69A 1I6LA 2ETXA 3LBHA 3AUSA 1DI0A 2V5UA 1G4HA 3QY9A 4UVEA 3A8TA 4GZLA 4JGBA 4LE0A 5K8LA 1OH8A 2BE9A 2YWEA 5IT4A 3KB6A 1G291 2WU8A 2WILA 2A9KA 4IVRA 5EE9A 3RUEA 1VE9A 5B37A 2J30A 1LPOA 1MW9X 1TTPB 2ZSJA 5IAOA 1XCGB 4FOPA 2KLHA 4KBFA 4CI0B 1GT6A 4F5YA 1EJ0A 2J87A 3RIHA 4LXUA 2C20A 2WZDA 3P2JA 3KB2A 3HVUA 1PFWA 3HHEA 1DIRA 4Q24A 4Z86A 4CCAA 2A9PA 3TCXB 4BO6A 2E4YA 1HFJA 3OPVA 4P93A 4QUAA 3Q8MA 4J4HA 1EBBA 3PC6A 3A9RA 1V41E 4E15A 4K88A 5IVIA 3GARA 2PGXA 2X22A 2D1SA 4MCIA 4OI1A 2R85A 5I4IA 4NOLA 5TSDA 1IUOA 3ANLA 3C5CA 1W6RA 2PPLA 4EJFA 1IEQA 3JQAD 1IHOA 5F3DA 3GF4A 5E6RB 2D13A 5LQDA 3R8CA 3VOBA 1BQ3A 1U3GA 3IUSA 3H99A 4UCWA 4FFDA 4WJLA 4YRGA 1VI6A 3ABOB 2Y1OA 4ZOBA 2QD3A 2PUEA 5IYZF 4A92A 4QG7A 1INLA 4BP1A 3MAJA 4XLLA 1E62A 1QOPB 1LDEA 1UKAA 6ADHA 3FUUA 3MELA 4FK8A 2JIQA 4Y6LA 1NXPA 5IAEA 4EZEA 5AVWA 4EENA 3TG2A 3ELBA 2HZBA 1ZMBA 3PEEA 1GL7A 4I14A 1J0DA 1KNXA 4KIUA 1JQBA 1WXQA 4P7GA 3VU9A 5KYTA 5I7OA 3AVTA 2GMWA 5GP1A 1BXGB 3NBXX 5HHTA 1DQZA 1YMVA 4UU1A 4TLLB 2P4HX 1Y1TA 3G2HA 1IQUA 2VYFA 4K26A 4UREA 1Z5WA 5JHGB 2H1WA 2PHZA 3RYFB 3F6CA 5CIWA 3EWNA 1C9NA 5K0FA 2AUTA 1FVHA 3EIWA 3OHPA 1YONA 5FWYB 1B8PA 4D82A 1A77A 2FHSA 3UPUA 1WMDA 3LKBA 4PLWA 2MSEB 2X8JA 5T8KA 3UA4A 2ZATA 1L2TA 1E9EA 2ERXA 2O52A 4IBOA 4LDNA 3R7LA 4BRUA 2HEGA 4OAOA 2Y0DA 3SZRA 2LBPA 4R8VA 4NCKA 4YRBA 1LTKA 3A0RB 4U1RA 5B7PA 4A15A 3K9BA 3X2SA 1ZR4A 4DHEA 3KE8A 2IS1A 4RJJA 3AEUB 3NYRA 5JYCA 1KFKB 2P8JA 3T9BA 2L19A 1XZCA 3U4AA 3JQ7A 5D7BA 2CMKA 2EZTA 1QIKA 3AR8A 3WYBA 1XVLA 4C0SA 1YQUA 2FK8A 4ZWNA 4FGLA 3T0IA 5LPNA 2G63A 1N2CB 3JSXA 2WIKA 5DCLA 1F9EA 1R3DA 4RGBA 4QQFA 4YUZA 2GCGA 2IVFA 2W2MA 2RGEA 2XMPA 4TS3A 3SZGA 1IOZA 3AONB 3RJ9A 3WLFA 1YJBA 1BX0A 4DQVA 5C1OA 1HF3A 5K0SA 3VYRB 4HI0E 4W99A 4DQKA 3NBKA 3OZIA 2B6NA 2QRNA 3QVOA 2WJWA 3NVKI 1QCDA 3CSDA 4ZICA 1WZIA 3REFA 5TPZA 4ZT2A 1E59A 4KWEA 1WXGA 5DRTA 4L0QA 3G8DA 5GZ6A 5A2QA 5AW8A 2Z1NA 3CC8A 2ZVQX 4X94A 4B6PA 1M1UA 1XCOA 2PAFA 2QZPA 5BNTA 1CF4A 4U7GA 2FSVA 4AO6A 2H8KA 3FWHA 2O14A 1KK2A 4I50F 1SWVA 2YY6A 4KXUA 4QUKA 4UJ3A 3TXAA 3ZY3A 4RDXA 4ZYYA 4W7SA 4AJJA 3C0KA 3OIWA 4ND5A 3G68A 3A9VA 1DV1A 2H5LA 2OO5C 4XX0B 4EB0A 4ZIRB 1M5UA 3KJEA 3EOZA 2BRUC 2ZJFA 2ATXA 2Z8YM 2PQ0A 1F38A 1PQWA 2OQRA 4IOMA 3GLFA 3S8MA 2QN9A 1JMVA 2G0TA 3P4UA 3D0QA 3LYAA 5AOCA 3WRXC 4ZV4A 2YZGA 1GA4A 1Z0FA 1IIBA 2IODA 3NHWA 4IMIB 4CL2A 1SG0A 3OWOA 3MT8A 3MA0A 3DEKA 3KQLA 4QICA 2GAIA 2DPMA 4GLJA 5IVHA 2ZIUB 3ZGZA 3PKIA 5EMHA 4XVQA 4D8VA 4R3WA 4B0PA 1HMYA 4J3FA 4LC9A 4N6GA 4C2AA 1Z7EA 2FR1A 2FN3A 3RW9A 4F3YA 5J3JA 5TQ0A 3FNHA 2PXXA 4NL4H 2CHVA 4A91A 1RKXA 3L7JA 3SEQA 2ODAA 1D1QA 3FKSA 3O3CA 3L1VA 5ALMA 2ASVA 2WSIA 3IELA 4DLPA 3OESA 2XNHA 4LGYA 4JI2B 2AD1A 1Q6YA 1T9CA 2DUJA 2ON6A 2VA8A 3LE8A 4L6IA 3VH3A 2P6RA 2WF8A 2YINC 1WCIB 1WMFA 2MSWA 3HVJA 5DP1A 3R5KA 3SS7X 4JJ6A 4JV5B 1NN1A 3NFYA 2RSLA 3MSCA 4XWYA 4AJKA 1SVUA 1WKBA 2G28A 3ZNQA 4KQIA 3DXXA 2F1JA 4JU9A 5KOHB 5IK2D 4NOJA 2VVTA 3D6MA 4UDYX 3JARA 1CX9B 4MS3B 5AVJA 2IOQA 3C7CB 4DLUA 5ITWA 1QVWA 1K9SA 5JI2E 4A10A 1G6Q1 4NG4A 3ULKA 4FJ1A 5B3JC 4ZVKA 3KFXA 3EXIB 2RHWA 2FN9A 3WICA 4MI1A 1LUAA 2VS1A 2UVQA 3PFCA 1GWNA 4F1JA 1QRDA 3M1LA 3GJYA 3IT0A 1B8NA 1ZGZA 2JATA 2REBA 4NYMR 5DTJA 3LT1A 2GHRA 3ND7A 3H9CA 3G8AA 2BHNA 3PDJA 1BDBA 2GILA 2DKFA 4IF6A 1BHQ1 2R1UA 2QOEA 1SXJB 4HGOA 3MGCA 1RLJA 4JYCA 4ARUA 1CETA 4PLGA 3A9CA 5ITZB 4QEKA 1LJUA 3HZOA 1E7SA 3VC3A 2JI7A 3I92A 2QSZA 4C14A 3C8UA 2OCKA 3Q3GE 4ZAFA 5K3CA 1DWOA 4HOYA 4Y0VA 3X1JA 1HEIA 3B1ZA 4PQYA 4JFAA 5CFMA 5KJ1A 2HCFA 2XYRA 3AW9A 3ET5A 4QLAA 1A9XB 2LWIA 3KEGA 1K75A 2GEKA 1VL6A 3IEUA 3OIFA 4IZOA 5IVDA 5AM0A 1V96A 3BBPA 4RX1A 2Q3MA 2P9BA 4INOA 4XB6B 2VT2A 3RIGA 4W9MC 5JLJA 5ES3A 1BHJA 4BFUA 5LIPA 2OFOA 5JVDA 1JECA 4QARA 1V5FA 1TO2E 2N9UA 2VBFA 4WOKA 4W1QA 4A0FA 5B6PA 3M6IA 3BTVA 5BWLA 5MN6A 1JT2A 1NRIA 2YH2A 1Q3KA 2VPPA 2EKDA 3NIWA 4S1PA 4RETA 3HPQA 5DISB 3VH2A 2YXNA 5IUNC 1IPEA 1ZUWA 1N2BA 3IESA 1FFHA 4G9BA 4DSUA 3E9EA 1U7WA 3R2JA 3CLTC 3JAKA 3USZA 2Q4TA 4YUVA 3IDSA 3ITKA 1T9GR 3ORQA 4MARA 4QTTB 3RVOA 3UT5A 4BNDB 5CG2A 2PLNA 4PX9A 1OXXK 3GR6A 4QBKA 4M9ZA 1DQYA 4ASUD 1XGKA 1EFVA 1IBSA 4YUYA 2IKQA 4DV2B 3VKFA 5K3EA 1G3IA 4DPLA 3OZFA 3CX3A 3ZVKA 3JVUA 1P2BA 5CDYA 4MUGA 3FZGA 2REQB 4MW9A 1SVKA 1TT5A 2XDQA 1B8UA 4MP3A 4NV3A 4OBWA 1GZ6A 3L0CA 1JBEA 2QIOA 1J8QA 5GIPE 2WC1A 2G5CA 1CLEA 3HSKA 5E4TA 5ILGA 3GGDA 3D6TB 3TOZA 4YJHA 5ENVA 3A70A 4UNNA 3VC1A 1FDRA 1Z17A 1PL7A 3FMVA 2XNKA 3QBTA 4XKJA 5D86A 5DK6A 3RWMB 4OJMX 3BEDA 5C53B 1KDTA 1RAFA 3RUDA 4KMSA 4C0HA 4QO8A 3GZNB 3KKLA 3L41A 4PNEA 1BC5A 1XZIA 1L7EA 2BM0A 4ZARA 2RH5A 2Y27A 1J90A 1G55A 1WABA 1OBHA 2HNAA 3EAFA 4K05A 2HSJA 1RZUA 1LLDA 1WLSA 2FRDA 1KDRA 3UJ9A 3HZZA 1BMQA 1EWVA 3CLRC 3WDLA 1DMSA 4RTOA 1EFAA 1K98A 2FX5A 4OLBA 4LHZA 2GTHA 1Y34E 2XF8A 4BFCA 4ZRDA 5AXBA 3OZSA 4LRTB 3NHUA 5FFNA 4BLVA 3CBQA 3JASB 3TL2A 3IAUA 1JIIA 1W8IA 4XVCA 5F9FA 4ACAA 2DT8A 1VLZA 3LCVB 3P9PA 1OZGA 1BN6A 5EY5B 3SAJA 4IQ8A 2PEYA 4ZYXA 4XQCA 2LDXA 3L93A 5GJWC 5CX4A 1PFKA 2ZBRA 3TAHA 3W2HA 3FSRA 4ILKA 1I2BA 1S9DA 3HDVA 4C0JA 2JGMA 3NH6A 4AM8A 2IY7A 1WPXA 4TT3D 5EWLA 2IYQA 1J2EA 4AN1A 5JYDA 1P1BA 2NQ2C 2BZSA 3L8DA 1ILWA 2Q4RA 1UJMA 2HH9A 3A6HA 3O83A 4EEXA 1T4DA 2J5XA 2QRMA 5A9TA 1SBQA 3RRBA 3FLMA 1M73E 1EX9A 1KY5A 1LWOA 3WIBA 2AHRA 4A2WA 4CM8B 3UXYA 4QNNA 4F3TA 2SKCA 5F64A 3IR7A 3JD3A 4U8GA 2DTDA 4HRYA 5EHIA 1PFGA 1L5RA 3GNLA 4U7JA 5ILQA 2GN2A 5KVVA 3EIQA 4HB0A 3HACA 1TVKB 3GBPA 5DBOA 2Q6KA 4EL5A 4X90A 1PDOA 2CXOA 3R7DA 2G5GX 1ZIDA 3FCXA 2FZCA 1Z8HA 4Q3CA 4AJIA 4DDUA 4IDFA 1QKKA 3V4FA 1JDBB 1FP4A 4WNAA 3SQXA 2XNCA 3HCCA 4DPMA 4G1FA 4O2AA 1EFKA 2BY4A 2C58A 2W11A 4L0MA 2IYZA 4TMYA 3KUCA 3IEPA 1AK1A 1CJTC 3GAZA 1NW4A 5CCDA 1USVA 4TPKA 4Y2TA 4AG5A 3AEKA 5EE5B 3R74A 1LZLA 2FSHA 4R1MA 3BT7A 5F7XA 1NUHA 1A3CA 3N7AA 4I6JA 2IYVA 4CT4B 1U8EA 3N86A 4N6NA 4MLZA 3KR2A 2CZGA 2ANCA 4LF9B 2RI0A 1YKSA 5DEIA 3DMPA 3FDJA 2ZSIA 4OQYA 2XVYA 4PTYA 1BS1A 2NO6A 5K99A 1T9HA 1ZLXA 4Q6WA 2GN1A 1F60A 2QM3A 3Q8LA 4CMKA 1E18A 1SXJC 4ZI5A 5TNXA 1K6JA 1Z8NA 3ZXIA 4L1KA 1PT5A 3ONDA 4MYHA 2EBWA 1IDN1 1XCLA 2GEJA 4MLPA 5AP9A 3VPFA 4DCNA 2Q1SA 4OIFA 5JFGA 4OGWA 1XRQA 1C9KA 1IUNA 1L7DA 2MOKA 3AX6A 3OT5A 1TRKA 3QVTA 4MQLA 3TNJA 1GR0A 2PS3A 2E1RA 1C1XA 4JCOA 1KI4A 4YAEA 4C5CA 4FQ7A 3U3KA 1JFFB 3O95A 4NCHA 1Q0SA 4HP8A 4L28A 2HN9A 3TR6A 5LMZA 2Y2UA 1AB5A 2NZVG 5IK2A 5BMVA 4YMSA 1ZINA 5KQRA 4TTJA 4EG7A 5KNLA 2PGJA 4P0TA 1T3HA 3PVCA 4L6CA 5JOQA 3FPFA 2I2WA 4LK2A 3PJDA 4E31A 1W30A 2J9XB 3MUEA 2IYLD 1IB0A 1U2GC 1E64A 2CVOA 1BHO1 2DFKB 5H1YA 5B1YA 3JWIA 2I71A 3D7NA 3LL7A 4OHYA 2J9FA 1UPFA 3FNRA 3QE0A 4MEAA 1JJIA 3ICEA 1E3LA 3HUEA 1PYGA 5DN9A 1UPXA 3BGSA 3OPYA 1KETA 5T4FA 3RU9A 2C4WA 3T4EA 4ZT3A 1KBZA 1MIOB 2ZJ0A 5KJCA 3PEVA 4O3MA 1OFUA 1CZUA 1JZQA 3T0FA 3AC0A 3NJRA 4C20A 1O2DA 3N5CA 3K15A 3W5BA 2G0AA 2EBUA 1Z39A 2B2XA 2O9JA 4R5MA 1QK5A 3N8DA 4MVJE 1JYEA 1Q1AA 5AUNB 3B6EA 3K5WA 1G66A 1ARZA 2ILTA 4MV9A 5CPFA 5F5NA 2PKYX 1KYIA 3IB6A 3N05A 3ZNNA 3H1AA 1Y4DE 5K2OA 1U3VA 1L9XA 3L49A 1W5EA 1MB4A 2PR2A 2WM2A 3E9CA 4IXWA 4TUYF 5EKXA 4ZTBA 4KMOA 3I04M 3WY9A 2Q1TA 3KV3O 1Y9JA 1NVVQ 4DBVO 1UOOA 2OYSA 2D2XA 3H9QA 2GPBA 4JLNA 3MJFA 3VR6D 1KJ9A 1XNQB 2FWMX 2VJYA 1OQAA 5TVGA 2H65A 3I6ZA 1BS9A 1TAQA 2EERA 3DHYA 3CLVA 2QL5A 2ZWPA 3OKAA 2Q28A 2BP7B 3GB9A 4GNRA 4OOEA 4O63O 3CEJA 2GVNA 4R3UC 2ECFA 4YRSA 5C18A 1H2EA 3D1LA 2FFRA 2IHNA 5CB8A 2V8BA 3M3HA 2Z4RA 3DYVA 4IRXA 4P4SA 2PZLA 5JSKA 2IIPA 2X3YA 3NORA 4R7ZA 4TX1A 4ARAA 2DTXA 3FTFA 3GJQA 2JJQA 3PR3A 5HF6A 3JQRA 5ECGC 3F8TA 1TUBB 4HTFB 4ASUA 1BU5A 3WWEA 5JPIA 3VC2A 5A6SA 2J9ZB 2XCRB 1U8ZA 1Q50A 2QU8A 1JSXA 3OBBA 2W71A 3MCVA 4CKXA 3I1YA 3GN1A 1XRPA 3THYA 2IUYA 2COUA 4WQMA 3VNRA 3RFUA 1RHRA 4N3GA 3DUFA 5AR1A 5AW5A 4O6VA 1DJOA 4G1BA 3KIPA 3DNFA 4JROA 3VPXA 3V42A 1SXIA 3E05A 4NEHB 2XPCA 1DMRA 3NONA 1FMFA 3PXDA 1DDIA 2BFFB 2QTGA 1L4UA 4NKRA 5DRYA 3EWSA 5K8CA 2H3HA 4P2BA 5EWMB 1KQNA 3VO2A 1ZD8A 4ZCLA 1TVCA 4OBBA 1ZD9A 1A7AA 4ZVUA 1V37A 3IE2A 1IFXA 3IEKA 2XCIA 4ZHQF 1JQKA 1LNZA 3W9UA 4FB4A 4L4YA 1IJBA 3DNPA 3O73A 5AKIA 2B4TO 1J7KA 3UMCA 3RFFA 4MPPA 1Z6ZA 3EUEA 3ZCVA 4CG0A 3OM0A 1BW9B 2OORC 4XQEA 5BV1A 1JWBB 1FRNA 3QX7A 4ZOLB 3U61B 4CGYA 5BSWA 3LFUA 1CRWG 1JDBC 4BQQA 1XQWA 1J2UA 1YR8A 1ABEA 1YI8A 4GUDA 1UXJA 2PT7A 4JX8A 3RSSA 4E5VA 1YQWA 3GMSA 4R1NA 5DGCA 4F2GA 1KS9A 1WZCA 1W4RA 3EBPA 3UUFA 4P2GA 3ZU5A 4BKMA 3QUCA 2IYWA 4X6LA 1LS1A 2F6RA 1UBEA 3NWPA 2DQ4A 4G4IA 4KMMA 2UYHA 3BREA 4MS4A 3DLCA 2LV8A 4JDPA 1VSVA 1UADA 5ALDA 4BLQA 4WWHA 3H8WA 3CWCA 3QNWA 3KQVA 3LC2O 3RSOA 2WEKA 4AUKA 4AJ4A 5ALQA 4PSAA 1L9KA 2A9RA 4IKEA 4BMXA 3U4QB 4BB9A 3BA1A 1BWPA 2JCYA 1JR4A 5DCWA 3ZLBA 1A04A 2QN7A 4XQ9A 4UHDA 2HU2A 3CJRA 1ZRSA 5DBEX 1VJGA 1QGYA 4JQCA 3QE2A 2HF9A 1BFKA 1P18A 4AKTA 3L7NA 5L4SA 1KMHA 3O03A 4GX0A 1UOPA 1EXMA 4ZI2A 2BEUA 3H9BA 4FHEA 2OTCA 3RYIB 4YLYA 3M9LA 3NPAA 4KSYA 5AIBA 3NLLA 4XPIA 5C8YA 3FPHA 5CU7A 4IHAA 3JD4A 3PCRB 1NSTA 2NTJA 1I2AA 1SHUX 4E88A 4BHTA 3G1UA 4DIMA 4EBBA 3A4LA 3HJAA 3R3VA 3GBVA 4O3FA 2QD4A 1X42A 3AEQA 3OFKA 4G4JA 5GGXA 1NXSA 5EA2A 5CD9A 1GJRA 3IO3A 5EXDA 4OBXA 2C2HA 4N0EA 1UFRA 3R7FA 1YWGO 1JIUA 1HRKA 4RXTA 4TVBA 1CNMA 2GNPA 1SUPA 3V4VB 4ARIA 1ZXBA 3QJYA 1OA1A 1K7YA 2PLWA 4R9UC 5GV8A 5L7YA 3SHFA 4C7VA 1A9YA 2AE2A 2PUTA 3K1JA 4GQAA 3R5HA 5AK5A 2PUWA 1KI8A 4V0LA 1OX4A 2QXYA 4MUEA 1P1KA 5LQMA 2B25A 2H1RA 3SR0A 5LBTA 1QYRA 4OJNA 3PUJA 3FMPB 1YB2A 2GCIA 1JIJA 3F90A 2HIHA 2ZSDA 5TR9A 3RS0A 2I34A 2O2DA 3T7DA 3IKLA 3CRNA 2VUSA 3C24A 2GYUA 4PO8A 3QXJA 4MYSA 4US1R 3RB8A 1WXEA 2Y9MB 1NQOA 3QMPA 4F4CA 3FCAA 3IJRA 3CB4A 3FFWA 1SCBA 1Y3CE 2E5FA 5AKLA 1DXYA 2O8VA 4IJ6A 3K0CA 2DT5A 4LJRA 4LWZA 2IWRA 4BLUA 2GRUA 4DQDA 3ACBA 1NPYA 1ZUD1 3FCUB 2WT9A 5L3ZA 3LY9A 4EZIA 2HMYB 5DHTA 5F12A 4YCNA 1TZMA 3E2MA 2AKAB 4X1IB 3BULA 3ZW9A 1JYFA 3AI2A 3VZDA 4K6FA 3BHIA 2VNHA 4OH7A 2QPAA 3CR7A 1FMCA 1GCOA 3LPCA 3PICA 4L2IB 3ZVMA 5AKKA 2Z3VA 2ZE6A 4MVCA 2QRZA 1H6BA 2YNMC 4B6GA 1QP7A 2MIIA 3SEFA 4LF6B 2WU4A 2ZRCA 3P5SA 3ZHTA 1E2BA 4MUYA 4PEVA 4BEBA 4TTSA 2GM4A 4DCGA 3BFJA 5HIAA 3KUDA 3NDBB 3AINA 3A6EA 4BNNA 2CFOA 1EZ1A 1M2JA 2PD6A 1F6DA 1HA3A 1KYYA 2PKQP 3P9XA 2UYQA 3AJEA 4DTIA 4XGKA 1NZFA 4EW2A 2UXCB 2GWRA 1F0PA 3E8XA 3H3FA 3I9V6 3MINA 4CKCA 4KK4A 3MJ4A 3PITA 3SJAA 3W2FA 4QOFA 1VB5A 2DFLA 4ZRMA 3TQCA 5DTRA 4RWEA 3I9MA 4L76A 3KEOA 4TKMA 3LX6A 3ZW7A 5B58C 3V34A 2DPYA 3O5AA 3LPNA 4FYKA 4LMBA 1DQNA 4HMQA 1DBVO 2HYDA 3JPWA 4M86A 3TM4A 1RRKA 4V0OA 4D81A 5HKKD 4HUJA 1G19A 1Q12A 2GA9A 3M0EA 4BECA 4POOA 3D31A 4ICIA 4N48A 1FDUA 1UM9A 3H3XA 4GR5A 1NG9A 3BB1A 5B4UA 3CUVA 1BDIA 4A8JA 3OZEA 4D5EA 4HDMB 3A2MA 1X7YA 2OFPA 4L51A 4RIIA 3UKOA 1JJ7A 1QUFA 5F33A 2RKBA 4F96A 1SURA 3RUFA 1VKHA 2DKOA 3FCCA 3TLKA 3KSAC 2YWRA 3TMYA 1J2TA 3HJCA 1PR4A 3F3MA 2VOEA 3NV7A 4KXQA 5CM8B 3UHAA 2IPNA 2NWQA 3GRUA 4A0SA 1K7SN 1RM0A 4X91A 4ZJYA 1IL0A 5CEEA 1QE0A 1KDPA 2W2LD 2ZU6A 3ET4A 2FN7A 4XJSA 1PEKE 2MYNA 4BEVA 1ZI6A 4IQ0A 4OQXA 3M4XA 1S2IA 3JATB 2DHRA 3JWEA 3QMWA 2J3EA 1RMYA 3K70B 1FZQA 1EKXA 2C9CA 2HO5A 3IP5A 1PL0A 1I4OA 1QAOA 3JRNA 3Q9UA 4CMHA 4NS1A 5K0GA 2ZZKA 4KR0A 3QVKA 5EERA 1GPH1 3ZOZA 4MVJF 3V4SA 5B4VA 5HW0A 2H2DA 2WD7B 3MG9A 1WHSA 2VHYA 2WWXA 4W6ZA 3Q9SA 4ITRC 3UCFA 1Z6AA 3UTDA 3JCZA 2GLUA 3OOEA 3DOUA 1OJ7A 3SX0A 1X19A 3VC7A 2FN4A 2QD1A 5KKAA 4PZ0A 4XEHA 4NFSA 4HY3A 2ECQA 1FA9A 3LOPA 1ZU5A 4JQYA 4XQ0A 3RKRA 4BRWA 1GVNB 1DBRA 4HYEA 5ALEA 4GRAA 1K5HA 1EM6A 1HNXB 2X6RA 3JQPA 5BVGA 2OXIA 2ZSAA 2R84A 1TAGA 4B5KA 1UJNA 3KJGA 5EIXA 2F3RA 3UQZA 4LHXA 1NU6A 2CMHA 4MDFA 1R6VA 5JZBA 1Q16A 1BJRE 1X80B 2Y0PA 3FX2A 4LI3X 3RV4A 7REQB 3WSVA 4E6PA 2Q41A 4XYBA 3AYXB 4H7HA 4ZCMA 5JNWA 4ZVMA 2GK7A 2GF9A 4II3A 5ILOA 2QPLA 5ADWA 4OHZA 3R3XA 5TMPA 2ID4A 1I4TD 3FNEA 1OZHA 3GUYA 4GP6A 1U0NA 3CX7A 1DQSA 3FGOA 1IQRA 5IMBA 1RPNA 1ZNZA 3DDZX 2BKVA 3Q9LA 4E2XA 1F8UA 1GD1O 1ID1A 1OD6A 3FPBA 1U9IA 2QUBA 3ONVA 4IDAA 3PNPA 4ZVQA 2GCPA 2QMEA 4UAGA 2DEUA 2XMCA 1LEHA 4K6OA 3CF2A 1E6KA 4WINA 4W5JA 2IH2A 3BHMA 4KYVA 3U3JA 5AW1A 3V2IA 4J7XA 2ABWA 4BBZA 3JQ9C 1QR2A 4I6GA 4BO7A 1G5QA 1JSLA 2R4QA 3AOEC 1W4LA 1NONA 4ZCSA 4A8HA 2Y0EA 3UK6A 4BO9A 3MOSA 2O0HA 5J9FA 2UYYA 2PRZA 2RH8A 3AM5A 4L0DA 3BSYA 1BVYF 3OC6A 4LYEA 2I62A 4WBNF 3JY6A 5HUJA 1N1EA 1WDWB 3ZYZA 2Q3LA 2FPUA 4ECAA 3G9QA 1L5VA 4MB0A 4F7WA 4D1YA 2V7PA 3IQEA 1R6DA 1MVLA 1WB5A 4DT1A 2MWMA 1POWA 4WOBA 1ANKA 1C7ZA 1ZVKA 4R2HA 2OO7A 3ROXA 1EXWA 5IWAB 5BSMA 4WXHA 2JAHA 3ILVA 4FD3A 3TKAA 1CU1A 1TK9A 1E69A 1PR6A 4L9WA 3VDNB 3HJUA 3A4IA 3WGKA 1ISJA 1L7OA 5G0UA 1FNDA 3K1TA 5HQ3A 4MDEA 1X0VA 1QWOA 4WKGA 1TKRA 5HF9A 3L4BC 2QK4A 1GPNA 3PF8A 2SHKA 5CXXA 3ZX4A 4EMSA 5DNDA 4HLCA 1HYBA 4PPQA 3KYIB 4U9UA 3RUHA 1EZ4A 4M22A 5A03A 4MQ4A 4WXEA 4RA6A 4H60A 5G3ZA 1FVOA 3PEUA 1FSPA 5BYBA 2H48A 1YCGA 3IAS1 1SCUB 3H8VA 3FMGA 2ZUUA 1X74A 3VNQA 5BN5A 4IIBA 1L4FA 4EJ2A 1YRLA 2EW1A 1VJ5A 4B35A 2WK1A 1O5OA 4RK4A 1T10A 4FHFA 1KYWA 3BYZA 3WV5A 3PSHA 4UAUA 3WR5A 4B4KA 1RXWA 1YHYA 3E53A 3ADCA 4UPDA 1ULZA 4G09A 3S2GA 4C0QC 2RCYA 5HR5A 5L7TA 4GMDA 1Y3AA 4NE7A 1NF2A 3CUUA 5D3ZA 1IE3A 5I7AA 3NHBA 2ZJAA 1HY3A 5T4HA 2NYVA 4JKYA 2A9QA 1VCNA 2WM8A 4PIMA 4KAAA 1JKXA 4MWEA 3W3ZB 1RVDA 4OYLA 4NE9A 1M0WA 1V95A 3D54D 3ZCQA 1NJ2A 1L3CA 2I6TA 4D46A 3KZMA 4LQLA 5BQOA 3LKZA 4PAWA 1T4MA 3P2IA 4CMGA 3V3KA 4KWTA 3O4VA 1GGMA 2ODEA 1B2RA 2NO9A 4FFBB 3JYLA 4OA8A 4D25A 3A4YA 4B3XA 4QGHA 5LU9A 2V1UA 1HX7A 1YB1A 4Z9BA 3E27A 1HLFA 1P73A 1D2GA 2X7HA 4OHOA 1WKCA 4O08A 5CT4A 5LJIA 3K5IA 4FR5A 3RGWS 3SHVA 2RGWA 2XHEA 4CV2A 2ZR9A 4U8HA 3ZGLA 2W2KA 4F4UA 3WMWA 4RSMA 1P80A 1ZKDA 3LUFA 3NTLA 1I7DA 2BSQA 2FZGA 3GT7A 3I37X 4MYTA 2Q45A 4C89A 3LPLA 1E3SA 4KQ6A 4FFSA 1C0EA 5ALZA 1SQ0A 4LNHA 5ECDA 3AR3A 4NDNE 5FUQA 3CG0A 2C1XA 5HKKA 4W5RA 4G97A 2EARA 2ZRNA 3PX3A 4GHWA 2X1VA 3K8ZA 4R98A 5CM2Z 3SP1A 4ZGWA 1T8YA 1Q0RA 5AW0A 4H17A 2VK4A 4WBSA 5FFMA 1SIWA 3DC2A 3HZRA 3IUEA 4C0AC 3QWBA 5FOTA 2YV1A 2IEDA 4TMTA 3IGFA 2OCPA 4LOAA 4Q1AA 3S5UA 1I3LA 3FVQA 3ZCTA 1YZHA 2C4NA 1DQPA 2I3DA 1CJKC 2J5BA 1L5YA 3DEFA 3F74A 4IEEA 3PR2B 3ZWWA 1HFWA 4A5OA 1RYHA 1V26A 1SFRA 3ENQA 2XZLA 5BOVA 4LJYA 5B1SA 1KEVA 4RCYA 3DP9A 1E1LA 1L4KA 2GZMA 2PEZA 4G1CA 5C34B 1URPA 3ZHZA 2H2AA 4IZHA 2Q5OA 2A5DA 1XHLA 1TQ4A 2A9VA 4Z53A 2GD1O 1N1MA 4DZTA 2RFLA 2X8JB 5ALNA 5EJ7A 2X2FA 2ZE8A 4UEKA 3ZCSA 1ISFA 4AG3A 4EYEA 2C2BA 2P69A 1DTWA 4G1UC 3WC4A 1V1RA 1XK7A 1S2NA 2RDMA 3PNMA 3EUWA 3SVZA 3S8EA 4ZEWA 3D02A 4B48A 3LYHA 2B78A 5D5QA 1USUA 2AA3A 2B8TA 5INTA 1AUVA 4DGSA 1XEAA 2IPAB 1EHCA 2XKJE 3IP6A 2SKDA 3JQ7B 3LP6A 5AHWA 4C4OA 4S2UA 4V02A 4IIVA 4DMGA 4EHAA 5K03A 5KYGA 4QM6A 1YQ9A 1XZJA 2O8BA 2XW6A 2ZYWX 3G8CA 1ZA1A 4UTNA 2CNDA 4JHLA 5EUMA 1OY1A 4MCHA 2YMLA 1SIUA 4HNVA 4QE3A 1GTSA 1XLVA 2D0PB 3C85A 1FP6A 2X1HA 2XITA 4X61A 3W3AD 5IAJA 1CSEE 1GGVA 3TUZC 3DJYA 1VZ2A 3FHCB 3GJ0A 2BHLA 2QRLA 3CNHA 3CU5A 1LPNA 2HDHA 2XOXA 3OCUA 4RM3A 2I6XA 4TL6A 3B1FA 5THQA 2VJDA 3FYDA 4IYJA 2WUFA 1K4MA 4P1ZA 3UW3A 4Q1VA 3BK2A 3EF0A 3SU8A 2CLFB 4X3OA 1PX0A 3MJEA 4WZAE 5J2UA 4U7WA 1CUWA 1YJCA 3KUKA 1B00A 3EQ9A 3ZK8A 1O9GA 4EMTA 5FH9A 2Y4OA 3QFSA 4OJKA 3X43A 2A9JA 1K5GA 5EKTA 1PZHA 5JZVA 2F2TA 1HPLA 1QV7A 4JJFA 5H68A 3ZCXA 1OH6A 1GTG1 2H4YA 4UM5A 4PYRA 1NQVA 2CCGA 2VKQA 2ZR7A 4Q3OA 1H22A 1D4OA 1VXOA 4ZXPA 1IHPA 3RBZA 2DCUA 2IGTA 2OV6A 4B7CA 4WK2B 2ERYA 1P91A 2QLTA 5B55A 4JAVC 1TIBA 1CIVA 3D8SA 5K6RA 3GLFB 2ODWA 4G0XA 5DZSA 1MAAA 2V6MA 3P0EA 3AFNA 1EP3B 5LZ5A 3X1YA 2YMMA 2ORED 4UQPA 3IRUA 1W581 3BF8A 4XCQA 3ROTA 3TOSA 3ENNA 1R4AA 4DLNA 5KYUA 3LFHA 5IFKA 2J0UA 3KVOA 1UFOA 2FK7A 4I4TB 4F46A 1G8SA 1TLFA 1Y4SA 2PMCA 3F1LA 4UHEA 5C7OO 1Y7LA 4JP3A 3I39X 1L7NA 1PW5A 1M6HA 3NNNA 5D1HA 1JNYA 1NLMA 1XD8A 3GBSA 1U4OA 3D3QA 3PXAA 4YT5A 5TQ0B 2XODA 3I30X 5CCBA 4O25A 2Q8NA 4EPXA 3LAWA 4L3VA 1YMUA 1SELA 4NNJA 3L82B 1QSGA 1DARA 4DV0B 2BYTA 3CW9A 2PJRA 2OBLA 1RPZA 2FW7A 1QHFA 4QNRA 3SX2A 4Z3OA 1Q0HA 5AI4A 2IYRA 2XUGA 3LCUA 1UFVA 1QDLB 4FX5A 4CIBA 3LQ4A 2D2FA 5HFJA 5E4FA 3WL3A 4UFPA 4E11A 3ASVA 2J4DA 5LBUA 4LMRA 5F9MA 3SNHA 3JARB 4PYLA 4YCLA 2OCGA 4FFPA 3OJEA 4GYKA 1N9GB 3W5JA 5KB3A 2D1TA 3HYSA 5MDHA 2HSDA 3WFIA 2JH9A 3K6RA 1D2RA 2YJGA 1JH8A 1UZNA 3UFXB 4HRXA 1KXZA 4YROA 4ZO8A 5DLQC 2H1OA 3LUJA 2R97A 4AY5A 1GL3A 1AN9A 3TE7A 1ADJA 3LQ1A 1SD1A 1ZITA 3N9IA 4HN2A 5IT9A 2O7SA 3N3AC 1QX4A 1X13A 5DVZA 4AKEA 5JBIA 2UYOA 5TY0A 1YGYA 1RXYA 5JECA 1UDWA 2VF5X 3GV0A 2WT8A 3KSZO 4O4LA 4R6XA 3JQBA 5JYEA 1RWKA 1Z4KA 4FDVA 3MOGA 3QF7A 2Q9AA 2O2ZA 1SC3A 2SKEA 2AN1A 4KXYA 2GJSA 4MVJA 1VDMA 3K3PA 4KITB 3COWA 2I2DA 3UWOA 2EP5A 2QJWA 4PV7A 4DMMA 2Z2YA 5AOVA 1V1MA 4CODB 4BLWA 5AJXA 3EY4A 2D1QA 4Q05A 2G5TA 1UKYA 1KGSA 1ZGCA 3ED5A 1E1RD 5H8WA 1R27A 3LSYA 3AR4A 4OGKA 4UNPA 2G1PA 5JVDB 4RACA 4J29A 2J1LA 1KR5A 4I46A 1SH7A 1E1QD 4NBNA 2BZGA 2Q46A 1JPVA 3NHPA 4NZYA 4PLYA 4I5IA 5T8KC 3SQDA 1N6KA 3BRWD 1H05A 1Z5OA 2OA0A 1N7HA 4JSRA 2HT1A 1YJXA 3IERA 2W0SA 3QVWA 1C4XA 4M1WA 4RKYA 1P0FA 3UJDA 1FS4A 3H84A 3JAKB 5JD4A 3LA8A 3ND9A 3R3WA 3UT5B 4Y0NA 1KH2A 2AKYA 1XVVA 3OF3A 1D7OA 5DM4A 2QSUA 2H1FA 1LBTA 3HYCA 1JZTA 4TXHA 3NYQA 1EFVB 3IILA 3OOHA 4LNAA 4YDRA 1PVVA 4HB3A 4CQJA 4Q7JB 4DC0A 4QLBA 3E9DA 4KUHA 1CY8A 4K6MA 3TTSA 3FRHA 2P2ZA 2XWQA 4UU7A 3ZJVA 5L6MB 4DRXA 1TT5B 2RGAA 2XDQB 2F9LA 4CF4A 3V8RA 4DNOA 1ZVVA 3H5VA 4OHKA 1GTMA 1TLLA 3B53X 3EA0A 2MYPA 3VHQA 2BM1A 5AVTA 4AICA 4YJHB 1CT9A 5CFOA 1SU6A 3ZZTA 2PS0A 3E15A 4Y2UA 1BGXT 1ADBA 4QGGA 1G16A 1GGKA 1VBFA 2QNRA 5JY1A 1YS9A 4YBZA 2PX6A 3C1UA 3QPVA 3ZOKA 2DF8A 1XPOA 2ZXEA 1FUUA 4B74A 1HTTA 1ZOIA 2EW8A 3PJEA 1HZZA 1UDRA 4U3JA 3G17A 3QP9A 4MV6A 3SZ3A 4OHVA 1B93A 2Z2XA 4DMLA 3I2HA 2H16A 5G1OA 4YMTA 3KKKA 1FX1A 2YWGA 1ISIA 3DTVD 3ZG6A 4JB8A 4URFA 4MQ6A 2YJZA 1ZGHA 4YAKA 2FRXA 5EKDA 3AUKA 5FBZA 5JCXA 3TQTA 4ZJUA 1ORIA 1UBLS 5K05A 3PI7A 1IMJA 2C9YA 5DW0A 2IE0A 5IM4F 3MWDB 3E4DA 5FBVB 1I1NA 4TV9A 2PUJA 2XYHA 3MTJA 1G3UA 1DFGA 2BOVA 1Q95A 1KAGA 2BHSA 3AKDA 5FTWA 4YMGA 2D7JA 4FGSA 4MIYA 1APBA 2QA5A 2QVBA 5GIOE 1E8NA 4AIRA 4ALIA 3UMGA 1DAEA 3F6YA 4DSAA 3WDMA 3L0IB 2NLOA 2ZCVA 4WA8A 2OMKA 3B89A 3WYNA 1T8UA 1IAQA 2X76A 2GVDC 5A5FA 2VNJA 3NS7A 1TZJA 4QDOA 2FVXA 4CQNA 3SICE 2H4ZA 1T1SA 1JWLA 4R83A 1U0FA 4HLUA 3GEIA 4D8XA 2JLUA 2JFWA 1TU0A 1P0CA 3LNCA 2B7CA 4W6QA 4YLEA 4AJNA 3GMTA 1WSWA 3A6LA 5EE1A 1AY0A 4HVTA 2XMZA 3TDKA 1HSOA 1O8BA 3NBMA 4AVYA 1W36C 4O5AA 2JHAA 5AHKA 3PPXA 1N2GA 3PEFA 1GGJA 1FP4B 3EH1A 4WNAB 4QOIA 4D8TA 5DE3A 4O2AB 2XQVA 1R88A 1NQ5A 2J9GA 3TSWA 4D0SA 1KRXA 4BJHB 4CLOA 3S29A 2HNKA 4BO4A 2NO0A 2NQTA 3MAAC 1ESNA 5FOUA 1QPBA 3H3JA 4K40A 1B42A 1A71A 3AEKB 3Q6MA 4TV8A 4F7DA 1M0TA 3KQKA 3HV0A 3WJ1A 2X0JA 3GC6A 5F4BA 3LOQA 3ESRA 3HR4A 2V4MA 3D7SA 3K4QA 4FUQA 3QOYA 4NXMB 2CMDA 3JRWA 5F5XA 1C8LA 2O7QA 1AZTA 4OQ4A 1HM5A 2OHOA 5JJKA 2R6R1 5F3WB 2ADOA 4OQMA 4EI2A 3OOWA 2EW2A 4CTOA 3NUQA 4V1CB 5IJZA 2DLNA 3WIEA 2EF0A 5C31A 2OQVA 2W5UA 4K9DA 1J1UA 2YOGA 1TYDE 4OOFA 5BT9A 4QBHA 1XKLA 2I29A 1SU4A 2FEWB 3E70C 1FRQA 3OA2A 1E2HA 1C1XB 3IHKA 4GD3Q 1TM3E 2QGFA 4FGWA 4JHXA 3WFJA 1Z4NA 4YFYA 2MMCA 1KWKA 1QE3A 4OQNA 3O9MA 4RELA 5BMVB 1YHNA 1Z63A 4FOTA 2YN4A 1SCNE 5DX0A 2V3VA 1DVRA 2WPDD 5GAJA 3A05A 1IZYA 1OE0A 3TR5A 3ZNOA 1MC5A 2XH8A 2B37A 3W6UA 3T41A 4EUNA 4HZGA 4D96A 1D04A 2IUTA 4H7IA 2XQJA 2XA9A 1GGFA 3PRYA 4FNAA 4EF5A 1YIAA 3MT9A 5HE9A 4HDKB 2Z6VA 4KR9A 2OCLA 4ITVA 4RVGA 1N1GA 1QMPA 2NAFA 1NT2A 2Q5JA 3OPYB 1WZ2A 1GPAA 4LYJA 3IUBA 4NK4A 2QY9A 1GLGA 5CNJA 3H42B 5A5DA 4KN8A 1ZRHA 3OHMA 1FSGA 4P0PB 4DSZA 3LBAA 3E8SA 2KX7A 1NWHA 4HAIA 3RYTC 1JAZA 3CUWA 3UGTA 3TWOA 5HQTA 2ORIA 2AG0A 3D4OA 3MCAA 4Q7LA 4ZDJA 5C1BA 5IC4A 1VMAA 1O94D 3AIMA 1UIMA 2PRIA 3HKEA 4G8DA 4H0FA 5MFZA 2X4GA 3DE2X 4QAQA 1RRFA 1E1RA 4Q47A 4AWAA 3H16A 3U37A 4Z51A 3AR2A 3Q1LA 2WAMA 5GPBA 3V1UA 3KV1A 5IWCA 4ZCPA 3LPDA 3HA7A 3TX6A 3AXSA 4IJQA 3ONNA 1E1QA 2JGLA 2OY0A 4N54A 5EMLA 5I8PA 2H92A 1LPMA 1S6YA 3ITDA 1Q6ZA 2FRDC 2IYTA 3AJAA 2H63A 5KKNB 1L5ZA 2IX3A 3PUZA 3D81A 3OECA 4QGAA 5G4KA 1KO7A 2IXDA 3KVNA 4TOIA 4P4SB 5IJAA 4PO9A 4DVGA 2A0UA 4HN4B 2PSDA 2CXQA 5IKEA 5KQMA 2HLHA 4TYNA 3I9JA 4HG2A 4B3SB 3Q41A 3MF4A 4RZIA 1NX6A 2O05A 1KJNA 1QQBA 5M2QA 1JMYA 4JL8A 2AF3C 2B0JA 5JC1A 2EZ4A 4YP7A 3KNZA 5G53C 5A6SB 4A2CA 5JQGA 5AK6A 2FUG1 5H4GA 3GLTA 2XWPA 1XQ1A 2B5VA 2YHAA 3LX5A 5DI9A 3MJTA 5HNKA 3TS1A 4N8SA 3DUFB 3DVLA 2C8VA 4HNRA 4IF4A 2E5LB 3IV6A 1PTKA 4DKXA 4S1OA 5DXFA 3GDFA 3GEHA 5CJPA 2O5CA 3MJHA 2HK9A 2HFKA 3LX4A 1TI7A 1QBKC 2I65A 3ILHA 4TMKA 3V9AA 1D2AA 2B5OA 1G38A 4DXHA 2BKAA 1RMQA 3O4JA 1TKCA 3AF2A 1PAUA 1SVMA 1BX3A 2YN0A 3R6LA 4DR1B 1EWYA 3EYAA 5KU1A 4R3NA 3DLPX 4DG5A 1D0VA 5JAUA 4IILA 2YBDA 1AKRA 3AFGA 2PPVA 4K9KA 1NV8A 1QJCA 2N0SA 4TL7A 4C5BA 4AKSA 4FDMA 3PQ8A 4JP5A 3RIEA 5A4FS 3CR3C 4OD0A 2J3QA 3E82A 1DJNA 3I53A 3R0VA 4Z0TA 3RKSA 3U1VA 1ORDA 3E8MA 5IDWA 4B73A 1CFJA 1MH1A 3VZRA 3Q85A 3NEPX 1VL2A 1GPDG 1BSVA 3A6ZA 1A9ZA 3G5UA 1L5FA 3R40A 1ZVJA 1W5BA 4IIEA 2A14A 3AJ8A 3M3PA 1HTBA 3DWGA 3FPJA 5L3QA 4W5NA 1G64A 1Z2DA 1Z2CA 1RPAA 3BFPA 3UJ7A 1CDEA 2WUWE 1FFAA 2IZZA 2ZOSA 3GG2A 4CT5A 1VKNA 3C3DA 3X2FA 1SQGA 4INPA 4MS4B 4C29A 1DOZA 3ZGYA 1BE1A 2Z3ZA 2EBFX 4D9CA 3M5WA 3F9CA 2E82A 4ARBA 1POXA 2O2YA 2XKBA 2AZMA 1FDWA 2ZUDA 2XUAA 1XL0A 2JI8A 3GT4A 2YASA 3O94A 2X6QA 1RRVA 1UPTA 1WD7A 1YIOA 2GBPA 1E89A 4ZQIA 3S3TA 3VPGA 2NU9A 3EC1A 5BV0A 7YASA 3LLVA 4FI3F 3PUWA 4CKBA 2E1PA 2IZ7A 2HLPA 3KTFA 2KSQA 1CZRA 1I2MA 3OQVA 3QPUA 4MCJA 4C7XA 4AI6A 3WMEA 2EEPA 1NMSA 4E6EA 4HH0A 2NPIA 3G3EA 1K8XB 1YR6A 2IOFK 4E1BA 4DV6B 2JF0A 5AVUA 4KVGA 1ZJ6A 4RCZA 3C8MA 1BAPA 3FMOB 4JBLA 4B79A 1R66A 4GLLA 2BEUB 1ZC4A 3ZS8A 4RPGA 3EXG2 5K09A 4XPIB 4W82A 5C32A 5C8YB 1UL1X 4TXNA 3NBAA 4C7MA 2VAPA 1QB8A 4GWGA 1ZQ9A 3CNLA 1ECLA 2QORA 1VKOA 2L2QA 2QT1A 1II8B 1OGYA 3AEQB 3LK6A 4OA5A 2J5QA 2OV8A 3AJRA 1HL3A 2VYCA 3H5AA 3LOUA 3ZK7A 2AN4A 4LDJA 3HKDA 2HXYA 1USKA 3C74A 4FIZA 4JLKA 2C83A 2F4VB 1CE8A 1X8LA 3H2JA 3GJ6A 1XNJA 1UANA 2EX1A 2FUCA 5JPDA 3PV0A 4JMLA 4PXYA 3PWZA 3IUJA 5FNVF 4TQ9A 1NIPA 4PSKA 2OD9A 4JI0B 3KQOA 3WLRA 2H31A 1CHDA 3KJQA 3JS5A 1OX4B 1T9KA 2PWBA 3ONWA 3O84A 2OZPA 3PU6A 4DRZA 4E30A 5KDOA 2DHQA 3NNSA 2YS6A 4ZI7A 3RHFA 3BGIA 4QYIA 2X0DA 2VDWB 1FL9A 2AVNA 1NUTA 1S7GA 1Z36A 1J20A 1E6MA 2FEMA 3MJCA 3QVXA 4YCBA 4C5AA 1E5VA 4UBIA 5T64A 2HWYA 1Q91A 4N40A 4A03A 3EYWA 3TD6A 3ETLA 1NJ6A 3D4NA 4IXNA 3ZI0A 3C4VA 2J48A 3QV2A 1AXGA 3FB1A 2HU8A 3DVQX 3T99A 4WKPA 5BSHA 1JJFA 4OXYA 5JARA 1XAGA 4N41A 5COAA 3R24A 4QJIA 1OWLA 4O2BB 4RQTA 4ZOCA 4JLUA 5AKHA 4EFKA 3HH8A 1N0WA 4CM3A 1ZHHA 1QZXA 1E5QA 3PFFA 3GJ8A 3O3NB 4PQRA 3RT9A 2NO7A 1HDOA 4FB5A 4DNFA 1QMGA 3SSAA 5I3CA 1DKLA 4B3IA 3GJ4A 3EIOA 1JEOA 4B43A 4MKZA 1E58A 2CVPA 2P4EA 4QDTA 3ST7A 4ETNA 3FUWA 1LBSA 1OIWA 3D7LA 1R9NA 1M3SA 4QPJC 2CYAA 4U7PB 3K6SA 5EAIA 1NJ8A 4JT2A 4NV0A 3OIDA 1ZBQA 1P0IA 3QPBA 3UAOA 3FA2A 3TW4A 3TTWA 4PHCA 2WE7A 3DAGA 1PZFA 3KAKA 3PGXA 2OG1A 3VPHA 1EHIA 4OJYA 2VKTA 1DT3A 1V9SA 3HU5A 2IOYA 2JJMA 2W6ZA 3R7AA 3MINB 4AX8A 4CKCB 2OC9A 2OUKA 4LV6A 4J90A 4C0WA 3UMFA 4AZ3B 2JD0A 3ESYA 1Y4AE 2PXAA 1ZONA 4KSCA 1NN5A 4K9RA 1Z34A 2FWAA 3P5BA 3DXFA 2FP3A 3KEMA 2B94A 3N1UA 3HG7A 4BTEA 5CBKA 5IM4A 1IVNA 2BJHA 2DZDA 1I0ZA 4I2VA 4BTLA 1BZYA 1P5JA 4FKMA 1N7GA 3NUZA 1Z08A 1NIJA 2J7PA 4IH1A 1X14A 4KQ2A 1A1SA 5I9TA 2VSOA 5AI6A 1GCAA 1FPQA 2AOTA 2HGZA 5EP2A 2UZ0A 1OTXA 4A8JB 1GYPA 4PINA 5IEJA 1X7YB 2VNAA 4D4HA 5LLTA 5LB2A 3KKNA 3WGUA 1HORA 1RXEA 1W5AA 2WWTA 3DSRA 4LBWA 1ZD3A 3H17A 2CWWA 1CS0A 1SN7A 4Z4QA 3O8DA 1F51E 2VZ8A 3PNYA 4FMCF 3MJDA 4P35A 4HEJA 4JIMA 1KDVA 3TZKA 4MW0A 5EGSA 2W8ZA 4FOSA 3NHYA 3A28A 1JHRA 2FPIA 4GPAA 3RSLA 4CTJA 1SZJG 4LJ4A 3PSAA 1W9MA 1A4UA 2KJQA 2HA7A 3R7NA 4CIWA 3NVAA 4FFOA 3SR3A 3WWOA 4LVUA 5IULC 1NVBA 2AQKA 2RD2A 1N5MA 3IA2A 3SZMA 1EBFA 2P1DA 1ACLA 1A8PA 3CNNA 1V3QE 1Z2PX 2ZUFA 3GFBA 4HSGA 1WHSB 2GR9A 4ER6A 4DMUB 4G5YA 1F4VA 1LQUA 3P9QA 1P60A 2EXXA 2HWUA 3HWRA 1Q1BA 1SG9A 2E6KA 2PK3A 4NZNA 3TF5A 3OT4A 2P0AA 2P68A 1WDMA 3PC2A 4QGSA 5DHPA 5IEBA 2Q4OA 2DBZA 1ODIA 4IPTA 2BL4A 4DF3A 2YXDA 4BNXA 1JFSA 1K8QA 2QAIA 3N2ZB 4G5HA 1E1YA 3G6WA 2Z8YA 3G5LA 3SS8A 1R4MA 2PRJA 2P2SA 1T2EA 4I1OA 4BGVA 1CERA 3H2HA 4BN4A 1G20B 5BNWA 2M6LA 4HVLA 4OG2A 3DMDA 1DG3A 4X85A 5BSRA 1PGOA 4A0RA 5BVGB 3NMUF 1II9A 1JAYA 2XE6A 3QOWA 3CO0S 1VP3A 3KSUA 4ZCIA 4KFUA 1XD9A 3WNQA 2EIHA 2J3KA 3KZOA 5EHGA 2ZZNA 1LLFA 2ZITA 2NNWB 4X3PA 1SXGA 4ZP1A 1SBIA 3EQ8A 1HE4A 4N76A 3OUUA 4WZAA 1ONSA 4C4TA 3U7HB 3NASA 2HU7A 3V3TA 2L17A 4WOPA 1YHZA 5KNBH 1OC4A 1OBOA 1KAQA 3H65A 4MW1A 4E2FA 4DY6A 2LXNA 1A4XA 5CLGA 1UP7A 3WLJA 1PDWA 3FFAA 3FFTA 3N2NA 4PSCA 4RIHA 3HJNA 3GFTA 4WZ6A 1KXJA 1U7PA 4DLVA 3RM3A 4B6QA 1RVV1 2WJJA 2LIPA 5DNWA 1Y42X 2HMWA 1PGQA 2J08A 1MOPA 2G0NA 4R8RA 3X1MA 1EPUA 1W76A 1JTFA 4D99A 1BKYA 2NZWA 4ZJZA 4CKZA 3QLVA 3I1IA 1FMTA 4Q9HA 1NFRA 3TZ6A 4OFWA 4EQZA 3R4VA 4PN7A 1RYYA 2IU4A 1YQTA 3FBWA 4N65A 4PBRA 3KZNA 4E4TA 3EPJA 1F2UB 3F67A 2QQEA 4RTKA 3T6KA 3B85A 3QK7A 5B3KA 2CT8A 5EZYA 1FUIA 4IG9A 4J4TA 2Y3IA 1VRCA 2HXSA 2FU5C 3A0UA 1Y6ZA 2I0FA 3QFRA 4PYNA 5HKAA 3OJXA 3EIFA 3DCNA 3WYEA 1D0IA 5BNIA 5IBCA 2JLVA 3JTEA 3K0CC 4YMWA 1IUPA 3NT2A 4I1IA 1J7JA 2ZWAA 4EY5A 2PIDA 3PXBA 4WCFA 1CUYA 3HCFA 2ZEJA 4GPIB 4Z4EA 4DT1B 1M2WA 4L4SA 3DXZA 3QG1A 1BOOA 1M2OA 1XZEA 1ZGGA 2BF7A 3OOYA 3QYFA 2XE4A 2RJNA 4PE5B 2ZTSA 1YNOA 1DKQA 1Z0SA 1NVMB 2NO1A 3A6FA 1MH9A 5IASA 2ZRJA 5HCNA 3PC4A 4OBEA 2R8YA 4CKWA 2X8AA 3MRTA 1HV8A 4JBIA 4AO8A 4RD6A 4EO4A 1E4VA 5KUTA 2WSMA 4Y6OA 3LBFA 5HQ3B 4N47A 3AG6A 2VAVA 4HDSA 1I4LD 3OZTA 3UAGA 3HO6A 5KREA 5BPHA 2KMLA 4JXJA 4Q3DA 2AUMA 2VYVA 4PICA 1S3IA 4V0NA 4RA6B 1I5EA 2LZ0A 4F56A 2YDYA 5I7EA 3Q15C 3CTPA 3EPRA 4KG7A 2Z9CA 1AK2A 1L4GA 1PV1A 1KFEB 3CZCA 3PHJA 3A1VA 1NQWA 4LDAA 5BN5B 3OTOB 5JR3A 3N70A 3VVCA 3OLCX 5JV5A 2OBFA 4RY0A 1NULA 3VMMA 2SBTA 5EJ2A 3OZDA 3ZU6A 4AZWA 5CDHA 3W7AA 1GZUA 1T6YA 2XZOA 1KKUA 4A1FA 1M7GA 3GROA 2JLWA 1F2TA 1EX1A 3C7TA 3K9WA 5JNVA 5AFSA 1R5NA 1KVQA 1P1FA 3HCNA 5A04A 1O0BA 2GRAA 1UPBA 4PXSA 4CEJA 4KLAA 4QUDA 5DT9A 2AHOA 5TB5A 1JBKA 2GCNA 2XGGA 2E87A 1IG3A 3H1TA 4A8JC 4HWGA 4MIEA 4R1PA 3ZU2A 2MSDB 1AV6A 1DHTA 4B2PA 1TK2A 1DIHA 1DXQA 1P7YA 2Q49A 1T2DA 2ZRMA 3FMIA 3H2GA 3WLQA 3BWBA 5K9ZA 4KPUA 2VDLB 3MW8A 4UAVA 5BYAA 2PD3A 1C8KA 4GI7A 3AR5A 3OU7A 1L8LA 4HBZA 1XZHA 2QMQA 3B1JA 1V0JA 4F4IA 5J2TA 1ECGA 4LE2A 4Q4DA 5HCIA 1YAHA 2A33A 2TMYA 4JLPA 4MO2A 5TMEA 4EDFA 1M33A 3BCHA 3ORHA 4QXOA 4BKRA 5DNYB 4MPRA 2O0KA 1GTZA 2CVQA 2UZ3A 3NEJA 1J1IA 3V5NA 1TKAA 1J56A 1CR0A 1L5KA 2WJIA 4DIBA 4MPJA 4X95A 3UVEA 5BV8A 4DV3B 2Z83A 3AILA 2W2KB 5THKA 1NNUA 4B3FX 4PPNA 5IABA 1TQHA 3IAXA 5AXDA 4WEOA 1V8FA 4BVJA 1RPTA 4MR9A 4X6YA 2DB3A 3ANTA 1YVEI 4NCAA 2F9MA 5F7OA 2NT3A 3RSQA 1GXSA 3O9VA 4XXHA 3UMVA 5L4LA 1ZCZA 2VF7A 1UOQA 4OXIA 1A5BB 2BGLA 2VP9A 3EE6A 3HB9A 3O3MB 3VGPA 3T1QA 1BGWA 3T3GA 4YMUA 5IJ9B 3SJCA 2CBXA 3BS4A 3T12A 4KX3A 1FS5A 4QOJA 3W8EA 4HFRA 1GUZA 2X9NA 2ATCA 2HMAA 2YY5A 2D3WA 4XI9A 4X71A 1E20A 3E7FA 3N74A 4AMYA 4KIWA 2DFPA 2L69A 3DKKA 4R84A 1A95A 1LLQA 1PL8A 2B0CA 4QSHA 2YIVX 3HJHA 4FOLA 3VHRA 4RPIA 3BL6A 1KTIA 2GN9A 3AHEA 1QYIA 2W8BA 4C08A 4AURA 3ZD8A 2GETA 3UYLA 2IPXA 5JS2A 3AV0B 5AVXA 2O6HA 4HK4A 1PJQA 2JFYA 5BSUA 4R1QA 5I7UA 2WJZB 1DTWB 4B3MB 3RIMA 1V1RB 3AGQA 1Z6QA 3GJ7A 4RF3A 4V03A 2IXEA 4LSZA 3K9GA 4X65B 1FU7A 1A9SA 1I2DA 1OF1A 4R1SA 2WA2A 3WYDA 5JTTA 4DTCA 2E0IA 1U9IC 4JI1B 4HFMA 2ZPUA 2O8BB 5E7MA 3WLOA 1DWPA 4O8ZA 4YJ3F 3TLEA 4FZ3A 4Z9XA 3LUGA 4GC5A 2A7XA 1MC8A 3WQHA 1V1JA 2H1LA 2I5PO 2DY1A 4WDRA 5LP6F 4BATA 2QJRA 2C0PA 3QKSA 4IDNA 5T6MA 3BGWA 4FP9A 3H4TA 1CRZA 1DEOA 3UICA 2QVLA 4J0JA 3UXHA 1LSOA 4D0NA 3KOXA 1PYOA 4Q4JA 4KSBA 3T4UA 1NURA 3QQPA 3S2YA 1KVSA 5J2UB 1KI6A 3O47A 4PTZA 5LJLA 4R0NA 1E9BA 2WA1A 3CGWA 3DMFA 2FE4A 1ISPA 5WRFA 1TTHA 3QEJA 2OVBA 4KRFA 4XW2A 5NULA 4E2WA 3NATA 5FAKA 4ECEA 1Z45A 2IUSA 2NTEA 2WDZA 2HSWA 3BAFA 3ND8A 2QX8A 4EI8A 1J0BA 3BMQA 1XYGA 2WI8A 2AGVA 2X14A 3ENKA 3IFSA 3UAWA 2IV3A 1S4QA 1QF7A 3IP8A 3QEAZ 4GBMA 4I55A 4NAUA 1QTNA 3JD2A 3NH9A 4LCEA 3SHQA 5K8UA 2W7TA 1RM5A 3IKVA 3DBHA 4WZBE 3PDHA 1HQCA 1KU6A 3WK6A 3FB4A 4K2AA 3A4VA 2OAEA 3K30A 4MRMA 4OUKX 1G7SA 1V48A 3CUSA 2WWVD 3G79A 3RS7A 5KYUB 2BR3A 3SIPA 2J0UB 4AIIA 2HUPA 5G40A 3ETJA 2CBGA 1SHZA 1XVUA 2G36A 1PR0A 2PA0A 3I23A 1WTCA 4MRVA 4Q9LA 5H5JA 1ZKMA 4LY3A 1AURA 1QF9A 3S2UA 4KR6A 1N8SA 2UZAA 5KMGA 4S12A 4XFDA 1DCKA 4PBTA 5DULA 1QPGA 2V55B 3RBXA 4QHSA 3MYYA 3C70A 2EJVA 4NJOA 5DEOA 4U7DA 3CRZA 4MVYA 4US2R 4G0PA 3EMKA 4LVNA 2B9VA 5L8VA 1U0BB 4A8PA 3ZWPA 1EX6A 1KRWA 1FVXA 1TMKA 3TIIA 4WBNA 2LE0A 3JZDA 4RL6A 5LWHA 3LT0A 4KUGA 1K68A 1USWA 4RYDA 2DWUA 5IRCD 2G09A 1Z4QA 2PBZA 2VXCA 3IQDB 3NOQA 3Q7TA 4HPWA 4A2PA 3QFHA 1GGNA 4G81A 3VQTA 5JSHA 1XMIA 4D57A 4I7EA 4JT8A 2VT3A 3I04A 1UMKA 1RYZA 3DH0A 3UA3A 3HI6A 5BWBA 2CJFA 2PANA 4BFTA 3ZWOA 1C50A 5KYNA 3KQQA 3K9FC 2ZUVA 3IP3A 1S4MA 4Q15A 3PRKE 1OH7A 2YRFA 1Q19A 5GINE 3TJRA 1O4WA 4XDHA 4ZGGA 3K4HA 5C1PA 5DNCA 1KSJA 4RJ2A 1GM5A 1HE8B 4D3SA 4B6RA 3CRQA 2RB5A 1JVBA 1M75A 1OCEA 4BC1A 5TVKA 1H2AS 4O4LB 2GK4A 3N7UA 4JI3B 1NZDA 4NLLA 1B14A 2QVGA 1SKUA 4D80A 2DWOA 4I99A 1AO0A 2XVZA 4NJMA 2Q2WA 4GBGA 3HCEA 5IBRA 1A8IA 1BCRA 1LK5A 2JGIA 1XDSA 5KOJA 2FWIA 3BQ9A 1GAXA 3WL6A 2JARA 4TTAA 1RS0A 1W0JD 1ZFNA 2ZUBA 4M37A 2HTEA 5AVQA 3KXIA 2A2ZA 2V9PA 1ZCAA 2GBLA 1O08A 4K7JA 5KPDA 1V1MB 2VHTA 1PQPA 4AYWA 2Q4BA 2QTZA 3RG8A 2RKOA 1E32A 1PV4A 3TDNA 3WBJA 1B41A 3NOXA 4CR7A 1DEKA 5L95A 1P7VA 2QUJA 1KZHA 4HVCA 3C7KA 2UAGA 3DT8A 2P9TA 4QPZA 4CDMA 1E0AA 2G88A 4UKDA 3EG9A 1A0OA 5DLDA 4H7KA 2UUOA 2FY8A 2Q2NA 4GPEA 2PRYA 4PR3A 4YIKA 2VHXA 5AWFC 4GICA 4BZWA 4XDYA 5FPQA 1DADA 1MG5A 4DEXA 1JDJA 2QV0A 3RC3A 1G8HA 2QI9F 4BX3A 4G8BA 4EITA 3GRVA 4MR7A 1J8YF 5H83A 3N7TA 3TLJA 3ETEA 1ENYA 5A0FA 1TW2A 4JYBA 3H5RA 4LE1A 2QJTA 2QF7A 4EKNB 1AD2A 3L0ZA 4HB2A 3N28A 2X86A 1SHKA 4EI7A 1R1DA 2BCEA 1P81A 1VFPA 1I51A 2CXNA 4MH0R 2REOA 3TXYA 1EK2A 1B1CA 1LBHA 3V7WA 1D4ZA 1WW3A 5K2MA 2GPSA 4DRXB 3LDFA 4O2RA 3KK0A 3MPOA 1AT1A 1YDFA 1XTIA 3IOMA 2C7VA 3WGMA 4KHPB 2JEOA 3OPNA 3HNOA 1X1DA 2G1AA 1CUJA 1VQ1A 2QE7D 4MWSA 5AMXA 1Q14A 1ORVA 2CFIA 2H2FA 2PU5A 1IXRC 3INGA 3G8YA 3MXOA 4LKRA 3RFTA 2V7XA 3UWKA 3GJSA 2HR1A 3N2EA 3I32A 5C35A 1DKNA 1N6OA 2OYCA 1IY2A 2BLNA 5MN5A 3JQ8A 4R1OA 5TEVA 1G3MA 3LX8A 3TZBA 1JA0A 2WAYA 3BN3A 4U3JB 2UYGA 4AU1A 4C1BA 2J6BA 2BE7A 3U7EB 4ES6A 1D6SA 1P74A 3O8QA 1PKEA 5CEJA 3BIJA 1R6XA 3D5QA 3TKYA 3IL2A 3DZ8A 2ZUWA 3VJKA 4EG1A 2VJLA 1J07A 3VU8A 3U60B 2DUMA 5BOSA 4IXMA 5ADHA 3ANYB 3B78A 4LCBA 3IVAA 5IJ0A 2DQZA 4U2FA 2VSYA 2OLKA 1FFCA 4OB8A 4QBIA 5A05A 5KWEA 4WY5A 1JHYA 5I01A 2G70A 3QU5A 3G0HA 4IV5A 4M0FA 4BLRA 2I6UA 4QPCA 3TTXA 5LZ4A 3HO1A 4TV9B 1NZJA 3OZRA 4PCLA 1U81A 2NAPA 4TVKA 4V24A 4JGIA 1EU1A 2D2EA 4RJKA 1K0FA 1YZQA 3OKPA 3OU6A 1WEHA 4DQXA 4MSUA 2FEXA 2YHUA 3P0HA 1G1MA 2R68A 2HSEA 2ZCJA 1C2TA 1Y9ZA 1PJCA 2P4UA 3SY8A 2H9YA 2VL7A 2Z0MA 3I42A 4HNSA 4JS0A 1QGED 2BMDA 1E9DA 3SSNA 1Y1LA 2PZMA 3PYLA 4N0DA 1E94E 3HY6A 5DHRA 3UK1A 1R0SA 3ZV6A 2BFBA 1UM8A 4RLQA 3V48A 4BQNA 4DDVA 3AB8A 1PJ8A 4EAQA 4O1MA 4ZN6A 3E58A 1M2HA 2PYZA 4X84A 1G4UR 1RBYA 1ODFA 2AI1A 1MB0A 2NV0A 4LV8B 3A1SA 4GOND 4V0KA 3VUFA 2VSXA 4RVCA 4BFLA 4CG3A 4TMZA 2PUAA 3SK0A 4BB5A 3SXJA 1ETHA 4AECA 1F0KA 3FTDA 1XTSA 3HADA 3OIGA 3MBKA 4GF5A 1TJYA 5F23A 1M2VA 2X1MA 2P5SA 4FONA 1A8UA 1AQ6A 1FZTA 3QMVA 4OB7A 2P62A 3ER8A 1ZESA 2QEQA 2CLDX 4WAUA 4BPBA 2QRQA 2OK7A 5IXYA 1TYCA 3CVXA 2GDZA 4HFJA 4RGYA 2IUUA 2O2XA 3MT7A 5CDTA 1NJ5A 3COZA 1CJBA 1J9GA 1ML4A 2G71A 4CLOB 5L7WA 3GLKA 1IATA 1OHHD 2IUFA 2QMZA 3EIXA 3R0ZA 2Y2VA 3BWDD 4OMDA 2WUEA 4F3RA 1A5ZA 1MU0A 4TV8B 3IT3A 3RU7A