1QZTA

Phosphotransacetylase from methanosarcina thermophila
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
332
Chain Sequence
b'VTFLEKISERAKKLNKTIALPETEDIRTLQAAAKILERGIADIVLVGNEADIKALAGDLDLSKAKIVDPKTYEKKDEYINAFYELRKHKGITLENAAEIMSDYVYFAVMMAKLGEVDGVVSGAAHSSSDTLRPAVQIVKTAKGAALASAFFIISVPDCEYGSDGTFLFADSGMVEMPSVEDVANIAVISAKTFELLVQDVPKVAMLSYSTKGSAKSKLTEATIASTKLAQELAPDIAIDGELQVDAAIVPKVAASKAPGSPVAGKANVFIFPDLNCGNIAYKIAQRLAKAEAYGPITQGLAKPINDLSRGCSDEDIVGAVAITCVQAAAQDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate acetyltransferase
publication title Crystal structure of phosphotransacetylase from the methanogenic archaeon Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Transferase
total genus 111
structure length 332
sequence length 332
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.8: Phosphate acetyltransferase.
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01515 PTA_PTB Phosphate acetyl/butaryl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10750 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isocitrate/Isopropylmalate dehydrogenase-like 1qztA02
3.40.50.10950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qztA01
2AF4C 2AF3C 1TD9A 4E4RA 1R5JA 1XCOA 1VMIA 1QZTA
chains in the Genus database with same CATH superfamily
5AW2A 4ZAGA 4BB9A 2JAOA 4U8HA 4CLOA 1QBKC 2FPOA 4G0MA 2V5UA 3ETLA 4YJ2A 2ZE7A 4ZOQI 4BNLA 1Q6YA 2TS1A 4DOMA 2XSZD 2AFIB 3ZW9A 1DSSG 4BX0A 1GO2A 5IJ0A 1TZBA 2F17A 3DLAA 5L3VA 1HLPA 1KHHA 3TQRA 4BLQA 3TUIC 4RZHA 3JZDA 4QRIA 1WO8A 5AKGA 5EPEA 2OYRA 2JJ1D 3OZUA 3ZCVA 4DYDA 3Q6MA 4BVEA 4BNMA 1O6ZA 4CT4B 1RLMA 2QVLA 3I1IA 3MGBA 2BIFA 1PW5A 1ILWA 1CUDA 1DXHA 3NT4A 1HYEA 1NURA 5EE5B 2VDOB 1PHRA 3E5RA 3N70A 4RF5A 1AQNA 4H08A 3WQSB 4QTTB 5C37A 5JZ9A 3OZDA 5DLDA 5ALZA 1NNUA 3IERA 1MA0A 1JHYA 1VBKA 5EWMB 1C9YA 4EX7A 3E84A 2HREA 4A3SA 2ZZKA 4PG7A 3FTQA 1E58A 1MEJA 2PX4A 2CYCA 3C43A 3H5WA 1WZNA 3IAM6 1USGA 3PNKA 5CRIA 1W52X 3RAPR 1UADA 2CXPA 3JQ9C 3EVAA 2W2QA 3BKWA 2OCAA 1M2VB 2I34A 5E8RA 3CH5A 3BJRA 1WWKA 4KYUA 4ZVTA 2XCUA 3RAJA 2XOXA 4FGLA 5E0KB 1T1RA 3B9RA 4HDSA 4TL9A 2OCBA 3QNWA 2BP7B 4WSOA 3QH4A 3QX9A 2YXEA 4HAZA 4IVNA 4RA6B 4IAOA 4K8RB 4PYOA 3JYNA 3AMVA 3EQ9A 4H7DA 3R9XA 1ODIA 1WPXA 2HJRA 2XQFA 2OBXA 2CB9A 4F85A 1FMLA 5ANRB 1J25A 3IKVA 2IELA 1EQ2A 2ZVPX 2K6GA 4FOPA 1BFKA 3DD1A 1R1DA 4QYWA 4PLFA 2DY1A 5EP4A 4C7VA 5A3QA 4DEXA 4H3SA 1TLFA 1DFGA 2DRIA 2X0RA 3PC2A 4YRCA 4NU5A 3WLEA 3ZXIA 4F56A 3TG8A 2FZEA 4LIPD 1RW4A 2B7CA 4NJMA 3RVNA 5KOYA 5JNLA 4UE3S 4ZTUB 3OP1A 3JQQA 1KSJA 5HF9A 2I2FA 1DQNA 1E32A 4JC0A 1DJQA 1G4HA 3Q0IA 3QPAA 1NE7A 1GZ7A 2D8MA 1ENOA 3FNFA 4Z5XA 3ISVA 5KYXB 3TQSA 1Q0RA 3WHKA 3OHMA 1UEJA 4NF2A 2D62A 1CY2A 4GPBA 5KTPA 2EIXA 1YOVB 4PS1A 1I4EB 2C0CA 3V1UA 5ED4A 3TQQA 3KJXA 1U4NA 1OZHA 2C9DA 3FGNA 5BVGB 3QENA 1C7EA 1XTIA 1ZN8A 1ZOOA 3RIGA 3ZIAA 1GT6A 2QTGA 2P9YA 5BNTA 3M5PA 2AEFA 3VHXB 2GAAA 4UDNA 3WB2A 3A6PC 1XTPA 4U3JA 2II6A 3FKSA 3UJ8A 4R8RA 4R8LA 2PD6A 1FX0A 1GRQA 1YRAA 1ZH0A 4MYDA 1NU6A 3B8HA 4IL5A 4G5XA 3DL7A 3L0DA 2B30A 5A5EA 5JSUA 3G7UA 4L5BA 4E32A 2AZDA 2ZBUA 3IPYA 1I80A 4LJRA 3DCYA 4PIPA 1J0DA 1RXEA 2IS4A 4Z4HA 2E9SA 2ZITA 3FETA 4C30A 4B46A 4NLLA 2WFLA 4UXHA 3TNJA 2YS6A 4F11A 1YRBA 2N1MA 1QF7A 4LMRA 2I65A 2R25B 4P54A 2AFHB 3EW7A 5CIWA 4ZDJA 1O0BA 1KYTA 5I9NA 3L6CA 2QAGC 1LFDB 3WLSA 3HKCA 1QMPA 3AVPA 4DMLA 3LOPA 4CM1A 4G1EB 2FR8C 3KR9A 4HWPA 1RYMA 1USKA 3I1JA 2A2ZA 4F4JA 4NBTA 2I67A 2NWQA 2P2GA 3BIOA 3SGLA 3ROMA 3WMEA 4Y6QA 1Q17A 3GZ4A 2XY4A 4MUMA 1J2JA 1OU0A 1ZZEA 4GC9A 4M9SA 4BVBA 1QS0B 2ZJ4A 4HEHA 4D4GA 1M34B 2BFCA 2YNMA 3EAGA 3G1TA 1QRAA 4K7JA 1KH1A 2WMDA 5B7PA 1WMBA 2G6TA 3WRXC 1II8B 1YS7A 3ZBQA 1G20E 3KSZO 2OAQ1 1SKMA 1NVVQ 1HPLA 1G18A 1OHHA 1VECA 1ZHHA 4P4SA 5T6MA 3MWEA 3RS7A 5J4YA 4JHXA 1BDJA 4G41A 4EB8A 3RVBA 4HQFA 2YBEA 3LQKA 4Q7MB 2ZJ7A 5DJ5A 4TRRA 5JLAA 2XYRA 3FJYA 3WHIA 2VQSA 1PZFA 3NT5A 5K4AA 3LDAA 5FR1A 1HYQA 5CIQA 2VPIA 1H2WA 1OTHA 2XAUA 4C7BA 4AY2A 2O0MA 2QRJA 1ZSYA 2VSQA 3PJEA 3QG5A 2Y0EA 4NEHB 3FCSB 4A1FA 1RFLA 1JI3A 2R4TA 3WZ2A 2JZCA 3DQZA 4OQYA 2QD3A 3NH6A 5K3OA 1G2IA 2D06A 1TEVA 4XWAA 5ITZB 4MKHA 3KZCA 4PFKA 2ZSBA 5JMWA 1ZEMA 3DOJA 5T6BA 1VCHA 3C0KA 4MZXA 2P6OA 4HNRA 2F1IA 1FDUA 3ELDA 1NF2A 5JH7A 1I2AA 5G2OA 4JXXA 3E3NA 4MKRA 3ZI0A 1PWEA 1GZVA 1I13A 1GZDA 3FNGA 1O0SA 1E1KA 5JFGA 3QOXA 3ZLTA 3WDMA 4N8SA 1FFGA 3LWDA 3WBBA 1IZYA 4XWTA 2DWUA 3OOYA 1Y8ZA 1NBEA 1SU4A 1ZOPA 3ECAA 4KXXA 2Q46A 1JDBC 3K09A 4TMXA 5ALSA 2QE7A 4HXYA 3KSDO 3FPAA 3RBXA 2GAOA 1F9EA 4MWDA 3J80A 3O47A 4H6PA 5CCBA 2HLDA 4D4HA 4E6PA 3T9AA 2GAJA 2ETXA 1P9WA 1N2JA 2AQKA 3W7AA 3K7EA 4CMIA 4A0HA 1E2FA 2GZ3A 2ODBA 4BNKA 1YB6A 4HRVA 1N2HA 3FTNA 3F6BX 1Z8HA 4OJNA 3REGA 5JV5A 1Y9JA 2X1HA 1NVBA 2BN4A 5CVEA 2A3RA 3FFTA 1H6AA 1M1XB 4LWOA 2XUFA 3HRKA 4MS4A 3IFSA 2F9FA 5K51A 3MBKA 2XEXA 4CKCB 3AVVA 2XA9A 3HYLA 4F1WA 3HXQA 4XOIA 3FNQA 2JHPA 1LTHR 2GTIA 3PHJA 3QPUA 1U0RA 1FB5A 2FUG6 2JLAA 1U98A 2VJQA 4FHDA 3BH7A 1E1LA 4B31A 3CCBA 5IPFA 4CM7A 5A4AA 2ZI9A 4HPXB 1XNJA 3TXYA 4CEIA 1V9CA 1Q0SA 2JGNA 2RSLA 2PT7A 4S1TA 2AQHA 2R96A 3AM5A 5G3YA 2DH5A 1UPUA 5TY0A 1H0SA 1YS6A 2GPJA 4RF3A 3NW9A 3ZK8A 1VXOA 2G70A 2P62A 2YMPA 3U81A 3RTCA 2VTBA 1VJTA 4NMXB 2ORED 4N65A 4GE3A 1EUCB 1SWWA 2BW0A 2ZT8A 2CBZA 1J7KA 1J6UA 3RODA 3KZNA 1FOEB 1XNHA 2IXDA 3P4YA 4H7IA 4OQ4A 1WZ2A 4Q9JA 1ZN7A 4E70A 1XRPA 4QU5A 4ZVMA 2XRFA 1E1QD 2CLSA 3F5MA 5AI0A 2V6GA 3JQCA 4BLWA 2IH4A 1PNRA 1N2IA 4TM8A 3OH8A 1IN5A 4GECA 2H1VA 3NWPA 1CUFA 3T7TA 2BEUB 2PAAA 4B35A 2P2NA 3AHCA 1J0EA 3M2PA 4GC5A 2BZGA 2O3SA 3NUZA 4MITA 4Q1BA 2IW3A 4FEGA 4DMUB 2A1UB 3W1WA 5DTJA 5THKA 3G02A 4L6CA 3DULA 4Q3AA 1K98A 2OMEA 3I12A 2B0JA 5E7QA 2HCRA 4J03A 2BV3A 3C98A 3BDAA 1K5HA 4IV0A 2GZMA 2H7CA 3T0FA 1PQYA 1R66A 3KQUA 3Q1LA 1T36B 3K30A 2QPOA 2X4DA 4F5WA 4UJ3A 3KYJB 5KYYA 1XNRB 4CFZA 1T26A 4WKPA 1Q1NA 4HUQA 4BWYA 4FQ8A 1KJZA 4QOHA 3HPRA 2W8ZA 5JNRA 3FM9A 2VBFA 2GLUA 2JCXA 3KTDA 2QLMA 3QE0A 1MN6A 3DE1X 4JJIA 2IE0A 3GP5A 1TCCA 4IVPA 4XJVA 4D4JA 1GTL1 3MOIA 2C7OA 2J41A 1JJBA 2EIHA 2H65A 4KN5A 4EFNA 1RE0A 4PLZA 4INAA 5JQWA 4RE6A 3EUEA 4QBGB 1WKBA 3KBBA 4Q7KA 4XVRA 3VU8A 1YQ9A 4CUKA 4DA4A 1XHFA 2WP0A 4M8IA 4JXZA 4L1KA 2W9XA 2KBFA 2ZJ6A 3NETA 1QQ7A 3N87A 3UPUA 1WCIA 3C70A 3S2IA 3DUFB 3SFZA 3T4UA 5BNFA 3VH3A 1D7OA 4ENUA 2I1LA 2OYSA 5HFAA 3FGPA 4JFRA 2J32A 2IZ7A 1B0ZA 1Z0UA 2QLTA 1M1ZA 1L3IA 1M6EX 3IT1A 3BM5A 3N74A 5HJ7A 3AQIA 2H1IA 1CP2A 4LYGA 2JCGA 3ER6A 2YW2A 2BDUA 4FK8A 3O9VA 4LJLA 5IUNC 3IAS6 2GJSA 2K7FA 4PQGA 2XRYA 4HATA 3UANA 3F98A 3MJEA 5EERA 2ZG6A 1TYEB 2JEOA 2NZWA 1U1DA 3D2LA 3UMRA 4WDRA 1G41A 2PGDA 2IYUA 5GINE 3BD8A 5BWOA 1XEAA 1W30A 3N28A 4EYOA 1OBOA 3HEMA 4N6OA 1TMGE 4F2DA 4F5DA 4GP6A 3W2FA 2BD0A 2AOUB 3WQQA 4XD7A 3KVNA 4RK1A 4CHTA 5LP6A 3RD5A 1YC5A 1MV8A 4DBVO 2XI4A 2PUEA 1EFRD 2OMKA 4WERA 3CNBA 1VDZA 3D3JA 3MS2A 1NW4A 2MYNA 4QWMA 4EJ0A 4OY3A 1XB2A 3PNVA 4YDHB 4BVFA 1JEYA 1NVDA 2ZS9A 2GGSA 3TJMA 2GEDA 3F47A 2FE4A 1W44A 2IEIA 2YHIB 1A8HA 3OPYA 4J0FA 3R41A 3WWDA 6YASA 2GN8A 3T3IA 4KO8A 2E4YA 2HQRA 1YZQA 3ILXA 2C54A 3BSWA 4B76A 1SU6A 3NALA 1TD1A 1H5QA 1KOFA 1W4ZA 4FYWA 3AO0B 4KGZA 5BSVA 5C2JB 2XOKA 2OL4A 7AT1A 4I08A 4IDEA 1NKTA 1Z2PX 1BYUA 2GFHA 4Y2SA 3VC3A 1Z38A 3K8QA 5HILA 5KMGA 2Z6AA 1OGIA 1NXTA 4O4JF 1EQUA 2ZZMA 1E3DA 1OREA 1MA3A 1YQGA 2ZIUB 4L3WA 3HYNA 1NW7A 3JR3A 4H16A 3L6BA 4P4UA 4ISCA 5D86A 3ZBUA 1WV1A 3CG0A 3RYTC 1BE1A 2XXJA 1JQJC 2X8AA 5BR7A 2I4RA 3OURA 4GU5A 4D9MA 4RLQA 3PJDA 5JQGA 3PE6A 2FJPA 2PZLA 5JI3E 4IXDA 4L08A 4MS1A 4O2BA 4CMJA 3ZE9A 3CKLA 3PUKA 5I7OA 3F49S 1OIWA 2F00A 2PAFA 5B3AA 2I4OA 3HFJA 5KHAA 5DB4A 3E27A 1G5QA 1IJFA 3GPBA 1Q7GA 2XWJI 3QXJA 1DKPA 3JARA 3T95A 5FUMA 1OJLA 2AF4C 3PC7A 3A0RB 4JOBA 4DA0A 4W82A 1AX9A 2O8VA 1UBNA 3NIWA 4DC0A 4X7PA 1ZRMA 5HK8A 3TL3A 4QU9A 4UAUA 5F9HA 3BTUA 2W6ZA 2HR1A 4J1TA 4LDQA 3CZ9A 1OI7A 4V1CB 3UB3A 1P3Y1 2AG5A 1MAWA 5HSGA 1KMMA 4RIHA 3TVYA 3K72B 1DC5A 1ZMOA 5HTOA 1NUTA 1DINA 4JA0A 3V1NA 3ASVA 3P2KA 4ENWA 1A9PA 4ZXFA 2OGTA 2AVDA 4D0RA 5LDHA 2G8LA 1U0LA 3UMCA 4DXDA 3ZXSA 1G9SA 3ECCA 1IOWA 1T43A 5E6SB 5KYUB 2C2ZA 3RREA 1OLSA 2BCJQ 4QEZA 4W7IA 1GKKA 4JU8A 1CX9B 1K89A 1L8LA 3PUIA 4HRYA 1YVUA 2H5JA 2QORA 5KSPA 1P1BA 2QNRA 2HPZA 1NI3A 1VLHA 1ZD2P 2IVFA 1Y9DA 3I9V1 4HX5A 4NOLA 3P9PA 5KQPA 2ZDGA 1XRMA 2CNDA 3ZVMA 1NUQA 4LA4A 2VDNB 4S0XA 4ZHQB 4S1OA 2Z98A 2IVZA 4WNAB 1RPTA 1JHOA 2TMYA 2ZTLA 3NTXA 4R1PA 4ZOLB 4AECA 1GFZA 1YUNA 1B1CA 3PA6A 4Q02A 4BX9A 4CTMA 3THWB 4TV9A 2J9XB 2EXXA 1V9LA 4MR8A 2XKKA 4TKUA 4YUZA 5CG1A 4FSHA 1G8SA 2GM3A 4U6QA 3MAJA 2IHBA 4WK6A 2ZKLA 2BTOA 3LPNA 4Q1DA 1BMQA 4XPIA 1ND5A 2VI5A 4ECEA 1DCTA 3I5MA 3PQ7A 4QSHA 1FQJA 3LUHA 2XMBA 1EJ6A 4TMKA 3L4KA 5FOQA 2YZ7A 3HM2A 5REQA 5F1PA 5JZOA 1K68A 1AZSC 3AIIA 2VXBA 4L5IA 4WADA 1T9CA 2CHQA 2NXEA 3K16A 2C94A 3MXTA 3LQYA 5DNCA 1RWPA 3RIEA 3I30X 3LD9A 5CH8A 3S8EA 2GJAA 4CW7A 1QKKA 1TKBA 2R1VA 4ILEA 4KVAA 3URKA 4DWOA 2YL2A 1YONA 1VPTA 3OX1A 4CI9A 3N58A 4CG0A 1W85B 4TWBA 4F97A 2VJMB 1MRZA 2B4AA 2G77B 1II0A 2H7VA 4RGBA 3TRDA 1VFNA 2WA1A 3C3YA 4KE7A 1PL7A 3Q7SA 3S68A 1NPYA 1YBHA 3FAZA 4QXRA 2WWYA 2G76A 3DE3X 3DZCA 1YS9A 2Q28A 1VP3A 3HP1A 4TL8A 4BIIA 1X15A 1HQKA 4F3YA 1PVDA 3UENA 1GRNA 2CV0A 1F3LA 2NP7A 1Q1GA 4Z8YA 4GSKA 3U17A 1QIHA 2E0IA 3ENZA 1BC5A 1C1DA 4QLBA 4QQFA 3CO0S 2HSJA 2JASA 4JUDX 4ZGBA 1LDNA 3FWZA 4CDGA 2AC4A 2QRQA 4KN8A 3H4IA 3A1CA 4C29A 5L51A 5LOVF 1EUYA 1DADA 2KS6A 2PVSA 4JB0A 4DM3A 2VDRB 4B4UA 4ECAA 4U2GA 4EG8A 3OQVA 2UUCB 4D80A 3BRWA 5FBVB 5F78A 4JEUA 3F67A 1NI4B 2A9RA 4ID3A 1WF6A 2YY5A 2VNJA 1A2OA 1KFJB 3I6IA 2A9OA 5F64A 1JAHA 4RMIA 3OX4A 4WE3A 3BE4A 5K0LA 4ZMBA 5J4KA 1AXEA 1DMSA 3EGCA 5BOSA 1UFRA 5JAPA 1DQPA 4XGIA 1W581 1JT9A 1C3JA 1EP2B 1LSSA 2O57A 3VTZA 3W5IA 1BG6A 1UBRS 2B6NA 1E96A 1GVNB 4A2PA 5FF9A 3ZCSA 3IQDB 5HJEA 1C41A 4GOOD 1ORHA 1YJXA 2R7KA 3EODA 4BQNA 3WL7A 1TQ6A 2FMKA 1TZMA 1GGEA 2CLMB 3OC0A 4KWCA 3MMNA 4YJGA 5FPTA 5IYZF 4CVNA 3TDKA 4XPZA 4JOSA 5CEJA 3G7SA 2VZEA 4A8JC 5ISMA 2I71A 2I9KA 2B5OA 1EVIA 3ESQA 5E9JA 1G3RA 1DRVA 4BYMA 2BKAA 1I94B 1QUFA 1PX0A 3FUXA 1V45E 1ZR4A 1E77A 3PXCX 3KETA 3I09A 4MUIA 1MVOA 4HI0E 2JHCA 3L0BA 1CLEA 1UKVY 3BXGA 4KXFB 2HEGA 4CM6A 1D2GA 2AOXA 1C3OB 2O52A 5KNDD 1AIPA 1M73E 2I62A 1DXOA 3LAWA 1FNNA 5A04A 2IHUA 1C2TA 5LLTA 3AKDA 1QH8B 1IOZA 4Q66C 4EENA 4JHLA 3UIEA 3O9ZA 3VAYA 1ZOLA 4DFDA 4BTVA 1E7SA 1SQGA 4L4UA 4MS3B 3WLTA 5H81A 4GZMA 1JMYA 2Y05A 5C7OO 3LL4A 4Q4HA 3COWA 2WPNA 2ZJAA 1T0IA 3VO1A 1JAIA 4OKSA 3ZVNA 2Y1FA 3B3GA 4JOCA 2GKGA 3PFCA 3ZJVA 1KQNA 2YN2A 4KVFA 2XJ9A 3CSSA 1R4MB 2LBPA 3H11B 4INZA 3TPZA 3NV9A 1UK6A 3FMOB 5BQPA 1K8ZB 4HGOA 2HJGA 4HVTA 1RXVA 5DNEA 2IYRA 4YAJA 5F7XA 3K9GA 4E46A 1W0JD 3TUJC 4Z54A 1NHGA 4U2DA 3VUFA 4MIKA 3BKXA 4FMBB 2RI0A 3EIOA 4Y6SA 2NTNA 3VISA 4CG1A 3BFVA 3KQLA 2R60A 4WZBB 2H1SA 2Z58A 4M98A 2FEAA 1NE2A 2VZLA 2W7TA 2WJIA 4DPLA 3NBYC 3UMJA 1XU7A 3WGOA 2F7SA 3LCVB 3MIZA 1H2FA 2X1VA 4YAEA 4QT0A 2CZGA 5TQVA 3E53A 1J1ZA 2BBOA 4TS1A 1O8CA 4RORA 3L49A 2CUTA 5CURA 2NGRA 4IIHA 3TOSA 1FMFA 4YDQA 2DAPA 1WXXA 1XD2B 2W2MA 5K0EA 2DPGA 1ZHOA 1H4SA 2Y67A 2JAHA 1GTJ1 1QVAA 1VLQA 2REXB 1Y1RA 1LNZA 2RAPA 3BSFA 3DOIA 4OBBA 4C7JA 1K97A 3BSSA 1AKYA 2NSDA 3D6MA 3FYTA 1U0JA 5CM9C 1P6UA 1YB1A 2REBA 1B0AA 3RS3A 1YVPA 2Y4NA 4EY3A 3PC4A 2HWXA 3F3MA 1ZM7A 3IQGX 2VAVA 3PKIA 3VSAA 2GTPA 1E0SA 3DPSA 2BF7A 5B1EA 3O82A 4QZVA 2QVCA 5E6UA 4EDHA 3RWMB 4HGYA 3CZ5A 5LB4A 3AZPA 4BEBA 1OXBB 4P5DA 4WXPA 3TLCA 1YZNA 5F12A 3SEAA 4Z9FA 2BFPA 1J1IA 2CJPA 1R0SA 3JSAA 5KTMA 3NHSA 1LEHA 4EARA 1OILA 1X0VA 1M6WA 1GZHB 3WRYC 1R0BA 1DG3A 1EDZA 3PD1A 4NU0A 4R5HA 1JDPA 2CNNA 4NP6A 4UBJA 2NU6A 4IIJA 1C9MA 3HA3A 3B9BA 5HUHA 3AC0A 1PDVA 2HBRA 4RGQA 1V1MB 1BD4A 2AMVA 3VSDA 3EDRA 2FR0A 5A0TA 1J2YA 1N2EA 4ZARA 4PC1A 4ZZ1A 1JLMA 4JAVC 4B5LA 3DM5A 2JFWA 1O3YA 2PKCA 1X86B 2PSSA 3MS4A 4DYHA 2OHJA 2O8FA 2CSXA 1Z7YA 1M0EA 1SHTX 3EC2A 3PGKA 5TARA 3CX3A 2HC9A 3II6X 4P33A 1P5RA 3ROPA 1E2LA 2QNBA 4J7UA 1MR3F 5DI3B 3KQKA 2ALJA 5FBZA 1ZH4A 3KOXA 3OOSA 4IWYA 5ICSA 4RK6A 5GADl 1N2OA 1SVSA 4WL0A 2JDID 4AP9A 1G66A 3SC4A 3UGQA 4KE9A 5LMCA 3D3WA 4D9NA 1GUDA 1PJLA 2PS1A 3OEHD 5EA2A 1SG0A 4PM4A 4E1AA 2IXGA 3W8DA 3THXA 1TA4A 2UAGA 4PLHA 4UTNA 3QVOA 1L9XA 3FPHA 3R5FA 3K20A 2PX0A 5JRZA 4B71A 2R751 1T24A 4LKRA 3N1UA 2M6LA 3A2LA 4DS3A 2FR1A 3GJ5A 5BV1A 2CBGA 3GL9A 4QO8A 5EJ6A 2Q5LA 5JS6A 1J5EB 1ZNZA 3IQXA 4KYVA 1KK1A 1Z5WA 3DAFA 4BPBA 2B69A 4DARA 4U6NA 3R3ZA 3TQOA 2I8AA 3LKBA 1ZL2A 2C7BA 2YV5A 2FDXA 4HZIA 2G36A 4RSMA 1V7CA 3ZX5A 3OCWA 4BQIA 5J1TB 2R0QC 3ICCA 2HD4A 1L3BA 1O03A 2CD7A 3KFXA 3M33A 3WYBA 1ZL0A 4B7AA 1JLLB 3JQ7A 4CKXA 5DLPA 3K0SA 1F0YA 2H52A 3EUFA 3FPSA 4CM4A 3PA8A 2F8TA 3X1WA 2WMNB 2BUBA 3DTNA 1N3IA 3WNCA 3B5IA 1Q57A 1UPFA 3Q3VA 3L0ZA 3W6NA 2ZUVA 3L6EA 1T3GA 4F86A 7REQB 4AZWA 1HZJA 2WSLA 1J22A 1ORRA 1R5JA 2GVNA 2B1JA 3VR1A 1DCFA 1T4DA 4RY0A 1HFWA 2ID4A 3V4PB 3SPXA 2W43A 5LXTB 3KDAA 1E7YA 4PC2A 5F7JA 4X1KA 3GR6A 1GEGA 3UV3A 3CM0A 1GFSA 1TXGA 1OV4A 4XTCS 3FB4A 2FSHA 5GJCA 5AI5A 4W4TA 3IUJA 3ZWBA 2B83A 3LVRE 3UJPA 3VZRA 3CPJB 1TCAA 3ZZ1A 3L8GA 2PR7A 3DEJA 3GMIA 4FFDA 3HU3A 5F2EA 3V6LA 2P91A 2A0UA 4GM4A 5J2UF 1T5DX 3AUYA 1H1LB 3FZNA 2C9MA 3ABQB 3ND7A 4AT1A 3F7MA 3O83A 3ZHVA 1B43A 4GM0A 2ZRFA 2GM9A 1USWA 3IIKA 3PEFA 1MB9A 4MVXA 4P0TA 5C5DA 3NJ4A 1F38A 1U9JA 1ZVQA 4L5YA 3FOZA 2BFEA 1SCBA 2GZAA 3COYA 2NAPA 3NC1C 3OZSA 3PTLA 4DY6A 5DNYB 3PXXA 1QYVA 4FLEA 3L7IA 2D5BA 3CCFA 3O8QA 4QUBA 5DBEX 4ZFNA 1R9NA 4H7KA 1Q7RA 2FA9A 3E22A 3P9XA 1RLIA 2XTMA 2HADA 3AYXB 4JJZA 4X3PA 5EXEA 4TLLB 3CUWA 2BKVA 3UT5A 2PRZA 3BFKA 1T0JB 5CTAA 3CTPA 3FHTA 1D8TA 3HB9A 4ZAFA 3P9YA 4WK0B 4RDIA 4UEKA 5E8JA 2PD4A 2P41A 1MOZA 3A1UA 2AHOA 3MJSA 5EYPB 4ZDKA 3ASUA 1W73A 2FW7A 5CXUA 4L4ZA 4D6YA 4IOMA 2I8LA 2PFSA 2DKFA 2C9ZA 3E3LA 4HDRB 1W0KD 4Y2XA 2XVYA 4UUAA 4WNYA 1UC8A 3B3QA 4LGVA 2ZUWA 1ZZGA 1ZKDA 4G3XA 1LK7A 1UP6A 1K88A 5SYNA 2JFUA 1MIHA 4NFHA 1WSBA 3ILHA 4RVUA 3P27A 2ZTMA 4URHA 1R2QA 1VKOA 4GOKA 4PSVA 1N2BA 1UM9A 4AJ2A 2BE7A 1XZGA 2W98A 3WBKA 4CLOB 5CT6A 1Q0TA 1KK2A 3GN2A 1NKVA 2P0EA 4YJ2B 4DV6B 2MYPA 3F4BA 1Y3HA 5ECDA 4H1HA 3TW8A 4JWTA 2H63A 5IJ0B 1N5OX 3L7KA 4RHXA 1XO1A 4QOEA 4OSOA 5AO9A 3I37X 3M9XA 2VHXA 1X1DA 1IK6A 4HEA6 4LC0A 1GOTA 1GV1A 1WOMA 4ZRMA 3VKFA 3KEQA 3IP1A 4UM7A 3ZQUA 3ZWOA 3P0HA 4AJLA 1MC5A 5I7WA 2IEBA 4XQGA 3ONDA 1H6CA 4C7KA 3NG1A 2ABWA 4R2LA 2R85A 3OCVA 4L50A 3HJHA 3W5VA 2C2HA 1OVGA 1NOJA 4AMVA 1L1QA 2F64A 1AVTA 4HUJA 5C5EA 3K96A 1Z5OA 2DTEA 3ZQJA 1XTRA 3G0HA 2P79A 1Z8FA 3DBHA 1SOUA 2ZJ8A 2QRKA 1AHNA 4B8YA 1TKRA 1P80A 3DLCA 4KX5A 4EHFA 3NHFA 8GPBA 4V0ME 4KTTE 1UOPA 3RVOA 5DOZA 4DAOA 2ZE5A 4EUFA 1ZRHA 4BRSA 4L9WA 2NXCA 1NMYA 3OMWA 4QRDA 5D00A 1E2MA 2NXNA 3ZHCA 5AM3A 2IH5A 1ZD5A 4ZQEA 4P38A 1RI1A 1G5RA 5KB3A 3G7NA 2GD0A 3K9WA 3FKQA 4LDJA 1OFUX 3R9XB 1PFGA 2HLPA 2WT8A 3EQZA 1Z5PA 5HOEA 1D4AA 2IBMA 1JG7A 2FMXA 2RK3A 4N12A 1DEXA 2F62A 1TA0A 3OTQA 3Q72A 4NTZA 3A6JA 2JKZA 4HRXA 2Y3IA 3G13A 2EFCB 2G5GX 4NJMB 4ZU3A 4IZHA 1WMEA 2JFYA 1LX6A 4ZVSA 5K1ZA 4Y1FA 2C78A 1NFQA 2GR9A 4US2R 3GCDA 5B3JA 4GSYA 1BW9A 4JSYA 3D2AA 3HO8A 4TSFD 3TTTA 1HTBA 3ZKAA 3SYLA 1P7WA 2ONYA 3OTOB 4KR9A 4QAJA 3M70A 4L3OA 1KZYC 2EBHX 2FQWA 4KO3S 2WJ4A 3B5JA 3Q40A 3AKZA 4DUGD 2REQA 4IX1A 4WXRA 1H9BA 5IKOA 1K8YB 5ICMA 4WLOA 3DMDA 1LPOA 5DLEA 4MIYA 4H0NA 1FUUA 1ZICA 2XTJA 4ZC8A 4ER6A 3TO5A 2HF9A 5H02A 2ERYA 2R79A 4CGYA 1D2HA 5CFOA 3KAPA 3HL0A 3QKSA 5JXGA 1P18A 4QUKA 4Z0HO 3I5UA 3Q5DA 5CT9A 3RU9A 4DCGA 4DBLE 1HKHA 3KQQA 1CUVA 1NSYA 2WKSA 4U3JB 3E82A 4B3FX 2HUPA 4BQEA 4ARZA 1WU7A 2XA1A 2IFTA 3T7IA 3V80A 1C3EA 1K7EB 5M04A 1TA9A 4IKOA 1DKNA 4N7RA 3QOWA 4QHSA 2XZTA 3HI4A 3OQPA 3K8OE 3TL6A 3WV5A 4XVUA 1LK5A 1RAIA 4R2MA 3BH0A 1ZISA 1NHWA 2WFLB 3QQ5A 4IDBA 4UUBA 2PWAA 2X4GA 1ZGJA 4JB3A 3C87A 3JALB 2QZ9A 2OFPA 2AWOA 4TZTA 3TOZA 3FVRA 3G0DA 3BRCA 4MW9A 4RHCA 5D01A 4WXMA 2GERA 1F3OA 4IR7A 1HTWA 3HKCB 4IDQA 3MJFA 3L7JA 1P5FA 2BVNA 1G2OA 1RM0A 3LXMA 1EGQA 4O2AB 2XCRB 1T1JA 1R4ZA 3STVA 3LPLA 1VHLA 1C2YA 4S35A 3V32A 3WADA 4UE2A 3H5IA 4BFXA 1PNQA 1VPWA 1K7YA 1KA9H 3DHNA 4LYEA 1WS6A 2V98A 4E5SA 5GV8A 4MZDA 4HQKA 2FPLA 4Q9AA 3E9ZA 3V6MA 4TZKA 2BFCB 5EIFA 5KSWB 2H4XA 3C5VA 4NEQA 3PRYA 4GEGA 1HV8A 3O4VA 4M0KA 1R6DA 4DR6B 5BR1A 3DT9A 4B4OA 1M7GA 2IHZA 5FORA 3ZLVA 2ANCA 3FNBA 3K9HA 5GGYA 2EP5A 1D1SA 1EB9A 3X43A 3FHJA 3MWEB 4AAYA 1L7BA 4GKAA 3ZE7A 4CM5A 4UVDA 1YT5A 2Q2WA 3ES9A 4RDHA 3SOZA 2PLRA 3G49A 4CM8B 4OLHA 1Z2DA 1KYQA 3NH9A 3NORA 3L43A 3QE9Y 2RGAA 3EQ2A 1G291 1K5PA 2CXHA 2PPLA 3ZLUA 4CL0A 1WBBA 2BEVA 1FS4A 3GUZA 3JVEA 3NTOA 5KTTA 1I2DA 5CB8A 4D9IA 2I0FA 1ZINA 2I2BA 4FYMA 3TB6A 3JYHA 1IY8A 2FNAA 1UK9A 4NAHA 3ST7A 3ET5A 2K87A 3UK6A 4BMYA 1B8PA 4F6RA 3BE5A 5EUMA 1Z0IA 1LDMA 2BM0A 4ACAA 5B7GA 4OH7A 4ZQBA 1DOZA 5A4KA 2B7LA 2I66A 4XQ9A 2ZCJA 1NR1A 1R00A 3PEYA 4FD3A 2JLZA 5BMVA 4DV5B 4G01B 4HVAA 4QVIA 2K5UA 1XCPA 1IM8A 2CVQA 3UXYA 1MKYA 3H13A 2PBLA 3AM1A 3WKAA 4H1VA 3QFTA 3H4VA 1BE6A 4O4IF 2X1LA 1ZW6A 2QMEA 4M0UA 1UR5A 5FTWA 1A5BB 3CRW1 1VCIA 2E37A 2OCDA 1SBHA 2FWIA 2XDQB 2ZJ1A 3JAWA 3MQ2A 1DI0A 4PQFA 2OBFA 5AKZA 5EZ5A 3VBCA 3WI7A 1PVVA 2OHVA 3U16A 1RC0A 3QBTA 3SG0A 5B4UA 2YN0A 3B1KA 4CMIB 1MH1A 3Q10A 3ETNA 3G2MA 1HE3A 3RM3A 3SCZA 1FNBA 4G25A 4QGSA 5AVQA 1WTCA 1I6KA 2VNIA 3NLLA 1E4EA 2FX2A 2W6CX 4YRRA 4B7ZA 4OP1A 4Q7JB 3AM3A 3DMHA 3ON5A 3QHPA 1TJ4A 3O1JC 4WX2B 3UFBA 4CG3A 3CEAA 5BRAA 1FXWF 4JU9A 4MS4B 2XGMA 2GD6A 4QEDA 1QIEA 1WUJS 4PRKA 3V8VA 1EJ2A 3EEFA 4AQ7A 4N5LA 4B34A 1RP7A 3ZXUB 3E9RA 3WL6A 4G56A 5IBQA 2I99A 1Y4DE 2CHEA 1QGUA 3CPEA 3DE2X 3RQIA 4XIIA 3NR2A 3AI7A 5F23A 3G1UA 4CEIB 4DKJA 3E61A 2HHCA 2WWRA 4LHYA 4R81A 2E7ZA 3RG2A 4ZN6A 5CLFA 3JASB 1HKUA 1OROA 2C4NA 2O48X 2PMBA 2QLNA 2CDBA 4UDXX 4RHYA 2AB0A 1C4KA 3V55A 3SYRA 2VTBB 3R9KA 3PB3A 4IDHA 2VRCD 3H65A 4NOKA 3UC9A 3I53A 3WK7A 1N6PA 5BT9A 2NYRA 3A70A 3WGLA 1I7QB 5F5LA 5ALNA 3R8CA 5BNIA 2HRRA 3BWVA 4LV6A 1TU3A 1P9RA 2QF7A 3UAOA 5J63A 5HUQA 1O95A 5D7BA 4DM7A 1ND6A 3SLGA 4MMXB 4PVCA 1U7HA 2G08A 5F77A 1PP4A 3DKKA 1HMPA 1RYNA 1UJ2A 1UAAA 1XZPA 3I1FA 1WULS 3FLMA 1AXRA 3Q7PA 4V39A 3PTAA 2PU7A 1B0PA 5DM2A 4RXTA 1OVMA 2BWJA 2D1RA 2GF2A 5JJLA 5GZ3A 1OLOA 2GBCA 4NK5A 2O1EA 4H60A 4HUQB 5KYWA 3H75A 5DPMA 1AQJA 4YJ3A 3OQ6A 5CPFA 3AHFA 3F9IA 4N41A 1GD1O 1AJEA 1NAIA 4CCWA 2JFXA 3U31A 6LDHA 3ZNOA 4WLFA 1IZ9A 1DDOA 1DFIA 4LQLA 4ESHA 2VPYA 1T5HX 3D6VA 4I81A 3WZMA 1ODFA 4NZNA 2N3ZA 4YHBA 5BYAA 1XAHA 4MVCA 4OTZA 1F14A 4FM9A 2NT4A 3V7UA 4CDMA 1WCIB 4B0PA 4CLDA 3PGMA 1XV5A 4ML3A 5AK4A 2VKQA 3VVMA 5AW4A 1W6RA 2HTFA 3DG9A 4X00A 4LOIA 1K27A 2XHZA 3KBOA 1H22A 4M89A 4WNIA 5EUCA 2GPNA 2NSJA 4DCJA 3JTMA 3U7GA 1WB9A 4JASB 3E8XA 2GPAA 1M74A 4DJFC 2QTTA 3KUDA 3VO8A 4F12A 1H0KA 1S02A 3EEBA 4AYTA 2IX3A 3OG9A 2N0SA 3PRKE 4GRDA 3QM1A 3ZCXA 1ISSA 1CK4A 4Y2HA 2DLCX 4HQ0A 4QJBA 4HWRA 5ELLA 3A25A 2QPAA 2FWMX 1QV6A 4XGRA 4YLYA 4H15A 5THXA 2DQ4A 1U8EA 4YB8A 2XQVA 3V42A 2HQSA 4KOEC 4EA9A 3U4GA 3TW6A 3D0KA 4HV4A 1PAUA 4EGAA 3A28A 4BMCA 3WGYA 3NXSA 4MVJD 3VPBA 4DDKA 4PCLA 1XDBA 2W4IA 1WA5A 2ISQA 3GUCA 4BZZA 1EK5A 2PT9A 4YA6A 2YVKA 1ZU4A 5FOUA 4JB8A 3KQOA 5LP6B 3UMMA 2BR3A 3NPAA 3QPWA 3AG6A 3TTSA 3W9SA 3WGJA 4OX9Y 2O7VA 1DIRA 4G2NA 1XF9A 2CD9A 3LK7A 2B3TA 2FJ0A 4I4LA 1OX4A 3WP1B 1U3WA 3KPYA 3MILA 1JEYB 2LR0A 1HBJA 2ZFUA 3QUTA 3PL1A 4QFCA 5DLQC 1PKEA 1BSVA 4UHHA 5BWMA 5EE1A 4DR2B 4ER5A 1G21B 4WGFA 2P5UA 5LBIA 2ZSIA 4LE1A 1IXYA 1PYOA 1YCGA 1ECPA 3ENVA 2VXYA 1SB8A 1N9KA 1YA4A 2AUTA 4HADA 3ZIAD 1U5BA 621PA 1KQGA 1V3QE 2JGFA 5C8VA 1FLDA 1O94C 4KR7A 3CLVA 3CNLA 4J2HA 1SVNA 2ARKA 2J4FA 4LNUA 1C1YA 5KMGB 1OWMA 4OM7A 4X63A 3VPAA 1OX5A 1TIKA 5BV7A 1XMSA 2G7MC 5IH7A 1ZWKA 1AUXA 3PDUA 4PPQA 4N5MA 5FUVA 4RJKA 2COKA 2RCYA 4GRIA 4MUBA 3DE0X 4Z2AA 2FK8A 2X58A 2NO9A 3VDXA 5AW8A 3KDSE 4QUHA 1KYIA 1JFRA 4WBNA 1RRPA 4GKBA 3WK9A 3UEOA 2L69A 3V7FA 5A1JA 1Z06A 1UBOS 5BYBA 2IEYA 4O2BB 4MS1B 1ZAKA 1ADBA 2JNWA 1IN8A 5HA5A 5FO0A 1WUHS 3EG9A 1DBWA 2V7EA 3LECA 4MV6A 3LCCA 1SNYA 5FUBA 5LA6B 5WRFA 4G0QA 3A3YA 4YT8A 2NTEA 4YRZA 1JG4A 5JD6A 2HB6A 2IS2A 3PD0A 3JARB 3CS3A 4LF5B 4FWIB 1Z0AA 2DUMA 3PXGA 4PYNA 1FUYB 4WEOA 5AVRA 3IIMA 3W8RA 4D02A 1FCJA 3GG9A 2CF6A 1XZEA 3F73A 1R0YA 4JB2A 1NUAA 1YDMA 4RF4A 1EHIA 1DS6A 3MFQA 1W36C 1U0HC 2XMSA 3OO1A 1PD0A 4J1QA 4LI3X 4KJXA 2X0EA 5AIBA 4TXHA 1SBNE 3OCJA 2ERCA 3QVSA 2JAUA 1OHHD 3A6GA 4CCYB 4B4WA 4J91A 1AKRA 2HWWA 2QMZA 2PJRA 2YRXA 3G9TA 4OMFG 1XRRA 2JIDA 3MTEA 1J07A 4GL2A 3O8LA 4P3NA 3H2HA 3VZBA 3FSRA 1P1FA 3MG9A 4NC9A 1LQTA 1MTOA 1NUSA 1OBFO 2DT5A 3Q7QA 3HJNA 3LSYA 2X9LA 1P1KA 5L53A 3AG5A 1OLSB 3RFTA 4L8LA 2EKPA 4NDAA 3BXEA 4LY3A 3WJ2A 4FVTA 4D3DA 4FDLA 4ILKA 1YZTA 2GFQA 2X9GA 4QQRA 5E9WA 1DG1G 5KU1A 4L8YA 3R4VA 4JQOA 4RMHA 2B4KA 4WK4B 4BMVA 1G2PA 2L17A 3A7DA 2OYCA 2OO3A 1ZESA 1KC1A 2XUKA 2CEAA 3NFRA 4AY4A 1APBA 1C0IA 1U2EA 4RS4A 3DVAA 3IX7A 3S4YA 2YWDA 4NCIA 4NJEA 4TMFA 2JGLA 4TV9B 2V7GA 5KOJA 1NNEA 2X7JA 1OASA 2C2MA 3VNBA 4XYMA 1RQ2A 1K6EA 4BNIA 4YUAA 3EGOA 4D42A 2ZPUA 1N57A 2MTBA 2CCGA 2EGUA 4D46A 1JVNA 4ISBA 4CG2A 1JU3A 4OXNA 3U39A 1K6XA 3HSYA 1TUBB 4WLEA 4HQLA 2DZDA 2ZI6A 3GA7A 4MUXA 1ISHA 1JJIA 1V95A 1ZD9A 2QE7D 3QLTA 3WIOA 1RRMA 3BZUA 2PV0A 1OOEA 1ZGGA 3GHYA 1TJ3A 3LF1A 1VMKA 1CEEA 1XQ6A 1WXWA 1PJCA 5DRTA 4ZGGA 2R1VB 4CR7A 1UBFA 4R5MA 3R6LA 1KDTA 3LBHA 3PGXA 3FN4A 4LJ5A 1UDAA 3GY0A 1Y6FA 1I3CA 1HE8B 2WIAA 5A9SA 5KKNB 5CLLA 4V0MA 4Z2YA 4KUGA 5CW1A 4X60A 3M2TA 2FOIA 4G65A 3DYIA 4RKRA 4D8UA 4DBZA 1NPDA 3MA0A 4ZPXA 1WPRA 4GZ3A 2J5XA 4AXBA 3OZXA 1GA1A 2HQOA 5I9TA 5C7IO 3EF3A 3NKVA 4P58A 4C6TA 3V1TC 2IZ1A 3N3AC 1N0IA 5H3LA 2M98A 5ITVA 1I4DD 5FI0B 3GLFB 1A8QA 4DANA 2O8EA 4M9CA 4UATA 1SWVA 2A30A 3BHNA 3EZLA 4TS4A 3CWZA 5FA6A 3U4AA 4BV8A 3EX7C 3CVWA 1P62B 2BPOA 3LUCA 3LUJA 3UT0A 4HB2A 3VYRB 3WLNA 4CTNA 3BILA 3R7NA 3HBLA 3WL8A 1U0FA 1L4FA 3T7SA 3FLAA 3UG6A 1GP2A 5IS2A 1Z4KA 4HVCA 5BSWA 1J09A 3W2IA 4P6VF 1NW8A 1KQPA 3LFHA 3IIIA 2UYOA 4A6DA 4DLSA 4J9VA 3SJCA 5BOSB 1HK7A 1WCXA 1O57A 4P81A 2QJWA 1QQ6A 2HU7A 5KVQA 3NBQA 3SKXA 5BV2P 1MB0A 3V2HA 4CEHA 5FFMA 3ASYA 5BPHA 5JYDA 2YRFA 5T8KA 3JQ9A 2VTKA 4W5OA 3IR5A 4DLLA 4YJGB 3K1TA 1CUXA 3BDVA 1DWUA 3E4DA 4UEWA 2QUAA 1NXVA 3NTQA 3AU8A 4WVLA 4EO4A 2UV8A 1EFPB 2NTVA 3FPKA 3HBJA 4D5GA 3NVAA 3UG7A 3CLRC 1GPNA 4HJRA 4P7JA 3C85A 1U0BB 4C0JA 4WOPA 3OM9A 1V7ZA 2YV2A 1Y63A 3X3HA 5JC1A 4HF7A 4UVHA 1A9OA 1XP8A 4O4LF 3PT9A 3U7HB 1O9HA 1TQ2A 2W0MA 2X7XA 3HXKA 2Y92A 3MHPA 3LQ4A 4GMHA 3HZRA 4PQEA 5K3SA 3SYNA 4MVJF 5JWRA 4BLVA 3IJRA 5FTNA 2C1XA 2JJ2A 2CJWA 2ONCA 3ORRA 3QUQA 3HTXA 2C61A 2ZIZA 3OZCA 4J0QA 4FFBA 1QO0A 4AQDA 4F3NA 4MRMA 1BHQ1 3ROKA 4IO1A 2QW8A 3RK4A 5JSYA 2R7MA 3RS0A 4G0UA 1ZGZA 3GB9A 1L7XA 3CG4A 2Q21A 3BREA 1IEWA 3CRVA 4KYIB 4E08A 3WLAA 4CCAA 2O50A 1Y42X 1ZNWA 2V6BA 3VYVA 1Z63A 2QTHA 5BVHA 4DQDA 1JZTA 1F9AA 3R3SA 2IEAA 3D3NA 3DBIA 2FEWB 3D4LA 3Q5GA 4LZOA 5F5NA 3KOZA 2X0IA 3H1EA 2HDNB 4UM5A 5FWXB 1AA6A 2EW1A 1HEIA 1XTSA 1W4RA 3WGVA 2K2QB 4EVSA 2ZYHA 3SX4A 4W8OA 2CFTA 3TINA 2IP1A 5BQOA 3ZLBA 4DRYA 1G20B 1WP9A 1NBWB 2B4QA 3FH0A 3RHZA 2WVHA 2H08A 4UBKA 1S4MA 2A4KA 4U4AA 1ONOA 1LKZA 1BU8A 2QHXA 1SUIA 4KQHA 4BP8A 2F3TA 4DG8A 1GZ4A 2OORA 1TGVA 3DLPX 3CRZA 3EZXA 3LKVA 2QAJA 2YDYA 4JSRA 5KWJA 3DKIA 1C29B 2I6SA 1E2GA 1KYZA 3V8PA 4H4DA 5CDHA 3DOEA 3BH6A 2PUCA 1T8WA 1SKAA 2IOFK 2PS9A 1E7QA 5DNVA 3RUIA 1Z8DA 3WYCA 2RGEA 2D7DA 3C6BA 2ZI3A 3DBRA 3PDCA 1GCAA 4G9EA 4JGGA 1N0WA 4TN1A 3WKCA 3IDSA 3K0FA 3WDLA 5IAOA 3KYCA 3FWHA 1RJGA 4URZR 4NAVA 4OPMA 5NLLA 2HDHA 1QH0A 2CNWA 3IYLW 1ZD4A 2WJPA 2ZQZA 5CNMA 1KERA 2WHYA 5JHGB 3PX3A 1PWYE 4JYMA 4AKEA 2J3EA 2VF5X 4PQYA 3IUBA 3CNHA 4GGPA 2C4UA 1OXVA 2FR8A 3NHBA 4KHZA 1UBTS 2EZUA 1XTKA 5E6UB 2XOKD 1PR2A 3BULA 1CSEE 1UDXA 3A1SA 2JVKA 3U1VA 5K8TA 1ODSA 3NBAA 4HZGA 5B64A 2VJBA 4I6GA 4R7TA 4EY5A 3T1QA 5JEEA 1WR8A 2VKTA 4YT2A 4C1BA 1JS1X 4IHAA 5K5EA 4ENVA 1N6LA 1R6TA 3WRXA 2GZ2A 2ZRHA 2D2XA 4H4CA 1TMYA 2I80A 1MAUA 4F4CA 4OHWA 2NU6B 3AY0A 4IIJB 3H1TA 3X1MA 4D8XA 4BAUA 1SM4A 3WLFA 3ADCA 2WKWA 1HLFA 4LUCA 1PV1A 4EZIA 3EGEA 3N0XA 4NR0A 3W5UA 4IIEA 5T4EA 4A91A 3VNQA 2Z2ZA 2QAIA 3CLSD 4MPPA 1G59A 4WA7A 1E3TA 3TCXB 3LX5A 1DXYA 1YH3A 1Y80A 2AX3A 3AR7A 1YIAA 2VPTA 3CZPA 2C1EA 3I01A 3HMQA 4GUDA 4TLAA 5FRDA 2NG1A 3RR2A 5EC8A 4QE3A 4K9LA 2ZRJA 3AEUA 4O59O 2AW3A 5EZQA 3SR0A 4M0FA 3D8SA 3TI7A 4JT8A 4LGYA 1YVRA 4R84A 5FNVA 2NZXA 1XJ5A 1QHHA 2PKXA 3TWOA 1IB6A 4TWZA 3D3WB 2ZAOA 1IIBA 2TSYB 3C8HA 3EZ6A 3INRA 3EGWA 4BAZA 4M8LA 2VRNA 4TPKA 1RWXA 3RUCA 2DH6A 4Z3KA 1JHXA 2LP4Y 3R0VA 3GPCA 1BOFA 1BGWA 3PQ6A 4MYCA 1AS3A 3BORA 4PZZA 4Q24A 1G98A 4YMWA 3ROQA 2I4LA 1FTNA 2OESA 4EJ6A 3VR5A 2VHVA 5H80A 2PYIA 3WK6A 3THXB 1KYWA 3UWMA 2QLLA 1RYHA 3ACCA 3FKJA 1S5PA 4FDUA 4JR0A 2A9FA 3RTGA 4P32A 1XN4A 4X95A 3LJKA 1XR3A 3ENQA 3QY0A 2GHQA 4I4NA 1QYDA 1QAOA 5ALMA 1U3DA 3IB6A 3HVRA 1LI7A 2A57A 5CDTA 5EMNA 3TRJA 4XZ3A 3VU9A 1JQKA 4MLCA 2P90A 2HA6A 4R54A 3B8EA 3KJQA 5KX5B 3K4PA 1YZLA 4LXXA 3W6UA 2PSFA 1SHZA 4ZO9A 1KF0A 3ULKA 2QX6A 3DT8A 4CM4B 2C7PA 2IPLA 1FVFA 1X87A 3H1PA 4FR5A 4TS9A 5GIOE 5JBIA 1YVEI 3E23A 4XIYA 4IQ8A 2OZLA 4Q0MA 5JO0A 1KTVA 4GDFA 3H7AA 1TYDE 3DP9A 1AT1A 1CCWA 3ESDA 4KQ1A 5FPSA 1N5KA 1NW6A 2JCSA 2WNIA 1B2LA 5DASA 5AVJA 3ZHTA 3KKZA 1FYXA 3QFRA 1YRWA 3LVQE 1G8FA 3E7DA 4JC4A 4DSUA 1AMUA 3BS4A 1ZJZA 1JH8A 2ASVA 4X1KB 3N3BC 5SICE 3HDGA 6CHYA 3VAAA 3GJXC 3OZBA 3PE4A 2MSEB 4EG5A 4FLMA 4YO8A 1IJBA 3AEKA 2Y76A 3GEGA 2P0AA 3K0CA 4PFSA 4W9NA 1CY8A 2JGJA 3OKCA 1QO7A 1E0AA 1G6HA 2X4IA 2IIVA 3NGMA 1KKUA 1XD9A 2HXGA 4G8DA 4GXTA 4BGVA 1GTSA 3ADOA 3PSAA 2DCMA 5C7YA 5M5BA 1CUGA 1VXRA 1A3CA 1X7DA 5DHFA 4ZQIA 4PLVA 2R62A 4ZC1A 3RFXA 7MHTA 5FAXA 1I7PA 1R0XA 2BFEB 2QZSA 4RIGA 4MRSA 3CWQA 3HJTA 4RFLA 4E1BA 1M67A 4WCVA 1TMOA 1P2DA 1YZUA 2NZYA 2PTGA 3ZYZA 3HZOA 4LBVA 3O8QB 1WXGA 1SC9A 3BTVA 1NTRA 4ZQFA 1DKOA 4A23A 3E22B 3AERB 3DWFA 2ZCVA 1XRJA 4C07A 3AY6A 2H0RA 5FHRA 1M7BA 5KNDH 1RI2A 2CYAA 5ALTA 4EELA 1KNQA 4OBEA 1PZMA 1YZ3A 4FINA 4URXR 2GAIA 3FY4A 3Q3JB 4RTQA 4RJIA 2G1PA 4X92A 3EZ2A 1DBIA 3JRXA 3LLUA 4K2HA 2IYLD 3A27A 3KWFA 1NV9A 3NONA 1TYBE 4EZEA 3CKYA 2GCNA 2PZAA 4UUPA 4ZMSA 1C4XA 2F55A 2FJUA 2Z4TA 4KJZA 3RBZA 2IA5A 3BRWD 3ENNA 4FGKA 3VZCA 5JROA 4ZRDA 4AJKA 1PLJA 4BGEA 1FYVA 1MF7A 1ZG3A 3A4LA 1R0KA 1YSCA 4NZYA 5AMXA 4C5AA 4ZCTA 2MINA 4ESOA 4IJ6A 1DL5A 3N86A 1UM9B 2YJ3A 2ZETA 1N75A 4KI7A 3V2IA 4BS9A 3HR7A 1XE3A 1BE0A 1Z2NX 2CHFA 5T64A 3HJBA 4DT1A 3PDIA 4ZU1X 1L5KA 3IPCA 4D9EA 1X77A 2C4KA 5GGXA 3ZR4B 1XLVA 1PR3A 1YDGA 2FEOA 2V74B 3A9UA 1DQZA 3PP8A 3W3AA 4TGLA 2EKQA 1V11A 5IFKA 1PG2A 1G8KA 1Z5NA 1Y5MA 2AN4A 4K40A 2IUTA 1DLIA 1X1QA 2WM9B 3DKPA 2EW2A 2QM7A 3MWFA 5D5PA 5IM4A 4N5HX 4OXQA 2Q1WA 1JSXA 3IURA 1RS0A 4IS3A 2Q3LA 4R9UC 1RZRA 1ZH8A 4IIYA 2BM9A 3I5XA 1W48A 4AJEA 4YHHB 1DV1A 2QMYA 4JJ8A 4L7VA 1L4BA 3EEYA 1I2CA 3TL2A 2FFRA 2R1ZA 3V8NA 3O0DA 2CVZA 2P8JA 1IJKA 4MQFB 2MIIA 2RDMA 2FQQA 1CF4A 3KZ1E 1LJ8A 1LSOA 1OBVA 4BMOB 3DBHB 2PQ2A 5IKEA 1SEVA 1MG5A 2PA0A 4Y0NA 3PJRA 3Q2KA 1ULUA 3FZQA 1I7LA 3N7UA 1GQYA 4FYIA 1FU7A 3STYA 2CNBA 3DO6A 2J6IA 4P3XA 2B1QA 3F5DA 2V7WA 2CMHA 3MWDA 5AJYA 3EPKA 2I2CA 1ONNA 3LHKA 2RGYA 2P69A 3ZY3A 3DEKA 4CR8A 4R69A 3AUXA 4FMCB 3NHWA 3FGOA 4MVJP 4OBWA 5ALPA 5G02A 4KXUA 1SULA 3GCWA 5LU8A 5I5EA 4ZAVA 2FMTA 2OV2A 3TM4A 2HWUA 1QRSA 2Q99A 3ANMA 1OFUA 3OPXA 4HYEA 3RYHB 4M6WB 4JH0A 4NE2A 4M1ZA 4RBNA 3TJRA 5L6MB 4I1PA 4KMSA 2WTXA 3R3YA 1UXKA 5EKXA 3QU5A 2DSTA 3V8BA 2BCGY 4MW6A 3DA8A 1QH1A 2P5TB 3R2JA 5IDVA 3MCVA 5DGDA 2VJKA 1ARZA 1JJVA 2I9PA 4FCWA 2ZLBA 3VU1A 2NQTA 1QYIA 5KWSA 2BFWA 1UZMA 1NTOA 2QZ4A 4KAAA 1ZC3A 2H29A 4D3YA 1I14A 3K8YA 1JSCA 4ARVA 2G25A 1WM1A 4RJLA 3F7TA 1BW9B 5A9RA 2HHJA 2NUAA 3WQBA 2RJ3A 3U5ZB 1T8PA 5AESA 2YWEA 2FVXA 3R24A 4PX9A 1KDZA 1GG8A 1WDKA 2P9JA 3KOWA 2E4ZA 3LCJA 4GVXA 4MYTA 4EWLA 3EPLA 1NOKA 4I1YA 1OH7A 1IEXA 3ESBA 3HB1A 2REQB 3QVXA 3L7CA 4CM3A 5LMUB 2BMJA 1KMIY 3IKLA 2YY6A 4DEVA 1J2TA 4EYGA 4B73A 1H94A 4UM9D 9ABPA 3RSHA 2FZ5A 3I2FA 1QGDA 1IOLA 2A5GA 3QKSB 2GK7A 3N8NA 1IMOA 4BEJA 2V6MA 1IQPA 1CR2A 4L57A 4DLPA 1UXIA 3GLTA 4PIMA 3C4JA 2IQ5A 4LZAA 1FMCA 1RQRA 3LHSA 2B98A 1PS0A 2ZJBA 5HX7A 2ZB8A 1N2GA 4X24A 2D0OB 1KMHB 1T4GA 1CDEA 1QFYA 1LPNA 2H4FA 1AB6A 1QHEA 2IHJA 4PGGA 3OIUA 1NA5A 4MA4A 3A6LA 4N3AA 2LZ0A 4YDSA 4YUXA 4LDRA 2MMCA 2WSBA 1ZVMA 2F8MA 3QIVA 3DC7A 2WSSD 1BDHA 2FEKA 3DNFA 5DDIP 3R6GA 5DM0A 5A4DA 2JBAA 4EW6A 3EA5A 3IEKA 5AHRA 4RY8A 1XROA 2FFJA 3IAUA 1QVZA 2HRDA 1Y4SA 3E03A 2Q5OA 3ESYA 3ZWDA 3RIMA 1RRGA 1OKKD 2EV9A 1W2GA 1ZK1A 2XPCA 1GQQA 2GOYA 3D4NA 3PG5A 4OHCA 4DILA 4EPXA 4GR4A 3H5AA 5TF0A 1Q1QA 2Z2YA 1KZGB 4OAOA 2XIQA 4AY3A 4G86A 3TLZA 1QH9A 2PH3A 5C8XA 4S2EA 3NV7A 1E3EA 1DTWB 1NXWA 3NOXA 2D1SA 4QGBA 3QPBA 4WY8A 5BMOA 3HY6A 2V65A 2GSDA 3OKFA 4DM4A 3I0NA 1DIOB 4EKDA 1QCCA 2PGAA 4BO6A 4JLVA 1C9KA 3S99A 2X9QA 4M76B 4NCNA 2HJSA 2QZPA 1BEZA 2VDLB 1UINA 3B9PA 1PJAA 2O3JA 4GPIB 1P73A 4LZNA 1PYDA 3C97A 1Q44A 3EQ7A 3PGVA 4WXEA 5DCWA 1WUKS 2EJBA 5EE9A 721PA 1E3WA 1W4AA 1XZDA 3K0EA 4MUFA 1E59A 4DB2A 5F51A 4MARA 2HPHA 4Y1RA 1W87A 2UVDA 3CZCA 2F4VB 1W5SA 4P3KA 1F51E 2QR5A 2QXYA 3DMTA 4UNPA 3SHFA 3B3JA 1NN3A 2O2SA 3GFRA 1NNSA 2I5PO 4PZ0A 1ZMRA 3KXDA 3MN1A 1CQWA 4NG4A 4F6RB 1GKLA 1YASA 1YR6A 2PRYA 1KI6A 3QKWA 5BWLA 1LTQA 1HFEL 4RWZA 3IPAA 4G4GA 4EA8A 1JXQA 2V5VA 4PG5A 4EG4A 2CCJA 3WOHA 1D07A 4LOLA 2QSUA 1SG6A 1JHZA 3IHWA 4HEJA 5BMVB 4AULA 3QVTA 3D1VA 2BHNA 2DPLA 4J0KA 1G4UR 2H54A 4AZTA 4JCCA 1ADFA 4GDMA 4DN6A 1JP7A 4MQ5A 4Z4QA 4URFA 4M1TA 3RVMA 1IWOA 1T2CA 1YJ8A 1EK2A 2FN7A 2QRVA 3D6HA 3NHUA 4KAXA 4UCXA 4CV1A 4DIMA 3A36A 2OQRA 5EESA 3DNPA 2P6RA 2ZULA 4PSUA 5C53B 1BEEA 1KARA 2YASA 2I87A 1FFDA 2FGJA 1XCJA 2WAXA 3MF4A 4HN2A 4MK4A 4MW7A 3WWPA 4DIBA 3SHWA 4RVGA 4BLSA 4L8WB 2A1TS 1J2RA 1UMDA 5MFPA 1L7NA 1CS4C 2Q5EA 5FUXA 3WG9A 3B9QA 5H7XA 1B8OA 5B30A 3Q8LA 3VDMA 2LD4A 1M72A 3E3MA 3N75A 5ALYA 4BX8A 3WDSA 4K6OA 4REOA 5C8ZA 5KNBD 2IJGX 4F8YA 1M0WA 1SUWA 1E4EB 2WHPA 2H7YA 4RETA 2JLSA 4OKNA 4RJJA 4Z86A 5H3HA 1HSZA 2NQ2C 4LK2A 1Y8CA 3S27A 5HGXA 3KRTA 5KSYA 2AUNA 5AJTA 5CD1A 4UXIA 5ENZA 2C3YA 3VR2D 1FUIA 3WR5A 2ZQ5A 4YO7A 3WYEA 4Q3OA 4HDMB 4TLCA 1SIOA 4OI2A 4B6QA 2EW8A 3HO1A 3JQFC 1MVLA 1KOJA 5AVTA 3I9LA 3W2EA 1OIVA 3DLIA 4GP9A 5H3CA 2P3SA 4H6XA 2VA9A 4GS5A 4NENA 4TTPA 5IJ9B 4FBMA 1VE6A 2QG9A 3BHJA 4Z99A 4ETMA 1MD9A 2H92A 3QVJA 5K8JB 2P9BA 2NNWB 3T1OA 1CERA 3NIGB 4ALIA 1DAEA 5IH3A 4ESVA 1TIBA 1XAJA 2PUGA 1EDBA 1X14A 2C0QA 3LIPA 4ZEWA 3VX4A 3O31A 5FXMA 2OZEA 1Y3CE 4IKEA 4W5TA 3K1AA 3RLFA 1IHPA 3CNNA 1V6SA 4IDAA 4DV2B 1N7JA 1QX4A 3KKOA 4Q3BA 3BMCB 3NHAA 3SX2A 2EARA 2JL1A 3W5BA 4MAMA 2AA3A 3WQHA 4NPAA 3EE6A 4P3YA 3SIXA 2WG0A 4F4HA 2I3BA 1FC0A 3DBOB 4P5PA 4F6LA 4HGPA 4MXDA 5EOVA 2OQ2A 5DHSA 2DGDA 3CEHA 5EZYF 1AGNA 2GO7A 2PFGA 3DWGA 4P7BA 3TLAA 2PMCA 4QBKA 3FUVA 1Q7CA 3I8SA 3RV4A 5FTMA 4PBTA 2RK6A 2ST1A 2ZYVX 1LSUA 5CP8A 1PDWA 5CNJA 4RPLA 3DCJA 3QVGA 1RKXA 5TSDA 1Z4MA 3WQRA 2VG8A 4M1EA 4XB1A 3ND8A 3O73A 1RAEA 3FMFA 4O29A 2NPOA 2HNAA 2QG6A 5AKLA 4DC9A 5KYWB 2HCBA 2J3QA 3GJSA 4H17A 4YJ3B 4ALMA 2H1HA 1QHNA 4KVGA 1INLA 2BHSA 2NTYC 2V7VA 2Q4DA 5HQJA 4F5YA 1C14A 3B38A 3RSFA 4KQXA 4YY3B 4JELA 1GL7A 4QRHA 4GXNA 4W63A 5ENVA 3PQ8A 5JMPA 4EF4A 2IZ0A 1K3FA 3E9EA 4RH0A 2ZAIA 1LNQA 3MOGA 3QI7A 1E3LA 2ZYWX 4X20A 5ALJA 3R7BA 3SIWA 4IIUA 2HZ7A 5FPPA 3U3KA 2FPIA 2CMDA 4ZALA 1R0LA 3K3PA 2O8DA 4DLAA 1D9XA 1WZEA 2QVBA 3KG2A 1H6BA 4ZKDA 4DJTA 3ORSA 3QNMA 4B48A 3GUYA 4WWHA 2PZGA 3K92A 1T1EA 1ULZA 4DIOA 4LDNA 1KDVA 2OUKA 1L4UA 3M1IA 3N2LA 4N7BA 3JQGB 1GCIA 1JBQA 3D8TA 3KXIA 5CYFA 3THRA 2OBYA 4JIGA 2LCIA 5TGTA 3ELWA 4RTKA 2WIDA 4RY9A 1GQRA 4C4ZA 1YI1A 3GEHA 1R74A 3QMPA 1ETUA 1Y6RA 1EJ0A 2V7BA 1SCKA 2Y0CA 1BX3A 3W05A 2H5LA 3IQIX 3WGGA 5A6SA 4WI1A 3X1DA 2BFMA 3M4NA 1MHTA 1EFCA 1E6UA 4QO7A 3V1MA 3V9PA 4EI9A 1DUSA 1LSJA 2CFSA 3OZ7A 1Z2EA 2C8KA 3MGAA 4E3WA 5LD2C 1KJWA 4IH4A 2J9FA 4LRSB 3IUSA 4CNQA 2OEPA 3QU9A 4BB6A 1QTIA 1PUJA 2GFIA 2OK8A 3GFOA 4G4SP 2VEOA 4NBNA 4RK0A 3NUQA 4URWR 2I6FA 4FZVA 5EJ7A 1SUPA 2W4MA 2YDXA 5IAEA 3X2SA 5KKCA 3AONB 1OX4B 2Q4TA 3O94A 4JJKA 4NK4A 3NOOA 4CXMA 3PDWA 5FADA 3LPCA 3K53A 2X6RA 3O8OA 3BMOA 4IQFA 4NBKA 3NWOA 1SGWA 1YJ5A 2J8ZA 3E2PA 3ELUA 2V8OA 5DEOA 4CBVA 1DRJA 2Q1TA 2I6UA 1WUYA 4QDXA 4B45A 1JILA 4YRIA 1VIAA 1L6IA 1WUIS 2ZBQA 4YCDA 2J6CA 1U5BB 4N18A 4EJSA 5CVTA 3BL8A 1U65A 4PO8A 2VCYA 3H9QA 3IT2A 4JI0B 4LNUB 5DCLA 2IYYA 4H3HB 4BKRA 4DVJA 5JD3A 1Z75A 2BDTA 1UDBA 5EP3A 1YRYE 3A1WA 2WDZA 4QGHA 3DQPA 4RADA 2QR3A 3T52A 3UAXA 1CULC 2G9UA 1EP3B 1VE1A 1J8MF 2O7NA 1THTA 2Z56A 4YGXB 3RI3A 1GG9A 9MHTA 5KHLB 3ABZA 1YCDA 3FDZA 2R6ZA 4WBNB 4IVQA 5KDLA 4C01A 4DA6A 1YV9A 3BWXA 4IOJA 4YT4A 1E6LA 4HNVA 1ISRA 1NATA 1VG1A 2FUCA 1TKAA 5KI6A 2LIVA 2SBTA 1OAKA 1Z08A 2V6IA 3L7NA 1KKLA 3EG9B 3TSWA 2J3HA 4YRQA 3KT0A 1GA4A 4OBXA 4C05A 3AVWA 3P7MA 2BKUA 4R8MA 3D1JA 4HL6A 4TL7A 3BT7A 1Z37A 3GUHA 3JRNA 4GR9A 4FOOA 1K6JA 4UOEA 4XFJA 1EG2A 1PRYA 1RBZA 3UM9A 1HWYA 3OIDA 2A5JA 5TB5A 3SC6A 5C4MA 3INNA 2JI8A 4CRWB 4CV0A 1DBQA 4EYQA 4TWIA 4UUOA 1NVEA 3TGWA 1C7JA 1DHTA 3OC6A 4KFUA 4EH1A 1UOQA 3AEXA 2VP0A 1MEOA 1WZCA 2XDYA 3C1AA 4C88A 4PG8A 4X1YA 1Y6GA 1GUYA 4FGZA 2P4UA 1XZNA 1M6NA 1XTVA 4RH1A 3OJCA 1JPUA 4GFDA 1AKMA 3PHIA 3B1XA 1K7XB 3UJ9A 4AW9A 1RQ7A 3AJDA 2Z8YM 3DL0A 3GJRA 4HDOB 1KU6A 6Q21A 1FBTA 4DLUA 3CPHA 5HZMA 4FOLA 4A6PA 3MCZA 3ZVLA 4DW8A 1THGA 2O54A 3H5LA 2FUNB 3MPOA 1YE5A 1V2GA 1R27A 1OIXA 2YOFA 3COVA 3R0IA 1KFEB 4I5IA 4Q48A 3AKCA 1PO7A 5FD8A 3CUUA 4JQSA 3SC3A 3DEZA 4L0DA 4OXRA 3NMUF 3WO1A 3P19A 1U31A 2XRMA 4FJ1A 3QUSA 3GN1A 2QQGA 4HYQA 4QNNA 3L0OA 5IC5A 4HDAA 4URVR 3WAJA 1UJMA 1HF3A 1DOHA 5CFQA 1QQAA 1U1CA 3G2KA 4PYQA 4BEWA 5JAOA 4L6IA 3IPXA 5IKPA 1U5CA 2Q6TA 1GPH1 1VE9A 3U7QA 2RFLA 3UJ3X 4DHWA 4PC7A 3DVAB 1P0QA 2HJ9A 4BN4A 4NJEB 1A04A 2LNDA 4MAAA 4KDFA 4OD0A 3VSBA 1ONBA 4MRAA 3G2LA 1QE3A 4C5BA 2W11A 5ELMA 1D7AA 1BFUA 3W2HA 5GM1A 1GL9B 2C2WA 2PLAA 4QL3A 3T3PB 1P61B 4QVKA 4R83A 3UJ6A 4DEYA 4YDRA 5LWQA 5C35A 5DMXA 1KY3A 1PWHA 2UYGA 4NCHA 4PR3A 2ZJZA 2QTLA 5CR9A 1UBSB 2HRCA 1JHMA 3BQ9A 4Z9BA 5I8ZA 3IOCA 1XAGA 1MIOA 1HYHA 2ZIVB 3UK7A 4BKUA 3FCEA 1W9MA 3F97A 3IODA 2V59A 5A7FA 4LZZA 4PF1A 2EBUA 4RTLA 3QYJA 3M6AA 3ABOB 4I4CA 3T3OA 3CVOA 1P9OA 1JR4A 3OT5A 3BTOA 3D7KA 1HT0A 5EIWA 3JQAD 3RVDA 5B7NA 5KVVA 4UU1A 4TYWA 3L5OA 3ISJA 1HT3A 4LJSA 1SA0A 2LW7A 4CF5A 3C6MA 4GX0A 1GSHA 5A9SB 4GLBA 1I3OA 1BMDA 3H9CA 5PNTA 3TFOA 4M1SA 5GVSA 2AMYA 1QP0A 1VKNA 4CJXA 3C7DB 2WIKA 3D8HA 1Q22A 1U90A 1KMQA 1X1AA 3AQ4A 4L8VA 3ZY2A 2EP8A 1VJRA 1M1NA 4CKWB 3ZCPA 4EY6A 2RKWA 3HVJA 1SXIA 1D8AA 3I0ZA 1TLTA 3OHPA 4J75A 4C6TB 1Y0BA 4F7DA 1RJ9A 4IWNA 4AIIA 1J9ZA 2VRBA 5IW8A 1RJFA 3MCAA 4LXQA 3C5HA 3KL4A 4R41A 4XGQA 5HR5A 4HDQB 1P9LA 2O8EB 2Q0XA 4ZXPA 2WEKA 4P4NA 1ZJ4A 1N77A 1ISPA 1E3QA 3P9SA 2PKEA 4RLFA 4ERXA 4NQZA 5TT0A 5ECWA 2Z5FA 3BA6A 4GOLD 3ZGXA 4E15A 4XLZA 1DJNA 2C2BA 2XVXA 3DTYA 3L7AA 1NFRA 1BHJA 5FUYA 3TR6A 4DJJA 2M1XA 4V0OA 5BV0A 5IT9A 4KGDA 5CGQB 3PQ4A 2X5JO 3UCEA 4R0MA 2HMVA 4ZJUA 3A6DA 3EUAA 4BLTA 3LWZA 1CE8A 4I36A 4PVDA 1DCKA 4HFRA 3L7YA 3H1AA 4HDKA 1WDMA 3LWBA 2FKNA 5LCXA 4ZJZA 1JPVA 2X0NA 1WHSB 1XTBA 5BQ3A 4ZYYA 3OAAA 1OFVA 2WHXA 4LJ6A 4CEHB 3QUBA 1O95D 4NICA 5FBWB 1EPUA 1FSSA 1US8A 5U4QA 4BFTA 4XJXA 3KVOA 2WAMA 4U2CA 3ZV3A 5FWYA 2OC9A 4LYHA 5DN6A 3UHJA 4OF4A 3DT6A 4NU6A 3GJTA 3MUFA 4EKIA 2BY4A 4O3FA 3L7DA 3KHTA 1Y34E 5H5JA 4FHFA 2WVGA 4OUDB 1SQ6A 4PZLA 4DIEA 4TWRA 2E89A 3H99A 5JXIA 1P9NA 4MVJH 2ZDQA 4GZLA 4Y6GB 2AZXA 3NDJA 4BMZA 3PQCA 1FEZA 3JWHA 1SHJA 2ZUCA 5E1BA 2O8CA 2FY8A 1N5IA 2J33A 2W2XA 3OUTA 2INGX 2NZUG 2OBBA 3QWFA 1SKUA 4LVUA 5DP1A 1QCYA 1CZKA 4W1SA 3VHRA 2PUWA 2VDKB 2Q3CA 5K0TA 3UXMA 3PT5A 3S7TA 2J9ZB 2CJWB 5GJWC 3R7WA 3SJBA 5KNCA 4QJIA 5LDDC 1T15A 3ODPA 4Q4JA 2IU3A 1PT7A 1AKTA 3GLIE 4X8OA 2RE8A 1RXYA 4NESA 4B7CA 4RTOA 1HE1C 1VI5A 3PC3A 1KKMA 3LBFA 4NARA 4RU1A 3NEYA 4I2NA 4RPHA 1RHQA 5BVHB 1P4GA 1P81A 1XZMA 2J4DA 2YX1A 4YP6A 5HE8A 4QJ4A 1QIKA 4FEYA 1SCAA 2GM5A 5SZJA 3S1SA 4C0KA 4HWKA 5FBRB 3WGKA 2C5LA 2X13A 3I72A 4QPPA 5I3CA 1IRXA 2G06A 4Z51A 2JB9A 5DLYA 4LRQA 4QWWA 2JJ1A 4RC9A 4KO2S 3NO4A 2W6QA 3H0CA 1TJNA 10MHA 3H2BA 2Z2KA 4UHFA 4WH0A 1NMXA 1VRVA 3D7RA 6NULA 2DEUA 2FWBA 5C1PA 1FVXA 1P2VA 2QRPA 2R7LA 4OFXA 3PFNA 1FK8A 5TS2A 1GSAA 4Q00A 3HU5A 2PKYX 4AJHA 2FAXA 2G9RA 1J39A 3HDHA 2ACWA 3KLPX 3R0JA 4OFWA 3WP0A 3R7AA 5FOVA 5JNSA 1NWHA 1A2BA 2GJ9A 3K0FB 1X19A 3KYCB 3UB2A 3JYLA 4BP3A 1KOGA 1DXQA 4DXAA 4J16C 1QIMA 1E1YA 4TTQA 3RK0A 1TVKA 3DDCA 3MGCA 3CZ4A 3LXRA 4JJ7A 3MTQA 4CCSA 4XDHA 4CI0B 1QF9A 3OQJA 3W5HA 4HMQA 4PAWA 2CJFA 3QVUA 2QSZA 4J0HA 1A4RA 1TRHA 1GPLA 1UXGA 1YIOA 2CVPA 2IYTA 3NAZA 2AFRA 1COZA 4IFBA 5K8LA 5B3KA 1Y4ZA 3UV6A 5K05A 4A5SA 5BQ5A 3L4EA 1FRVA 1Z33A 3GRCA 4E2WA 4BV2A 3MCTA 4R01A 4PLWA 3T3EA 4C76A 1F8YA 4H2DA 5JJ5A 2FEPA 4HDNA 2GCGA 2D00A 1J23A 4YMIA 3O1LA 4C7OA 1NXXA 5LB2A 3WBJA 4CF4A 1ZIPA 3UGKA 2QXTA 3QX7A 4UC0A 1WXIA 1FP4A 4LY6A 1DHRA 3BJIC 5D84A 1OYVA 2L18A 4DDHA 4CLHA 5CTJA 1SBIA 1TU0A 4FXOA 4HQNA 1GYPA 3LLSA 3UAZA 4TQGA 1KGDA 5MFZA 4E5MA 3HUFA 3GFTA 5HQTA 2YIVX 4XX0A 1SUCA 3JPWA 1USUA 4JQCA 4MWZA 2JA2A 4POAA 2O3QA 3DZDA 3NATA 3ZG6A 1RXWA 4NE7A 5FOXA 3HABA 2A35A 4YXWA 4AU1A 2GJKA 3H83A 5B53A 5LQSA 1ECJA 4IILA 3EFOA 2QMUA 3IQHX 4YV1A 4RZ2A 1QRUA 4KQJA 2NV2B 5IAAA 1H05A 3BZWA 2QN2A 3TTUA 3PPXA 5BOVA 3IXMA 1ZPDA 1JTVA 5LLDA 3QTTA 4DUYB 4D8TA 2POQX 1MABA 1I6WA 2PUJA 3H6HA 1EE1A 2UZ4A 2DECA 1NVKA 1PX2A 4HNAA 3LZ6A 1NBME 4LGCA 4POOA 4AKIA 3H6KA 5LC1A 7GPBA 2WHRA 3DMYA 3F1KA 1NVXQ 1MW9X 3L79A 3ONFA 4HPWA 1BXKA 4P83A 2JIRA 3AHIA 3IVRA 1BAPA 3C45A 1UM8A 3AFGA 1QC5A 3PICA 1EDDA 4HGRA 4KV7A 4Y2YA 5EGSA 2Z30A 3E5HA 4DPKA 1S2GA 5AW0A 3KLBA 3VU9B 2DE0X 3ZDXB 3JYPA 3DLTA 4ZREA 1S01A 1KWKA 4GUAA 3FPCA 5AK6A 3WWYA 3ZDYB 4B43A 4AZVA 3CGWA 1W75A 3F90A 5JEDA 5FV7A 1N7HA 1GGNA 1ZMXA 4IUCS 3GU3A 3NVDA 2XT6A 3CZAA 1JKJA 4H0FA 4BHTA 1MZPA 3EXHA 3ADKA 4D4KA 1MAVA 3H9UA 1SOMA 2OZLB 3NHPA 1P7CA 4O4JA 5KEIA 3NCTA 5DWVA 1ESMA 5ILOA 1MORA 3RNOA 1BMTA 3B1YA 1TJ5A 3F2VA 3LUFA 5DV9A 1ZJ5A 2E4AA 2P3QA 3MWKA 3QF4A 4YAWA 2EQAA 1FTSA 5J1SB 2FN3A 1U8XX 3RC9A 1YQXA 1QV9A 1VGQA 2BEWA 2FSVA 3O8NA 4F0JA 2J6BA 3GEEA 1LI5A 4XB6B 3V8MA 1GT91 2EAUA 2JARA 4CIWA 1EUQA 2P6MA 4MV7A 1RADA 4GBJA 4MTCA 2J48A 2FHPA 5L9AA 2GZSA 3R0ZA 2O0JA 2OLJA 4B80A 1Q3HA 2QRUA 2DFKB 1RI3A 1STOA 1DEOA 2G67A 3CUEF 2RHGB 2RI1A 5IRCD 2O0LA 5HKAA 4ROSA 1ONPA 5KQLA 1FFEA 1SZDA 2FI1A 3NHMA 4MCIA 4GMKA 4S24A 4L7QA 3W78A 4PR0A 1V8OA 4G1MB 1T3HA 3HC7A 3PBKA 4YS6A 1HNNA 2I3ZA 1LK0A 2VT3A 3E0QA 3I2GA 4ND1A 1PT8A 1VSQA 3E35A 4W5JA 2VT6A 4RDXA 4BY9E 2RHJA 4B3BA 5A03A 2FN8A 3DOFA 2IW1A 2XKAA 4MULA 5KX5A 4YV7A 5A4FS 2LKDA 5JAMA 2IIBA 5J43A 2C57A 5JR3A 4OMUA 3UF0A 3DE4X 3U61B 2WJWA 3PD7A 4FFVA 2XEDA 2CNOA 2WNHA 4KW7A 5FB3A 4BLUA 3R5KA 1JPJA 2B3DA 4L4RA 1IQRA 1W59A 1V0JA 4IHQA 1L5LA 5JYBA 3UYKA 1P4RA 1Y7LA 1PDOA 3DEIA 1TRKA 4OA5A 3Q9SA 4X1IA 1SCJA 5TGDA 4B40A 3PXAA 4E1VA 5A4IS 1VG9B 2FZVA 3BGWA 2MINB 2CHGA 4MUHA 4R0VA 3T9DA 4BC0A 5FH9A 2MWMA 4GLOA 1ZVJA 3CW2A 1I51A 3RT7A 1GGKA 1QG0A 1TOAA 2I33A 4Z0TA 3UAWA 3IR6A 4KMRA 4DT1B 5KREA 2P8SA 3PDIB 4QNMA 4UXJA 3JAKA 5JDIC 2VVTA 1P2GA 2X0FA 4HLUA 1NSFA 2I4TA 4GXRA 4KQFA 5EKSA 3ITDA 1H9CA 4KQCA 1SUAA 1V11B 4ZCLA 4IBOA 4BN0A 1Z4IA 1DDIA 5AKEA 3L4BC 1R37A 2EZ9A 4EG3A 3I76A 3M8KA 3IV9A 3DBLA 3NDPA 4QTUB 4U39A 3G1WA 3GIDA 5KC8A 1BQ3A 2IXBA 2JGDB 2UZIR 3HCPA 1OFGA 3HNPA 4J7AA 1W8IA 4LRXA 1KK0A 4N8DA 2X42A 3QZUA 1E7WA 3L04A 1NQVA 2GVZC 3I9MA 5CYPA 2RK4A 3WLLA 1RRKA 1T3TA 1YACA 2PLNA 4NZOA 1PR0A 1UP4A 2ZW9A 4HAWA 3GRPA 3GT3A 2ECFA 4IYRA 2RHRA 3QMVA 4X97A 2CXRA 1XLWA 2Y0DA 4RQUA 4B6PA 4YC7A 1ZMTA 4RV4A 3ZV7A 1FXUA 1U4SA 1NW5A 1QFZA 4I3FA 1XDDA 1G8AA 1TJYA 2X3YA 3CRQA 3RC8A 1P44A 2O5VA 3QVWA 3RVLA 2LWIA 3H9GA 3MWDB 4O1IA 4WTOA 4A8PA 1RLTA 2ZSEA 1M33A 3D7MA 3DL4A 4AKGA 4DLYA 1UBCA 3X44A 3D9QX 2IUYA 2X76A 4R3NA 2QPTA 1WDWB 3PFIA 1R6AA 3MAGA 3ZTYA 2ZSHA 1L7OA 1T2FA 4O4HF 1SR8A 2Q1UA 2JBWA 3F0TA 4ROTA 5DBGA 4QSMA 4LNHA 4IPTA 2IWRA 3RARA 4WOJA 3H7IA 2O6LA 3C5EA 4ENTA 5FL3A 4ZIRA 2HMUA 4EK9A 4PZAA 1QH1B 3D6NB 1L8XA 4PYKA 5FL7D 1QHYA 5BR4A 5LOVA 2OILA 3LBYA 1GCOA 3T0IA 4F5ZA 3WNBA 2N9UA 3EMBA 4WW0A 3ILYA 1AF7A 3EC1A 4RANA 3ZOZA 4Z9XA 1PG5A 4BX3A 2C88A 4G84A 4Y9SA 2SKCA 4E88A 1DJPA 1NBAA 5G0WA 2NUAB 4Z3DA 2A9VA 5FBHA 1U3GA 2QU8A 2ZCUA 3VOTA 1SKYE 4LCEA 2ET6A 2VP5A 4MSUA 3GVHA 1X3LA 3LK6A 4TMWA 3QJ5A 5K99A 3I6MA 1NDHA 1SCIA 3EZFA 3L6RA 4LK3A 4CTOA 2FQ1A 1Q15A 3NANA 4HNSA 2C9OA 3TI9A 3NC0C 3TNDA 4A92A 3MXOA 1VMDA 4I14A 3F8WA 3BB1A 4JI8B 2YWFA 5IYZA 1PI3A 3CO5A 3ESXA 3OF2A 2JHAA 2VHQA 5G4LA 5HG0A 2B2XA 1VJ0A 4C2TA 2WAAA 1LZKA 1AUOA 1N5LA 5AICA 4XASA 5K3BA 1L7EA 3U60B 1K8QA 2VUUA 3UGTA 1W88A 3R7LA 4C0LA 4CF7A 1U7UA 5CJPA 3VR4A 5LXTF 1THMA 3QXHA 3U37A 5AIAA 4MJXA 4QREA 5FFFA 5E7JA 4CKYA 3HXPA 2GESA 2OLEA 5AK0A 4MPJA 3JQRA 3RTBA 5IBPA 4C9BA 1XZKA 1GA6A 1ZC4A 3CZMA 4XH9B 1OR8A 1GLGA 3ZJYA 4YMHA 3MUNA 3H9JA 4NE9A 2HTEA 3KV3O 4D6PA 4UMDA 4A6XA 3OZFA 3W0LB 3KUUA 5COAA 3R76A 4Y6RA 5LJIA 5HM8A 2ZRCA 5D87A 5EP1A 1Q1EA 3ROGA 4LHEA 1JMKC 3CIFA 1B4DA 1T5BA 1ZUD1 5CB0A 2VSNA 1TZKA 2BGTA 4LHXA 4AY5A 3FYSA 1JF8A 5K20A 5B2FA 4LE0A 1FDTA 1FDSA 3PR3A 1DMRA 4PSCA 3BL6A 3IVCA 1ZM3A 4RZUA 3V7YA 1AKEA 4NHEA 1XHLA 3KKMA 4ZV4A 3OFNA 8OHMA 2FWRA 4JLNA 2Z2XA 3DONA 2CDCA 3LXXA 2BLLA 3B51X 3E8MA 5GTDA 4OFBA 3AUTA 3NWJA 3CVXA 3LT0A 4BVGA 4CHGA 5EPUA 2HL6A 4OGKA 4YCLA 4A15A 3SBXA 3K15A 4J0DA 5AVXA 2BH9A 2GWRA 1E3WB 3NAMA 1H93A 3HCEA 3A9RA 4HAXA 1C0PA 3KZVA 4PANA 2ORVA 4I9HA 1ZCZA 5D7NA 2EFEB 1A1SA 2B4YA 2Z83A 2M32A 3ZWQA 1IXSB 4CU2A 3DB2A 4Y1RB 4EHHA 5JCOC 1LW7A 4EMUA