1R083

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
b'GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
molecule tags Virus
source organism Human rhinovirus 14
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r08300
2RS53 2RS13 2R061 2RM21 4Z92B 1VBB3 1BBT1 5BNNC 5K0UC 4FTBA 5BNOB 2XBO3 4YVSC 1D4M3 1HRV2 1RUC2 2R062 1RUC3 1X36A 1AR92 1FPN2 1WCDJ 2BBVA 1RMU2 2BFUL 4AEDC 2X5IB 3VBOA 4RHV2 1QJU3 1V9U2 2R042 4IV1A 4QPIC 1MQTA 3VBSC 1GFF2 5CFCA 1PVC3 4FTSA 4RR3C 1AYN3 5JZGA 1CD3G 5AC92 2WZR2 4FSJA 4CDQA 4CEYC 2WS93 1FMD1 3JBG1 2WWSA 4N43B 1RMU3 4CEWB 1C8NA 1RUC1 1AR93 5A32A 1PGL2 1R082 2WS91 5LK7B 4GH4A 1AR63 3TN91 1D4M2 1NCRB 3VBRB 1VB2A 5BNPB 3J8F3 5BNNA 3VBOC 1HRI3 1C8M2 4CDWB 1QJY3 4Q4Y2 5C4WC 4RFT0 4RQPA 1AR62 1RUD1 3VBHB 5ACA2 2BPA2 1HRI1 5J96B 4IV3C 1VRH2 1MEC1 2MEV1 1PO13 3ZFFB 1VBD1 2HWB1 2XBO1 1R092 1TME2 5C9AC 1AR61 1K5MC 2R071 5A32B 1NCQB 2RR12 4CDUB 3LOBA 5DDJ3 5D8AB 3JB4C 1RUJ2 4JGZB 1QQP1 1H8TA 1FPN3 5ACA1 5L7OA 1OOPB 1VRH1 2RR13 1IHMA 1R1A1 2TBVA 2XBO2 4NWWA 4RQPC 1AL23 3NAPC 4N53C 5AC91 1RUE3 2PLV3 1RUE1 4JGZC 2HWF1 5C8CA 1NA1B 1ZBA3 1RUG2 4NWVA 1PO12 1VBC1 4CDQB 1RUJ1 4QPGB 3JD73 2HWE2 2HWB3 3VBUC 1K5MB 1RUI3 2GH8A 5C9AB 1RVF2 1HRV1 5CFDB 1VBC2 1R1A2 1NY72 2RS52 1B35B 3JD72 4Y5Z0 3ZFEA 3VBHC 2R041 5C8CC 5BNPA 1AR83 4Q4X1 2HWD2 1V9U1 1POV0 2FZ1A 1RUJ3 5C8CB 1EAH1 1NCRC 4GH4C 1NG0A 3VBRC 1MEC3 2R072 4WM8B 2R043 1R1A3 1BMV1 5FOJB 5GKAC 1EV12 2ZZQA 4PDWC 1RUI2 5CFCB 1QQP2 4N43C 3VBUB 1HQNA 4QPGC 5A33B 1B35C 4QPIA 4RR3B 1B35A 3TN93 1FOD1 5DDJ1 1RUG3 1QQP3 1VBC3 1RUF1 4AEDA 1PO22 1ND3B 5D8AA 1VBA1 2X5IC 4AEDB 1RUD2 4IV3A 1VBB2 1MEC2 2VQ0A 1BMV2 1VBD2 3FBMA 1EV11 1VBE2 1HX6A 1NA1C 1PVC1 1QJY2 1PGW1 4Q4Y3 2RR11 4YVSB 1ZBE1 1X33A 1RUH2 4N53B 1AR82 2QQPA 4N53A 4RQPB 1ZBE3 1POV1 1NY71 2RMU3 4EJRA 1PIV1 1ND2B 4RHV3 1ND3C 1H8TC 3ZFFA 1AR91 2PLV1 1VB4A 1VBE3 4IV3B 5AC93 1NCQC 4CDUC 2FZ2A 2WFF2 5C4WB 4CDWC 5CFCC 3JBG3 4PDWB 4Y4YA 1AL21 1RUE2 1QJU2 1V9U3 3S6PA 1TME3 1PO11 1AL0G 4WM8C 2ZAHA 1BEV2 4GH4B 5ACA3 4BCUA 1HRV3 3IDEA 1ZBA2 5C4WA 4WM8A 2GSYA 1COV3 1EV13 3JD71 2WLPA 3VBFC 2RS12 1VBB1 4Q4X3 1ASJ1 1Z7S2 1ZBA1 1MQTB 2XPJA 1A6CA 2RMU1 5CFDC 1POV3 1OPOA 4CEWC 1RUG1 4CEWA 2MEV2 5CFDA 4GMP0 4FTEA 4CDQC 1RUI1 2RMU2 5ABJC 2BFUS 4Q4Y1 4YVSA 1AYM1 3ZFGA 1HRI2 3ZXAC 2BUKA 3NAPB 2HWF3 1NA1A 2HWB2 3VBHA 3ZFGC 3TN92 1FMD3 1RUF3 1RB8G 1FMD2 1AR72 1OOPC 1FOD3 1AYN1 5JZGB 2HWC2 2WFF1 1C8M1 1F2NA 4GB32 4Q4W1 5BNNB 2WS92 1R081 5K0UB 1AL22 1PGL1 1PGW2 1M06G 5D8AC 1HXS1 3ZFEB 1AR71 1QJY1 1Z7S3 4WM7B 2ZTNA 4GB31 4Q4W2 1RUH3 1COV2 5C9AA 4YVWB 3ZFFC 1HXS2 1PIV2 2HWD3 3VDDC 5BNOA 5FMOS 1ASJ3 3M8LA 4RHV1 1BBT3 1AYN2 1VBD3 1BEV3 2RS11 4JGYA 1VBA2 4Q4V2 4CDXC 2X5IA 3VBOB 1W39A 4GB33 1DDLA 3VDDB 1RVF3 5BNPC 2RM22 1PO23 4YVWC 3JBG2 4GMP3 4CDWA 2RS31 1K5MA 1C8M3 1EAH2 3CJIA 4PDWA 1RHI3 2HWF2 4RS5C 1RHI2 4RS5A 4CEYB 1ND3A 1VBA3 1EAH3 1RMU1 4CEYA 2R073 3DPRB 4Q4V1 1QJX3 3HAGA 3VBSB 4QPIB 4RR3A 1F8VA 5A33A 3ZFGB 1ASJ2 1E57A 1Z7S1 4IV1C 3CJIB 2PLV2 2RS33 2RM23 1HXS3 1AYM3 2RS32 2DF7A 2HWC1 4JGYC 5L7OB 4IV1B 2RS51 1PO21 2HWE1 2WZR3 1R091 1QJX2 5J98B 5ABJB 4Q4X2 3VDDA 5BNOC 1RVF1 1BBT2 5L7OC 4JGYB 1D4M1 1AYM2 1VBE1 5K0UA 3CJIC 1BEV1 1QJX1 4LLFA 4QPGA 1VAKA 1AR81 2HWD1 1MQTC 3DPRC 3VBSA 2R063 3DPRA 3VBFB 1RUD3 1AUYA 3JB8A 4N43A 4RS5B 1R093 3NAPA 2HWC3 3VBUA 1NOVA 1QJZA 1SMVA 1VRH3 2HWE3 2WZR1 1FOD2 3J8F1 2WFF3 1OOPA 1TMF3 1RUF2 1R083 1NCRA 3VBRA 1TME1 1OHFA 4JGZA 4YVWA 1CJDA 4SBVA 4CDXB 4Q4V3 3J8F2 1COV1 4CDXA 5DDJ2 5ABJA 1RHI1 5FMOL 1NCQA 4CDUA 4WM7C 1PVC2 3ZFEC 1ND2A 1ZBE2 1TMF1 1RUH1 1PIV3 2IZWA 2MEV3 1QJU1 1H8TB 1FPN1 4GMP1 1ND2C 4Q4W3 5JZGC 2Y26A 1AR73 4WM7A 1TMF2 3VBFA
chains in the Genus database with same CATH superfamily
4ASKA 3D0JA 3F2ZA 5KXEA 2RG4A 2PHRA 4AI9A 5JMOA 1NYWA 1VBB3 2C9AA 4XMAA 3RVHA 1JYWA 4QQLA 4LIVA 1N1YA 4FTBA 2Q1MA 4AVCA 1S0GA 3RDIA 3AZWA 1HRV2 1WCUA 2FDIA 2WKKA 1IQDC 2R062 1T6GC 4B4RA 3BYWA 2P3IA 3AMMA 2VCCA 1WCDJ 1X8MA 1BHGA 5FKBA 3OY8A 4CU7A 3KGZA 2BFUL 3VBOA 2ZHMA 4OLLA 2WJSA 1QJU3 3MPBA 4MGQA 3PTRB 2CNAA 2IXKA 2K2SA 4QPIC 3AYAA 1MQTA 3VBSC 1SFYA 3VLBB 1QF3A 3MF6A 3NV3A 4LO6B 2J7MA 2A6VA 2VJXA 3KF5A 3LSDA 1AYN3 2H6CA 1CAUA 1CD3G 2E32A 2WZR2 3AL5A 4K20A 5FV3A 1MZ6A 2FMDA 3AYEA 4NPMA 4CDQA 5FPZA 4BYYA 2LW8A 2XWJB 3DYPA 5F6KA 5FPXA 2W2IA 2WNUA 3JBG1 2G1MA 2DFCA 2EXIA 2GH2A 2A6WA 4KMQA 1W6PB 3VD4A 4W6XA 4XHBA 4LUKA 3T0BA 5A32A 4JTOA 2WS91 5FP3A 1HV0A 4GH4A 1O4ZA 4XCAA 1J59A 4BQWA 2VCAA 3OPZA 1IPKA 2DVBA 2Q1ZB 5A3OA 4E4SA 1YWKA 2DURA 2G19A 5L9RA 2CAUA 4W6WA 4NHKA 4AVTA 1C8M2 1CPMA 4P14A 4CPBD 4BE3A 4RQPA 1W8TA 1UOFA 4MGKE 3LEIA 4N9HA 3H50A 1PGSA 3UKNA 1OLME 4AFCA 2BPA2 1HRI1 3WZ1A 1EUTA 1J1TA 5FO8B 4UAPA 2JDHA 2VBDA 3HOBA 3O1TA 4URTA 3ZFFB 5J37A 1VPHA 1POQA 5H9SA 2BDRA 1TME2 3ZYIB 1W6QA 4N7IA 2A3XA 1AR61 4HVOA 4QX7A 3S7EA 4GALA 1JZ6A 4D6SA 3UETA 4RYDA 4CDUB 4QXHA 2VO5A 4AWDA 3POFA 4YFZA 3UJOA 1US3A 1UO9A 4PLNA 5FYIA 2VC9A 3LA3A 4K1ZA 4W8JA 4A45A 1UPSA 1QQP1 4QX2A 5FMDA 3T4VA 3MLJA 3LE0A 4CE8A 2XLAA 3OUHA 5L7OA 4LBQA 4YG0A 5L19A 3VKNA 3P1IA 5T5PA 3KF3A 2JG9A 1SLCA 1ZX5A 4M3CA 3WNXA 2XBO2 4XIOA 2D6OX 4ASLA 4IEOA 2OXBA 4NN0A 2YC4A 3I2FA 1JUHA 5EQUA 4ZHNA 1RUE3 1ZZ7A 5JWPA 1RUE1 4OHVA 2NLRA 2DCKA 2JEMA 1QGLA 1NA1B 1ZBA3 4B7KA 2CHHA 1PO12 4LO8A 3OF1A 4HSLA 2E6VA 3PMEA 2ZOEB 4FFGA 4D7SA 4AEMA 4OZOA 4Q26A 3ZYGA 1XXNA 4D94A 3WDUA 1RUI3 4EYUA 5C9AB 2VUCA 1OUXA 4RD7A 5FBJA 2Y6JA 3M70A 3NW4A 4DRVA 4CRQA 4LXLA 2ZS6B 1VBC2 1R1A2 3APBA 3PLQA 5FWEA 2DYCA 2HJIA 1YQ8A 4IEWA 5DMYA 4UFKA 3KLSA 2ZGOA 2R1DA 4Y24A 5FZOA 3ZFEA 2XGXA 2LRPA 3I2JA 5JIUA 1UOJA 2VZQA 2DCZA 3P5BA 2JE9A 3KV6A 1O6UA 4QKFA 3RJ2X 1GWKA 5A3PA 1N3OA 1RUJ3 3PVEA 3HIFA 1W06A 5C71A 2ZABA 1NUKA 2XB6C 4FP2A 5FZLA 3HNMA 1FATA 1DGLA 1W0OA 4FPYA 4B4PA 5IAXA 3A23A 3A7QA 3S5AA 4QQOA 1DQ5A 4YPJA 1WLCA 5IWFA 1BMV1 5FOJB 5CNAA 2ORZA 4KWLA 1I5PA 4IE5A 2ZZQA 3WVJA 2P3KA 2ZEWA 2DCJA 1LULA 5FK7A 2PMWB 3SQOA 4DNYA 4RN5A 5FJKA 1LOAA 3IDCB 3B94A 5LK5A 2P4EA 5DZEA 3CNAA 4AGVA 4COZA 3BTAA 4QPIA 1JOBA 4I02A 3NVCA 4HKLA 5LBFA 2EA7A 5GLZA 3QH7A 2QUOA 3UK9A 2VNOA 5FYMA 1VBA1 1OUSA 3AZXA 3I2IA 4BQ3A 4KG8A 5H9PA 3SNMA 4EWAA 2C5DA 4SLIA 3CBNA 1DGWX 4FOYA 2VQ0A 2J1EA 2QQIA 3SKJE 3PL0A 4LITA 1RXGA 4UW3A 4Q4Y3 3C7GA 4FQZA 5CVRA 4IDZA 4YVSB 1PMIA 4L11A 2VCMA 1ZBE1 2JD4A 5A6YA 2W1SA 3ZN6B 3NJVA 3QACA 4P9XA 5FAXA 3I7DA 1Y4WA 4N53A 4FT8A 2WO7A 3WF2A 1GSLA 1KFUL 3N9NA 4XC9A 4WVZA 2W9XA 4DZGA 1OF3A 1WW7A 1ZA7A 3OCPA 3VZLA 2WUHA 4A44A 1OKQA 4XF0A 3TRSB 2W47A 1JODA 1XYOA 2PLV1 2VZ1A 4LKEA 2XDVA 2DV9A 4XILA 2PHXA 1YXWA 5J3UA 3MUZ1 5I0RA 4XTPA 3AFKA 4KI5M 4OHZA 1I3HA 2Q0AA 5FP9A 2D3SA 5CFCC 2Y33A 2HYXA 5IK7A 1QJU2 3S6PA 1TME3 1CX1A 5BY5A 2RDQA 2ZGKA 4R4ZA 4HG6B 4QB2A 5FFOC 3M3CA 1W05A 4AI0A 4OULA 3RZLA 1QWRA 2ZPXA 2DFBA 2I74A 2ZAHA 4PIYA 2VY0A 3ATGA 1UOGA 3ZXEA 1QJFA 5FZCA 3IDEA 4BCUA 1CAWB 4L8QA 5T5LA 2PHDA 3TWIA 1NT0A 3ACGA 3ZN6A 2VOXA 2R32A 4GWJA 2EICA 4L2NA 3IZOA 1COV3 4HMZA 2VPVA 3ENRA 5A80A 4S2DA 2WLPA 3DGTA 3LKJA 5LASA 3VBFC 2QBXA 2XJSA 3RMYA 3O12A 1WUVA 4A6SA 3O5SA 4Q4X3 5A3MA 1Z7S2 1ZBA1 2ZX0A 2GC3A 1LOGA 2BWCA 2WNOA 4YW7A 3W58A 3DXUA 4DXTA 1GWLA 2JIJA 2EIEA 2RMU1 3VL8A 2P37A 1W9FA 1KEXA 1OH4A 1POV3 2QQNA 1RC6A 4C1WA 5KWRA 4BDVB 1OPOA 2AH2A 2C6SA 3OEBA 2B7YA 3WQ0A 4CEWC 4R9CA 1L7QA 4C0HA 1YCIA 1AHSA 1GQGA 2JKBA 3HN3A 4GIQA 3RYRA 3VKFC 4A2UA 4DFSA 2BVVA 3Q8EA 3ZYBA 4FTEA 4CDQC 4JQTA 3AYDA 3WQ7A 1UMIA 3DYMA 3PUAA 3LDBA 3PMSA 4Y33A 4CA9A 3RQ0A 4Z82A 5IVFA 1C57A 5IAVA 1UIJA 3ZXAC 5JR2A 1S0CA 1YQ2A 2WDBA 1YI9A 3FC0A 3FBYA 4KBBA 4OUEA 5FXZA 1Q5OA 2W87A 2JKXA 5LBCA 1Y9MA 3ZMNA 5H9RA 3A22A 3BTXA 1JN2P 2WYFA 2BP6A 2P1BA 1SACA 1FMD3 4MOAA 4F83A 2D3PA 1AR72 3WF0A 2YYOA 4QQHA 1AYN1 5JIAA 4A41A 1W0PA 5GZCA 2O14A 4IE4A 2HWC2 4UI9L 4NPLA 2JD9A 3FFQA 4F8AA 3J9SA 4Q4W1 3LOIA 2WS92 1AL22 1XE7A 4RGGA 3EJKA 4JDOA 4UYBA 4XDPA 5A1FA 2C4XA 3SEPA 1QJY1 5CG8A 4QGNA 4ONUA 1QOTA 1Q3EA 4H3WA 1Z78A 1ULGA 2LROA 5FPAA 5LRRA 4LO5B 1GR3A 4ZZ5A 3M1HA 5CZKA 3H42B 1IGOA 2QNKA 1PMJX 3ZX7A 1LJ7A 4NE9A 2AREA 3OBTA 3OYWB 4QT6A 5F2WA 3N35A 4WVMB 3VDDC 3AMNA 4DY3A 4M4PA 4HVRA 4K1YA 3ZM8A 5F7UA 5A7WB 3LIHA 2FD8A 3PIGA 4UBGA 2RS11 2E33A 1OLRA 2CDOA 2ZAAA 1UXXX 3H0OA 1FV2A 2WA4A 3IN9A 3W5MA 4JCKA 4Q4V2 3VDAA 4CDXC 1DGRA 1SDDB 3RYKA 4CYDA 3PUHA 1G9DA 3VDDB 4MVTA 1YJLA 4XBQA 3GHNA 4JVAA 5FO7B 3JBG2 4GMP3 3ZPOA 4CDWA 3O14A 2J1SA 2FCVA 2E7AA 1RUOA 1S2EA 3I3EA 4MGIE 2RS31 5FZHA 1G9CA 1ZVFA 3TAYA 3WHUA 1AVBA 3O7OA 2JDNA 1K5MA 4QKNA 5FXWA 3OGJA 5B4XA 4YW2A 1EAH2 1P8JA 2W3JA 1OPMA 2Y6LA 1RGSA 1YFXA 3U11A 3RZKA 5A7PA 5JXJA 2KD7A 5SV8A 1AX2A 5FZBA 3RZJA 4PCRA 2GNDA 3HJRA 4K7JA 3PVBB 4RGKA 4QAWA 3JQWA 5A6QA 3HAGA 4JQRA 4OUSA 1F8VA 1E5SA 5A7WA 5CG9A 2Z2SB 4AGGA 2ZACA 4PLMA 3ZFGB 1Z7S1 4MSVA 3ROUA 1W6MA 3CJIB 4QGLA 2RS33 4Y22A 1SBFA 4BK5A 4D6RA 1HXS3 1SLAA 1DYKA 4M00A 1W6MB 1NLSA 2DF7A 5T5JA 5T52A 3P3PA 3U1XA 4AR2A 2RS51 1UU6A 2Q4SA 2I2SA 1AJOA 3LEGA 3JU9A 1PVXA 1SFNA 4YW6A 5J98B 3KSCA 2WC2A 4P9YA 2RJKA 1KDMA 3FE5A 4IEXA 3WEZA 2OZ6A 4GJYA 4LLOA 1WW6A 5L7OC 1QKQA 1SG3A 1J83A 1KFXL 1OH3A 4XF3A 4C90A 5EJ1B 5E88A 4ZS3A 3VZKA 1JZ8A 4Q27A 4CP2A 5JOYA 1S1AA 4MO3M 4IETA 3EHKA 1BEV1 2WO2A 1QJX1 2YV8A 3ABZA 4LLFA 2GC0A 4GULA 5FYUA 4LA3A 4TLFA 3SISA 1AR81 3THPA 1O3TA 3JQXA 3MHZA 4AEJA 2EXJA 4NRMA 3NNFA 3VBFB 3K2OA 1IS6A 2ZEYA 3CLPA 3VZJA 1R093 3B7MA 1W8OA 4OQ9A 5ISLA 5A3WA 1GBGA 2ZJCA 1JYCA 2XUMA 4JAAA 4GAZA 3WNOA 3GDBA 3HQUA 2HWE3 2WZR1 3LIGA 1JYVA 1JXNA 1JU3A 1RUF2 1R083 2QJVA 3DKQA 1PK6B 5F6LB 4RFRB 2XXZA 3N9QA 4XXAA 4CUCA 5BNQA 4PT6A 2PXJA 4U36A 1F35A 4Y1ZA 3WX5A 3OG2A 3I49A 2P5BA 1CJDA 3H1WA 2XWBB 4FXGB 1QDCA 4WVWA 4SBVA 2IVIB 1IS4A 4FI9A 4CDXA 3PURA 1NE4A 3B01A 3URFA 2P17A 5FJHA 5FZDA 5E6HA 3WXPA 3QOPA 5GALA 1WBLA 3KHCA 1GZWA 2G9ZA 4D6QA 2MPFA 1JYXA 1AJKA 4YZ5A 1JYTA 2UWCA 1PIV3 1O4YA 2BTVC 3OYWA 4S2HA 2A5ZA 3BALA 3UV9A 1E5RA 1FXZA 1URXA 4ES9A 2QQMA 4Q4W3 4PIZA 3ILNA 4B4QA 2Y26A 3HR9A 4QKBA 2JDYA 1AR73 4IL7A 3IIIA 4PLOA 4WM7A 5SV5A 4Z8BA 3INAA 4QHZA 1AZDA 4R9BA 2RS13 4K8FA 1SDWA 4UW5A 3SCGA 3KCYA 3VZOA 4HPKB 4XJUA 3H8UA 1A8DA 1W90A 1BBT1 2OIIA 2Z79A 1ZRFA 1H1IA 3WP5A 1JU4A 3J7LA 1JMUB 3KVBA 4UFMA 3ZXDA 1V6NA 3P6BA 1SPPA 1YFUA 3AJYA 1D4M3 4YVSC 4PQQA 5FZIA 1QDOA 3MIHA 1LRHA 3H9AA 1RUC3 4AVSA 3GJAA 1YO8A 3OBAA 5C3RA 4LPLA 4MV2A 2VZSA 4V1PA 4AFAA 2BBVA 3SCFA 5FIXA 2A70A 1LB2A 1RMU2 1YI7A 3O0XA 4RHV2 1YIFA 4OHXA 4D7YA 4YW3A 1LODA 1V9U2 3J7HA 3LPGA 5IATA 4IV1A 3UNPA 4IEPA 4FXKB 3WW4A 5CFCA 1W28A 1YFYA 1W6NB 3HNBM 1XNDA 2YPJA 4CEYC 4QX1A 2WN2A 1HV1A 4CCLA 1HJFA 4C0BA 3U0ZA 4N43B 1SHWB 1RMU3 3FHAA 2EF6A 2QKDA 1W6PA 1JS9A 2DVFA 1CAVB 1RUC1 4AVVA 2YMZA 1UYXA 4BXFA 4XURA 4I0AA 1AR93 1JOPA 1PGL2 3SEEA 1R082 2EAKA 4HETA 5LK7B 1W6OB 3WP3A 2XVGA 2H6BA 2WT1A 3K77A 1JOJA 5DAWA 1T6BX 2R0FA 4N90A 3VBRB 5IK8A 5FK8A 2VW2A 3NNJA 5E8AA 4XCBA 1SLBA 2K0GA 4OI0A 1FNZA 1KJLA 3OUJA 5FKCA 2ZBJA 5A1AA 4KWJA 3N9MA 1OVSA 4XUTA 3S7IA 4JHZA 3K46A 5EXOA 5FDBA 1GNHA 4Q4Y2 3EO6A 2BWAA 4NHXA 4UXAA 1VMJA 2ZHLA 4EZ4A 4EN9B 5ACA2 5HV0A 1J3PA 5J96B 3MIFA 2WA3A 1MEC1 3BTZA 1ZRRA 3GCXA 4A42A 2R49A 1VBD1 2BNMA 3I2GA 1K5JA 2JXAA 2HWB1 3POJA 3AZVA 3CL1A 3RWKX 1VIWB 2VW0A 3AP4A 5C9AC 1NQDA 4CCMA 2X8KA 3Q9OA 2XUEA 3KV4A 1ENSA 2BGCA 4P9WA 4DEVA 5K9YA 4GWIA 4LEJA 4O9GA 2PELA 2VBBA 4YM0A 5EIYB 1US2A 2DU1A 5DDJ3 1LOCA 5D8AB 4XOGA 3U78A 3GHMA 1RUJ2 3ST7A 3KQRA 1REEA 1CPNA 1F5JA 4ZXEA 1AXYA 5DQ0A 3T09A 1FPN3 1X50A 3AMHA 4YGDA 2JE7A 2E9QA 1OOPB 2JDPA 3BVCA 3TOJA 1VRH1 2LS6A 2VOKA 5FZ3A 2D40A 1IHMA 2AUYA 2YROA 3NRUA 4TSVA 4E2GA 2TBVA 3IAPA 3THDA 4KWUA 4DO0A 5F3EA 1Y9QA 1V6KA 1AL23 1AF9A 3MFCA 4N53C 2IXIA 4XDOA 1I6XA 4XEZA 5FZ9A 1PZ9A 3THTA 2Y64A 2A75A 1OI6A 2W68A 4HBNA 5C8CA 2XKOA 4NWVA 1M4WA 2JG8A 4YYOA 4E2SA 4QPGB 1CZVA 4XFGA 3JD73 4OMDA 5C3PA 4Y20A 3MFAA 5J48A 4HANA 2BGPA 3KV5A 2HWB3 4Q0PA 3VBUC 3D0SA 3U4XA 1YJKA 5LRSA 2QQVA 5D2AA 2YU2A 2Q8CA 2PQSA 2XQRA 3R4DB 5CFDB 2XMLA 5APAA 3AXDA 4A7YA 3R0RA 2NN8A 1DQ0A 3CMGA 1B35B 3JD72 2P34A 5C8CC 3O1MA 4XTMA 4XMIA 3FUOA 4JV4A 4URAA 1FX5A 2XQXA 2ZHNA 4JKKA 4CXYA 4Q4X1 1HQLA 3TEYA 3WDVA 1POV0 2FZ1A 5KHGA 2Z4FA 2WLQA 3FL7A 4G3YC 2HEVF 3LF7A 3UESA 2ZGLA 5C8CB 1DP0A 1EAH1 1NCRC 2D7FA 1NG0A 4GH4C 4R9AA 2R30A 4CUBA 1WLWA 3S0MA 5FBZA 2ZA9A 2R043 3AKTA 4R9DA 2EXKA 5K7PA 1IZ3A 1TMF2 4P00B 1EV12 4DUVA 3WNLA 3RG0A 1DQ2A 1RUI2 1ZZ9A 3ETPA 1AXKA 1NX9A 2R1BA 4P9JA 4YM2A 3ZR5A 4LHSA 2Y38A 5LB6A 2ADEA 3ON7A 4QDRA 1H4GA 2CYFA 1XU2A 2J42A 2YC0A 3VD3A 4P9IA 4BA6A 4QPGC 5A33B 2BV4A 1B35C 2JX9A 2WNVC 5IFTA 1B35A 1XNAA 3M4FA 1XQNA 1RUG3 5F32A 1XJAA 2K9ZA 1VBC3 2VQAA 3W5NA 2JB8A 1JZ4A 5D8AA 5M0TA 2QZ2A 1OD3A 2OA2A 4NIIA 5L9BA 1KS4A 1O59A 1RUD2 4IV3A 5ANNA 2Y34A 4MGZE 1SPPB 1PNFA 2V73A 4NOTA 5HV4A 5A6ZA 2Q30A 5FY8A 4QX8A 4YWAA 4BIOA 4GKXA 4XUPA 5F39A 5FY9A 3KT1A 3ZSJA 1APNA 2SLIA 1PVC1 3B3QE 3DEMA 3WDXA 2ZGRA 4Q0QA 5KXDA 3S57A 3WG1A 2XJQA 1LTEA 4LBNA 1AR82 4N53B 4QXKA 4Y1VA 3EMRA 1DG6A 4TTGA 3PU8A 5FUIA 3JZVA 3UKVA 1LOEA 3AL6A 1ZBE3 1H0BA 1YQCA 2XR4A 5DUVA 2XL7A 1IPSA 3C3VA 4LQRA 4EJRA 4KH9A 3U14A 1UN1A 1ND2B 4FOQA 2BEOA 1ND3C 3DN7A 4NAOA 1H8TC 4GZ9A 5BXXA 5FLJA 1AR91 1HB1A 5A3LA 3GNEA 1VBE3 2W52A 5GM0A 5FXVA 4ZU5A 4IV3B 2BNNA 1HB2A 4PF5A 4KU8A 5FZMA 3ZSEA 1NAEA 2RJLA 3NKGA 5AC93 2XJVA 1TE1B 2FZ2A 4I3GA 3UJQA 3KGLA 5AFBA 1F15A 3Q8AA 2GP3A 4NR1A 4PDWB 4Y4YA 1AL21 1LU2A 1V9U3 4O65A 4QX5A 4CP1A 5KR7A 2Y0OA 3N9OA 5KHKA 1J84A 3BUCA 2C9KA 2R0HA 4G4FA 2O1QA 1YEWA 3UKTA 1UYPA 2W0XA 4LBMA 3LSEA 4COWA 1ZM1A 1G9FA 3U75A 5LW9A 5KXCA 2CDPA 2WQ8A 2BOJA 2QDRA 4LHLA 4YZ3A 1BKZA 2ARCA 3C7EA 5EJZB 2GN3A 4GWNA 3VHNA 1G6NA 1H4HA 3A21A 2G4IA 1BEV2 4IERA 4Q8LA 1XYPA 4LR4A 3TNPB 2GN7A 1HRV3 3ILFA 3OY8B 4YM3A 5JMCA 5C4WA 1YUDA 5GZGA 2BU9A 2B46X 1W0NA 4CXXA 5IVYA 4CU9A 2BVBA 2OPWA 2NPIA 3H3LA 4NO4A 5EV7A 1EV13 3VKMA 3B02A 2JB4A 2VTXJ 1I5ZA 4LK6A 2FHRA 1NE6A 4YG3A 4UT5A 2WO3A 3DECA 2RS12 2XHKA 1UZYA 4E8DA 2XJTA 4FOVA 2P6HA 3J26N 1ZRIA 3AP9A 2Y6GA 3B93A 1JBCA 1UYYA 5FTTC 4CVUA 1O3RA 1RUG1 2MEV2 2XHNA 1DYOA 2EXHA 2GMMA 2JENA 2XJUA 4XW3A 3R6SA 4B7EA 4I30A 4EQVA 2RDNA 2WZEA 3EB7A 4IQPA 3ACIA 4MADA 1RUI1 5FP4A 2RMU2 2VZRA 2BFUS 3GJBA 1BVP1 3R4SA 1AYM1 3VZNA 2WBKA 3EXUA 3N7KA 2E63A 1HRI2 2RJ2A 3C7FA 3FJSA 3IAQA 3OGVA 2CGOA 2YDEA 4HOOA 1BK0A 1LNSA 1SBDA 2BUKA 4DB5A 2V09A 3NAPB 4GD4A 1DF0A 1W8WA 4UF0B 4QWNA 1BZWA 5GLVA 5A7QA 3BN6A 1BJQA 3KD4A 2DWRA 3TN92 1A78A 1RUF3 3MYXA 3JXSA 4QD2A 5DUXA 1FV3A 5FYTA 1IPJA 4AAXA 2OW4A 4DRRA 1MPXA 1F2NA 3I59A 1PGL1 4YW4A 1R081 1UZWA 3EQEA 5DAPA 1C3HA 1HXS1 3VZMA 1TZOA 4X8PA 2G9FA 1AR71 1WCQA 1OKOA 4ZPIA 4QPYA 5FPUA 4NIDA 4MHRA 4M4RA 1I1EA 4WM7B 5GLUA 1STMA 2J1RA 2MNGA 1PX4A 3NQHA 1SFPA 2ZTNA 5FZEA 1HN1A 4Q4W2 3HQRA 1F31A 1RUH3 3E5XA 1JHNA 2ET1A 1LOBA 4GQ7A 4IE7A 4AI2A 1DZRA 2RVAA 3LPFA 4P9GA 1EP0A 1RL3A 2VZVA 5BNOA 2VD7A 4RHV1 5FUPA 2XOMA 5EJ3A 4QGMA 1DLCA 1BEV3 4NPRA 3SKVA 4BB3A 1OT5A 2ZGTA 3MIGA 4NUBA 4XFAA 3AKPA 5TSWA 1J3QA 5GLTA 3VBOB 1O4TA 1QOOA 1W39A 3K51A 4DINB 1JZ3A 3ZN4A 3K4AA 1H9PA 4EN7B 1VAMA 4YGBA 1W03A 3POIA 2PYTA 1IQAA 1FI2A 2XJPA 5FY1A 3ACHA 4CCEA 2Z5WA 5FZAA 2HYKA 2ADDA 2YB7A 1LHWA 2WSVA 4FOWA 4Q2FA 1QH6A 4YFWA 3AKQA 5EYXA 2OQ7A 2OZJA 4HN0A 4XUNA 4ZY9A 2J1VA 3ZXLA 4LKFA 1RHI3 3CU7A 2HWF2 5F8PA 1JUIA 1XB9A 2GNBA 2XKPA 1ND3A 1CAVA 2DDUA 1GZ9A 5FLIA 1S0BA 5FYBA 5CKMA 3USUA 3H3UA 4K8RB 1G9BA 2A6YA 5G04L 4QPWA 4RR3A 4LOSA 4YG6A 4B1MA 3I3DA 2UWAA 3ITQA 2JIGA 1NKGA 3T0DA 2ZGSA 2W08A 3MLLA 4M3CB 1YFWA 2YPDA 2VXJA 1SCRA 1UWWA 2V5YA 3V0BB 2YHJA 3IM0A 4IEQA 1MS9A 1ALYA 2DUOA 4FPOB 5GZEA 3ZIWA 1AYM3 1MS3A 1GNZA 4BQ5A 1SLIA 5L7OB 2FDHA 1PO21 2PHWA 1H30A 1UX7A 3AVSA 4GWMA 5A70A 2F6BA 1VLNA 4YGEA 1DZTA 3PU3A 5ABJB 5FWJA 5K8SA 3QD6A 4J6GA 4S2GA 4Z1VA 1RINA 1BBT2 4B3NA 4H14A 4XJZA 5BNOC 4KBZA 4OFGA 2Y60A 2IFWA 1AYM2 3IWZA 1VBE1 2ZEZA 5K0UA 1LGBA 5F5CA 3CJIC 3VL9A 3ZSLA 4BQYA 3AYCA 3W20A 4XHXA 3BODA 4YGCA 5T3NA 4OHWA 3RPQA 4HL0A 3WW1A 3OD4A 5IFPA 4XJWA 1MQTC 3DPRC 3POEA 2R063 3VBSA 4A3ZA 3U37A 4K6BA 2OUHA 1S0DA 1KRIA 3W9AA 3JB8A 4HKWA 1XRUA 2QQPA 1X82A 3LCPA 4BHPA 2HWC3 1N1TA 1U0AA 2TUNA 4HONA 1YNAA 4OHYA 1C1FA 3IMNA 1NOVA 1SMVA 1VRH3 3NNLA 2VOTA 3VBUA 1FOD2 1W2OA 3C7HA 2WFF3 3J8F1 5C33A 1BK1A 4AXOA 4OI4A 1NCRA 1KJRA 2ZGUA 5HBAA 1FT9A 1NXD1 1OA2A 4CP0A 2PAMA 1Y43B 3MZHA 2JDKA 4Y4RA 3M3EA 2WN3A 5CBLA 4CDXB 1W9WA 4Q4V3 4INDA 4KNCA 4BMBA 3E5QA 2VMFA 3T1MA 3I8TA 5FMOL 1NCQA 4OUMA 4WM7C 3H7JA 2JECA 2D44A 1WMXA 4XAEA 1GANA 2QDNA 3M3QA 3AMPA 3ZSMA 3PJYA 1RUH1 4AHXA 5F2SA 2B9VA 1S0JA 2DVDA 1C5HA 1QJU1 3BCWA 4GMP1 3BIWE 1WLDA 1ENXA 1HIXA 4XQDA 2BJSA 2D6KA 3LWCA 5CU1A 2RS53 3GZAA 5LZ6A 5D1IA 1W3XA 4XAAA 3ZYJB 3I97A 2RM21 1A34A 3SC7X 3CZJA 4Z92B 5EWSA 1GQPA 4JHTA 2PHLA 4NHLA 4QXCA 1VMFA 5FZKA 2ARAA 4TLGA 5FXXA 4BXSV 4D8MA 1YRZA 3GBGA 1HN0A 2YBPA 4K9SA 4WVMA 3IKWA 3LGRA 4OYUA 1GYKA 1U5YA 1U12A 5DN2A 1L7RA 3OUIA 3ZXFA 1OSGA 5DG2A 3OB8A 1JH5A 4XZUG 1X36A 2YXSA 5I0TA 2AEZA 4KWKA 4XBLA 1AR92 1ZZ8A 3C8XA 1FPN2 2VXRA 3TEXA 3EBRA 4XIKA 1GICA 2VMGA 2BBAA 3E6DA 4AEDC 2X5IB 3ILRA 4GXLA 4O61A 2R042 2TEPA 1FNYA 1MS8A 5J7MA 4N8MA 4UW6A 1XSQA 3NJZA 3POGA 1PVC3 4A4AA 2BGOA 4RR3C 4FTSA 5JZGA 2YU1A 2NMNA 3GALA 5C3OA 5JDBA 4L92A 4IGQA 2X09A 2XLFA 4Y1UA 4JRLA 1DQ4A 1FMD1 2WWSA 4BWOA 1VAVA 3HN1A 1H2MA 1C8NA 2W1UA 2WSUA 4FPFA 4CEWB 4EV0A 4QDQA 5KHJA 2BZDA 3WF1A 1K3IA 4XF9A 3H1YA 5C5UA 4AI1A 4CU6A 2ORXA 1ULPA 3HMYA 2LM3A 4OZXA 3KCXA 2ZEXA 1D4M2 1O7FA 5EFUA 5AVAA 3T2TA 3AFGA 5IVCA 1LOFA 4FCAA 4HKOA 4BZ4A 5BNPB 3J8F3 4EN6B 1LEMA 2EALA 3PIJA 4J1WA 3RNSA 3ZVXA 1MS0A 1LHUA 4MHUA 5FLHA 3A0KA 3H8XA 3VBOC 4CCDA 4PHZA 4OMCA 4MG2A 4XABA 3RMXA 3ECQA 5FO9B 5FY7A 3BOWA 3NV1A 1CIYA 4RFT0 4AOCA 1GQHA 1LESA 3E5UA 3FZ3A 4NROA 4UOJA 1RITA 2JG9C 2W91A 3KZ4C 3VBHB 3N4MA 5HXVA 4IV3C 3DUIA 3LAGA 3THCA 2MEV1 3ZN5A 1YLLA 2Q8DA 3USSA 2ES3A 2A1XA 3NNMA 1H1MA 1Q56A 2B45X 2XBO1 1UU5A 4QQPA 5F3IA 4I2OA 3ES4A 3OSDA 1S2KA 5EZWA 4L97A 2HLEA 4FFIA 1K5MC 1CQ9A 5A32B 2NMOA 2A3WA 4LA2A 4C91A 1A8MA 4H2AA 3T30A 1DLLA 4YLZA 2QTWB 2B5HA 1Q43A 1NLQA 4W4ZA 1G86A 2D5HA 1MVEA 5E89A 3OOXA 3ZOIA 4B8EA 1D7PM 4JGZB 4Z07A 5HCFA 1MVQA 1N3QA 2WYSA 4CPBA 2QCSB 3RZHA 5EYYA 2GAUA 2FDJA 2ZMLA 3WDTA 1O5UA 3FLPA 3FHQA 4LHNA 3RI9A 2Z69A 1S0IA 3MV11 5GLWA 2LUWA 1R1A1 1QJEA 2GNTA 4WZCA 1ULCA 5DZGA 2IXCA 5GZFA 1W8NA 1SLTA 2FDGA 5FMBA 5AC91 3TEWA 3IIAA 4NHMA 5CKQA 5GJ6A 3BB6A 4FPJA 3UGFA 2OT7A 3IPVA 4JGZC 4M0NA 4E27A 3E6CC 2OQ6A 1RUG2 1PM4A 2WINB 4BPZA 3ZXGA 5BPXA 2AZ5A 3WNNA 1KS5A 3WV6A 4E4HA 1E5IA 1DU3D 1KXGA 3IDAA 3NV2A 1WBFA 2HWE2 3HVDA 3PNAA 4WVVA 4QX3A 5IVVA 5JOZA 2A73B 1UCXA 3O1UA 2ZZJA 1PZ7A 2W94A 1HRV1 1LHVA 2F4PA 2FBEA 2VUDA 3ME2A 4UFLA 3WUCA 2HEWF 1H2KA 1JZ7A 2E7QA 3AZZA 3DF0A 3ZYFA 5KXBA 2RS52 4CZSA 5LA9A 4XXPA 4Y5Z0 3HEIA 2JG9B 2KR2A 2R041 3FUQA 3KT7A 3VBHC 3GBFA 5CYYA 4B29A 1XNCA 2V72A 2Y0IA 3GGLA 4DMIA 1AR83 4H55A 4JDMA 4Q1PA 1R1ZA 3AX4A 2EIGA 2QQWA 4QMAA 2VECA 4YRDA 4AI8A 3HT1A 2AC1A 3UL2A 2DCYA 2R16A 1RIRA 1Y3TA 3AXEA 1QXJA 1L3JA 2R072 5FPBA 3U4SA 5AVPA 4WM8B 2VGDA 3VV1A 4AGRA 1V6OA 1XYNA 2VZTA 4FFFA 4IUGA 1K12A 2WWUA 1UPIA 5E1RA 3SH4A 3O1VA 1ULFA 2DUQA 4XJAA 2VH9A 4OI2A 3D6EA 2D6LX 4KGQA 4PDWC 1Y7BA 3QCWA 1T2XA 4AZZA 3O1OA 2DU0A 2XONA 1MS1A 1Q8QA 3VBUB 3K3NA 4QM9A 3Q8BA 1VMHA 3GZEA 4ISRA 3IB3A 2JG8B 4DXZA 2JDUA 2YBKA 5HCHA 4RR3B 4KU7A 4XUQA 1QQP3 1UMHA 1BXHA 3MW2A 1UOBA 2IUWA 4MXWA 1RUF1 4FAGA 1PO22 3WF3A 1IKQA 1V6IA 1ND3B 1MS4A 2A3YA 3WCSA 3U10A 2IXLA 1TVGA 2X5IC 3H1MA 2Y6KA 2ZX1A 3K48A 3JUUA 4XFCA 4AQSA 4DUXA 2DCTA 3GM8A 2A71A 4ZS2A 3NKTA 1PK6A 4Q5OA 3O1RA 1XC6A 1BMV2 1V6JA 3ACLA 2QQJA 1VBE2 1HX6A 3SCHA 1NA1C 1QJY2 4R52A 1PGW1 4LBOA 1HB3A 1F9KA 1K45A 4HPKA 1UNBA 3WINE 1X33A 3CZUA 1DGWA 1VJ2A 3MDPA 3HQXA 2X29A 3WDYA 1MZFA 2B9UA 1CESA 4FBFA 3E1F1 4AQ2A 3D82A 3WNKA 1W2AX 2D6NA 2D6PA 3OPTA 1G7YA 1POV1 2YZ4A 1ULDA 1NY71 4BQ2A 3ALQA 3CQOA 3FX3A 3OD0A 4I0WB 1PIV1 1DYPA 1UMZA 3HT2A 3FMGA 4LBKA 4WV8A 3HD8B 4DUWA 4XVHA 3WY6A 1D4VB 2Y6HA 3ZFFA 1H9WA 2EAAA 5HCAA 4AFBA 2CV6A 2WNVB 1BLZA 5I8TA 2VZPA 2JG8C 4XACA 1QH7A 3I2DA 2JJ6A 4N7UA 4RL7A 3T3YA 4CDUC 2WNVA 5FP7A 2BOIA 2WL1A 4LIUA 2XG3A 4XZPA 2I07B 2QQUA 2VVEA 5FOBB 1RUE2 4FPHA 1BQPA 1W8UA 4AFMA 3T1LA 1PO11 3NL1A 2ID4A 1HW5A 2W1WA 2WAAA 1AL0G 1U5ZA 4Y22B 3WNPA 4WM8C 2ZHKA 1VP6A 5FR3A 1E5HA 5JPNB 3BPSA 4QQ2A 5JOWA 1CGPA 3AP6A 4XF1A 5LA2A 4NHYA 3GCWA 5CA6A 4WM8A 1KD7A 1DZQA 3PUSA 1WW5A 2GSYA 4HK9A 1ONAA 5F5QA 1HB4A 1WKYA 2ZMNA 3WW3A 4BK4A 1XNTA 5JR7B 1TEIA 3O0WA 4LKSA 5CAZA 1VBB1 1D2SA 5LY1A 1GZWB 3O0VA 4QDSA 5DG1A 1MQTB 2VNGA 4YM1A 4A3XA 1U5XA 3MLKA 4KQ7A 4LJHA 5FYSA 4XQ4A 5A1LA 4GKYA 4J1XA 4LBJA 3PUQA 1ST8A 1UX6A 2QZ3A 4UFJA 1EPWA 2ET7A 2VOVA 2VUAA 1LECA 3I3QA 4B1LA 4CEWA 4YARA 2WNUB 3LEKA 1S2BA 3VHRA 4KL1A 4CCKA 1MACA 1PMHX 3MIDA 1UZVA 2H0BA 1EY2A 3PVOA 2YGMA 4MYEA 3BI3A 5ABJC 4Q4Y1 4ZONA 1OQDA 2UURA 3FLRA 1LGCA 4NVPA 2FMYA 3M7AA 5I0SA 3T4HB 1GP5A 4ARYA 5L36A 3I2KA 3H3ZA 3WOGA 2HWB2 1LKNA 4LUMA 4EN0A 2ZMKA 2W95A 2IWGB 1CAWA 2OVUA 5I93A 3KM5A 1UQXA 1FMD2 1OOPC 1RYYA 3QH6A 5JXHA 2PAKA 5IK5A 4OQ8A 4Q29A 2J22A 4CCJA 1CR7A 4AVAA 1W6NA 4XJ9A 4AVBA 1WCSA 2WFF1 2V4AA 2WQ4A 2OS2A 1C8M1 1W9YA 4GB32 5BNNB 4U2AA 4XDQA 4P9LA 1PGW2 1YYNA 2H0VA 3N36A 5F37A 1UU4A 3M3IA 5D8AC 4GA9A 3V0AB 1UY4A 3AP7A 1OFNA 2VMCA 3RRDA 1EUUA 1Z7S3 4DXRA 1UZ0A 2KM2A 2IXHA 1OLMA 3T0AA 5FQ0B 2OPKA 1W3VA 3SMHA 4AI3A 1NLRA 1GOHA 3MF9A 5CISA 1COV2 5L9VA 4YVWB 4UF0A 5L73A 1HXS2 2AENA 3M3OA 2CSGA 3MICA 1PIV2 4LE4A 2ZCWA 1J1LA 1KITA 1N1SA 2HWD3 1PX3A 2P2KA 1ASJ3 5EP9A 5A3UA 2B4KA 4MX3A 2VAUA 3M8LA 5F9TA 3GF6A 1BBT3 3POSA 1AYN2 3DL3A 4UW4A 4Y5SA 4HZFA 1JZ5A 1J58A 4XFBA 1DCSA 1X9TA 3ZSKA 3AB0A 3PTYA 4NIAA 2UY9A 2ERFA 3BU7A 5A7OA 1GZTA 4GB33 2YFUA 4PJYA 5I8YA 4V2WA 3VD9A 5BNPC 1OFSA 4EN8B 4YVWC 3VDBA 4MUVA 1QXPA 2UY8A 4TWTA 3O1PA 4MGYE 1UKRA 1NZIA 4XQWA 5JOXA 1V70A 4OI1A 4DPNA 1WWYA 4W6YA 1OA4A 2E51A 3LEMA 3SITA 3MW4A 5T55A 4F7ZA 1IG0A 1C4RA 1C8M3 2PHUA 3CJIA 4FQ4A 4BQXA 4LT5A 4RA0A 4E4ZA 5BYNA 3AKSA 4Z2WA 2WAOA 4RS5C 5B2GB 4ATFA 4RS5A 5E16A 2PFWA 1IG3A 3B9CA 1VBA3 3NO8A 4UBHA 3J4UH 5I8SA 1RMU1 4CTEA 1H1AA 1REFA 2R073 4Q4V1 3NV4A 5CKNA 4FAHA 4YZ4A 5A33A 4V2VA 3RZGA 4QB6A 3S5QA 4M01A 2DTWA 3ZXKA 1E57A 3ZPYA 1LEDA 3NSTA 2AEYA 2RS32 1HQWA 2KA3A 3QLQA 1UY1A 4JGYC 5FZ4A 2C26A 1WA4A 2HWE1 2VL4A 2WZR3 1D0GA 3VD5A 1ODNA 1D0HA 2VTXA 1PNGA 4IXLA 4XPVA 5FYZA 3UT0A 3RZZA 4CP9A 3WP6A 3VDDA 1IS5A 3I54A 4HSJA 1UZZA 2Q5TA 2YUEA 3RYPA 3ZLIA 4C1XA 5B4NA 4H7LA 5C5TA 4JGYB 2VZOA 2WNUC 4LTAA 4LKDA 4YW1A 4XYXA 5GZDA 3RFRA 1FYUA 2HEYF 2L9LA 4JC1A 3T08A 3RWNA 4ITCA 5FYVA 4ZU7A 4D3WA 5JXIA 2K46A 1X9PA 4QPGA 1VAKA 4FPKA 1JI6A 3WR0A 5CIRA 3MV01 3VDCA 2ZX4A 2CTVA 1HKDA 2GMEA 4BH9A 1AX1A 3K75B 1BVVA 2WQZC 4MXWB 3BIEA 1ZZCA 1AUYA 1OD5A 2FQPA 3G6JB 5IVJA 2WR9A 4RS5B 4TYSA 4COYA 4PF1A 2DTYA 4PBOA 4LHKA 2QE3A 2WABA 4XJ8A 1JYNA 4OVEA 1GLHA 1PZ8A 1REDA 4P02B 1YIPA 1DHKB 1QMJA 1QJZA 2ILMA 4DIQA 1S55A 1OOPA 3G7DA 4AFDA 3T2OA 3R4UA 3SLIA 1IOAA 3KS7A 2Q1FA 2ATFA 4YVWA 1JW6A 5FZ7A 3I3MA 2VVFA 1AX0A 3LZZA 3ZMOA 1MZEA 1S0EA 2B8MA 3J8F2 1COV1 1EPZA 3WCRA 5FY4A 5DUWA 1RHI1 5IK4A 4CDUA 2GDFA 1DQ6A 4HN1A 4IE0A 1SBEA 1LHNA 1ENRA 3PDQA 1ND2A 1XE0A 1ZBE2 1TMF1 1ENQA 5EPAA 3W59A 1VE0A 1WMDA 2Z42A 4TN7A 4HK8A 4K3UA 1OLQA 2DVAA 1H8TB 2NM1A 1G8WA 1UY3A 3POYA 4Y1XA 1GP6A 2PTMA 3WSOA 1NXMA 1ND2C 3LFMA 3KHBA 2WT2A 5JZGC 4LNVA 2VTFA 1C28A 2QQLA 3ELNA 2WZPP 3PUIA 3T2QA 3CJXA 1WD3A 1H8VA 1QOSA 4P5YA 3OGRA 4IESA 5ERLA 3VBFA 3B69A 1C1LA 4JX0A 2R061 2VZUA 1WMEA 5HXMA 2WT0A 4LULA 4EROA 4AHWA 1X8EA 2XLGA 3VHOA 1LAJA 3AM2A 2OX0A 4OCTA 4AQTA 1R64A 5BNNC 3CKHA 5K0UC 3ZDSA 4P5HA 3C7OA 4BQ4A 3TB0A 2VVDA 1GU3A 3KQ4B 3N3HA 2XBO3 3RJRA 5BNOB 1CWPA 2BW8A 3D8CA 1DIWA 2UU8A 3BOPA 3KB5A 1RUC2 1V00A 4PIXA 5JVVA 2QQOA 3TEZA 1XE8A 1DFQA 4Q1RA 4EE2A 4XFFA 3BU0A 3OBZA 2V5DA 4ZU4A 1UL9A 3CEWA 2JDZA 1WMFA 3K4ZA 4LK7A 4M3CF 2R6QA 4ARXA 5KC6A 1ZRCA 1LHOA 1SEFA 4PBPA 1VRBA 3OGGA 3KV9A 3J7NA 4FVVA 1GFF2 1OA3A 4LBQD 4RGAA 5DAXA 5JPMB 1V6MA 3I2HA 3AC0A 4Y20B 4TZDA 1CVNA 2ARXA 4A7ZA 4XFHA 4DY5A 5AC92 1GV9A 1W2NA 2UYAA 3O1SA 1WZXA 5C6CA 1UY2A 3CO2A 2WS93 3NMBA 5JAXA 5FZGA 1N47A 4ZXKA 3RZMA 4NAMA 1QHDA 3LFIA 2YG0A 5A3NA 3F95A 1O5LA 1OBNA 4AL9A 3SXWA 1W2TA 3LDKA 5DPNA 1W8HA 4IW3A 4CUAA 2NP0A 3W21A 1AR63 5T50A 4I01A 3SH3A 4FP3A 1J3RA 1GMMA 1VALA 3TN91 1NCRB 4ZZ8A 2JDMA 1VB2A 2ZKLA 1RUNA 5C8WA 4NMIA 1JYIA 1ZNPA 2VG9A 5BNNA 2PA7A 4YZ2A 1CIWA 3ZYHA 1H2NA 1HRI3 2ETEA 1V6LA 1KDKA 1QNWA 4F3JA 4CDWB 4UWDA 1QJY3 4LMFA 1MR5A 1CZSA 3AMQA 5BV6A 5C4WC 5J1XA 3WP4A 1AR62 1RUD1 4IEUA 1UIKA 4BMEA 5A3TA 3AZYA 1VRH2 1PO13 4DOUA 2E7TA 1VR3A 4ORFA 2MHFA 2XH6A 4MH0E 4MZUA 2VMHA 3QBQA 1R092 1XSRA 4IEVA 3LDRA 1UKGA 5F5IA 2FDKA 3C2UA 5IW0A 2R071 3FLTA 5J36A 1QY4A 2VOWA 3HPNA 1XOYA 3N7MA 5DAVA 3VHPA 4AG4A 2ZX3A 1NCQB 2RR12 4I09A 3LOBA 2GU9A 3KVAA 4QU1A 1W9TA 2XJRA 5FQ0A 3JB4C 3HWJA 1DBNA 5KHHA 5C3SA 3N9LA 1ULOA 1S0FA 1F5FA 1YQ5A 2PHTA 4QKDA 5LCWL 3FWEA 4AW7A 1H8TA 2P6CA 3D5OA 1IS3A 3R05A 4CCCA 5ACA1 4LOTA 2BQPA 1QIQA 5G05L 3DXTA 4LBQB 3WUDA 4JZRA 4Z2AA 2RR13 2WWJA 1JTZX 4QHBA 1O3SA 1OMIA 2FCUA 3N7JA 4NWWA 2YC2A 4RQPC 4M3CE 5CB7A 3NAPC 4AF9A 2VBPA 1WGPA 1QXRA 1WLTA 2HH9A 3ORJA 2PLV3 4QHOA 3VUOA 2HWF1 2QFEA 2NYYA 3A0NA 4O7XA 2SBAA 3ES1A 5FYCA 2QVSB 1VBC1 4CDQB 1RUJ1 2CGPA 2ZKNA 1MZ5A 1LENA 1OC1A 1DQ1A 1LR5A 2DVGA 4P08A 4PQ9A 4Y1YA 2VNRA 3NJYA 4UFIA 2P3JA 1K5MB 2XVKA 2VUJA 5LATA 2GH8A 4COUA 3MBWA 2HBUA 4A7KA 3A4UA 1RXFA 1RVF2 5K4LA 4BOWA 1ZREA 2A6XA 2BNOA 3JCIA 4XF4A 4YW5A 3I2OA 1W8FA 5DXDA 2DBNA 2F17A 3OTFA 1I9RA 4CU8A 5JSPA 4BLJA 1NY72 1XNKA 1EYBA 2ZXQA 2W92A 3WLUA 3GBWA 1BCXA 3KCCA 5FMCA 3H8OA 3BGAA 3CDZB 4ES8A 5BNPA 2RDSA 4IE6A 2HWD2 1V9U1 3LD8A 5A7SA 2BYVE 1SCSA 1O8SA 1LOFC 1W9SA 5FUNA 3GZTB 1UF2C 3NWKA 1WCKA 5IJRA 2WRAA 5LY2A 3GZUC 2GMPA 1Z0HA 1LU1A 3VBRC 4E9KA 1MEC3 3ETQA 4WBBA 2J1TA 3KT4A 5FYYA 1LGNA 3X29B 4E4DX 2ARBA 4ET7A 2AYHA 2C0ZA 1R1A3 5IVBA 1B09A 1RJ8A 3GYDA 3U07A 4AE2A 3RGBA 5GKAC 4AK3A 1CAXB 3VN4A 4R4XA 1SQ4A 1O8PA 5CFCB 5I0DA 1QQP2 2GALA 4N43C 2DBIA 1TNFA 4DQAA 1GKBA 1CAXA 1HQNA 3VGIA 3ZKYA 4YSFA 4AHYA 2GP5A 2IXJA 5H9QA 1XPWA 3VKLA 4FPGA 3TN93 1FOD1 5DDJ1 4QB1A 4WZFA 1QNYA 4C8DA 4JRAA 4AEDA 2PAEA 4BM8A 3ASIA 4QXBA 4BISA 1Y9GA 3VKOA 4LORA 4AEDB 1ZZ6A 1H6YA 2WNEA 1VBB2 4LO4B 2RHPA 4Y3OA 3OBRA 2FDFA 1A3KA 4HT1T 2Y6FA 4JDNA 1NZCA 4BJ0A 3WT3A 1MEC2 4W65A 3SH5A 1VBD2 1RJ7A 3FBMA 2WZ8A 5LA1A 1W6OA 1ZRDA 1EV11 3CIHA 4QU2A 4UFHA 2RR11 2QQKA 3BPZA 4CUGA 1GOGA 3DKWA 3GXUA 2X05A 3ZKUA 4CCNA 3TNQA 5FP8A 4LBLA 3PVNA 2GZWA 1RUH2 3H7YA 1Q8OA 1QEXA 4RQPB 3OJBA 2ENRA 3ACFA 3ZXJA 4YNIA 1H6XA 2ZX2A 4J25A 2RMU3 3J7MA 1W04A 1PM7A 2CU5A 1JHJA 3RS6A 5FZ8A 3LA2A 3OGSA 1AXZA 1ZZBA 2D5FA 2VZ3A 2O8QA 4X6QB 5I0UA 2D43A 4DEQA 2VE1A 4RHV3 4COVA 4HXCA 1YHFA 5DZFA 2YGLA 1OXCA 1VB4A 3WG3A 2YFZA 3E6BA 3IPVB 3WG2A 2NZ9A 1NCQC 5JCTA 3DYOA 2CAVA 3OPWA 2WFF2 1DGRN 5C4WB 4E2QA 2C1FA 3EYPA 4FO9A 4CDWC 4CXWA 3JBG3 5CADA 4NIHA 3MGUA 1FAYA 5F3CA 4MLOA 2EVXA 2PHFA 4XETA 3HBZA 5LBBA 5KBFA 3PHMA 2EIDA 1HJGA 3D4KA 5LWBA 1RTVA 2P3YA 2IC1A 5FREA 1K42A 5JSRA 4K21A 1PK6C 4I3PA 3M2MA 2F4LA 4GH4B 5IUQA 4ZKTB 5ACA3 5I91A 1ZBA2 2JWPA 2X53S 1GWMA 2YY1A 2HKXA 3MI8A 5FZFA 2ZGMA 1HDKA 2E53A 3AKRA 1O3QA 3MPPG 4NIGA 3NJXA 5LBEA 2OKXA 2N7GA 3ZYRA 1PHMA 3JD71 2J1AA 4FPCA 4N9IA 2D6MA 4AQ6A 2VNVA 2ZGQA 4BQ1A 1XNBA 1ASJ1 3FN9A 1CJPA 2CY6A 3S30A 2XPJA 3DCQA 1A6CA 3MUY1 2E26A 5CFDC 3V65A 1UW8A 3AP5A 4HFSA 4X8NA 4A6OA 1CONA 2VMIA 3MIBA 2VU9A 1OVPA 1UYZA 2HBTA 2D98A 4ASMB 1OURA 2XL9A 4S2FA 4D69A 2GC2A 4PI0A 5CFDA 5EHDA 4GMP0 3ZO0B 4D0QA 2G9GA 2VMEA 1CN1A 1S4CA 2RDRA 1TNRA 4FPLA 4YVSA 4BLIA 2NQYA 2YBSA 4XFIA 3SHRA 3ZFGA 2V4VA 5FRAA 5JSOA 2B42B 2Y8KA 4Q0VA 1GP4A 5KC5A 2JE8A 2HWF3 1NA1A 2D93A 3MEPA 2X10A 2I45A 4BU2A 3VBHA 3RSJA 3ZFGC 5CEHA 2ZGNA 4I0BA 1RB8G 3ZIXA 2LALA 1UXZA 2W1QA 3N7LA 3MO4A 1FOD3 2OUJA 5JZGB 3RI8A 5HCBA 5D21A 2Q8OA 4HVQA 4Q0SA 3H8RA 4EZHA 3LB9A 5K0UB 3FHIB 4L99A 1M06G 1TQ5A 4NRQA 2R7EB 3AJZA 1ULEA 5FPLA 4QM8A 1GOFA 4JTNA 3IMMA 5FZOB 3ZFEB 5FPVA 5KHIA 3P3NA 5HI0A 5IYYA 2IVJA 5FZ6A 3WD5A 3Q8FA 1G9AA 3WNMA 4IEZA 1KQRA 2AGSA 4GB31 3LQCA 4PI2A 3WHTA 5C9AA 1QU0A 2B39A 2C24A 3V64A 3ZFFC 2BRTA 4IEYA 5IVEA 5JLVA 4META 2GNMA 3V0BA 5FMOS 1W6QB 2A7AA 4RSUA 1C5IA 1VBD3 4YZ1A 2WIIB 2UYBA 2JDAA 2GC1A 4AEKA 2IFRA 3B5LB 4XE9A 1KGYA 1W2UA 3WF4A 4JGYA 1VBA2 2CWMA 5BUVA 1GUIA 2X5IA 1XBFA 5FY5A 1GZCA 5JI7A 5T5OA 5HPOA 2A6ZA 1RVF3 5LA0A 1DDLA 3KWVA 4O9EA 2RM22 1PO23 2DUPA 4Y26A 3K4DA 4HLTA 3V0AA 1OQ1A 4D7TA 5LEJA 1ZA4A 4EWDA 2JICA 4AAPA 4JKMA 3NNGA 5FZ1A 1ACCA 1ZYBA 2PN5A 5DUUA 2VW1A 3CHXA 1WD4A 3WQBA 3BKZA 2ZGPA 4AHZA 3MW3A 5T54A 4PDWA 4G9SB 2PQQA 2W39A 1L7LA 5C3QA 4FSJA 1UD1A 3WDWA 3CF6E 1Q8PA 3N9PA 3UYJA 1RHI2 1OQEA 4NRPA 4QX0A 2KXLA 1NQJA 5IHRA 4CEYB 4K40A 1EAH3 3TYJA 2VMDA 4BIFA 4CEYA 1Q8SA 3DPRB 3POWA 3T2PA 1U5IA 3L2YA 1Q8VA 1QJX3 3VBSB 1LCLA 4QPIB 3K3OA 2VR4A 4X6RB 2AACA 3D3AA 4CSWA 1CAUB 4GJZA 1ASJ2 5C7GA 4IV1C 2CL2A 1YQ6A 3AVRA 2PLV2 3HBKA 5FCCA 1YC61 2RM23 5DAQA 5ANQA 4MXVA 2HWC1 3MIEA 2D97A 3ZDVA 3AK0A 4IV1B 4Y5TA 1IKPA 1R091 2W5FA 1W99A 5FY0A 1XU1A 1JZ2A 2CGNA 1QJX2 4IGOA 4CP9B 1V0AA 1ODMA 2LTNA 4Q4X2 5A7NA 1RVF1 4DXSA 3WQ1A 3POBA 3I4IA 1D4M1 1H2LA 4Q8KA 1O91A 3I59B 2AR6A 3DV8A 2EIBA 4TXWA 1UAIA 1F4AA 1GNYA 2RE9A 4L0PA 4JKLA 5FZ0A 3KMHA 4XUOA 3LA7A 3WG4A 5FYHA 1N3PA 4DS0A 2HWD1 4MGSA 1F4HA 2OYZA 3UGHA 3DPRA 5LEKA 2WO1A 3B9IA 1RUD3 4MGTA 4N43A 4LO7A 2D3RA 4Q0UA 3UGGA 5F3GA 1OF4A 3B00A 3NAPA 5C70A 3VD7A 4ISQA 1BYHA 1TG7A 2E31A 5DABA 5A6XA 2CWSA 3BTYA 2VQTA 2Q8EA 1MS5A 3TBDA 4L9BA 1X7NA 4FFHA 1TMF3 5AFEA 3OEAA 3VBRA 2J1UA 2O8OA 2XVLA 1TME1 1OHFA 2VCBA 4LE3A 3V56A 4CCOA 4E8CA 4JGZA 2W46A 4ATEA 4KGGA 4H7MA 3ZYPA 3IBMA 4KG0A 3PJQA 3L9JT 4FPEA 2VM9A 4W50A 1W8ZA 1SLLA 4R8HA 5J09A 5DDJ2 4IGPA 5ABJA 2WFPA 1CZTA 2VULA 4XBNA 3L2HA 1PVC2 3WW2A 3IT8A 5F1RA 1SZBA 3ZFEC 3FFZA 1UY0A 4M0HA 1HLCA 1CX4A 1WA6X 2VQUA 1D2QA 2BERA 5JUVA 2UWBA 2IZWA 2MEV3 4NJ4A 2RV9A 3IDBB 2FCTA 3HNYM 3Q8CA 3ZR6A 1FPN1 2O0OA 5F5AA 5JI9A 4AYUA 1N1VA 2TNFA 3VB9A 4EWEA 5IT6A 3I3BA 5JXGA 1WW4A 3USUB 3E97A
chains in the Genus database with same CATH topology
3D0JA 5KXEA 2PHRA 1NYWA 1VBB3 2C9AA 4XMAA 4QQLA 1N1YA 4FTBA 2Q1MA 4AVCA 1S0GA 3RDIA 3AZWA 1HRV2 2WKKA 2R062 1T6GC 4B4RA 2P3IA 3AMMA 1WCDJ 1X8MA 3OY8A 3KGZA 2BFUL 3VBOA 2ZHMA 4OLLA 2WJSA 1QJU3 3MPBA 2CNAA 2IXKA 2K2SA 4QPIC 3AYAA 1MQTA 3VBSC 1SFYA 3VLBB 1QF3A 3MF6A 3NV3A 4LO6B 2A6VA 3LSDA 1AYN3 2H6CA 1CAUA 1CD3G 2WZR2 4K20A 4CDQA 4FSJA 1MZ6A 2FMDA 3AYEA 5FPZA 4BYYA 2XWJB 5F6KA 5FPXA 3JBG1 2WNUA 2DFCA 2EXIA 2GH2A 2A6WA 1W6PB 4W6XA 4XHBA 4LUKA 5A32A 4JTOA 2WS91 1HV0A 4GH4A 1O4ZA 1J59A 3OPZA 1IPKA 2DVBA 2Q1ZB 4E4SA 1YWKA 2DURA 2CAUA 4W6WA 4NHKA 4AVTA 1C8M2 1CPMA 4P14A 4BE3A 4RQPA 4MGKE 4N9HA 4AFCA 3H50A 1PGSA 3UKNA 2BPA2 1HRI1 3WZ1A 1J1TA 5FO8B 4URTA 3ZFFB 5J37A 5H9SA 1TME2 3ZYIB 1W6QA 4N7IA 2A3XA 1AR61 4HVOA 3S7EA 4GALA 4CDUB 4AWDA 4YFZA 3UJOA 4PLNA 3LA3A 4K1ZA 1UPSA 1QQP1 3MLJA 2XLAA 5L7OA 4LBQA 4YG0A 5L19A 3VKNA 5T5PA 2JG9A 1SLCA 1ZX5A 4M3CA 3WNXA 2XBO2 4XIOA 2D6OX 4ASLA 4IEOA 4NN0A 1JUHA 1RUE3 1ZZ7A 5JWPA 1RUE1 4OHVA 2NLRA 2DCKA 2JEMA 1QGLA 1NA1B 1ZBA3 4B7KA 1PO12 4LO8A 3OF1A 4HSLA 2E6VA 3PMEA 2ZOEB 4D7SA 4AEMA 4Q26A 3ZYGA 1XXNA 4D94A 3WDUA 1RUI3 5C9AB 4RD7A 3M70A 3NW4A 4DRVA 4CRQA 2ZS6B 1VBC2 1R1A2 3APBA 3PLQA 2DYCA 2HJIA 4IEWA 3KLSA 2ZGOA 2R1DA 4Y24A 3ZFEA 2XGXA 5JIUA 2DCZA 2JE9A 3RJ2X 1N3OA 1RUJ3 3PVEA 3HIFA 2ZABA 2XB6C 4FP2A 1FATA 1DGLA 1W0OA 4FPYA 4B4PA 4QQOA 1DQ5A 1WLCA 1BMV1 5FOJB 5CNAA 4KWLA 3WVJA 2ZZQA 2P3KA 2DCJA 1LULA 4DNYA 1LOAA 3IDCB 3B94A 5LK5A 5DZEA 3CNAA 4AGVA 4COZA 3BTAA 4QPIA 4I02A 3NVCA 4HKLA 2EA7A 5GLZA 3QH7A 2QUOA 3UK9A 2VNOA 1VBA1 3AZXA 4KG8A 5H9PA 3SNMA 4EWAA 2C5DA 4SLIA 1DGWX 4FOYA 2VQ0A 4UW3A 4Q4Y3 4FQZA 5CVRA 4YVSB 1PMIA 4L11A 1ZBE1 2JD4A 3ZN6B 3QACA 4P9XA 5FAXA 3I7DA 4N53A 4FT8A 1GSLA 1KFUL 4DZGA 4WVZA 1WW7A 3OCPA 3VZLA 1OKQA 4XF0A 3TRSB 1XYOA 2PLV1 2DV9A 4XILA 2PHXA 1YXWA 5J3UA 5I0RA 4XTPA 3AFKA 4OHZA 1I3HA 2Q0AA 2D3SA 5CFCC 5IK7A 1QJU2 3S6PA 1TME3 5BY5A 2ZGKA 4R4ZA 5FFOC 3M3CA 4AI0A 4OULA 1QWRA 2ZPXA 2DFBA 2I74A 2ZAHA 4PIYA 2VY0A 3ATGA 3ZXEA 4BCUA 3IDEA 1CAWB 4L8QA 5T5LA 2PHDA 3TWIA 3ZN6A 2VOXA 2R32A 4L2NA 1COV3 4HMZA 2VPVA 3ENRA 4S2DA 2WLPA 3DGTA 3LKJA 3VBFC 3RMYA 2XJSA 3O12A 1WUVA 3O5SA 4Q4X3 5A3MA 1Z7S2 1ZBA1 2ZX0A 2GC3A 1LOGA 2BWCA 3W58A 3VL8A 2RMU1 2P37A 1POV3 1RC6A 4C1WA 5KWRA 1OPOA 2AH2A 3WQ0A 4CEWC 2B7YA 4R9CA 4C0HA 1YCIA 1AHSA 1GQGA 2JKBA 4GIQA 3RYRA 3VKFC 4A2UA 4DFSA 2BVVA 4FTEA 4CDQC 3AYDA 3WQ7A 3PMSA 3RQ0A 4Z82A 1C57A 1UIJA 3ZXAC 1S0CA 3FC0A 1YI9A 3FBYA 4KBBA 1Q5OA 3ZMNA 5H9RA 1JN2P 1SACA 1FMD3 4F83A 2D3PA 1AR72 2YYOA 4QQHA 1AYN1 5JIAA 1W0PA 5GZCA 2HWC2 3FFQA 4F8AA 3J9SA 4Q4W1 3LOIA 2WS92 1AL22 1XE7A 4RGGA 3EJKA 4JDOA 1QJY1 5CG8A 4QGNA 4ONUA 1QOTA 1Q3EA 4H3WA 1Z78A 1ULGA 5LRRA 4LO5B 1GR3A 3M1HA 1IGOA 2QNKA 3ZX7A 1LJ7A 2AREA 3OBTA 3OYWB 4QT6A 3N35A 4WVMB 3VDDC 3AMNA 4DY3A 4HVRA 4K1YA 4UBGA 2RS11 3H0OA 1OLRA 2ZAAA 3IN9A 1FV2A 2WA4A 4JCKA 4Q4V2 4CDXC 1DGRA 3RYKA 4CYDA 1G9DA 3VDDB 4MVTA 1YJLA 4XBQA 3GHNA 4JVAA 5FO7B 3JBG2 4GMP3 4CDWA 3O14A 2E7AA 1RUOA 4MGIE 2RS31 1G9CA 1ZVFA 3TAYA 3WHUA 1AVBA 3O7OA 1K5MA 3OGJA 4YW2A 1EAH2 1OPMA 1RGSA 1YFXA 3U11A 5SV8A 1AX2A 4PCRA 2GNDA 4K7JA 3PVBB 3JQWA 3HAGA 4JQRA 4OUSA 1F8VA 5CG9A 2Z2SB 4AGGA 2ZACA 4PLMA 3ZFGB 1Z7S1 4MSVA 3ROUA 1W6MA 3CJIB 4QGLA 2RS33 4Y22A 1SBFA 1HXS3 1SLAA 1DYKA 4M00A 1W6MB 1NLSA 2DF7A 5T5JA 5T52A 3P3PA 2RS51 1UU6A 2Q4SA 2I2SA 1AJOA 3JU9A 1PVXA 1SFNA 5J98B 3KSCA 2WC2A 4P9YA 2RJKA 1KDMA 3FE5A 4IEXA 2OZ6A 4LLOA 1WW6A 5L7OC 1QKQA 1KFXL 4XF3A 4C90A 3VZKA 5E88A 4Q27A 4CP2A 5JOYA 1S1AA 4IETA 3EHKA 1BEV1 2YV8A 1QJX1 4LLFA 2GC0A 4GULA 4LA3A 4TLFA 3SISA 1AR81 3THPA 1O3TA 3JQXA 4AEJA 2EXJA 3VBFB 1IS6A 3CLPA 3VZJA 1R093 3B7MA 1GBGA 2ZJCA 1JYCA 2XUMA 4JAAA 2HWE3 2WZR1 1JXNA 1RUF2 1R083 2QJVA 1PK6B 5F6LB 4XXAA 5BNQA 4U36A 4Y1ZA 3WX5A 1CJDA 3H1WA 2XWBB 4FXGB 1QDCA 4WVWA 4SBVA 1IS4A 4CDXA 1NE4A 3B01A 3URFA 2P17A 3WXPA 3QOPA 5GALA 1WBLA 1GZWA 2MPFA 1AJKA 4YZ5A 2UWCA 1PIV3 1O4YA 2BTVC 3OYWA 4S2HA 2A5ZA 3BALA 3UV9A 1FXZA 1URXA 4ES9A 4Q4W3 4B4QA 4PIZA 3ILNA 2Y26A 3HR9A 4IL7A 1AR73 4PLOA 4WM7A 4Z8BA 3INAA 1AZDA 4R9BA 2RS13 4K8FA 1SDWA 4UW5A 3SCGA 3KCYA 3VZOA 4HPKB 4XJUA 3H8UA 1A8DA 1BBT1 2OIIA 2Z79A 1ZRFA 1H1IA 3WP5A 3ZXDA 1V6NA 1YFUA 4YVSC 3AJYA 1D4M3 1QDOA 3MIHA 1LRHA 3H9AA 1RUC3 4AVSA 1YO8A 4MV2A 4AFAA 4V1PA 2BBVA 3SCFA 2A70A 1LB2A 1RMU2 1YI7A 3O0XA 4RHV2 1YIFA 4OHXA 4D7YA 4YW3A 1LODA 1V9U2 4IV1A 4IEPA 4FXKB 3WW4A 5CFCA 1YFYA 1W6NB 1XNDA 2YPJA 4CEYC 1HV1A 4C0BA 3U0ZA 4N43B 1RMU3 2EF6A 2QKDA 1W6PA 2DVFA 1CAVB 1RUC1 4AVVA 2YMZA 4I0AA 1AR93 1PGL2 1R082 2EAKA 4HETA 5LK7B 1W6OB 3WP3A 2XVGA 2H6BA 2WT1A 1JOJA 3VBRB 2R0FA 4N90A 5IK8A 2VW2A 5E8AA 1SLBA 2K0GA 4OI0A 1FNZA 1KJLA 2ZBJA 4KWJA 3S7IA 5FDBA 5EXOA 1GNHA 4Q4Y2 3EO6A 2BWAA 4UXAA 2ZHLA 4EN9B 5ACA2 1J3PA 5J96B 3MIFA 2WA3A 1MEC1 1ZRRA 2R49A 1VBD1 2BNMA 2JXAA 2HWB1 3AZVA 3CL1A 1VIWB 2VW0A 3AP4A 5C9AC 1NQDA 2X8KA 3Q9OA 1ENSA 2BGCA 4P9WA 5K9YA 4LEJA 4O9GA 2PELA 4YM0A 2DU1A 5DDJ3 1LOCA 5D8AB 4XOGA 3GHMA 1RUJ2 3ST7A 3KQRA 1REEA 1CPNA 1F5JA 1AXYA 1FPN3 1X50A 3AMHA 4YGDA 2JE7A 2E9QA 1OOPB 3TOJA 1VRH1 2VOKA 2YROA 2D40A 1IHMA 2AUYA 4TSVA 4E2GA 2TBVA 1Y9QA 1V6KA 1AL23 1AF9A 3MFCA 4N53C 2IXIA 4XEZA 1I6XA 1PZ9A 3THTA 4HBNA 2A75A 1OI6A 2W68A 5C8CA 2XKOA 4NWVA 1M4WA 2JG8A 4YYOA 4E2SA 4QPGB 4XFGA 3JD73 4Y20A 3MFAA 5J48A 4HANA 4Q0PA 2HWB3 5LRSA 3VBUC 3D0SA 3U4XA 1YJKA 3R4DB 5CFDB 3AXDA 4A7YA 3R0RA 2NN8A 1DQ0A 1B35B 3JD72 2P34A 5C8CC 4XTMA 4XMIA 3FUOA 4JV4A 1FX5A 2ZHNA 4Q4X1 1HQLA 3WDVA 1POV0 2FZ1A 5KHGA 2WLQA 4G3YC 2HEVF 2ZGLA 5C8CB 2D7FA 1EAH1 1NCRC 4GH4C 1NG0A 4R9AA 2R30A 1WLWA 3S0MA 5FBZA 2ZA9A 2R043 3AKTA 4R9DA 2EXKA 5K7PA 1IZ3A 1TMF2 1EV12 3RG0A 1DQ2A 1RUI2 1ZZ9A 4P9JA 1AXKA 2R1BA 4YM2A 2Y38A 1H4GA 2CYFA 1XU2A 2YC0A 4BA6A 4P9IA 4QPGC 5A33B 1B35C 2JX9A 2WNVC 1B35A 3M4FA 1XQNA 1RUG3 2K9ZA 1VBC3 2VQAA 5D8AA 2QZ2A 2OA2A 1KS4A 1RUD2 4IV3A 4MGZE 1PNFA 2V73A 4NOTA 2Q30A 4BIOA 4GKXA 3ZSJA 3KT1A 1APNA 2SLIA 1PVC1 3B3QE 3WDXA 2ZGRA 4Q0QA 5KXDA 3WG1A 2XJQA 1LTEA 4LBNA 1AR82 4N53B 4QXKA 4Y1VA 2QQPA 1DG6A 3UKVA 3JZVA 1LOEA 1ZBE3 1H0BA 5DUVA 2XL7A 3C3VA 4EJRA 4KH9A 1UN1A 1ND2B 4FOQA 2BEOA 1ND3C 3DN7A 1H8TC 5BXXA 5FLJA 1AR91 5A3LA 3GNEA 1VBE3 2W52A 5GM0A 4ZU5A 4IV3B 2BNNA 4PF5A 4KU8A 3ZSEA 5AC93 2RJLA 3NKGA 2XJVA 1TE1B 2FZ2A 4I3GA 3UJQA 3KGLA 5AFBA 4NR1A 4PDWB 4Y4YA 1AL21 1LU2A 1V9U3 4QX5A 4CP1A 2Y0OA 5KHKA 3UKTA 2R0HA 4G4FA 2O1QA 2W0XA 4LBMA 3LSEA 4COWA 1ZM1A 1G9FA 5KXCA 2QDRA 4YZ3A 4LHLA 1BKZA 2GN3A 4GWNA 3VHNA 1G6NA 1H4HA 2G4IA 1BEV2 4IERA 4Q8LA 1XYPA 4LR4A 3TNPB 2GN7A 1HRV3 3ILFA 3OY8B 4YM3A 5JMCA 5C4WA 1YUDA 5GZGA 2B46X 2BVBA 2NPIA 4NO4A 5EV7A 1EV13 3VKMA 3B02A 1I5ZA 2FHRA 1NE6A 4YG3A 2RS12 2XHKA 1UZYA 2XJTA 4FOVA 3J26N 3AP9A 3B93A 1JBCA 5FTTC 1O3RA 1RUG1 2MEV2 4XW3A 2EXHA 2GMMA 2JENA 2XJUA 3R6SA 4B7EA 4I30A 4IQPA 1RUI1 2RMU2 2BFUS 1BVP1 3R4SA 1AYM1 3VZNA 3EXUA 3N7KA 2E63A 1HRI2 3FJSA 4DB5A 2CGOA 2YDEA 2BUKA 1SBDA 2V09A 3NAPB 1DF0A 1BZWA 5GLVA 1BJQA 3KD4A 2DWRA 3TN92 1A78A 1RUF3 3MYXA 4QD2A 5DUXA 1FV3A 1IPJA 2OW4A 4DRRA 1F2NA 3I59A 1PGL1 4YW4A 1R081 3EQEA 1C3HA 1HXS1 3VZMA 4X8PA 2G9FA 1AR71 4QPYA 1I1EA 4WM7B 5GLUA 2MNGA 2ZTNA 4Q4W2 1F31A 1RUH3 3E5XA 1JHNA 2ET1A 1LOBA 4GQ7A 4AI2A 1DZRA 4P9GA 1EP0A 1RL3A 5BNOA 4RHV1 5EJ3A 4QGMA 4NPRA 1BEV3 2ZGTA 3MIGA 4XFAA 3AKPA 5TSWA 1J3QA 5GLTA 3VBOB 1O4TA 1QOOA 1W39A 3K51A 4DINB 3ZN4A 1H9PA 4EN7B 1VAMA 4YGBA 2PYTA 1IQAA 1FI2A 2XJPA 2Z5WA 2HYKA 1LHWA 2WSVA 4FOWA 4Q2FA 1QH6A 4YFWA 3AKQA 5EYXA 4HN0A 2OZJA 3ZXLA 1RHI3 3CU7A 2HWF2 1JUIA 2GNBA 2XKPA 1ND3A 1CAVA 1GZ9A 5FLIA 1S0BA 3USUA 3H3UA 1G9BA 2A6YA 4RR3A 4YG6A 2UWAA 2ZGSA 2W08A 3MLLA 4M3CB 1YFWA 1SCRA 2V5YA 3V0BB 2YHJA 3IM0A 4IEQA 1MS9A 1ALYA 2DUOA 4FPOB 5GZEA 3ZIWA 1MS3A 1AYM3 1GNZA 1SLIA 5L7OB 1PO21 2PHWA 1H30A 4GWMA 2F6BA 1VLNA 4YGEA 1DZTA 5ABJB 5K8SA 3QD6A 4J6GA 4S2GA 4Z1VA 1RINA 1BBT2 4B3NA 4H14A 4XJZA 5BNOC 4OFGA 2IFWA 1AYM2 3IWZA 1VBE1 5K0UA 3VL9A 1LGBA 3CJIC 3ZSLA 3AYCA 4XHXA 3BODA 4YGCA 5T3NA 4OHWA 3RPQA 4HL0A 3WW1A 3OD4A 4XJWA 1MQTC 3DPRC 3VBSA 2R063 4K6BA 2OUHA 1S0DA 1KRIA 3W9AA 3JB8A 4HKWA 1XRUA 1X82A 3LCPA 4BHPA 2HWC3 1N1TA 1U0AA 2TUNA 1YNAA 4OHYA 1C1FA 3IMNA 1NOVA 1SMVA 1VRH3 3VBUA 1FOD2 5C33A 3J8F1 2WFF3 1BK1A 4AXOA 4OI4A 1NCRA 1KJRA 2ZGUA 5HBAA 1FT9A 1NXD1 1OA2A 4CP0A 2PAMA 1Y43B 3MZHA 3M3EA 5CBLA 4CDXB 4Q4V3 4INDA 4KNCA 4BMBA 3E5QA 3T1MA 3I8TA 5FMOL 1NCQA 4OUMA 4WM7C 3H7JA 2JECA 2D44A 1GANA 2QDNA 3M3QA 3AMPA 3ZSMA 3PJYA 1RUH1 4AHXA 2DVDA 1S0JA 1C5HA 1QJU1 3BCWA 4GMP1 3BIWE 1WLDA 1ENXA 1HIXA 4XQDA 2D6KA 3LWCA 5CU1A 2RS53 3GZAA 5D1IA 3ZYJB 2RM21 4Z92B 5EWSA 2PHLA 4NHLA 1YRZA 3GBGA 4K9SA 4WVMA 3IKWA 3LGRA 1GYKA 1U5YA 1U12A 3ZXFA 1OSGA 5DG2A 1JH5A 1X36A 2YXSA 5I0TA 4KWKA 4XBLA 1AR92 1ZZ8A 1FPN2 2VXRA 3EBRA 4XIKA 1GICA 2VMGA 3E6DA 4AEDC 2X5IB 3ILRA 4GXLA 2R042 2TEPA 1FNYA 1MS8A 5J7MA 4UW6A 3NJZA 1PVC3 4FTSA 4RR3C 5JZGA 2NMNA 3GALA 5JDBA 4L92A 2XLFA 4Y1UA 4JRLA 1DQ4A 1FMD1 2WWSA 4BWOA 1VAVA 3HN1A 1H2MA 1C8NA 2WSUA 4CEWB 4FPFA 4EV0A 5KHJA 4XF9A 3H1YA 4AI1A 3HMYA 2LM3A 4OZXA 3KCXA 1D4M2 1O7FA 5EFUA 5AVAA 3T2TA 3AFGA 1LOFA 4FCAA 4HKOA 4BZ4A 5BNPB 3J8F3 4EN6B 1LEMA 2EALA 4J1WA 3RNSA 3ZVXA 1MS0A 1LHUA 5FLHA 3A0KA 3VBOC 3RMXA 3ECQA 5FO9B 3BOWA 3NV1A 4RFT0 1GQHA 1LESA 3E5UA 3FZ3A 1RITA 2JG9C 3KZ4C 3VBHB 3N4MA 5HXVA 4IV3C 3DUIA 3LAGA 3ZN5A 2MEV1 1YLLA 3USSA 2ES3A 1H1MA 1Q56A 2B45X 2XBO1 1UU5A 4QQPA 4I2OA 3ES4A 1S2KA 5EZWA 4L97A 1K5MC 1CQ9A 5A32B 2NMOA 2A3WA 4LA2A 4C91A 1A8MA 1DLLA 4YLZA 2B5HA 1Q43A 1G86A 2D5HA 1MVEA 5E89A 4B8EA 4JGZB 4Z07A 5HCFA 1MVQA 1N3QA 2QCSB 5EYYA 2GAUA 2ZMLA 3WDTA 1O5UA 3FLPA 4LHNA 3RI9A 2Z69A 1S0IA 5GLWA 2LUWA 1R1A1 4WZCA 2GNTA 1ULCA 5DZGA 2IXCA 5GZFA 1SLTA 5AC91 3IIAA 4NHMA 5GJ6A 3BB6A 4FPJA 3IPVA 4JGZC 4M0NA 3E6CC 1RUG2 2WINB 4BPZA 3ZXGA 5BPXA 2AZ5A 1KS5A 3WV6A 1DU3D 1KXGA 3NV2A 3PNAA 1WBFA 2HWE2 4WVVA 5JOZA 2A73B 1UCXA 2ZZJA 1PZ7A 1HRV1 1LHVA 2F4PA 2FBEA 3ME2A 3WUCA 2HEWF 1H2KA 2E7QA 3AZZA 3DF0A 5KXBA 2RS52 4CZSA 4XXPA 4Y5Z0 2JG9B 2R041 3FUQA 3KT7A 3VBHC 4B29A 3GBFA 1XNCA 2Y0IA 4DMIA 1AR83 4H55A 4JDMA 4Q1PA 1R1ZA 3AX4A 2EIGA 4QMAA 2VECA 4YRDA 4AI8A 3HT1A 3UL2A 2DCYA 2R16A 1RIRA 1Y3TA 3AXEA 1QXJA 1L3JA 2R072 4AGRA 5AVPA 4WM8B 2VGDA 3VV1A 1V6OA 1XYNA 5E1RA 1UPIA 3SH4A 1ULFA 2DUQA 4XJAA 2VH9A 4OI2A 3D6EA 2D6LX 4KGQA 4PDWC 1Y7BA 3QCWA 2DU0A 1MS1A 1Q8QA 3VBUB 4QM9A 4ISRA 2JG8B 4DXZA 4RR3B 4KU7A 1QQP3 4MXWA 1BXHA 3MW2A 1RUF1 4FAGA 1PO22 1IKQA 1V6IA 1