1R084

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1r08400
1HXS4 1D4M4 1H8TD 1OOPD 1AR74 1AR84 1NCQD 1AR94 4GB34 1PO24 1RUJ4 2RS54 1VBD4 4Q4V4 4Q4Y4 1PO14 2HWC4 1RUH4 1Z7S4 1RUC4 3JD74 1R084 1EAH4 2HWB4 1RUF4 2R044 2R064 2PLV4 1POV0 1VBA4 1HRV4 1RUD4 1VBE4 1RHI4 2RMU4 1RUI4 2RR14 1HRI4 1R094 4PDWD 1AR64 1VBB4 2RS14 2RM24 1BEV4 2R074 1NA1D 2RS34 1MQTD 1AL24 1EV14 4RHV4 1COV4 1RUE4 1RMU4 1PIV4 1VRH4 1RVF4 3JBG4 1K5MD 1PVC4 3J8F4 4Q4X4 4Q4W4 1VBC4 1RUG4 2X5ID 1ASJ4
chains in the Genus database with same CATH superfamily
1HXS4 1ZOYA 1H8TD 1RUJ4 1Z7S4 3P4QA 4YT0A 1R084 2HWB4 2R7FA 3P4PA 2R064 4YTPA 1VBA4 4YSZA 2B76A 3ABVA 1R094 4PDWD 1KFYA 1AR64 4YSYA 1BEV4 1ZP0A 1MQTD 2WP9A 1EV14 4RHV4 2H89A 1RMU4 2WU2A 3J8F4 2WU5A 4Q4V4 5C3JA 1ASJ4 3AE3A 3AE4A 2PZSA 3AE5A 1AR94 2WS3A 3AE9A 2ACZA 1VBD4 2WDQA 2HWC4 3VRAA 2EX3A 3SFDA 2R044 3AEBA 1HRV4 1VBE4 1RHI4 3AEDA 3AE7A 3AECA 1COV4 3GQHA 1PIV4 1RVF4 2FBWA 4Q4W4 2PYJA 5C2TA 1NCQD 1AR84 3AE6A 4KX6A 2RS54 1NEKA 4YTMA 3SUCA 3FI7A 3AEFA 1PO14 3VR9A 1RUH4 1XI1A 1RUC4 3JD74 1XHZA 3AE2A 2PYLA 1RUF4 2PW9A 3AEEA 3AEAA 1RUD4 3P4SA 4YSXA 2H88A 4YTNA 1VBB4 2RM24 2R074 2WDVA 1NA1D 3CIRA 3SFEA 1YQ4A 1K5MD 2PLV4 1VBC4 1D4M4 1OOPD 1AR74 3AE1A 4GB34 4YXDA 1PO24 1KF6A 4Q4Y4 1NENA 2WQYA 1XHXA 3P4RA 1L0VA 1EAH4 3AEGA 1POV0 2PY5A 2WDRA 2RMU4 1RUI4 2RR14 1HRI4 1YQ3A 2RS14 3VR8A 2RS34 1AL24 3VRBA 3AE8A 1RUE4 1VRH4 3GQKA 3JBG4 1PVC4 4Q4X4 1RUG4 2X5ID
chains in the Genus database with same CATH topology
1HXS4 1D4M4 1H8TD 1OOPD 1AR74 1AR84 1NCQD 1AR94 4GB34 1PO24 1RUJ4 2RS54 1VBD4 4Q4V4 4Q4Y4 1PO14 2HWC4 1RUH4 1Z7S4 1RUC4 3JD74 1R084 1EAH4 2HWB4 1RUF4 2R044 2R064 2PLV4 1POV0 1VBA4 1HRV4 1RUD4 1VBE4 1RHI4 2RMU4 1RUI4 2RR14 1HRI4 1R094 4PDWD 1AR64 1VBB4 2RS14 2RM24 1BEV4 2R074 1NA1D 2RS34 1MQTD 1AL24 1EV14 4RHV4 1COV4 1RUE4 1RMU4 1PIV4 1VRH4 1RVF4 3JBG4 1K5MD 1PVC4 3J8F4 4Q4X4 4Q4W4 1VBC4 1RUG4 2X5ID 1ASJ4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXS 4;  1D4M 4;  1H8T D;  1OOP D;  1AR7 4;  1AR8 4;  1NCQ D;  1AR9 4;  4GB3 4;  1PO2 4;  1RUJ 4;  2RS5 4;  1VBD 4;  4Q4V 4;  4Q4Y 4;  1PO1 4;  2HWC 4;  1RUH 4;  1Z7S 4;  1RUC 4;  3JD7 4;  1R08 4;  1EAH 4;  2HWB 4;  1RUF 4;  2R04 4;  2R06 4;  2PLV 4;  1POV 0;  1VBA 4;  1HRV 4;  1RUD 4;  1VBE 4;  1RHI 4;  2RMU 4;  1RUI 4;  2RR1 4;  1HRI 4;  1R09 4;  4PDW D;  1AR6 4;  1VBB 4;  2RS1 4;  2RM2 4;  1BEV 4;  2R07 4;  1NA1 D;  2RS3 4;  1MQT D;  1AL2 4;  1EV1 4;  4RHV 4;  1COV 4;  1RUE 4;  1RMU 4;  1PIV 4;  1VRH 4;  1RVF 4;  3JBG 4;  1K5M D;  1PVC 4;  3J8F 4;  4Q4X 4;  4Q4W 4;  1VBC 4;  1RUG 4;  2X5I D;  1ASJ 4; 
#chains in the Genus database with same CATH topology
 1HXS 4;  1ZOY A;  1H8T D;  1RUJ 4;  1Z7S 4;  3P4Q A;  4YT0 A;  1R08 4;  2HWB 4;  2R7F A;  3P4P A;  2R06 4;  4YTP A;  1VBA 4;  4YSZ A;  2B76 A;  3ABV A;  1R09 4;  4PDW D;  1KFY A;  1AR6 4;  4YSY A;  1BEV 4;  1ZP0 A;  1MQT D;  2WP9 A;  1EV1 4;  4RHV 4;  2H89 A;  1RMU 4;  2WU2 A;  3J8F 4;  2WU5 A;  4Q4V 4;  5C3J A;  1ASJ 4;  3AE3 A;  3AE4 A;  2PZS A;  3AE5 A;  1AR9 4;  2WS3 A;  3AE9 A;  2ACZ A;  1VBD 4;  2WDQ A;  2HWC 4;  3VRA A;  2EX3 A;  3SFD A;  2R04 4;  3AEB A;  1HRV 4;  1VBE 4;  1RHI 4;  3AED A;  3AE7 A;  3AEC A;  1COV 4;  3GQH A;  1PIV 4;  1RVF 4;  2FBW A;  4Q4W 4;  2PYJ A;  5C2T A;  1NCQ D;  1AR8 4;  3AE6 A;  4KX6 A;  2RS5 4;  1NEK A;  4YTM A;  3SUC A;  3FI7 A;  3AEF A;  1PO1 4;  3VR9 A;  1RUH 4;  1XI1 A;  1RUC 4;  3JD7 4;  1XHZ A;  3AE2 A;  2PYL A;  1RUF 4;  2PW9 A;  3AEE A;  3AEA A;  1RUD 4;  3P4S A;  4YSX A;  2H88 A;  4YTN A;  1VBB 4;  2RM2 4;  2R07 4;  2WDV A;  1NA1 D;  3CIR A;  3SFE A;  1YQ4 A;  1K5M D;  2PLV 4;  1VBC 4;  1D4M 4;  1OOP D;  1AR7 4;  3AE1 A;  4GB3 4;  4YXD A;  1PO2 4;  1KF6 A;  4Q4Y 4;  1NEN A;  2WQY A;  1XHX A;  3P4R A;  1L0V A;  1EAH 4;  3AEG A;  1POV 0;  2PY5 A;  2WDR A;  2RMU 4;  1RUI 4;  2RR1 4;  1HRI 4;  1YQ3 A;  2RS1 4;  3VR8 A;  2RS3 4;  1AL2 4;  3VRB A;  3AE8 A;  1RUE 4;  1VRH 4;  3GQK A;  3JBG 4;  1PVC 4;  4Q4X 4;  1RUG 4;  2X5I D; 
#chains in the Genus database with same CATH homology
 1HXS 4;  1D4M 4;  1H8T D;  1OOP D;  1AR7 4;  1AR8 4;  1NCQ D;  1AR9 4;  4GB3 4;  1PO2 4;  1RUJ 4;  2RS5 4;  1VBD 4;  4Q4V 4;  4Q4Y 4;  1PO1 4;  2HWC 4;  1RUH 4;  1Z7S 4;  1RUC 4;  3JD7 4;  1R08 4;  1EAH 4;  2HWB 4;  1RUF 4;  2R04 4;  2R06 4;  2PLV 4;  1POV 0;  1VBA 4;  1HRV 4;  1RUD 4;  1VBE 4;  1RHI 4;  2RMU 4;  1RUI 4;  2RR1 4;  1HRI 4;  1R09 4;  4PDW D;  1AR6 4;  1VBB 4;  2RS1 4;  2RM2 4;  1BEV 4;  2R07 4;  1NA1 D;  2RS3 4;  1MQT D;  1AL2 4;  1EV1 4;  4RHV 4;  1COV 4;  1RUE 4;  1RMU 4;  1PIV 4;  1VRH 4;  1RVF 4;  3JBG 4;  1K5M D;  1PVC 4;  3J8F 4;  4Q4X 4;  4Q4W 4;  1VBC 4;  1RUG 4;  2X5I D;  1ASJ 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...