1R084

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1r08400
4RHV4 2R074 1RUG4 1RUE4 2HWC4 2RS34 1NCQD 1EAH4 2RR14 3J8F4 4GB34 1RVF4 1HRV4 1VBA4 1POV0 1R084 1AL24 2RMU4 1COV4 3JD74 4Q4V4 4Q4Y4 3JBG4 2R064 4Q4X4 1RUH4 1RUC4 1R094 1VBE4 1AR74 2RS14 1K5MD 1VBB4 1HXS4 1OOPD 4Q4W4 1PVC4 1ASJ4 1PO24 1RMU4 1RUJ4 1VBD4 2HWB4 2X5ID 4PDWD 1HRI4 2RS54 1EV14 1AR84 1Z7S4 1PIV4 1RHI4 1H8TD 1MQTD 1RUI4 1BEV4 1D4M4 1RUF4 1VRH4 1AR64 2R044 1NA1D 1AR94 1VBC4 2RM24 1PO14 2PLV4 1RUD4
chains in the Genus database with same CATH superfamily
3ABVA 3VRAA 3AEDA 1NCQD 3AEEA 1ZOYA 3AE1A 2WDVA 1RVF4 1HRV4 1POV0 2ACZA 2WDRA 4Q4Y4 3AE6A 2R064 2R7FA 3AE2A 4RHV4 4Q4W4 1PO24 2HWB4 3AEGA 3AE4A 3GQKA 3AE5A 3AECA 1NEKA 4YXDA 3AEBA 1MQTD 2R044 3P4QA 2RM24 3P4RA 2PLV4 1VRH4 1RUD4 5C3JA 1KFYA 2WDQA 1RUG4 1RUE4 2B76A 1EAH4 3AE7A 2H89A 3GQHA 2FBWA 2RMU4 1YQ4A 3JBG4 4Q4X4 3AE8A 1RUC4 1AR74 2EX3A 2RS14 1K5MD 2WS3A 1PVC4 1ASJ4 1RMU4 2X5ID 1HRI4 3AE9A 1Z7S4 3VR9A 4YT0A 4Q4V4 1RUI4 1XI1A 3VR8A 1RUF4 1XHZA 1AR94 1VBC4 2PYJA 3J8F4 2R074 3AE3A 2RS34 2RR14 3AEFA 2WQYA 4YSZA 3P4PA 2PW9A 1R094 4KX6A 2PZSA 3FI7A 1RUJ4 1VBD4 1KF6A 4YTNA 1EV14 3P4SA 1RHI4 1H8TD 4YTMA 1BEV4 1D4M4 1PO14 3CIRA 5C2TA 2WU5A 2H88A 2HWC4 1YQ3A 1L0VA 4YTPA 4GB34 2PYLA 1VBA4 1R084 1AL24 3JD74 1COV4 1ZP0A 1RUH4 3SFDA 2WP9A 1VBE4 1VBB4 3SFEA 1HXS4 1OOPD 2WU2A 4YSYA 4PDWD 2RS54 2PY5A 3AEAA 1AR84 1XHXA 1PIV4 3VRBA 1AR64 1NA1D 1NENA 3SUCA 4YSXA
chains in the Genus database with same CATH topology
4RHV4 2R074 1RUG4 1RUE4 2HWC4 2RS34 1NCQD 1EAH4 2RR14 3J8F4 4GB34 1RVF4 1HRV4 1VBA4 1POV0 1R084 1AL24 2RMU4 1COV4 3JD74 4Q4V4 4Q4Y4 3JBG4 2R064 4Q4X4 1RUH4 1RUC4 1R094 1VBE4 1AR74 2RS14 1K5MD 1VBB4 1HXS4 1OOPD 4Q4W4 1PVC4 1ASJ4 1PO24 1RMU4 1RUJ4 1VBD4 2HWB4 2X5ID 4PDWD 1HRI4 2RS54 1EV14 1AR84 1Z7S4 1PIV4 1RHI4 1H8TD 1MQTD 1RUI4 1BEV4 1D4M4 1RUF4 1VRH4 1AR64 2R044 1NA1D 1AR94 1VBC4 2RM24 1PO14 2PLV4 1RUD4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RHV 4;  2R07 4;  1RUG 4;  1RUE 4;  2HWC 4;  2RS3 4;  1NCQ D;  1EAH 4;  2RR1 4;  3J8F 4;  4GB3 4;  1RVF 4;  1HRV 4;  1VBA 4;  1POV 0;  1R08 4;  1AL2 4;  2RMU 4;  1COV 4;  3JD7 4;  4Q4V 4;  4Q4Y 4;  3JBG 4;  2R06 4;  4Q4X 4;  1RUH 4;  1RUC 4;  1R09 4;  1VBE 4;  1AR7 4;  2RS1 4;  1K5M D;  1VBB 4;  1HXS 4;  1OOP D;  4Q4W 4;  1PVC 4;  1ASJ 4;  1PO2 4;  1RMU 4;  1RUJ 4;  1VBD 4;  2HWB 4;  2X5I D;  4PDW D;  1HRI 4;  2RS5 4;  1EV1 4;  1AR8 4;  1Z7S 4;  1PIV 4;  1RHI 4;  1H8T D;  1MQT D;  1RUI 4;  1BEV 4;  1D4M 4;  1RUF 4;  1VRH 4;  1AR6 4;  2R04 4;  1NA1 D;  1AR9 4;  1VBC 4;  2RM2 4;  1PO1 4;  2PLV 4;  1RUD 4; 
#chains in the Genus database with same CATH topology
 3ABV A;  3VRA A;  3AED A;  1NCQ D;  3AEE A;  1ZOY A;  3AE1 A;  2WDV A;  1RVF 4;  1HRV 4;  1POV 0;  2ACZ A;  2WDR A;  4Q4Y 4;  3AE6 A;  2R06 4;  2R7F A;  3AE2 A;  4RHV 4;  4Q4W 4;  1PO2 4;  2HWB 4;  3AEG A;  3AE4 A;  3GQK A;  3AE5 A;  3AEC A;  1NEK A;  4YXD A;  3AEB A;  1MQT D;  2R04 4;  3P4Q A;  2RM2 4;  3P4R A;  2PLV 4;  1VRH 4;  1RUD 4;  5C3J A;  1KFY A;  2WDQ A;  1RUG 4;  1RUE 4;  2B76 A;  1EAH 4;  3AE7 A;  2H89 A;  3GQH A;  2FBW A;  2RMU 4;  1YQ4 A;  3JBG 4;  4Q4X 4;  3AE8 A;  1RUC 4;  1AR7 4;  2EX3 A;  2RS1 4;  1K5M D;  2WS3 A;  1PVC 4;  1ASJ 4;  1RMU 4;  2X5I D;  1HRI 4;  3AE9 A;  1Z7S 4;  3VR9 A;  4YT0 A;  4Q4V 4;  1RUI 4;  1XI1 A;  3VR8 A;  1RUF 4;  1XHZ A;  1AR9 4;  1VBC 4;  2PYJ A;  3J8F 4;  2R07 4;  3AE3 A;  2RS3 4;  2RR1 4;  3AEF A;  2WQY A;  4YSZ A;  3P4P A;  2PW9 A;  1R09 4;  4KX6 A;  2PZS A;  3FI7 A;  1RUJ 4;  1VBD 4;  1KF6 A;  4YTN A;  1EV1 4;  3P4S A;  1RHI 4;  1H8T D;  4YTM A;  1BEV 4;  1D4M 4;  1PO1 4;  3CIR A;  5C2T A;  2WU5 A;  2H88 A;  2HWC 4;  1YQ3 A;  1L0V A;  4YTP A;  4GB3 4;  2PYL A;  1VBA 4;  1R08 4;  1AL2 4;  3JD7 4;  1COV 4;  1ZP0 A;  1RUH 4;  3SFD A;  2WP9 A;  1VBE 4;  1VBB 4;  3SFE A;  1HXS 4;  1OOP D;  2WU2 A;  4YSY A;  4PDW D;  2RS5 4;  2PY5 A;  3AEA A;  1AR8 4;  1XHX A;  1PIV 4;  3VRB A;  1AR6 4;  1NA1 D;  1NEN A;  3SUC A;  4YSX A; 
#chains in the Genus database with same CATH homology
 4RHV 4;  2R07 4;  1RUG 4;  1RUE 4;  2HWC 4;  2RS3 4;  1NCQ D;  1EAH 4;  2RR1 4;  3J8F 4;  4GB3 4;  1RVF 4;  1HRV 4;  1VBA 4;  1POV 0;  1R08 4;  1AL2 4;  2RMU 4;  1COV 4;  3JD7 4;  4Q4V 4;  4Q4Y 4;  3JBG 4;  2R06 4;  4Q4X 4;  1RUH 4;  1RUC 4;  1R09 4;  1VBE 4;  1AR7 4;  2RS1 4;  1K5M D;  1VBB 4;  1HXS 4;  1OOP D;  4Q4W 4;  1PVC 4;  1ASJ 4;  1PO2 4;  1RMU 4;  1RUJ 4;  1VBD 4;  2HWB 4;  2X5I D;  4PDW D;  1HRI 4;  2RS5 4;  1EV1 4;  1AR8 4;  1Z7S 4;  1PIV 4;  1RHI 4;  1H8T D;  1MQT D;  1RUI 4;  1BEV 4;  1D4M 4;  1RUF 4;  1VRH 4;  1AR6 4;  2R04 4;  1NA1 D;  1AR9 4;  1VBC 4;  2RM2 4;  1PO1 4;  2PLV 4;  1RUD 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...