1R091

Human rhinovirus 14 complexed with antiviral compound r 61837
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human rhinovirus 14 complexed with antiviral compound R 61837.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 40
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1990-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r09100
5BNPB 3VBUC 3ZFEA 1OOPB 3TN92 1PO12 2RS33 1MEC1 1BBT1 1B35C 1PVC2 1PO23 1RUC3 1NG0A 1HQNA 1X36A 2HWB1 2WLPA 1EAH1 1AR73 3VBSA 3VBHC 1QJU3 3DPRA 4PDWA 4Q4W2 2X5IA 4QPGA 2GSYA 3VBHB 3NAPA 1VBC2 2RM22 1TMF3 5CFDC 3ZFFA 1RUC2 1NY71 1A6CA 5BNPA 5DDJ1 4Q4W1 2PLV3 1PGL1 1RUJ1 1RUE2 2HWB3 1AR83 5GKAC 2HWE1 5L7OA 1F2NA 1QJU1 1R083 4CDQA 4RHV1 5BNNB 4WM7B 4CDUA 4EJRA 4N43A 1PGL2 2HWD3 1RHI3 3CJIC 4GMP3 2WS92 1OOPA 1HRV2 1RUH3 1VBD2 2MEV2 4JGYA 5A32B 1RUI2 1ZBE1 1ND3B 5ACA1 2HWD2 1NCQA 1VRH2 3VBFA 4NWVA 1VB2A 1F8VA 5ACA2 4PDWC 4RR3B 4IV1A 5CFCC 1DDLA 1V9U2 2R041 4FTBA 4JGYC 1WCDJ 4RQPB 3VBOA 1HRV3 1RUH2 3JBG2 1COV3 1RUI3 3M8LA 1ND3A 3J8F2 3VDDB 4N43C 2HWF2 2RMU2 1NCRC 1PO22 4GH4A 1AYN1 1HXS2 1H8TB 2R063 4AEDA 1RUF1 2RR12 3TN93 1QQP3 4IV3A 5LK7B 1ND3C 2PLV1 2RMU1 1R1A3 1HXS1 4CDWC 5DDJ2 3CJIB 1AR81 2R062 5AC93 1RUD2 1TME1 1VBC1 1FPN2 4YVWC 2PLV2 1IHMA 1COV2 1ND2C 2WZR2 4RS5C 2XPJA 1VBA1 1BEV3 4BCUA 5J98B 5JZGB 5CFCB 3ZFGC 1V9U3 4RQPC 2X5IB 4Q4V2 5ABJA 1VBD1 1RMU1 4RQPA 1ZBA2 1QJU2 1D4M3 3VBOB 1B35B 5C9AA 4FTEA 4RHV2 1AYM3 5C9AC 2HWF3 1K5MB 1RB8G 2GH8A 5K0UA 5FMOS 1EV12 1VBA3 5D8AA 2MEV1 4CDUC 2RS52 1ZBE2 5L7OB 1VBB2 1AL21 4Q4X3 4IV3B 1R082 3NAPC 1Z7S1 1AR71 3VBRB 1H8TC 1CJDA 2XBO3 1D4M1 1OPOA 4CEYA 1PIV3 1ASJ3 5FOJB 2DF7A 1QJY2 1C8M2 4JGYB 1BBT2 5A32A 4QPIA 5BNNC 1D4M2 1BEV2 5DDJ3 4QPGC 4CDQB 3VDDA 5BNNA 1PGW1 1RUJ3 4N43B 1ASJ2 4YVWB 2RMU3 2BPA2 1POV3 2RS53 1QJY3 1HRI3 1ND2A 2XBO1 1VBB3 1FMD1 5JZGC 1B35A 5C9AB 5AC91 1POV0 4GB32 4N53B 1EAH2 1RUF2 1RUJ2 1VBE2 1AUYA 5C4WA 3JBG1 4LLFA 4AEDB 1RUC1 1AYM2 3VBRC 1AR82 4PDWB 4RR3C 1RMU3 1BMV2 1AR93 2WFF3 2WZR3 4RS5B 1RUG3 1FMD3 4IV1B 4CDUB 5ABJC 1AR61 3CJIA 5ABJB 5C8CC 1QJX1 4AEDC 4CDQC 4CDWB 2R043 1NA1A 1NCRB 4Q4V1 1AR62 1RHI2 2BUKA 1H8TA 4Q4X1 1HRV1 1MQTB 2RS11 1RUI1 3HAGA 2WZR1 1QQP2 1VBA2 4RHV3 1PIV1 3VBFC 5CFCA 4WM7C 2IZWA 1RHI1 4RS5A 4N53A 4IV3C 2WS91 1QJX3 2X5IC 3TN91 1QQP1 1RUH1 1HRI2 1AL22 2RS31 1ZBA3 4GH4C 4Q4V3 1R1A1 5K0UB 1NCQC 4Q4Y2 4CEWA 4QPIB 2QQPA 1EAH3 3VBFB 5ACA3 1R093 1AYN2 5JZGA 1K5MC 3J8F3 1VB4A 1RUG2 1PO11 3ZFGA 1NA1C 3VBOC 4YVSA 3VBUA 2FZ2A 1PVC1 4CEYB 5L7OC 4JGZA 1BEV1 4YVSC 1TMF1 4Z92B 4FTSA 3NAPB 1RUE3 2ZZQA 1C8M3 1OHFA 1COV1 1MEC2 2HWE3 1VBE3 5C8CB 1AYM1 3J8F1 1AR91 2WFF1 4CEYC 4YVWA 1AL0G 3DPRC 1AYN3 2R061 1PVC3 1RUF3 5A33B 1CD3G 1MQTC 1SMVA 1RUE1 1QJZA 1AL23 1MEC3 2HWE2 1Z7S3 4CDXB 1BMV1 2R072 1NY72 5BNOA 2BFUL 1VBE1 2RM23 2BBVA 4Y5Z0 1VRH1 1NA1B 1NCRA 1OOPC 1TME2 1X33A 5C8CA 1PIV2 4QPIC 1ND2B 1FPN3 1V9U1 2R042 4GMP0 4Q4X2 4Q4W3 3JB8A 3ZFEB 4FSJA 4IV1C 4WM8B 1HX6A 1HRI1 1RMU2 1VBB1 5C4WB 4WM8C 1QJX2 1M06G 3VBSC 1Z7S2 1EV13 2ZTNA 1R081 4Y4YA 2HWF1 1PO13 5C4WC 4CDWA 2RR13 5D8AB 3JD72 3FBMA 3ZFFC 3VBSB 1PGW2 2HWD1 5K0UC 4CEWB 1FOD3 4GMP1 2RS32 5A33A 2HWC2 4JGZC 1TMF2 5CFDB 1RVF3 3DPRB 3JD71 1HXS3 4JGZB 1E57A 4SBVA 1RUG1 1ASJ1 3ZFFB 4Q4Y3 2HWC1 4CEWC 1TME3 1VBC3 2RR11 1R1A2 5AC92 4GH4B 1FMD2 1RUD3 1FOD1 4GB31 3ZFGB 1NCQB 2HWB2 1NOVA 4QPGB 3VBHA 5J96B 3JD73 5BNPC 4WM7A 2Y26A 2RS13 1VBD3 2FZ1A 1AR92 1W39A 2WFF2 5CFDA 1FOD2 2RM21 1VRH3 2R071 5D8AC 5FMOL 3ZFEC 2WS93 1R092 1GFF2 4CDXC 5BNOB 2TBVA 1RUD1 4GB33 3JBG3 2MEV3 1ZBA1 1FPN1 4YVSB 1VAKA 3JB4C 3VDDC 1R091 2R073 1AR63 4RR3A 1EV11 2RS12 3S6PA 5BNOC 4WM8A 1K5MA 1AR72 2WWSA 1BBT3 2BFUS 1MQTA 1ZBE3 2VQ0A 1PO21 3LOBA 1RVF1 1C8M1 1POV1 2RS51 4NWWA 1QJY1 3ZXAC 3VBRA 2XBO2 1C8NA 3IDEA 4N53C 3VBUB 4Q4Y1 2HWC3 2ZAHA 4RFT0 4CDXA 1RVF2
chains in the Genus database with same CATH superfamily
1SBDA 1N3QA 2WNUC 5H9QA 3ROUA 1ZVFA 1MS0A 3IMNA 2LTNA 1EUTA 4EZ4A 2RS33 3D82A 5GZFA 3OJBA 1BBT1 1C57A 3OBAA 1GZCA 4XMIA 3I3MA 1W03A 2HWB1 2NMNA 3UJOA 1AR73 3WW1A 3CF6E 3EB7A 1ZRDA 3ZYGA 3VBHC 4CTEA 3MPPG 2D6NA 1NQDA 2PYTA 2X5IA 1UL9A 4PDWA 3OF1A 1EP0A 3N7MA 3CU7A 4XBLA 1VBC2 2PTMA 3ES4A 5T5PA 2XB6C 4A3XA 3RZJA 4MXWB 3MW4A 3U0ZA 1H30A 2YHJA 5CA6A 3I2DA 4BLIA 4I3GA 3WNOA 3POYA 3ST7A 3ZDVA 1REEA 1AX1A 1PGL1 2GNTA 1JU4A 5LBEA 5L9RA 2Q8OA 1RUE2 2BDRA 1AR83 3NNMA 5GKAC 4QXCA 1PX3A 2J7MA 1XYPA 1F2NA 2VNRA 4XJWA 4JVAA 4I0WB 4FP2A 4LBLA 2Z2SB 2Y38A 4CDUA 4RGKA 4CCEA 3A0KA 3ACLA 3IMMA 5GZDA 4AEMA 2WS92 1CPMA 4Q0PA 1SCSA 2PAMA 4DRRA 3O14A 3WDWA 1W0NA 3QD6A 5DZGA 5JPMB 2VTXA 5L9BA 4AVSA 2XL7A 1VMJA 2JD9A 2LW8A 3DXTA 1N1TA 1JYCA 1Z78A 2HEWF 1C5IA 5ACA1 1UY1A 3O1TA 4P5YA 2Y6HA 3JQXA 3RGBA 2Y0IA 3AKSA 3VBFA 1XPWA 2GH2A 2PHFA 5FZ6A 3UGFA 4AEKA 3LEIA 4QGLA 3UKNA 5AVPA 5BYNA 1VB2A 1CAVB 2XJTA 1JI6A 4ITCA 4QMAA 1F8VA 1HN0A 1UD1A 4RR3B 3KHCA 1QKQA 1DDLA 1IPSA 3SEPA 4UYBA 2W68A 2D3PA 3NMBA 2JDKA 1WLTA 4JGYC 4FTBA 1SLBA 1XJAA 1OQDA 3HNMA 4QKBA 5T3NA 3CLPA 4A3ZA 3RZMA 4O61A 2FBEA 4AQTA 1N1VA 2IVIB 5JVVA 1DQ5A 4A6SA 2N7GA 4UFJA 1COV3 5JR7B 2DBNA 1HKDA 1N1YA 3WNKA 3J8F2 4JTOA 2JB4A 4WVZA 4HXCA 3DYMA 1OLRA 3WHUA 2DDUA 3B9IA 1UXZA 3FUQA 1K42A 2AR6A 5A7WA 5DPNA 3ZXLA 1AYN1 2A3WA 5GALA 1UY2A 4V1PA 1AXZA 1W8NA 4XIKA 3URFA 3BOPA 2BRTA 4YFWA 3THPA 1XSRA 3MFCA 2W1QA 2ADEA 5FQ0A 2H6CA 4AFDA 2DUOA 4IV3A 5EPAA 3BCWA 5FZ9A 1ND3C 1U5IA 3NNJA 1R1A3 4NVPA 5CADA 4CRQA 4IUGA 2VXJA 4CXXA 2IXLA 2GN7A 1SQ4A 3OEAA 3LAGA 3MI8A 4XFAA 2VMEA 2VZ3A 1QGLA 1JZ3A 3E5XA 1WW6A 3IM0A 4I02A 4LBNA 3LQCA 2PLV2 3SH3A 1COV2 4LNVA 2YV8A 1JYTA 4RS5C 4ZU4A 2XPJA 1JYWA 4X8PA 4PF5A 4FSJA 3A21A 3DECA 3KCXA 4Y33A 4X6RB 2ZMNA 2VBDA 1BKZA 2X29A 1UY4A 3MDPA 4ZKTB 3WCSA 1UOFA 4LQRA 5K4LA 1X9PA 1ENRA 3QACA 3NJVA 2YDEA 1XE0A 5DABA 5FUNA 1D2QA 1D4M3 2X8KA 3T2PA 5I8YA 1B35B 2VE1A 4COUA 5C9AA 2JG8A 4RHV2 2CGPA 4Q0QA 3BU7A 3U75A 3O1MA 3AC0A 2JICA 3QH7A 5E1RA 1DF0A 1NXMA 3UV9A 5JOYA 1EY2A 4V2WA 3SKJE 3ZMNA 2JXAA 1W2UA 4QX0A 3VUOA 3O1PA 1EPZA 1S0EA 5K0UA 5FMOS 1BVVA 3K48A 2Y33A 1RGSA 1H6YA 3CJXA 2MEV1 3AKPA 3DKQA 3WQ7A 5JMCA 4DY3A 3RRDA 1ZBE2 5L7OB 2OVUA 2QQKA 4LMFA 2K46A 4ASKA 1NT0A 2TUNA 2VTFA 5A3NA 1R082 1W0OA 1Z7S1 3O5SA 3VBRB 2P3JA 4XCBA 5FMBA 2XBO3 1PIV3 1A8MA 3N9LA 4DUXA 3HWJA 1GP5A 5FOJB 4PQQA 1UU6A 2DF7A 1H4GA 1CVNA 4N7IA 2BZDA 5CISA 1IGOA 2XHNA 3AZXA 3KT4A 4MGYE 4JGYB 1JBCA 2FDHA 1LHUA 5A32A 4LO7A 2HKXA 3ZN4A 4IE4A 3PUIA 1DP0A 3AZYA 1W6OA 3BU0A 2VUDA 2P3IA 1PX4A 4MGZE 4QPGC 5BNNA 2VCBA 4LT5A 2BNMA 2YZ4A 1ASJ2 3O1SA 4YVWB 2RMU3 1Y9MA 4S2FA 3AZWA 2OUHA 3V0AB 2ZABA 1IKPA 1STMA 2ARCA 2XBO1 4CVUA 1OBNA 2LS6A 3S7EA 1O5LA 2QQNA 3EBRA 3LEKA 3NKTA 5A6XA 1YI9A 5AC91 4L9BA 5FY1A 3K2OA 1EAH2 5FYCA 3BGAA 3I3BA 2B8MA 2P6CA 1Y9QA 5FP9A 3BB6A 1SACA 3AJZA 3D8CA 1AUYA 1XXNA 3LPGA 4E2SA 1OH3A 2HLEA 2J1AA 4ASMB 3RNSA 4AEDB 4BMBA 1W04A 3FFQA 1RUC1 3BPSA 3ZDSA 3VBRC 4ARXA 4LE3A 4PDWB 5DAQA 5BUVA 1QJEA 1RMU3 3LD8A 4DUWA 2WZR3 4RS5B 3LDKA 4ZS3A 1RUG3 4IV1B 3KF5A 4PT6A 5ABJC 1JW6A 1AR61 1Q3EA 3DL3A 4OI1A 1G9CA 3VKFC 2W91A 2L9LA 2QQIA 3B93A 4XUTA 2GMEA 2YPJA 4YRDA 3U78A 4BDVB 4D7YA 2NMOA 3O1RA 3VD4A 2OQ6A 1NA1A 1NCRB 5T5JA 3WW3A 5GLUA 2Q1MA 3OPTA 2YUEA 4HT1T 5GJ6A 3WDXA 2YBKA 1AR62 1RHI2 3POBA 1H8TA 1HRV1 4ATEA 1YCIA 4AI9A 1JODA 1W0PA 2WZR1 2GC1A 4MUVA 5I0TA 2G4IA 5FPXA 3BI3A 1RJ8A 2DWRA 4YPJA 3SCGA 1V0AA 2VU9A 1E5IA 4UW6A 4WM7C 4YM3A 5KXCA 1RHI1 4E2QA 4N53A 4JRLA 4CA9A 1MR5A 1S0GA 3WY6A 2PAKA 2X5IC 3NNFA 4AHYA 1PMJX 2D7FA 5E89A 1AL22 1H2MA 1ZBA3 2RS31 1OI6A 2BERA 4BHPA 5C3OA 2KA3A 4G9SB 2FQPA 2VY0A 4DINB 2DVGA 2QQPA 4FFIA 3VBFB 3BVCA 1R093 4TZDA 1ZRCA 3KV6A 1K5MC 2XJUA 4AQ6A 3KCCA 1HIXA 3ZSMA 1PO11 2XVKA 1G9BA 3POJA 2XJQA 4QKDA 2VR4A 4YVSA 2C9AA 1BK0A 1TE1B 3RMXA 3BN6A 4JGZA 5C3QA 1F31A 3H1MA 1GUIA 4FTSA 4HOOA 3UK9A 4GKYA 2E7TA 3NAPB 2ZGPA 2R0FA 2VAUA 1DQ0A 2YGLA 1RUE3 3LSDA 1GP4A 4HONA 2DVFA 5T54A 2C4XA 2VQAA 4K7JA 1LESA 1VMFA 1WBLA 2JDPA 1UY3A 1FYUA 3LF7A 4NJ4A 4M3CE 4OMDA 1DU3D 4FOVA 4WVMB 4KGQA 4GA9A 3WVJA 1LOAA 5A1AA 4MH0E 5FO8B 1LU2A 2Y60A 3N35A 1C28A 1OHFA 2OPKA 3J7MA 1MEC2 3ZN6A 2BNNA 2V5YA 5C8CB 1J1TA 4UAPA 3SMHA 4CEYC 5FY8A 2XLAA 1JN2P 1RXFA 5FAXA 1GNZA 1RL3A 3O12A 1MQTC 3ENRA 3NW4A 1RUE1 5L19A 2OYZA 1SHWB 3AP6A 1GNHA 4KH9A 3D0JA 3CKHA 4XF9A 4GALA 2VOTA 4XFHA 1LOCA 1BMV1 5B4XA 2DUPA 2D3SA 2GC3A 4YSFA 2G1MA 1PZ8A 1D2SA 4W8JA 2RM23 3NL1A 4Y5Z0 1VRH1 1OOPC 1TME2 3FJSA 3K3NA 3BTXA 4LORA 1WA6X 1YLLA 2EXHA 2WZEA 2IFWA 5KC5A 3HT2A 3J7LA 4DFSA 3ME2A 1I5ZA 3B5LB 3P5BA 4QPIC 5DAXA 3M1HA 1FPN3 4AAXA 1LB2A 2VZTA 1GYKA 5CB7A 1DQ4A 2WYFA 4GXLA 3OBZA 3B02A 5HCFA 1WW7A 4AYUA 5G04L 1L3JA 5DG2A 5A6YA 5C4WB 2BGPA 1QJX2 4Y20B 4QX7A 3NSTA 1XNKA 4LLOA 4Q5OA 5C4WC 3OYWA 4QQHA 1H4HA 2EALA 2HYXA 4I01A 3FBMA 5D2AA 4ZZ5A 4G4FA 4CEWB 1RUOA 4DB5A 5FY0A 3WF4A 2WN3A 4XEZA 1S1AA 1WA4A 2A3XA 2JE7A 5G05L 2J1UA 5LATA 2HWC2 3HEIA 4BQYA 4NIHA 4AQ2A 2CDPA 5F6LB 3DPRB 1H2KA 3NV3A 2O1QA 4NPRA 3MGUA 3AYEA 3MUZ1 1CESA 3LEGA 2DFBA 3VDCA 5FREA 1ASJ1 5KBFA 1JYVA 3T09A 3M3QA 3T4VA 3PNAA 2ZACA 4FFGA 2D5HA 4NOTA 3WDTA 2ES3A 3Q9OA 1R1A2 3LWCA 1LAJA 1FMD2 3C7GA 3TEXA 1RUD3 3KSCA 2WN2A 4I0BA 1YHFA 4UFIA 3TOJA 4XHXA 4KWJA 2JG9C 4D7TA 3WLUA 2O14A 3MIDA 2YGMA 3POWA 4QGMA 1Q8VA 1WW5A 2OPWA 1UPSA 1G9FA 1VBD3 1AR92 5CFDA 3V0BB 4B1MA 3S5QA 1S0CA 4IL7A 4TSVA 2O0OA 1SZBA 3NV1A 4UT5A 2R071 2W1UA 3WDYA 4Y3OA 4OUSA 1OQ1A 4COZA 5F5QA 4EROA 3IDBB 3BIWE 4F3JA 4E4ZA 3KF3A 1R092 5F2SA 1ALYA 4MZUA 1KGYA 2IC1A 3AM2A 3GDBA 2TBVA 2ZEZA 3ZPOA 1RUD1 2MPFA 1RJ7A 2Q8CA 2MEV3 3H0OA 1ZBA1 4ET7A 4DQAA 1OH4A 4EN6B 4AI3A 2CGNA 5LASA 3VZOA 3JB4C 3T3YA 1APNA 2QQWA 4W6XA 1C4RA 1UMIA 4LA3A 3WV6A 4HANA 2YG0A 1R091 3HBKA 5H9PA 1OVSA 5JXJA 5A7QA 1TZOA 3SITA 3ZXEA 1CAUA 3QLQA 1EV11 2OS2A 4PIZA 5CAZA 1XYNA 1AJOA 1OUXA 4GWMA 4WM8A 3RZGA 3KT7A 3LKJA 4YM1A 1LOFA 4FBFA 1OFSA 2ET1A 3QH6A 1MVQA 2YXSA 5IFPA 1XNAA 1BBT3 3NNLA 1XE7A 1ZBE3 4KWLA 2VQ0A 3GZTB 4LTAA 2BOIA 3U11A 4C90A 3GALA 2FDJA 1RVF1 2CNAA 3HBZA 1WMEA 4NWWA 4KMQA 3RWNA 3ZXAC 3WX5A 4INDA 4ZU7A 1F4HA 2XBO2 2PHLA 5FPBA 4XAEA 2D40A 1LECA 2ZX2A 3UT0A 3VBUB 2ZAAA 1E5RA 3PDQA 4E8CA 1DG6A 2W08A 2KXLA 4YLZA 4CDXA 1MS1A 2EXKA 1RVF2 3VBUC 5FP7A 4UWDA 4YNIA 3W59A 3AB0A 1OOPB 2QBXA 4HKWA 4KGGA 1O8SA 1Y4WA 2JX9A 4YM2A 5LBFA 2HH9A 2WR9A 4GIQA 1J59A 3WNMA 1X82A 1ZRIA 1PVC2 1ZA7A 3IIAA 2BNOA 4Q26A 2NZ9A 2WNUA 4FPEA 4D0QA 5FZEA 3MIHA 1NG0A 2VZVA 3FZ3A 1XQNA 5FP3A 3T1MA 4W65A 1F9KA 2NM1A 4QQPA 1ONAA 3IWZA 3VBSA 2QQJA 2IUWA 2QZ3A 3M3CA 3WP4A 2OUJA 3OGRA 2BW8A 5LCWL 2JKBA 3WF1A 1IOAA 1IQAA 2P37A 3NAPA 5DUVA 1RUNA 2Y64A 3CNAA 1UMHA 2AC1A 1IS5A 4HPKB 1GANA 1TMF3 5CFDC 3ZFFA 1RUC2 4LA2A 5FXZA 2A5ZA 5TSWA 3INAA 4N7UA 2QQMA 5HI0A 4Z2AA 2DVBA 5GLTA 4JDOA 1KRIA 4JRAA 4BA6A 5FWJA 3MW3A 3L2YA 4Q0UA 4QX5A 2Y0OA 3MHZA 4URAA 5GZGA 2A6XA 2BJSA 2HWE1 2RVAA 4LHSA 4PCRA 5A3WA 5F1RA 5L7OA 1W6OB 5FZGA 3KS7A 5FY5A 5BNNB 4WM7B 3BTYA 1R1ZA 4LPLA 1AX0A 2BEOA 2DFCA 1RHI3 5EHDA 3KGZA 5FIXA 1CX4A 1KFUL 4BQXA 3TBDA 2QE3A 2AACA 2YC2A 1NXD1 2QKDA 4GMP3 3NWKA 4A2UA 4OFGA 4NRQA 3VHOA 4F8AA 2JDAA 4E2GA 1EUUA 3FLPA 3I3EA 1HRV2 1NQJA 3LIHA 5BNQA 4JGYA 5A32B 2JD4A 4C8DA 4ISQA 3T0AA 1DYOA 1X8EA 2ZX0A 3K4DA 3ZYBA 1LGBA 2NN8A 3CEWA 5KXDA 2E51A 1FNZA 5BPXA 3DYPA 3OPZA 3DYOA 2ZA9A 2UWAA 4XC9A 1TQ5A 5JOWA 4FO9A 3RYKA 4UXAA 3ZXGA 2NPIA 2VW1A 4OZXA 4PQ9A 3RVHA 4NROA 2XG3A 3WR0A 2BTVC 2UYBA 1KDKA 1FV2A 2CSGA 3E6CC 1YFUA 1YXWA 2DTYA 3AVRA 2YBSA 1HW5A 1MACA 1I5PA 3I3DA 3OGGA 1WMDA 3VKNA 4IV1A 5F39A 1W9WA 2ZBJA 1W2AX 2FDFA 2JB8A 1B09A 3SNMA 4RQPB 4AI0A 4NIDA 2VCMA 3K75B 3SKVA 4UBHA 1HRV3 2Z5WA 3A0NA 4QX8A 4A7YA 1D4VB 4R8HA 5JLVA 2ZHNA 3EJKA 3GZUC 2PAEA 5DAWA 2HWF2 3S57A 2VZOA 1POQA 5J36A 5HCAA 4GH4A 1O91A 1HXS2 1H8TB 2IWGB 2VOWA 4Y4RA 2F17A 1RUF1 1AJKA 3ZKYA 3C7HA 5FPVA 1MS3A 1NZIA 1WCKA 4FXKB 4AVAA 5KHJA 4AVCA 3RZLA 4QXKA 1PZ9A 1URXA 1LTEA 2XKOA 3IZOA 2QUOA 2PLV1 3FE5A 3AP9A 3B01A 4PLOA 2R0HA 4META 1HXS1 1NLQA 3ZXFA 3CJIB 5JSOA 1AR81 1NE6A 1QWRA 3KZ4C 2R062 1JZ7A 2EIEA 2XVLA 1V00A 5FJHA 2TNFA 3OY8A 1TME1 2RV9A 1IS4A 3W21A 1FPN2 5A80A 5IVVA 1IHMA 4BWOA 2VH9A 2Z4FA 1VBA1 1OLQA 2KD7A 5F3IA 5IK4A 1UKRA 5GZEA 5KHKA 2OA2A 2YROA 2YY1A 3EXUA 2A1XA 1V9U3 5KC6A 3KQ4B 5I0SA 1FXZA 4IE7A 1DYKA 4A42A 2ZOEB 4Y1VA 3H7JA 3C7FA 1NZCA 3GXUA 3WDVA 4MHRA 1ULCA 3WF2A 1JZ4A 1H0BA 1DFQA 2XVGA 5DZEA 1CQ9A 2HBTA 3MLKA 2YFZA 4HKOA 5AVAA 5C9AC 3AK0A 4RA0A 2D6MA 4Y24A 1O4TA 4I2OA 2VNGA 1PK6A 1YQ5A 1CAXA 1UIKA 2VMFA 2DCYA 1L7RA 2ETEA 4LO8A 1EV12 1VBA3 5FMDA 4QU2A 5JI7A 5JMOA 1H1MA 2OX0A 1J83A 2LRPA 4P9IA 1JYXA 3EQEA 3LEMA 1GR3A 2E9QA 4IV3B 4R9AA 4XFCA 1CJDA 4KL1A 5IUQA 2A6YA 5F5IA 1XOYA 4YZ3A 3U14A 1WLWA 5DN2A 4D8MA 3TEYA 1ASJ3 4JKLA 1YI7A 5LA1A 1E5HA 3M3EA 1C8M2 5FZMA 4LIUA 3EMRA 2ZGLA 4EN8B 3EYPA 1QXPA 1SEFA 4Y5SA 4YW3A 2VG9A 5EFUA 1S0FA 3RS6A 1BEV2 3SISA 4FPCA 4CDQB 2WINB 3VD5A 1PGW1 1VAMA 1IKQA 2I45A 4LEJA 2QNKA 3QOPA 4N43B 4S2HA 5EWSA 3VLBB 3VD9A 2RDRA 1JTZX 3OUJA 3ACHA 1HB4A 3Q8EA 1POV3 3VN4A 2WJSA 2DBIA 4CUAA 3O1OA 3H1WA 5E16A 3WG1A 3RG0A 4XPVA 1QXRA 1B35A 1I6XA 1OC1A 4IERA 2JG8B 2W2IA 3WT3A 2VM9A 4XQDA 5C9AB 1WCSA 3BOWA 4AHZA 5K7PA 2D5FA 3H42B 2Q8EA 3HNYM 2V4VA 4LBOA 5C4WA 1IS6A 1GMMA 4OI2A 1QF3A 1HB2A 1GBGA 2VULA 3JQWA 1JYNA 5FZIA 2WKKA 3ZSKA 3BTAA 1OD5A 1AYM2 3ZYFA 3VKMA 5LA0A 5A70A 2EF6A 1CN1A 3HNBM 1DQ2A 3P6BA 3ZYIB 3MUY1 3CL1A 3HQRA 1AR93 3AL6A 3MYXA 3KWVA 3KV9A 4CDUB 2E6VA 4PI2A 3AVSA 5FYTA 5FBJA 3ZYPA 1W9YA 3SH4A 3W5MA 4QX3A 5A3LA 4AOCA 1U0AA 1FATA 5HCBA 1U5XA 1H6XA 5A3UA 3CIHA 2DTWA 1NUKA 4XZPA 4IGQA 4AEDC 1PM7A 3GF6A 4U2AA 3OYWB 1YWKA 4TLFA 3V65A 1YFWA 5KWRA 3JCIA 2V73A 1XC6A 1V6KA 4AFBA 1FT9A 5DQ0A 1N3OA 1MS9A 3BPZA 4Q4X1 4AGRA 2WABA 4K8RB 3AMNA 1RUI1 2GU9A 4HN1A 3VB9A 4OHVA 4AWDA 4X8NA 4RHV3 1PIV1 1LCLA 2IXIA 3SC7X 1X50A 5CFCA 1AXYA 2IFRA 1UPIA 3GBGA 1GWLA 3PIGA 2IZWA 3PUSA 4H2AA 1JOPA 4RS5A 4LJHA 2A6VA 5DZFA 1H9PA 3DKWA 2J42A 1MZ6A 2EXIA 4ONUA 3ZXDA 1WD3A 1RUH1 1HRI2 3UGGA 2C26A 4M3CF 2YPDA 5CBLA 4BYYA 1O3QA 1NCQC 4Q4Y2 1CIWA 3L2HA 5ANNA 4QPIB 1YO8A 4A44A 4CEWA 4YW1A 2VZQA 4J25A 5FOBB 5FYMA 4XUOA 2MHFA 4CZSA 1KITA 2A75A 2ARAA 1KFXL 2PHRA 5A7WB 2ARBA 3W5NA 1HJGA 3VBOC 2DU1A 5IVFA 4IE6A 2XGXA 4CEYB 5J7MA 1JYIA 2RG4A 4MGKE 5F32A 4HBNA 1TMF1 4YVSC 5A7OA 4TLGA 4Z92B 4QGNA 4XUPA 3IDAA 1CZTA 1RINA 2Q0AA 2H0VA 3FN9A 1K5JA 5FPZA 1OVPA 1T2XA 2P3KA 1LEMA 3KB5A 2WO3A 4QQ2A 3PUHA 4FPOB 1K12A 4LKFA 5FZLA 3AKTA 5JAXA 5EJZB 3BUCA 2EXJA 4WZCA 2F6BA 4C1WA 4YW6A 5FP4A 2YU1A 3DPRC 3FMGA 5JPNB 4KI5M 2R061 4Y1YA 5H9SA 4OHYA 4CP0A 4I30A 1UXXX 4OCTA 2C9KA 3CZJA 4FPKA 4LBQB 1ULEA 2JWPA 4MX3A 2C0ZA 1F15A 1QJZA 4EN0A 4D94A 1QNWA 1ZZ6A 2HWE2 4UI9L 1O3RA 5F5AA 1AVBA 4CDXB 3PVOA 5T5OA 1DGWA 1GZ9A 5BNOA 4GJZA 1GOHA 4N90A 3PLQA 5LK5A 2BFUL 3WW4A 4MXVA 3T4HB 2AENA 1ULPA 1DGWX 2WWJA 2ILMA 1BQPA 1OQEA 5FO7B 3ZN6B 4CXYA 5DUUA 5FTTC 3ON7A 5C8CA 2E7QA 5CU1A 2RJKA 1OA4A 1JMUB 3NO8A 5ERLA 4UFMA 1ND2B 3AYAA 1ULDA 5A3OA 3TRSB 1C3HA 3I2JA 2BWAA 2DCZA 1IPKA 2FHRA 3Q8FA 1UX6A 2XMLA 4OZOA 4P9GA 4N9IA 5DAVA 3WD5A 2VBPA 3O1UA 1W2TA 3ZIXA 4Q4W3 1IS3A 3ZPYA 2X10A 5IFTA 3PTYA 4K3UA 2WNOA 4WM8B 1J3RA 2CHHA 4EE2A 2ZGQA 1HRI1 1RMU2 4NPLA 1PHMA 3SHRA 2YMZA 1VBB1 4PBPA 3KT1A 1S0JA 1M06G 1BXHA 4QPWA 3VBSC 4PHZA 4L92A 4R9CA 1R081 1PO13 4M01A 4CP9B 3TEWA 1OMIA 3O0WA 2XQRA 3T0DA 3ZFFC 5A1LA 3VBSB 4PBOA 1ZZ9A 1WBFA 1YRZA 4I09A 5FZHA 3O7OA 4GMP1 1YQ2A 4CCKA 3F95A 4NHMA 1I1EA 5LEKA 3ZN5A 2XWJB 2KR2A 4HN0A 1BHGA 3T2QA 4KQ7A 4ATFA 5IATA 5GZCA 1YIPA 1WUVA 4ASLA 2HYKA 4NIAA 1HXS3 1UYPA 2VZSA 4IDZA 4M0NA 4E27A 2DURA 1E57A 1J84A 1Y43B 2AH2A 2O8OA 2O8QA 4XDPA 2IXJA 3N36A 4MXWA 5FZ3A 4XFGA 2ZCWA 2JDNA 4Q4Y3 2B7YA 3SQOA 3GHMA 3K4AA 4CEWC 2XKPA 1LULA 3TWIA 1SFYA 4Y20A 1QDOA 2Q5TA 4CU8A 1UCXA 4XXPA 5FY9A 1CWPA 4M4PA 1QOSA 4DS0A 4GB31 1FOD1 3ZFGB 3H3LA 4IEYA 4JAAA 3FL7A 2DYCA 2E33A 3QBQA 4MHUA 3KMHA 4L99A 1G8WA 5I93A 2VUAA 1O3TA 5FKBA 2JEMA 4XJZA 4ISRA 1K3IA 2RDNA 4HPKA 1U12A 2Y26A 3BIEA 5D1IA 3I2OA 1LRHA 4QWNA 2WFF2 3FC0A 4FQ4A 1FOD2 2CDOA 4D69A 1VRH3 4QHBA 4XXAA 5FMOL 5KXEA 3IT8A 3RSJA 1NAEA 2R49A 4FOQA 4XE9A 4BPZA 1MS8A 4CDXC 3LE0A 3GCXA 4BXFA 4EWAA 4GB33 2VVEA 3JBG3 2YC0A 1AXKA 2JIGA 2XUEA 4BISA 1FPN1 4P00B 5IJRA 5J37A 3GJBA 1D7PM 3S0MA 2VXRA 1VAKA 3MF6A 5SV5A 4ZXKA 3ZMOA 5JIUA 3ORJA 5IYYA 4FPJA 4P9JA 1LGNA 3N9PA 3ELNA 5F8PA 3VD3A 3ZR6A 2W94A 2OIIA 1SLLA 2JDZA 2WC2A 1RYYA 4RR3A 3HQUA 1UOJA 5FKCA 4DOUA 2VNOA 4YW4A 2J1SA 5FCCA 5FRAA 4OHZA 1CZSA 1K5MA 3PTRB 4HETA 5FZ8A 4FPYA 4XF3A 1M4WA 2NYYA 2VPVA 5FLIA 3CQOA 3MV11 1SPPB 4XF0A 1PO21 4EZHA 4XFBA 3I2KA 2GDFA 5FZAA 3CBNA 1GQPA 3KVBA 4QB1A 4FAGA 5L73A 1W2NA 1WKYA 2WT1A 1VIWB 5ANQA 1G9AA 1POV1 2QQUA 3CZUA 3POSA 1RC6A 1HDKA 3W20A 2WO1A 3E6DA 5I0RA 1AHSA 4IXLA 5DAPA 4N53C 5FPAA 3I2HA 5L36A 2HWC3 5I8SA 2WQ4A 2LROA 1GWKA 4Q8LA 1JUHA 1LOEA 1KXGA 1IG3A 1GZWB 3LA7A 4BLJA 4EWEA 5BNPB 4XBNA 4YGCA 3WUDA 3NVCA 5FJKA 3TN92 5I0DA 4XOGA 1PO12 2P17A 1UYZA 4CCLA 4Q8KA 3B9CA 3NV2A 2ZGOA 4MVTA 2XWBB 5M0TA 5CG9A 1B35C 1OD3A 4UW4A 1PO23 4DXSA 1FI2A 1RUC3 1XNBA 4KU8A 4ZONA 3KGLA 4ARYA 3UESA 2FMDA 4XILA 5ISLA 1PK6B 1EAH1 4GJYA 1V6LA 4GZ9A 1Q8SA 1W8UA 3R6SA 1QJU3 4JDMA 2QJVA 4AFMA 2ORZA 4Q4W2 1OF4A 2GSYA 4ORFA 3VBHB 2GP5A 4YGEA 5KHIA 4MOAA 3PUAA 1J3QA 4XACA 1JZ6A 5C6CA 2VL4A 3M7AA 5A3PA 4QDSA 4XJ9A 2RDSA 1NY71 4FPGA 4Y5TA 4CU9A 3TB0A 1XSQA 1A6CA 2XJVA 3GBFA 2K0GA 3OY8B 4Q4W1 4OHXA 2GP3A 2B4KA 2XLGA 1X8MA 2YFUA 4DEVA 4D3WA 4QD2A 1S2BA 2E63A 4K8FA 4AEJA 5GLWA 3AMQA 2AGSA 2R6QA 3I97A 2BP6A 2A3YA 1QJU1 3VZLA 2ZX4A 3AMMA 1R083 4PLNA 4RHV1 4YG0A 2WSUA 4YW7A 3VKLA 4CDQA 3UNPA 1VRBA 1ZRRA 1GNYA 3VHNA 2GZWA 4N43A 2OZJA 5JOZA 2ZGTA 1LGCA 2BWCA 3CJIC 4NUBA 4LK7A 1SDWA 3ACFA 5EV7A 3ATGA 2LALA 1OOPA 2JJ6A 4UW5A 2OW4A 1D0GA 2MEV2 3H1YA 5DG1A 3HN1A 1RUI2 3LOIA 3WOGA 1XRUA 5JSRA 1ND3B 4JQTA 4NIGA 4PIYA 1JUIA 1US2A 1YEWA 2ATFA 2ZJCA 3Q8AA 4FPHA 4CUCA 2ZS6B 1T6BX 3DGTA 5EZWA 2HWD2 2D43A 1NCQA 4Q1RA 4BQWA 5FZ1A 4A41A 4UFHA 4CUGA 3WEZA 3ZX7A 4COVA 4JZRA 1L7QA 1WLCA 2Y6JA 2QQOA 4M0HA 4BB3A 2VMCA 3V0AA 4PDWC 4AFCA 2XH6A 4HSJA 5CFCC 3WNXA 2BQPA 2WNVB 2JDMA 5C33A 1DIWA 4J1XA 1WCDJ 2UU8A 3VBOA 4E4SA 3N9QA 2Z42A 3UKVA 3ZYJB 4Z2WA 2SLIA 3JBG2 3AKQA 1ST8A 2Y6LA 2JE9A 2ZGSA 4CYDA 1W9SA 1Q5OA 1RUI3 2W47A 1LENA 5C5UA 4AVBA 1V6NA 1QHDA 3JUUA 5FXWA 4HK9A 5FMCA 2XUMA 4Z1VA 3MIFA 1NCRC 2VMGA 2ZGNA 1LHVA 2R063 4HVRA 4AEDA 4EN9B 3IAPA 3H8XA 4J6GA 1IQDC 1S2EA 1MZEA 1GP6A 3RI9A 4QM8A 2JIJA 4B7EA 3WP6A 2P2KA 3R4DB 4JCKA 4FOYA 3UETA 3I8TA 5LK7B 1REDA 5IWFA 2OT7A 4CCNA 3DCQA 2AEYA 4HVOA 4CDWC 1VLNA 4MGQA 3HQXA 4Q29A 5C70A 4QKFA 2CWMA 5FWEA 4YWAA 1S55A 1VPHA 3AP5A 2YC4A 5AC93 1AF9A 2V09A 4QT6A 2RDQA 2RJLA 2W52A 1VBC1 2ZGRA 4LUMA 1GU3A 4XQ4A 3OCPA 2W3JA 3WZ1A 2VJXA 3ZIWA 1SG3A 1ND2C 4OVEA 4YGBA 2XJPA 5LBBA 2P4EA 1ODNA 3VL8A 5IHRA 2GNBA 5J98B 1SBEA 2AYHA 2C6SA 2B5HA 5CFCB 3P3PA 4DEQA 5JCTA 1YJLA 3DEMA 1BLZA 3RZKA 3POGA 1A3KA 4AL9A 1UQXA 3MBWA 4Q4V2 4EQVA 1Y7BA 2BV4A 3NQHA 4H7MA 4XUQA 4RQPA 5LA9A 1ZBA2 4IEPA 2WYSA 4LBJA 4KWUA 5FK7A 5FZKA 4O9EA 4YM0A 3RDIA 5DMYA 1JHJA 4KU7A 1AYM3 1H2NA 2A6WA 1YYNA 1JH5A 3FX3A 3HT1A 5FUPA 1RB8G 1ZRFA 2GH8A 3LFMA 3MO4A 5D8AA 4ZS2A 3FLTA 4CDUC 4QB2A 2A73B 4GWNA 2P6HA 1VBB2 1W8OA 1O59A 1AL21 1C5HA 1CIYA 3J4UH 4UW3A 4CE8A 4HVQA 4Z8BA 4CU7A 3ETQA 3ZOIA 1H8TC 4IEZA 5BNOB 1OPOA 3D6EA 1OUSA 2DVAA 5FYVA 1KQRA 3RYRA 4PI0A 4YZ5A 2EVXA 5FYBA 4COYA 1D0HA 3I4IA 3U10A 1ZA4A 1ZNPA 5T5LA 3WXPA 1W6NA 1V70A 5LBCA 1G7YA 2VMHA 1VALA 4BQ2A 4QPIA 1JXNA 2F4PA 4P9LA 3THTA 2CY6A 4UF0B 4FAHA 1UF2C 2XXZA 5DDJ3 5T50A 1QNYA 2Q8DA 1XBFA 1HV0A 3VDDA 3VGIA 1CAXB 5L9VA 2SBAA 2BVBA 1OF3A 3R4UA 4MGSA 2QDRA 3CMGA 3GM8A 5F5CA 1F5JA 1LJ7A 3RPQA 1QJY3 1HRI3 4HFSA 1DZQA 1ND2A 1VBB3 4DXRA 4EN7B 3KCYA 1GSLA 4SLIA 1F4AA 3DUIA 3LZZA 1UZZA 4QAWA 4BK4A 2E31A 2J1VA 1VAVA 5JZGC 2VECA 4K20A 1WGPA 4GULA 4GB32 3I59B 1G86A 4K6BA 4P08A 4P9WA 1ULOA 1RUF2 5FP8A 4AI1A 5LRSA 5EXOA 4HKLA 5K9YA 1HJFA 1CR7A 1QJFA 2D6LX 3WQ1A 1RUJ2 2LM3A 1VBE2 4XQWA 5JXGA 5FLHA 1OXCA 3SEEA 2B45X 2ZX3A 4A45A 4N8MA 4LLFA 1N1SA 5J1XA 5IT6A 1PMIA 4CXWA 4XZUG 2PHTA 4RR3C 4WVWA 2ZHKA 1VP6A 1BMV2 1NYWA 2VOXA 2WFF3 1YIFA 1FMD3 5FZDA 1JOJA 1ACCA 2PXJA 1ENXA 2Y8KA 1LOGA 1ZZ8A 3WG4A 2QCSB 1KJRA 3J7HA 3N9NA 5ABJB 1XNCA 4AHXA 4FP3A 2DUQA 1QXJA 2WIIB 3ALQA 3PVEA 2R043 2EA7A 2CAVA 1O6UA 2BOJA 4CCDA 1S4CA 5C3SA 3T1LA 4QX1A 5F3GA 4H14A 4B3NA 4BQ5A 5FK8A 3CDZB 4U36A 2X53S 2J22A 3PL0A 4MV2A 3HAGA 2CWSA 2VD7A 2JECA 2VMDA 1VBA2 4R9BA 3T30A 4QQLA 3WG2A 3ES1A 3VKOA 4N9HA 2VVDA 4KG8A 3AKRA 1V6IA 2GAUA 1T6GC 4RL7A 4TWTA 1H2LA 2XLFA 3AMHA 5GLZA 1HQWA 2D97A 1S0DA 4LXLA 3TN91 1WCUA 4AK3A 3BTZA 2ZXQA 2G9FA 1QQP1 5C3RA 1ZYBA 4MGTA 2UURA 3LDRA 4C0HA 3OBTA 2JG8C 1SLIA 4GH4C 1YNAA 5C8WA 2DVDA 2QZ2A 3VDAA 5K0UB 3KLSA 1VMHA 4QM9A 3ASIA 4TYSA 1N3PA 3H3ZA 3IDCB 3USSA 5A6QA 3LA3A 4IEWA 4XTMA 3OEBA 5ACA3 5JZGA 4QX2A 4IEUA 4RGAA 1AZDA 1RUG2 3ZR5A 3N7JA 3I3QA 3MPBA 1W6QB 4P14A 1DQ1A 2WQZC 1Q8PA 2FZ2A 1PVC1 3VV1A 1UYYA 1O4ZA 3LCPA 3CHXA 3KHBA 1W8HA 3VZJA 2X05A 4HL0A 2WT2A 1CGPA 3FWEA 3BALA 4F7ZA 4CCOA 4A4AA 2D98A 2UYAA 3LA2A 2ZZQA 1O5UA 4L8QA 2EIGA 5HV0A 4I3PA 2WZ8A 1COV1 2HWE3 2V5DA 4CSWA 1AYM1 3QCWA 1AR91 4XYXA 3E1F1 4LOSA 1DYPA 4EV0A 2JG9A 4YVWA 3IPVB 1AL0G 4AR2A 4OQ9A 3OPWA 2FCTA 5JSPA 1JZ8A 4LBMA 1PVC3 5C3PA 5A33B 3AJYA 2W39A 2VVFA 3K77A 4QPYA 1BCXA 1SMVA 4AE2A 4MLOA 3T2TA 4EWDA 3C8XA 4MADA 4JX0A 4KG0A 4LOTA 1AL23 1J58A 1H8VA 4OMCA 2QQVA 3GYDA 2WAAA 5HXMA 3DXUA 1LHWA 4CPBA 3RZHA 4B4QA 4O7XA 4DUVA 1NY72 1VE0A 3TYJA 5IVJA 1SLAA 1WWYA 3N3HA 3NKGA 4WVVA 4B4PA 2BBVA 3IAQA 3IBMA 2EIDA 1X33A 4ZU5A 5FZ4A 1WMFA 4AHWA 4NN0A 2QDNA 3AZZA 3RYPA 1YQ6A 3PUQA 4RGGA 4L2NA 3HOBA 4E4HA 4YYOA 1PIV2 1LODA 1UO9A 3GNEA 3MFAA 3P3NA 2WL1A 5EP9A 3PJQA 3E97A 5E6HA 3MICA 2PMWB 3I7DA 5CVRA 1MZFA 4XDQA 4QDRA 4Q4X2 1NLSA 3AYCA 3JB8A 4AI2A 3OGJA 2B9VA 5CG8A 2Y34A 1HX6A 4DZGA 3R0RA 3H7YA 2JDUA 1LOFC 2ID4A 4QHZA 1SFPA 3WUCA 2FDGA 4GAZA 2ZHLA 1HQLA 2ZTNA 2ZPXA 4YZ4A 2HWF1 1QH6A 2JENA 1GOFA 3WCRA 5D8AB 4CDWA 2Y6KA 1Z0HA 2HWD1 1TNFA 3FLRA 5T52A 2I07B 4MSVA 2K2SA 5K0UC 1FOD3 2V72A 1U5ZA 1JHNA 2RS32 1RIRA 2R7EB 2ZZJA 4XFFA 3WG3A 2WT0A 1SDDB 1OT5A 1YQ8A 4E8DA 1TMF2 1PZ7A 2DCJA 3EO6A 3JD71 3SH5A 3UJQA 3PMEA 2OQ7A 4D6QA 4RYDA 2WA3A 4JV4A 1AX2A 1I3HA 5EIYB 1PMHX 3RJRA 3USUA 3GZEA 4LHLA 4D7SA 3GZAA 4CU6A 2WZPP 3ZFFB 3AMPA 4C0BA 4FPLA 4NHLA 1W06A 2QQLA 4DMIA 4PJYA 4QXHA 4AQSA 5J09A 1TME3 1W6PB 3BKZA 1VBC3 4GQ7A 2WWUA 4XABA 4TN7A 4BU2A 1JU3A 2AEZA 4AVTA 3IKWA 5FUIA 3OD0A 2W95A 2FMYA 2VCAA 3W9AA 4CP9A 5IK8A 1NCQB 1RXGA 2HWB2 3KV4A 3JZVA 1HLCA 5EJ3A 3AX4A 1E5SA 1S0IA 3VBHA 5J96B 3GHNA 4DO0A 5KHGA 5JXIA 2OXBA 3JD73 5BNPC 4WM7A 4IE5A 4CPBD 4LKEA 2YU2A 2CAUA 2RS13 2UY8A 3G7DA 4QDQA 5FPLA 3I59A 3WW2A 2D93A 4MYEA 2F4LA 4W6YA 4TXWA 2RM21 1LHOA 3WNPA 4WVMA 3JU9A 5A3MA 5D8AC 4D6RA 1TVGA 1UY0A 4R52A 4LO5B 2WQ8A 3B00A 4GWJA 3ZFEC 4DPNA 2WS93 5IVBA 1DHKB 1GFF2 1GV9A 4R9DA 1NX9A 3D0SA 5F9TA 4AW7A 3DV8A 2AREA 5FYHA 5EYXA 4MGIE 5F2WA 3I2IA 4LBQD 3VDDC 3MLJA 3BYWA 5GM0A 4YZ1A 2Y6FA 2C5DA 2VUJA 2HJIA 4M4RA 4P9YA 1O8PA 1HB3A 2FCVA 2ZEXA 4L97A 2BGOA 2E53A 3ACGA 3PIJA 2PFWA 3HR9A 4IW3A 5I91A 2ERFA 3A4UA 1ENQA 1GWMA 2RS12 4URTA 4XIOA 5FZOB 1CX1A 2VCCA 1W9TA 3T08A 3K3OA 2A70A 5A7NA 5JIAA 2KM2A 3TNQA 1S0BA 1TG7A 5LA2A 4RN5A 2WWSA 3VZKA 3N9OA 2BFUS 2XHKA 5D21A 3D4KA 1OKQA 3ABZA 4OUMA 3TNPB 4JDNA 5LZ6A 5I0UA 3DN7A 1OA3A 4BOWA 5JOXA 4UOJA 1FV3A 3O0XA 3VBRA 5HPOA 4FT8A 4BK5A 3RFRA 2VW2A 2XONA 1WMXA 2P5BA 3MZHA 2R16A 1H9WA 1LU1A 4IGPA 4Q4Y1 2ZAHA 5FFOC 2ADDA 4IESA 3ZYRA 1W28A 3ZFEA 4GD4A 4DY5A 3S5AA 3SLIA 3J9SA 5LY2A 2BU9A 4FI9A 4IEOA 4XCAA 3H9AA 4JHTA 2ENRA 3VL9A 3POIA 4DXZA 1MEC1 3O1VA 4XETA 4FQZA 1QOTA 5FYYA 2AZ5A 3IN9A 2VZUA 1IG0A 2RJ2A 1HQNA 1OURA 2WBKA 3O0VA 1MS4A 2PA7A 1QY4A 3AP4A 3PVNA 1X36A 1LOBA 2R32A 2VBBA 2WLPA 1S2KA 3L9JT 2A71A 1W2OA 4PIXA 2GNDA 4NHKA 4Y1XA 1MZ5A 4UBGA 3E5UA 3DPRA 1ODMA 4DNYA 4BH9A 4QPGA 1LHNA 4OI4A 5FZ0A 2Q30A 3MF9A 2VUCA 4X6QB 2RM22 3ILFA 3PU3A 1W3VA 4H55A 3OUHA 2DU0A 1MPXA 1UOGA 3ACIA 4O65A 4YG3A 5BNPA 5DDJ1 1K45A 3LIGA 2PLV3 1PK6C 2P3YA 5AFBA 1RUJ1 5DXDA 4Q0SA 1QH7A 2HWB3 2K9ZA 1J3PA 3IPVA 4A6OA 2W0XA 2A6ZA 4XTPA 5FZCA 3T2OA 4UF0A 4P02B 2GMPA 1SLCA 2WNEA 2IXCA 5CZKA 3WINE 3TEZA 2DCKA 3V64A 1FX5A 2ZEWA 4K40A 4C1XA 4EJRA 1PGL2 2HWD3 2YBPA 4BMEA 1XNTA 3BODA 3D5OA 4W50A 1UMZA 4WZFA 1YFXA 1GZWA 3E6BA 3MIGA 2B42B 4TTGA 1F5FA 4XF1A 4RFRB 3I49A 4BIFA 2VTXJ 1RUH3 1VBD2 5BXXA 5HBAA 1WLDA 1ZBE1 4ZPIA 3ZXJA 1WW4A 4BZ4A 1IPJA 5T55A 1UKGA 1W99A 2I74A 1UZYA 3FHAA 1MVEA 1W8FA 4ZY9A 3OBRA 1W8TA 4LHNA 3ZLIA 1VRH2 4XAAA 1UNBA 3OOXA 3N4MA 2I2SA 4FFFA 4KNCA 5SV8A 5A1FA 3LFIA 1DBNA 4XF4A 3M3OA 2WO7A 1LNSA 4NWVA 4AFAA 4XVHA 4ES8A 1O7FA 3VZNA 4LIVA 3C2UA 4M3CB 4XW3A 3WF3A 4IETA 4K21A 5ACA2 4YW5A 1CAUB 3AFKA 4NMIA 3B3QE 5FYIA 1ZM1A 1V9U2 2R041 4GKXA 1G9DA 2WLQA 4H3WA 4Y22A 1W6MA 5HV4A 1SFNA 2V4AA 3AFGA 1W3XA 1PVXA 3WNLA 2JDYA 3N7LA 3AYDA 1RUH2 2Q1FA 2G9GA 4OYUA 5LRRA 1GQHA 3M8LA 4YGDA 1ND3A 1PM4A 4IE0A 1OKOA 3VDDB 1QMJA 2W1SA 1PNFA 1XU1A 4N43C 3FUOA 5GLVA 1UU4A 3KVAA 5KXBA 2RMU2 3J26N 4BQ4A 4YZ2A 1TNRA 2G19A 1PO22 3S30A 4JKKA 5JI9A 3RQ0A 1XB9A 1DLCA 5F3CA 2WNVC 2VW0A 4AF9A 3K4ZA 2RR12 3TN93 3A23A 2ZMLA 1QQP3 2CV6A 4BE3A 3OG2A 2VQUA 3THDA 2RMU1 2XOMA 1RTVA 3WQBA 4KBZA 1R64A 1NKGA 2H6BA 2LUWA 1A78A 5AFEA 3HIFA 5DDJ2 3GJAA 1W9FA 3Q8CA 3R05A 2WUHA 5CKMA 2RHPA 1MS5A 2WNUB 1RUD2 3AL5A 5E8AA 3VHRA 1RITA 3I2GA 1SBFA 1UX7A 4YVWC 5F37A 1BZWA 1WCQA 5IAVA 3SXWA 3ZM8A 2J1RA 2CGOA 4QHOA 2EIBA 2G9ZA 2Z69A 4M00A 2WZR2 2PHDA 2EAAA 1BEV3 4BCUA 5JZGB 3CO2A 3ZFGC 3HJRA 5DUXA 3F2ZA 4OHWA 4BQ3A 2XJSA 1X9TA 5J3UA 2ZEYA 4RQPC 3H8UA 3MEPA 2X5IB 4XJ8A 2CU5A 2FD8A 2GNMA 5ABJA 4L11A 2YB7A 1QU0A 1VBD1 1RMU1 3VBOB 1H1AA 1QJU2 1Q56A 4XFIA 1SCRA 2B9UA 4NIIA 4ZHNA 4FTEA 4FCAA 1DZTA 1G6NA 1W90A 4JC1A 1GOGA 2HWF3 4K9SA 4XDOA 5EJ1B 1BK1A 4HZFA 1K5MB 1KJLA 4JKMA 5LW9A 4XUNA 4CP1A 2ET7A 2WDBA 1CZVA 5FYZA 3OD4A 1GZTA 3PMSA 2RS52 2VOKA 1XU2A 4B4RA 5FV3A 3B69A 1GICA 3DF0A 2PQQA 3OGSA 4XJUA 2GALA 2ZGMA 2MNGA 3MIBA 4Q4X3 3NAPC 2VOVA 2NQYA 1W8ZA 1AR71 2H0BA 5LWBA 3D3AA 1ZZBA 5LB6A 5FZOA 1D4M1 4CEYA 4OQ8A 1C1LA 1UZWA 2DV9A 3ZXKA 4J1WA 5JR2A 4E4DX 5C71A 4NRPA 4W6WA 2IVJA 4QXBA 1LEDA 1QJY2 5K8SA 3MIEA 1BBT2 1WZXA 2ZKNA 4I0AA 4MO3M 2ORXA 4FVVA 5BNNC 2W9XA 3WSOA 3RZZA 1D4M2 2WAOA 3HN3A 3OSDA 2JG9B 4YFZA 1I9RA 2IXHA 4Z82A 4AVVA 1ULFA 5BY5A 3ZYHA 4LBKA 1LKNA 4XMAA 1DQ6A 1RUJ3 3FFZA 4RFT0 2NP0A 5JWPA 5E88A 3GGLA 2QTWB 1O3SA 2ZX1A 2BPA2 2RS53 5A7PA 4H7LA 5APAA 1Q43A 3SCFA 5A6ZA 5A3TA 1CAVA 1XE8A 1FMD1 3U37A 4OUEA 1POV0 5FQ0B 3W58A 5LEJA 3A7QA 5HCHA 4MG2A 4LBQA 1O4YA 2D44A 2XR4A 4N53B 3UKTA 4ES9A 2VZPA 3WP3A 2PQSA 2UWBA 3LGRA 3ZSLA 1A34A 5HXVA 1GQGA 3ZVXA 4DRVA 5I8TA 3JBG1 2PHUA 3V56A 3N7KA 4OLLA 3AP7A 4AGGA 5FYSA 1NLRA 4LITA 3WNNA 3K46A 3ZO0B 1UW8A 2WFPA 1XNDA 4D6SA 5EYYA 1W8WA 2P1BA 1AR82 1UU5A 1OFNA 2W5FA 3PU8A 3JXSA 3FHIB 3FBYA 3APBA 4S2DA 2B46X 2ZGKA 4K1YA 2E26A 4IEVA 1UAIA 2D6KA 3CJIA 4CCCA 3HD8B 3OTFA 4COWA 5C8CC 1Q8OA 1CAWB 1QJX1 1QOOA 2W1WA 4G3YC 4NHYA 4CDQC 4LR4A 3WQ0A 1F35A 4CDWB 1WD4A 1DGRA 3OUIA 4IQPA 4UFKA 4V2VA 5FZFA 5B2GB 4F83A 4Q4V1 3ZSEA 1W6PA 3MLLA 1H1IA 2BUKA 4Q0VA 3ECQA 3N9MA 1Y3TA 1ZZCA 1MQTB 2VNVA 2VQTA 2RS11 3B7MA 5CIRA 1YUDA 5JDBA 1VJ2A 3M3IA 2GC0A 4XURA 3ZSJA 2UWCA 2XQXA 1QQP2 3NNGA 1PNGA 4Q27A 5FY7A 4AAPA 4P5HA 3VBFC 4O9GA 4IGOA 2P34A 3POFA 1J1LA 4IEXA 2VMIA 4LO6B 1ZREA 4IV3C 2OKXA 3UYJA 2WS91 1PGSA 2E32A 1VR3A 4NE9A 1QJX3 5FPUA 1DGRN 2HBUA 1C1FA 2WNVA 4KWKA 4KBBA 5F3EA 1FAYA 1TEIA 1XYOA 3IB3A 4L0PA 4GWIA 4Q4V3 4B29A 2WO2A 1R1A1 2W87A 1UOBA 3GBWA 1EAH3 5CEHA 1AYN2 3IIIA 4FOWA 2FDKA 2QVSB 3J8F3 2CYFA 2XL9A 1VB4A 4HG6B 5FZ7A 3WF0A 2TEPA 3ZFGA 4YARA 1NA1C 2GC2A 3E5QA 3VBUA 2XJRA 5DUWA 3RI8A 3M70A 4AG4A 4AZZA 4BM8A 5L7OC 1CONA 4HSLA 4YG6A 1BEV1 1V6JA 1W05A 2C24A 1W6MB 5IW0A 2PHXA 3HPNA 4LUKA 3RMYA 1UWWA 2EAKA 4LE4A 1KS4A 4YW2A 2VZRA 3NJXA 3SCHA 4CUBA 4NPMA 1SLTA 3M4FA 2J1TA 2JE8A 2RE9A 4LO4B 3S7IA 1L7LA 1YQCA 4QB6A 3KM5A 1C8M3 2VZ1A 3C3VA 2IXKA 4LK6A 4R4XA 5KHHA 2W92A 1VBE3 4HMZA 4E9KA 3J8F1 2WFF1 3U4XA 1KEXA 1DZRA 5JXHA 2QFEA 2E7AA 4PLMA 4QQOA 1AYN3 5IK5A 3THCA 1RUF3 5LY1A 1Y9GA 1KS5A 2Z79A 1OSGA 3LB9A 1CD3G 5FR3A 4LKSA 3C7OA 3KV5A 1BVP1 2ARXA 4LHKA 3M2MA 4Q1PA 1OPMA 3NJYA 4JTNA 4UFLA 2AUYA 1MEC3 2PELA 1HN1A 1QIQA 2X09A 1V6MA 5IVCA 1Z7S3 1Q8QA 4BXSV 4B8EA 1UN1A 2R072 3I54A 4XBQA 3H3UA 4NAMA 2JDHA 1N47A 4HLTA 4NR1A 1ENSA 1VBE1 3OGVA 5C7GA 1KDMA 1QDCA 1ZZ7A 3HMYA 1NA1B 1NCRA 3ILRA 3PJYA 4DIQA 3U1XA 2UY9A 2ZKLA 2WSVA 1SPPA 2FCUA 4XJAA 4FXGB 4AI8A 1OLMA 4WV8A 2C1FA 3X29B 2ZHMA 4Q2FA 3WP5A 1V9U1 2R042 4GMP0 4BQ1A 4FPFA 3ZFEB 4A7KA 1ZX5A 1JS9A 4IV1C 1QEXA 1GKBA 4ZZ8A 2HEVF 4K1ZA 4NO4A 5B4NA 1YFYA 2HEYF 1JZ5A 3P1IA 3H50A 4WM8C 4JHZA 3I2FA 1Z7S2 1CPNA 1EV13 1W6NB 2YYOA 4FFHA 4LULA 4Y4YA 3WDUA 4B7KA 2RR13 3GCWA 3JD72 3ITQA 1PGW2 3LPFA 1A8DA 4ZXEA 3B94A 4R4ZA 2D6OX 4P9XA 2BGCA 5A33A 3FHQA 5CNAA 3UGHA 1UYXA 4QU1A 4RSUA 1EPWA 4JGZC 5FO9B 2Q1ZB 4BIOA 5CFDB 3V0BA 1RVF3 1US3A 2CL2A 3PHMA 2D3RA 5H9RA 4RD7A 1YC61 4JGZB 5KR7A 4AXOA 2R1BA 1FNYA 4IEQA 4SBVA 1GLHA 1RUG1 3G6JB 3KQRA 4XHBA 3ZKUA 4B1LA 1HV1A 2HWC1 3LDBA 3VZMA 5FBZA 3H8OA 3NV4A 2RR11 4NHXA 4NRMA 4Y26A 5AC92 4GH4B 1BJQA 1IZ3A 5FY4A 2CTVA 4CCJA 1NOVA 5IVYA 5FXVA 3RWKX 2JKXA 4QPGB 3TAYA 5EQUA 1JZ2A 4QKNA 5JUVA 3KD4A 4JQRA 3J7NA 2FDIA 2BYVE 1HB1A 5CYYA 4WBBA 4M3CA 3PVBB 1X7NA 5FZBA 2FZ1A 4CCMA 1W39A 3T0BA 5F7UA 4DXTA 3NRUA 5J48A 2BBAA 2BVVA 1REFA 3NJZA 4CP2A 5CKQA 4AGVA 1ULGA 1JOBA 5FDBA 4Y1UA 3K51A 4Y22B 1CJPA 2VO5A 5IVEA 5FXXA 1BYHA 2WA4A 2NLRA 3AXDA 3VDBA 3POEA 5BV6A 4NAOA 4C91A 1DCSA 3VHPA 4YVSB 5C5TA 1UZVA 3UL2A 3H8RA 3ILNA 1UZ0A 2Q4SA 5A7SA 2PHWA 2Y6GA 3A22A 1NE4A 3AZVA 4PF1A 3VD7A 1P8JA 2J1EA 2A7AA 2B39A 2PN5A 1EYBA 1YJKA 4W4ZA 3WHTA 3PURA 3USUB 1U5YA 1CAWA 1AR63 2R073 2EICA 3C7EA 3S6PA 5BNOC 2XDVA 2WRAA 3LSEA 2GN3A 2R30A 1V6OA 2R1DA 3AXEA 4OI0A 5FLJA 2ZGUA 5F6KA 3HVDA 4OULA 1UIJA 5CKNA 3ETPA 1OA2A 1AR72 1MQTA 5IAXA 2VC9A 3RJ2X 2DCTA 3R4SA 3OB8A 4A7ZA 4BJ0A 4Y1ZA 3Q8BA 3U07A 2VGDA 5IK7A 3LOBA 1LR5A 4HK8A 2D6PA 1C8M1 2RS51 1QJY1 2ZMKA 3MV01 1DGLA 4Z07A 1C8NA 3U4SA 4EYUA 1W6QA 3IDEA 4LKDA 3EHKA 4S2GA 3MW2A 2W46A 2OZ6A 5FYUA 2GMMA 1DLLA 1OLME 1KD7A
chains in the Genus database with same CATH topology
1SBDA 1N3QA 2WNUC 5H9QA 3ROUA 1ZVFA 1MS0A 3IMNA 2LTNA 2RS33 3D82A 5GZFA 3OJBA 1BBT1 1C57A 4XMIA 1GZCA 2HWB1 2NMNA 3UJOA 1AR73 3WW1A 3CF6E 1ZRDA 3ZYGA 3VBHC 4CTEA 3MPPG 2D6NA 1NQDA 2PYTA 2X5IA 1UL9A 4PDWA 3OF1A 1EP0A 3N7MA 3CU7A 4XBLA 1VBC2 2PTMA 3ES4A 5T5PA 2XB6C 4A3XA 4MXWB 3MW4A 3U0ZA 1H30A 2YHJA 5CA6A 3I2DA 4BLIA 4I3GA 3POYA 3ST7A 1REEA 1AX1A 1PGL1 2GNTA 2Q8OA 1RUE2 1AR83 5GKAC 1XYPA 1F2NA 2VNRA 4XJWA 4JVAA 4I0WB 4FP2A 4LBLA 2Z2SB 2Y38A 4CDUA 3A0KA 3ACLA 5GZDA 4AEMA 2WS92 1CPMA 4Q0PA 1SCSA 2PAMA 4DRRA 3O14A 3WDWA 3QD6A 5DZGA 5JPMB 4AVSA 2XL7A 1N1TA 1JYCA 1Z78A 2HEWF 1C5IA 5ACA1 3JQXA 2Y0IA 3AKSA 3VBFA 2GH2A 2PHFA 4AEKA 4QGLA 3UKNA 5AVPA 5BYNA 1VB2A 1CAVB 2XJTA 4ITCA 1F8VA 4QMAA 1UD1A 4RR3B 1QKQA 1DDLA 2W68A 2D3PA 1WLTA 4JGYC 4FTBA 1SLBA 5T3NA 1OQDA 3CLPA 2FBEA 4AQTA 1N1VA 5JVVA 1DQ5A 2N7GA 5JR7B 1COV3 1HKDA 1N1YA 3J8F2 4JTOA 4WVZA 1OLRA 3WHUA 3B9IA 3FUQA 2AR6A 3ZXLA 1AYN1 2A3WA 5GALA 4V1PA 1AXZA 4XIKA 3URFA 3BOPA 4YFWA 3THPA 3MFCA 5FQ0A 2H6CA 4AFDA 2DUOA 4IV3A 3BCWA 1ND3C 1U5IA 1R1A3 4NVPA 5CADA 4CRQA 2IXLA 2GN7A 1SQ4A 3LAGA 3MI8A 4XFAA 1QGLA 3E5XA 1WW6A 3IM0A 4I02A 4LBNA 2PLV2 3SH3A 1COV2 4LNVA 2YV8A 4RS5C 4ZU4A 2XPJA 4X8PA 4PF5A 3KCXA 4X6RB 2ZMNA 1BKZA 2X29A 3MDPA 4ZKTB 3WCSA 1ENRA 3QACA 2YDEA 5I8YA 1D2QA 1D4M3 2X8KA 1B35B 4COUA 5C9AA 2JG8A 4RHV2 2CGPA 4Q0QA 3BU7A 2JICA 3QH7A 5E1RA 1DF0A 1NXMA 3UV9A 1EY2A 3ZMNA 2JXAA 1W2UA 3VUOA 1EPZA 1S0EA 5K0UA 5FMOS 1BVVA 3K48A 1RGSA 3CJXA 3WQ7A 2MEV1 3AKPA 5JMCA 4DY3A 3RRDA 1ZBE2 5L7OB 2OVUA 2TUNA 1R082 1W0OA 1Z7S1 3O5SA 3VBRB 2P3JA 2XBO3 1PIV3 1A8MA 5FOJB 3HWJA 1UU6A 2DF7A 1H4GA 1CVNA 4N7IA 1IGOA 3AZXA 3KT4A 4MGYE 4JGYB 1JBCA 1LHUA 5A32A 4LO7A 2HKXA 3ZN4A 3AZYA 1W6OA 2P3IA 4MGZE 4QPGC 5BNNA 4LT5A 2BNMA 2YZ4A 1ASJ2 4YVWB 2RMU3 4S2FA 3AZWA 2OUHA 3V0AB 2ZABA 1IKPA 2XBO1 3S7EA 1O5LA 3EBRA 3NKTA 5AC91 1YI9A 4L9BA 1EAH2 2B8MA 1Y9QA 3BB6A 1SACA 3AJZA 3D8CA 1AUYA 1XXNA 3RNSA 4AEDB 4BMBA 3FFQA 1RUC1 3ZDSA 3VBRC 4LE3A 4PDWB 5BUVA 1RMU3 2WZR3 4RS5B 1RUG3 4IV1B 5ABJC 1JW6A 1AR61 1Q3EA 3DL3A 4OI1A 1G9CA 3VKFC 3B93A 2GMEA 2YPJA 4YRDA 4D7YA 2NMOA 1NA1A 1NCRB 5T5JA 3WW3A 5GLUA 2Q1MA 4HT1T 2YUEA 5GJ6A 3WDXA 1AR62 1RHI2 1H8TA 1HRV1 4ATEA 1YCIA 4MUVA 1W0PA 2WZR1 2GC1A 5I0TA 2G4IA 5FPXA 1RJ8A 2DWRA 3SCGA 2VU9A 4UW6A 4WM7C 4YM3A 5KXCA 1RHI1 4E2QA 4N53A 4JRLA 1MR5A 1S0GA 3WY6A 2PAKA 2X5IC 4AHYA 2D7FA 5E89A 1AL22 1H2MA 1ZBA3 2RS31 1OI6A 4BHPA 2KA3A 4G9SB 2FQPA 2VY0A 4DINB 2DVGA 2QQPA 3VBFB 4TZDA 1R093 1ZRCA 1K5MC 2XJUA 4AQ6A 3KCCA 1HIXA 3ZSMA 1PO11 2XVKA 1G9BA 2XJQA 4YVSA 2C9AA 1TE1B 3RMXA 4JGZA 1F31A 3H1MA 4FTSA 3UK9A 4GKYA 2E7TA 3NAPB 2ZGPA 2R0FA 2YGLA 1DQ0A 3LSDA 1RUE3 4YLZA 5T54A 2DVFA 2VQAA 4K7JA 1LESA 1WBLA 1FYUA 4M3CE 1DU3D 4FOVA 4WVMB 4KGQA 4GA9A 3WVJA 1LOAA 5FO8B 4MH0E 1LU2A 3N35A 1C28A 1OHFA 2OPKA 3ZN6A 1MEC2 5C8CB 2BNNA 2V5YA 1J1TA 3SMHA 4CEYC 2XLAA 1JN2P 5FAXA 1GNZA 1RL3A 3O12A 1MQTC 3ENRA 3NW4A 1RUE1 5L19A 2OYZA 3AP6A 4KH9A 1GNHA 3D0JA 4XF9A 4GALA 4XFHA 1LOCA 1BMV1 4YSFA 2DUPA 2D3SA 2GC3A 1PZ8A 1D2SA 2RM23 3NL1A 4Y5Z0 1VRH1 1OOPC 1TME2 3FJSA 1YLLA 2EXHA 2IFWA 5KC5A 3HT2A 4DFSA 3ME2A 1I5ZA 3B5LB 4QPIC 1LB2A 3M1HA 1FPN3 1GYKA 5CB7A 1DQ4A 4GXLA 5HCFA 3B02A 1WW7A 4AYUA 1L3JA 5DG2A 5C4WB 1QJX2 4Y20B 3NSTA 1XNKA 4LLOA 5C4WC 3OYWA 4QQHA 1H4HA 2EALA 4I01A 3FBMA 4G4FA 4CEWB 1RUOA 4DB5A 4XEZA 1S1AA 1WA4A 2A3XA 2JE7A 2HWC2 4AQ2A 5F6LB 3DPRB 1H2KA 3NV3A 2O1QA 4NPRA 3MGUA 3AYEA 1CESA 2DFBA 5FREA 1ASJ1 5KBFA 3M3QA 3PNAA 2ZACA 2D5HA 4NOTA 3WDTA 2ES3A 3Q9OA 1R1A2 3LWCA 1FMD2 1RUD3 3KSCA 4I0BA 3TOJA 1YHFA 4XHXA 4KWJA 2JG9C 4D7TA 3WLUA 3MIDA 2YGMA 3POWA 4QGMA 1Q8VA 1WW5A 1UPSA 1G9FA 1VBD3 1AR92 5CFDA 3V0BB 1S0CA 4IL7A 4TSVA 2O0OA 3NV1A 2R071 3WDYA 4OUSA 1OQ1A 4COZA 5F5QA 4EROA 3IDBB 3BIWE 4F3JA 4E4ZA 1R092 1ALYA 4MZUA 5BNOB 2IC1A 3AM2A 2TBVA 1RUD1 2MPFA 1RJ7A 2MEV3 3H0OA 1ZBA1 4DQAA 4EN6B 4AI3A 2CGNA 3VZOA 3JB4C 1APNA 4W6XA 1C4RA 4LA3A 3WV6A 4HANA 1R091 5H9PA 3SITA 3ZXEA 1CAUA 3QLQA 1EV11 4PIZA 5CAZA 1XYNA 1AJOA 4GWMA 4WM8A 3KT7A 3LKJA 4YM1A 1LOFA 4FBFA 1OFSA 2ET1A 3QH6A 1MVQA 2YXSA 1BBT3 4KWLA 1XE7A 1ZBE3 4C90A 2VQ0A 3GZTB 4LTAA 3U11A 3GALA 1RVF1 2CNAA 3HBZA 1WMEA 4NWWA 3RWNA 3ZXAC 4ZU7A 3WX5A 4INDA 2XBO2 2PHLA 2D40A 1LECA 2ZX2A 3VBUB 2ZAAA 1DG6A 2W08A 2KXLA 4CDXA 1MS1A 2EXKA 1RVF2 3VBUC 4YNIA 3W59A 3AB0A 1OOPB 4HKWA 4KGGA 3TB0A 1J59A 2JX9A 4YM2A 4GIQA 1X82A 1PVC2 3IIAA 2BNOA 4Q26A 2NZ9A 2WNUA 4FPEA 3MIHA 1NG0A 3FZ3A 1XQNA 3T1MA 4W65A 1F9KA 2NM1A 4QQPA 1ONAA 3IWZA 3VBSA 2QZ3A 3M3CA 3WP4A 2OUJA 2BW8A 2JKBA 1IOAA 1IQAA 2P37A 3NAPA 5DUVA 1RUNA 3CNAA 1IS5A 4HPKB 1GANA 1TMF3 5CFDC 3ZFFA 1RUC2 4LA2A 2A5ZA 5TSWA 3INAA 4N7UA 5HI0A 2DVBA 5GLTA 4JDOA 1KRIA 4JRAA 4BA6A 3MW3A 3L2YA 4Q0UA 4QX5A 2Y0OA 5GZGA 2A6XA 2HWE1 4PCRA 5L7OA 5F1RA 1W6OB 3KS7A 5BNNB 4WM7B 1R1ZA 1AX0A 2BEOA 2DFCA 1RHI3 3KGZA 1CX4A 1KFUL 3TBDA 2QE3A 1NXD1 2QKDA 4GMP3 3NWKA 4A2UA 4OFGA 3VHOA 4F8AA 4E2GA 3FLPA 1HRV2 1NQJA 5BNQA 4JGYA 5A32B 2JD4A 4ISQA 1X8EA 2ZX0A 5KXDA 1LGBA 2NN8A 3CEWA 2E51A 1FNZA 5BPXA 3OPZA 2ZA9A 2UWAA 1TQ5A 5JOWA 4FO9A 3RYKA 4UXAA 3ZXGA 2NPIA 2VW1A 4OZXA 4PQ9A 2XG3A 3WR0A 2BTVC 2UYBA 1KDKA 1FV2A 3E6CC 1YFUA 1YXWA 2DTYA 1HW5A 1MACA 3OGGA 1WMDA 3VKNA 4IV1A 2ZBJA 1B09A 3SNMA 4RQPB 4AI0A 4UBHA 1HRV3 3A0NA 2Z5WA 4A7YA 1D4VB 4R8HA 5JLVA 2ZHNA 3EJKA 3GZUC 2PAEA 2HWF2 5J36A 5HCAA 4GH4A 1O91A 1HXS2 1H8TB 2IWGB 2VOWA 1RUF1 1AJKA 1MS3A 1WCKA 4FXKB 4AVAA 5KHJA 4AVCA 4QXKA 1PZ9A 1URXA 1LTEA 2XKOA 2QUOA 2PLV1 3FE5A 3AP9A 3B01A 4PLOA 2R0HA 4META 1HXS1 3ZXFA 3CJIB 5JSOA 1AR81 1NE6A 1QWRA 3KZ4C 2R062 2XVLA 1V00A 2TNFA 3OY8A 1TME1 1IS4A 1FPN2 1IHMA 4BWOA 2VH9A 1VBA1 1OLQA 5IK4A 1UKRA 5GZEA 5KHKA 2OA2A 2YROA 2YY1A 3EXUA 5KC6A 1V9U3 5I0SA 1FXZA 1DYKA 2ZOEB 4Y1VA 3H7JA 1NZCA 3WDVA 1ULCA 1H0BA 1DFQA 2XVGA 5DZEA 1CQ9A 3MLKA 4HKOA 5AVAA 5C9AC 3AK0A 4RA0A 2D6MA 4Y24A 1O4TA 4I2OA 2VNGA 1PK6A 1CAXA 1UIKA 2DCYA 2ETEA 4LO8A 1EV12 1VBA3 5JI7A 4QU2A 1H1MA 4P9IA 3EQEA 1GR3A 2E9QA 4IV3B 4R9AA 4XFCA 1CJDA 4KL1A 5IUQA 2A6YA 4YZ3A 1WLWA 1ASJ3 1YI7A 3M3EA 1C8M2 2ZGLA 4EN8B 1QXPA 1SEFA 4YW3A 2VG9A 5EFUA 1S0FA 3RS6A 1BEV2 3SISA 4FPCA 4CDQB 2WINB 1PGW1 1VAMA 1IKQA 2I45A 4LEJA 2QNKA 3QOPA 4N43B 4S2HA 5EWSA 3VLBB 1JTZX 1POV3 3VN4A 2WJSA 3H1WA 5E16A 3WG1A 3RG0A 4XPVA 1QXRA 1B35A 1I6XA 4IERA 3WT3A 2JG8B 5C9AB 4XQDA 1WCSA 3BOWA 4AHZA 5K7PA 2D5FA 4LBOA 5C4WA 1IS6A 4OI2A 1QF3A 2VULA 1GBGA 3JQWA 2WKKA 3ZSKA 3BTAA 1OD5A 1AYM2 3VKMA 2EF6A 1CN1A 1DQ2A 3ZYIB 3CL1A 1AR93 3MYXA 4CDUB 2E6VA 3ZYPA 3SH4A 5A3LA 1U0AA 1FATA 5HCBA 1U5XA 2DTWA 4XZPA 4AEDC 1PM7A 3GF6A 4U2AA 3OYWB 1YWKA 4TLFA 3V65A 1YFWA 5KWRA 3JCIA 2V73A 1V6KA 4AFBA 1FT9A 1N3OA 1MS9A 3BPZA 4Q4X1 4AGRA 3AMNA 1RUI1 2GU9A 4HN1A 4OHVA 4AWDA 4X8NA 4RHV3 1PIV1 1LCLA 2IXIA 1X50A 5CFCA 1AXYA 2IFRA 1UPIA 3GBGA 2IZWA 4RS5A 2A6VA 5DZFA 1H9PA 3DKWA 1MZ6A 2EXIA 4ONUA 3ZXDA 1WD3A 1RUH1 1HRI2 4M3CF 5CBLA 4BYYA 1O3QA 1NCQC 4Q4Y2 1CIWA 3L2HA 4CEWA 4QPIB 1YO8A 4YW1A 5FOBB 2MHFA 4CZSA 1KITA 2A75A 1KFXL 2PHRA 2ARBA 3VBOC 2DU1A 4CEYB 2XGXA 5J7MA 1JYIA 4MGKE 4HBNA 1TMF1 4YVSC 4Z92B 4QGNA 1RINA 2Q0AA 2H0VA 5FPZA 2P3KA 1LEMA 3KB5A 4QQ2A 4FPOB 3AKTA 5JAXA 2EXJA 4WZCA 2F6BA 4C1WA 3DPRC 3FMGA 5JPNB 2R061 4Y1YA 5H9SA 4OHYA 4CP0A 4I30A 4FPKA 4LBQB 1ULEA 4MX3A 2C0ZA 1QJZA 4EN0A 4D94A 1QNWA 1ZZ6A 2HWE2 1O3RA 1AVBA 4CDXB 3PVOA 5T5OA 1DGWA 1GZ9A 5BNOA 4N90A 3PLQA 5LK5A 2BFUL 3WW4A 4MXVA 2AENA 1DGWX 2ILMA 1BQPA 1OQEA 5FO7B 3ZN6B 5DUUA 5FTTC 5C8CA 2E7QA 5CU1A 2RJKA 1OA4A 3NO8A 1ND2B 3AYAA 1ULDA 4E2SA 3TRSB 1C3HA 2BWAA 2DCZA 1IPKA 2FHRA 4P9GA 1UX6A 3WD5A 4N9IA 3ZIXA 4Q4W3 1IS3A 3ZPYA 4FSJA 3PTYA 4K3UA 4WM8B 1J3RA 2ZGQA 1HRI1 1RMU2 1PHMA 3SHRA 2YMZA 1VBB1 4PBPA 3KT1A 1S0JA 1M06G 1BXHA 3VBSC 4L92A 4R9CA 1R081 1PO13 4M01A 1OMIA 3O0WA 3ZFFC 3VBSB 4PBOA 1ZZ9A 1WBFA 1YRZA 4I09A 3O7OA 4GMP1 1I1EA 4NHMA 5LEKA 3ZN5A 2XWJB 4HN0A 4KQ7A 4ATFA 5GZCA 1YIPA 1WUVA 4ASLA 2HYKA 1HXS3 4M0NA 4E27A 2DURA 1E57A 2AH2A 1Y43B 2O8OA 2O8QA 2IXJA 3N36A 4MXWA 4XFGA 2ZCWA 4Q4Y3 2B7YA 3GHMA 4CEWC 2XKPA 1LULA 3TWIA 1SFYA 4Y20A 1QDOA 2Q5TA 1UCXA 4XXPA 1QOSA 4DS0A 4GB31 1FOD1 3ZFGB 4IEYA 4JAAA 2DYCA 3QBQA 3KMHA 4L99A 1G8WA 5I93A 2VUAA 1O3TA 2JEMA 4XJZA 4ISRA 4HPKA 1U12A 2Y26A 5D1IA 1LRHA 2WFF2 3FC0A 4FQ4A 1FOD2 4D69A 1VRH3 4QHBA 4XXAA 5FMOL 5KXEA 3IT8A 3RSJA 2R49A 4FOQA 4XE9A 4BPZA 1MS8A 4CDXC 4EWAA 4GB33 2VVEA 3JBG3 2YC0A 1AXKA 1FPN1 5J37A 3S0MA 2VXRA 1VAKA 3MF6A 5SV5A 4ZXKA 3ZMOA 5JIUA 4FPJA 4P9JA 1LGNA 3ELNA 2OIIA 1SLLA 2JDZA 2WC2A 4RR3A 4DOUA 2VNOA 4YW4A 5FCCA 5FRAA 4OHZA 1K5MA 4HETA 4FPYA 4XF3A 1M4WA 2NYYA 2VPVA 5FLIA 4XF0A 1PO21 4XFBA 2GDFA 4FAGA 5L73A 2WT1A 1VIWB 1G9AA 1POV1 3POSA 1RC6A 1HDKA 3E6DA 5I0RA 1AHSA 4IXLA 4N53C 5L36A 2HWC3 5I8SA 2WQ4A 4Q8LA 4RFT0 1JUHA 1LOEA 1KXGA 3LA7A 1GZWB 4BLJA 4EWEA 5BNPB 4XBNA 4YGCA 3WUDA 3NVCA 3TN92 4XOGA 1PO12 2P17A 4Q8KA 3B9CA 3NV2A 2ZGOA 4MVTA 2XWBB 5CG9A 1B35C 4UW4A 1PO23 1FI2A 1RUC3 1XNBA 4KU8A 3KGLA 2FMDA 4XILA 1PK6B 1EAH1 1V6LA 1Q8SA 3R6SA 1QJU3 4JDMA 2QJVA 4AFMA 4Q4W2 2GSYA 4ORFA 3VBHB 4YGEA 5KHIA 1J3QA 5C6CA 3M7AA 4XJ9A 1NY71 4FPGA 1A6CA 2XJVA 3GBFA 2K0GA 3OY8B 4Q4W1 4OHXA 2XLGA 1X8MA 4D3WA 4QD2A 1S2BA 2E63A 4K8FA 4AEJA 5GLWA 3AMQA 2AGSA 2R6QA 2A3YA 1QJU1 3VZLA 2ZX4A 3AMMA 1R083 4PLNA 4RHV1 4YG0A 2WSUA 3VKLA 4CDQA 1ZRRA 3VHNA 5JOZA 2GZWA 4N43A 2OZJA 2ZGTA 1LGCA 2BWCA 3CJIC 1SDWA 5EV7A 3ATGA 2LALA 1OOPA 2JJ6A 4UW5A 2OW4A 1D0GA 2MEV2 3H1YA 5DG1A 3HN1A 1RUI2 3LOIA 3WOGA 1XRUA 5JSRA 1ND3B 4PIYA 1JUIA 2ATFA 2ZJCA 4FPHA 2ZS6B 3DGTA 5EZWA 2HWD2 2D43A 1NCQA 4Q1RA 3ZX7A 4COVA 1WLCA 4M0HA 3V0AA 4PDWC 4AFCA 2XH6A 4HSJA 5CFCC 3WNXA 2BQPA 2WNVB 5C33A 1DIWA 4J1XA 1WCDJ 2UU8A 3VBOA 4E4SA 2Z42A 3UKVA 3ZYJB 4Z2WA 2SLIA 3JBG2 3AKQA 4CYDA 2JE9A 2ZGSA 1Q5OA 1RUI3 1LENA 4AVBA 1V6NA 1QHDA 3JUUA 4HK9A 2XUMA 3MIFA 1NCRC 2VMGA 2ZGNA 1LHVA 2R063 4HVRA 4AEDA 4EN9B 4J6GA 1MZEA 3RI9A 4QM8A 4B7EA 3WP6A 2P2KA 3R4DB 4JCKA 4FOYA 3I8TA 5LK7B 1REDA 4HVOA 4CDWC 1VLNA 3HQXA 4Q29A 2CWMA 1S55A 3AP5A 5AC93 1AF9A 2V09A 4QT6A 2RJLA 2ZGRA 2W52A 1VBC1 4LUMA 4XQ4A 3OCPA 3WZ1A 3ZIWA 1ND2C 4OVEA 4YGBA 2XJPA 3VL8A 2GNBA 5J98B 1SBEA 2AYHA 2B5HA 5CFCB 3P3PA 5JCTA 1YJLA 1A3KA 4Q4V2 1Y7BA 4H7MA 4RQPA 1ZBA2 4IEPA 4LBJA 4O9EA 4YM0A 3RDIA 4KU7A 1AYM3 1H2NA 2A6WA 1YYNA 1JH5A 3FX3A 3HT1A 1RB8G 2GH8A 5D8AA 3FLTA 4CDUC 2A73B 4GWNA 1VBB2 1AL21 1C5HA 4UW3A 3J4UH 4HVQA 4Z8BA 3ETQA 1H8TC 4IEZA 1OPOA 3D6EA 2DVAA 1KQRA 3RYRA 4YZ5A 2EVXA 4COYA <