1R091

Human rhinovirus 14 complexed with antiviral compound r 61837
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human rhinovirus 14 complexed with antiviral compound R 61837.
pubmed doi rcsb
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
molecule tags Virus
source organism Human rhinovirus 14
total genus 40
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1990-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r09100
2BUKA 2WLPA 4YVSC 4QPIC 3NAPC 4LLFA 1EV12 1RUI3 1RVF2 1RUI1 4N43B 3VBUA 1VBD2 1RMU2 2QQPA 1PIV1 4GH4C 5C9AB 2PLV2 1H8TB 4JGYA 5A33B 1IHMA 1DDLA 1RUF1 2XBO2 5BNOA 4QPGC 1VRH2 2HWF2 1AYM2 1AR82 1FOD3 5A32A 3IDEA 1RUC1 4CDWC 1B35C 1VBB2 4GB32 3VBOC 4RHV3 1NCQC 4RQPA 1AR71 2R071 1AR62 1ND2B 3VBRB 1X36A 4GMP3 1BBT3 1RUE2 1RHI3 1RVF1 1RHI1 4GMP0 3VBSC 1VBD1 1RB8G 3FBMA 1TMF3 1TMF1 4CEYB 1QJU3 1AL23 4CDXB 2R042 5ABJA 1PVC3 3JD72 3DPRA 4WM8C 2RR12 1OOPC 5D8AA 1RUH3 2HWD3 1RUJ1 1AR81 1MQTB 1QQP1 4IV1B 5K0UA 1ND3B 4Q4V3 4Q4V1 1VBE3 1VBB1 4GB31 5ACA3 1VBE1 5ACA1 1GFF2 3CJIA 3VBFA 3JB8A 1NA1A 1PO22 5AC92 3ZFGC 4AEDA 3VBUB 1K5MC 4YVWC 4Q4X2 3LOBA 4SBVA 4JGYB 1D4M3 2GH8A 2R063 3JBG3 2R061 5BNOB 2MEV2 4CDUC 4Q4W3 2HWB3 1ASJ3 2ZAHA 5JZGC 2R041 5A32B 4RR3A 1FMD3 4FSJA 1H8TC 4RQPB 4FTEA 2HWC2 2RS12 5BNNA 1VBA3 2HWE3 4CDQC 2GSYA 1SMVA 2RS33 5L7OA 1PO21 5AC91 1NY72 3ZFFA 2WWSA 1HX6A 3J8F3 1ND2C 3VDDA 3VBRC 1PGL2 4NWWA 5J98B 4Q4Y3 5ABJB 4Q4Y1 1HRV2 2MEV1 4JGZA 3DPRB 1AR93 1HQNA 1EAH3 2WS92 5D8AB 1AUYA 4Y5Z0 5K0UB 4RFT0 1VBC2 4YVSA 1POV1 3CJIB 3VBFB 1ZBE2 1F8VA 1R091 1ZBA2 2RS11 5C8CC 2RM23 4AEDB 1PIV3 2RM21 1TME2 4GH4A 4RHV2 1RUF3 1NCRA 3TN93 1NY71 2WFF2 3VBHA 4N53A 4QPGA 3TN91 1C8M2 1PGL1 1RUC3 1X33A 1R1A1 5C4WA 3S6PA 1AR73 4RR3B 4CDWA 4IV3A 2R073 4RS5A 1R083 1HRV1 1RUD1 1QJX3 1R081 1NCQA 1A6CA 1QJX1 4JGYC 2WS91 1CD3G 5BNOC 5BNNB 2FZ2A 2X5IC 2BFUL 1PVC2 2RMU2 4Y4YA 1EV13 1RVF3 1FPN2 1RUG2 1EV11 1VBD3 1ZBE1 1RMU3 5L7OB 1ZBA1 1RMU1 1BMV2 2PLV3 1TME1 1NG0A 2PLV1 3ZFFB 1HXS2 5DDJ2 4Z92B 3VDDB 2XBO3 2XBO1 1VRH3 1HRI2 1VRH1 2WFF1 2HWF3 2BPA2 2DF7A 2HWF1 1AYM3 1RUJ3 1AR83 4JGZB 1QQP3 4WM8A 1AYM1 1C8M1 5CFCA 4WM7A 1VBB3 4GB33 1V9U2 4EJRA 1D4M2 1QJY2 1VB4A 1AR63 1AR61 2IZWA 1MEC2 4Q4W2 1RUE3 2HWB2 1RUE1 5ABJC 4YVWA 4CEWA 5D8AC 2ZZQA 1COV2 4GH4B 1PGW2 1NCRB 1AYN2 3VBHB 1CJDA 1BEV2 1Z7S2 3CJIC 2HWE2 4N53B 3ZFEA 4CDUA 4N43C 2R043 5DDJ1 5CFDA 4AEDC 2WZR2 5C9AC 5JZGA 1PO12 4NWVA 3JD73 5C4WB 3JD71 2RR13 2RS52 4IV3B 4RS5B 2RR11 1NCQB 3J8F2 1V9U1 1F2NA 5FMOL 3HAGA 1PO23 4CDQA 5AC93 2BFUS 1EAH2 3M8LA 4Q4X3 4PDWA 4Q4X1 1RUI2 2MEV3 1QJZA 5BNPA 1Z7S1 1BEV1 5CFCB 1C8NA 5GKAC 5L7OC 4WM7B 3ZXAC 1POV3 4CEYC 2TBVA 4QPIA 3NAPA 4CDXC 1R093 2HWC3 1NA1B 2RS13 2HWC1 1WCDJ 1FOD2 1VAKA 1RUC2 5C8CA 1POV0 5LK7B 2R072 1MQTC 4IV1C 4CEWB 1ND3C 1BBT2 4FTSA 4CDUB 3ZFEB 3VBUC 1R1A3 5CFDB 1RHI2 1B35A 1HRV3 1RUD3 5JZGB 1M06G 3VBOA 1VB2A 2WS93 1TMF2 1NCRC 1QJU2 1AL22 1VBC3 3VBHC 4N53C 1VBC1 2X5IA 1ZBE3 1E57A 1RUH2 1ZBA3 5FMOS 1RUJ2 4CDQB 1QQP2 2HWD2 5C4WC 3VBSA 1FOD1 1TME3 4Q4V2 4IV3C 4RQPC 2FZ1A 4RS5C 5J96B 1VBE2 5ACA2 4PDWB 4RHV1 4GMP1 2WFF3 1BBT1 5BNPB 1C8M3 1OOPA 2Y26A 2R062 3JBG2 4YVSB 2XPJA 4QPIB 3NAPB 1QJU1 1ASJ2 2VQ0A 1AL21 3ZFGA 1K5MA 3DPRC 5FOJB 5C8CB 1FMD2 2RMU3 1PVC1 5CFCC 1FPN3 1RUG3 2RMU1 1FPN1 1RUG1 4WM7C 5K0UC 1RUH1 3JB4C 2HWD1 1AL0G 1BMV1 4QPGB 1HXS3 1VBA2 3VBFC 5DDJ3 1HXS1 1NA1C 4FTBA 4N43A 2RS32 1HRI3 1HRI1 4CDWB 5C9AA 1B35B 4CEWC 3VBOB 1H8TA 5A33A 1V9U3 1QJY3 1D4M1 1QJY1 3JBG1 4Q4Y2 1MEC3 1OPOA 2X5IB 3ZFEC 2BBVA 1MEC1 4Q4W1 2ZTNA 5CFDC 1AR92 2HWB1 4RR3C 1ASJ1 3VBSB 1FMD1 1OHFA 1COV3 1COV1 1ND2A 3VBRA 1PGW1 1W39A 5BNNC 1R092 1AYN3 2RM22 1AYN1 1PIV2 1BEV3 1Z7S3 4BCUA 1VBA1 2HWE1 4WM8B 1OOPB 2WZR3 1RUF2 2WZR1 1PO13 2RS31 1PO11 2RS53 3ZFFC 4PDWC 2RS51 3TN92 3VDDC 4CEYA 4CDXA 3J8F1 1NOVA 3ZFGB 1R1A2 5BNPC 1K5MB 4YVWB 4JGZC 1AR72 1RUD2 1R082 1QJX2 1MQTA 4IV1A 1AR91 1ND3A 1EAH1
chains in the Genus database with same CATH superfamily
3TOJA 5G04L 4DPNA 4S2HA 3UNPA 1US2A 2RJLA 5D2AA 5FYTA 1TVGA 2VNGA 4QPIC 5FZAA 5CISA 1RVF2 5A7PA 3VHRA 4MHUA 3MFAA 4IEUA 3DYMA 1WA6X 2KD7A 1W6QB 4PI0A 2IXKA 1IPJA 1RTVA 2JDKA 4Q29A 2GAUA 5CA6A 2JDAA 3JCIA 1GYKA 4M0HA 5A33B 1HJFA 2XBO2 1SFYA 2ZKLA 4QPGC 1DGWA 2ZEWA 2OXBA 1VRH2 3FL7A 4H7MA 4E8DA 4Y22B 1GP4A 2HWF2 4Q8KA 1ZYBA 3WUCA 2ZEYA 2RHPA 1UQXA 3M7AA 1L7QA 1HB2A 3RYKA 2UY9A 1QIQA 3T2OA 3IDCB 5JAXA 1WLDA 4HT1T 2OZJA 1I5ZA 5C3PA 5F8PA 5I0DA 3KGLA 1LRHA 5FZBA 3J7LA 3KLSA 2GC2A 3POEA 5IVBA 4PBPA 2WZEA 3KCCA 2D6LX 2R071 5KHJA 2D40A 2W9XA 3OPTA 3WDWA 1ND2B 3P5BA 1OQ1A 5EXOA 3ZYIB 1IPKA 1QF3A 1LGCA 5KWRA 4XF4A 1BBT3 3D6EA 4FFIA 2Y34A 2GALA 2WNUA 4TTGA 2YROA 2Y33A 1PK6B 1BLZA 1JZ3A 4O7XA 3AKPA 4F3JA 3LB9A 3O12A 1ZZCA 1DQ1A 1MZ5A 4BQYA 3GJAA 2X05A 3K77A 1UY4A 2J1RA 5F32A 5FYUA 4AHZA 3FBMA 5FYIA 4LT5A 1TMF3 2HKXA 3DKWA 2Z5WA 1TMF1 2CY6A 2WIIB 1K45A 1QJU3 4YW1A 1ZRCA 4XTPA 4FAGA 4ZU4A 1QOSA 4ATEA 3W20A 3E97A 3DPRA 3X29B 2WNVC 2WWUA 3ZX7A 2RR12 2Y6FA 5D8AA 4A44A 1RUH3 2K9ZA 2XLFA 4HXCA 5DXDA 3WY6A 3RG0A 2LALA 3HNMA 1OBNA 4LIVA 4AG4A 4BMEA 5C7GA 2WL1A 1Q8PA 1VBE3 4CCOA 4XIOA 2DVDA 1VBE1 2PHDA 3OUJA 1IZ3A 1LOGA 3CJIA 3JUUA 1GNYA 3MUY1 2D43A 4XJWA 1PO22 3N3HA 4G4FA 4AHXA 3D5OA 4AEDA 3E6CC 2D6KA 2YB7A 2VQTA 4YGEA 2BNOA 2OIIA 2VTXA 2ZABA 3FLPA 3I2HA 2Y38A 3I2KA 4GWIA 4Q4X2 1SPPB 3N7MA 5CVRA 4E4DX 4E4SA 5FWJA 4Q27A 1XBFA 2Y0OA 3POSA 5FP4A 4CCNA 1D4M3 1IKQA 1QXPA 5DAQA 4HVRA 2EVXA 4BQ3A 1W8TA 1LEMA 1H30A 1J83A 4LTAA 2Y64A 3U4XA 5CAZA 3E6DA 4TWTA 5LY1A 5A1LA 1BYHA 2VCMA 2AH2A 2WA4A 1Q3EA 3P6BA 4K8RB 1R1ZA 2VZOA 3J26N 5JOXA 3A22A 1SDWA 1S4CA 2BRTA 2VBDA 2ZA9A 2PHRA 2FDIA 2HWC2 2RV9A 1ENSA 3LKJA 4FPGA 4XZUG 3C7GA 3OJBA 1W3XA 2J1EA 2XJTA 4NO4A 3WQ0A 3PL0A 1S0IA 3CL1A 4OI0A 4NIGA 3AKSA 3M3EA 3PNAA 2B7YA 3IZOA 1NXD1 4FO9A 1GP6A 5LZ6A 1TG7A 2V73A 4FOWA 4IW3A 1WCQA 2GC1A 1JZ2A 4LA3A 4BQ4A 1AF9A 3U1XA 4UF0B 2ZX0A 3WP4A 1X9PA 1BVVA 2GNDA 2VVFA 4DNYA 4NWWA 1D0GA 2GNBA 1LHUA 4LE3A 1PGSA 2MEV1 4LUKA 4QAWA 4BQ2A 5JXHA 2HJIA 1HQNA 4Y5Z0 5HCFA 1NZIA 4OFGA 3I2FA 4RFT0 2FCUA 4DMIA 3FLTA 4LO7A 2P4EA 3MF9A 3H8UA 4LBJA 5JXJA 2DCTA 1MPXA 3FWEA 2MPFA 2ZPXA 3HT2A 4HFSA 1R091 2AEYA 1FV3A 1XC6A 2OQ7A 2RS11 2JDHA 1NXMA 2YY1A 3ABZA 2D97A 4UI9L 5DG2A 5C8CC 2P3KA 4HKOA 2CWSA 1O8SA 2OW4A 3N35A 4L99A 2WFPA 4U36A 5FUIA 4P5HA 1U5YA 1QWRA 2PHFA 1DIWA 3FZ3A 4I0BA 4DXZA 2DU1A 1XPWA 3H42B 4AVAA 1DZTA 1WMEA 4UFKA 3RYRA 1OPMA 2WFF2 3P3NA 4E8CA 1VJ2A 1H2NA 3N7KA 1UD1A 4QPGA 3ZMNA 3IAPA 3BCWA 4D8MA 1W6MB 4H2AA 3POBA 1R64A 1PGL1 1N3OA 5T5JA 4NMIA 3UKNA 1RJ7A 5C4WA 3EBRA 1AR73 4RR3B 1CIWA 3LA3A 4RGGA 2VE1A 5FFOC 2XUEA 5GLZA 4PQ9A 2H0VA 3CU7A 3VDAA 2J1AA 3BB6A 4XCAA 3S5QA 5BNOC 1J58A 3CHXA 4ASMB 2X5IC 3BU7A 1NQDA 3BTZA 5FYZA 4Y4YA 1EV13 1Y9MA 2QDRA 2XLGA 3RJ2X 1RUG2 1EV11 5GZDA 3PUQA 3U4SA 1XNTA 4JX0A 3M2MA 3PMSA 5L7OB 1ZBA1 3KM5A 1H9PA 4DINB 2PHTA 4XOGA 3WG3A 5BY5A 3GGLA 1NG0A 3KVAA 4NN0A 1YJLA 2WJSA 2HEYF 4HVOA 4XBQA 3VDDB 3VZMA 2W46A 1REEA 2Z69A 2WWJA 2Z79A 4M3CA 3AX4A 3WUDA 1H6YA 1YFUA 2XDVA 2Y6HA 4ISRA 3VD9A 4OULA 2BPA2 4GALA 5FWEA 2WT0A 3DXUA 1ZRFA 5CEHA 2J1VA 3WNNA 5BNQA 3LIHA 2D93A 3HNYM 1VBB3 2RJKA 1V9U2 3AFGA 3CQOA 4GB33 3WCSA 5FDBA 1JYNA 1D4M2 1W0OA 1TNFA 3N9NA 5EWSA 4CSWA 3NNFA 5DN2A 2YBKA 4XBLA 4E2GA 4JKLA 3V56A 4LR4A 4LBOA 1FAYA 4IEYA 4EZHA 1UX6A 1OLME 2RDNA 5ABJC 4AVTA 4P9IA 4AXOA 1E5IA 1D4VB 3PTRB 1V6IA 2GU9A 5DMYA 3SKJE 1Q8OA 2V09A 3HBZA 5GZCA 1AVBA 1XYNA 2YC2A 4LK7A 4R9AA 1NCRB 1YHFA 5CG9A 5JOYA 1SLTA 2G9FA 4PHZA 2C24A 4YW6A 5A3PA 2VW0A 1DQ0A 1CJDA 1BEV2 1GWLA 1Z7S2 2D98A 4N53B 3WDUA 2AEZA 5GZGA 3HJRA 2R043 1SG3A 3OGSA 5DDJ1 3IAQA 3ZYFA 4ES8A 2HEVF 2XHNA 4NHYA 4E2QA 1JU3A 3ACLA 1W2UA 3JD73 3BTAA 3JD71 3LZZA 4IV3B 4RS5B 4A42A 4ZPIA 4TSVA 1O4YA 2RDSA 5HPOA 3THPA 1RJ8A 2EXHA 2VOVA 5C3RA 1WZXA 2PTMA 3K2OA 4YW7A 2BJSA 1CWPA 4QKDA 1F2NA 2WAAA 3T4HB 3ZIWA 1UIJA 2MNGA 1WMFA 2ZXQA 4MX3A 4XHXA 4KWUA 2ATFA 1V6MA 2BQPA 3WZ1A 2WKKA 4J6GA 1XU1A 4UXAA 2ZS6B 3IIIA 1JHJA 5H9SA 4DRVA 3IWZA 2VL4A 5A1FA 2P34A 4OMCA 2LS6A 2W2IA 5T54A 2WAOA 5FZGA 1RUI2 3RMXA 1STMA 1J84A 3ZDVA 1JYWA 4YM2A 2YYOA 4MADA 5F5QA 1V0AA 1AXZA 2X10A 3DYOA 5BNPA 2BGCA 3OY8A 2WINB 1W90A 2W0XA 4XE9A 5FBZA 3TRSB 3WINE 3KCYA 3N7JA 2RE9A 1C8NA 2VCBA 4HBNA 3POJA 4WM7B 2WC2A 3ZXAC 1POV3 1ZZ9A 2PHUA 3IN9A 2QDNA 3UKVA 3WDTA 4Q1RA 2QZ2A 5ERLA 4AF9A 4TLGA 1K42A 3N4MA 1N1SA 3PJQA 1FOD2 1O6UA 2EXIA 2VM9A 5C8CA 3LCPA 5LK7B 2A71A 3ACFA 4URTA 5JOWA 1F4HA 5BPXA 2X53S 4FOVA 3TEXA 3QLQA 1QKQA 4YARA 4BE3A 2WDBA 2YFUA 4HLTA 5IVFA 2A73B 3R6SA 2NPIA 2VMEA 2PHLA 1PMHX 3GZEA 4P14A 3ZSJA 4FTSA 4RN5A 1QXJA 1VR3A 1R1A3 4P9JA 5CFDB 1VPHA 5FY1A 1EPZA 5FZLA 4JDNA 1XU2A 4CCMA 1B35A 1GNHA 1S2EA 1UKRA 1HJGA 3AZXA 3O1UA 2FDGA 5DQ0A 1TNRA 1X82A 1RL3A 3I3EA 5H9RA 1IS6A 5GLVA 3OD0A 1HW5A 3VBHC 1GU3A 2X5IA 1S55A 1KXGA 2DBIA 4NHXA 1CZVA 5D21A 4OQ9A 1ZBE3 2ZACA 1OFSA 1GZWA 2V4AA 1AXKA 3N9QA 3ZLIA 5LA1A 2E63A 2HWD2 4N9IA 4ASLA 4K40A 2E7AA 3ZSKA 4AI3A 2FZ1A 4EWAA 5J96B 2CU5A 5ACA2 3FJSA 3LGRA 2PAEA 3K46A 4WVMA 3WNPA 3THDA 5TSWA 1UZZA 4GMP1 2CV6A 1GNZA 3U10A 5A7SA 1YO8A 1LESA 3MBWA 4XFGA 3MW4A 4FPEA 5IAVA 5KHIA 1D0HA 1OOPA 4I3GA 4QMAA 1H2KA 1XSRA 5HCAA 4LHLA 1DYKA 2BV4A 3GALA 2FDHA 3ZXKA 3JBG2 1QY4A 3RFRA 1WUVA 1E5HA 1W8WA 3VHNA 4QPIB 2ZCWA 1DZQA 3FFZA 5A6YA 3M70A 2DTYA 1YFYA 3KF3A 3ZFGA 3O1OA 3MEPA 1J1LA 1G8WA 3CBNA 4KU8A 3FUQA 5JPNB 4JAAA 5F2WA 3VHPA 2RMU3 5FO9B 2RMU1 1W9YA 5C8WA 2IXCA 2XMLA 3L2HA 5M0TA 3KF5A 4OZXA 1IS5A 4OYUA 3LA7A 4AHYA 2VH9A 1BMV1 4BISA 5DAVA 1H1AA 2ENRA 2C1FA 1VBA2 2CTVA 4QPGB 4JQRA 1LOFC 2ZEXA 4HG6B 4D94A 1HDKA 4B1LA 1ZX5A 4M3CF 4FTBA 3IBMA 3O1MA 2RS32 3K4ZA 2PFWA 1W6QA 2VUDA 1HRI3 1HRI1 4BQXA 1Z78A 2D6PA 2PN5A 4CEWC 4DS0A 1YYNA 4XDOA 3EXUA 1XOYA 4FVVA 5A33A 3TB0A 2ETEA 1YQCA 2NM1A 3C2UA 1XNBA 4I0AA 4QM9A 4YZ2A 2HLEA 1O59A 3OUHA 4Y22A 1MEC3 3UL2A 3ZFEC 4MV2A 1LHOA 1MEC1 2ORXA 4LO5B 5F3GA 2ZTNA 1PNFA 4AEKA 4BHPA 3DKQA 2GMMA 1UN1A 3DUIA 2ZMLA 4RR3C 1ASJ1 3LIGA 1SQ4A 5EP9A 4ISQA 5DZGA 1W28A 2YU2A 4QDRA 3UESA 4KI5M 2LM3A 3ZR5A 3ILRA 1PX3A 1O8PA 3AZWA 1ND2A 3O0XA 2FQPA 4AAPA 1REFA 2D5FA 1AYN3 1H1MA 1Y4WA 1AX2A 1AYN1 4QPWA 3WNXA 1MACA 1PK6A 1O5UA 4QXCA 3QOPA 4YG3A 2F4PA 2WNVB 3KV6A 2WZR3 1HB1A 2WQ4A 1RUF2 1EUTA 3JQXA 2WZR1 1PO13 4FPCA 1PO11 4YPJA 4H55A 1Y7BA 4J1WA 5A6ZA 1O91A 3O1VA 1X8MA 5HCBA 3TN92 3VD3A 3VDDC 3MYXA 2I2SA 1WCKA 3WW2A 2V72A 3MIGA 3C3VA 1O4ZA 3IIAA 3WVJA 3W5NA 1XSQA 3L9JT 3AZYA 1JUHA 4QU2A 1R1A2 5FQ0B 5FPBA 2Q0AA 3SCGA 2NLRA 5FZFA 2BU9A 2LROA 4YSFA 1W9FA 4K1YA 5FLJA 1O3TA 2JE9A 3AM2A 1AR91 1UY2A 4AI2A 2XLAA 3ACHA 5I93A 4YFZA 3VUOA 2BUKA 2WLPA 3M3QA 3USSA 4XQ4A 3GDBA 3NAPC 3FC0A 1SCRA 3HQXA 4LLFA 1ZZ6A 5DZEA 3E5UA 4P00B 1VBD2 1RMU2 2CGNA 2D6MA 3J7NA 4L8QA 3NMBA 5A3OA 1UYYA 5FLHA 1IPSA 1PIV1 1NT0A 1GOHA 1SPPA 4LMFA 3TEZA 3BYWA 1X50A 4EN9B 4JRAA 3SXWA 2W1QA 1SCSA 5IVYA 4CP0A 4A3XA 5JLVA 2Z4FA 3LEIA 2ZHLA 4OUMA 1OVSA 5KHKA 2W39A 5L9VA 3WHUA 2JD9A 1AR82 3ROUA 5BXXA 1AXYA 4M0NA 2BP6A 3N7LA 3UKTA 1W6NB 4D3WA 4CDWC 4DY3A 5FTTC 1XE0A 3K3OA 5FY0A 4XUTA 2ZMKA 4RHV3 5F5CA 1JHNA 1QHDA 1AR62 3ZYHA 4DUXA 2I07B 2IFRA 2ET1A 4XVHA 1V00A 3KB5A 4LIUA 1F5FA 2Q8CA 2E7TA 1MS1A 4XURA 1W9SA 4JVAA 4QM8A 4L9BA 2GMPA 4KBBA 3AMPA 1GR3A 4CUCA 2Z42A 1RHI3 3NNJA 1RVF1 4YW5A 4WZFA 1RHI1 2XKOA 2VMHA 3VBSC 4W4ZA 3JZVA 1RB8G 2EIGA 2NQYA 2C0ZA 2D3PA 3RDIA 1IQDC 3D4KA 3LSDA 3P3PA 4QX7A 4A7KA 4XABA 2D3SA 4MYEA 5F6KA 4CEYB 4UF0A 5AVAA 1AL23 2WN2A 2HBUA 4KBZA 3VKLA 3THTA 3ZMOA 3OGVA 5APAA 5JR2A 2JDNA 3ZDSA 2R6QA 4WM8C 3ZSMA 4D6SA 2IXLA 1CQ9A 3BPSA 4GWMA 3F2ZA 2QFEA 1RUJ1 3UJQA 1SBFA 2NP0A 1QEXA 5FPZA 4Q4V3 4UFJA 2VUAA 4Q4V1 3OEAA 3MZHA 5LB6A 2WO3A 4NPMA 1GFF2 3H1MA 3O0VA 4XF9A 4XTMA 4Z07A 1W6OB 3PLQA 3MIDA 4LPLA 5EJ3A 1LOFA 2IVJA 1E5RA 5AC92 3CZJA 3I7DA 2P6CA 4Q0SA 5FUNA 4LXLA 1N47A 1Y3TA 3R4SA 4XYXA 5IK4A 5F6LB 5HV0A 1QH7A 4LBQD 4YG0A 3AMNA 3KT4A 4XFCA 3V0AB 2PHWA 5FK7A 5BNOB 3TAYA 1YI7A 1W6MA 1UCXA 1Q5OA 1U0AA 2HWB3 1N1YA 2ZAHA 2X29A 3U75A 2WUHA 2PELA 2VZUA 5FZOB 4RR3A 4GJZA 4AFAA 1FMD3 4YYOA 1F31A 1H2MA 2OPWA 4JKMA 4B8EA 5LW9A 4QDQA 1QMJA 1MS9A 2ZAAA 2XUMA 4Q1PA 4FTEA 1ZM1A 1IQAA 1OC1A 1CJPA 2EIEA 3ZYPA 5T5LA 2HWE3 1GANA 4FQ4A 3PIJA 4HONA 5I0SA 5L19A 1LU1A 5L7OA 3WP6A 1PO21 1SLIA 4HANA 2PAMA 4GAZA 1CZSA 1F15A 1HB3A 4I02A 1XE7A 1APNA 3USUA 3KCXA 2WWSA 3J8F3 5CG8A 3VDDA 3NSTA 2N7GA 4LBQB 2A7AA 5I91A 1OT5A 1J3RA 1PHMA 4CPBD 1N3QA 2QQUA 2DV9A 2X8KA 5ABJB 1HRV2 4HN0A 5FMBA 5KXBA 2DVGA 4LJHA 5DAPA 3MW2A 4AQTA 4R9DA 2WS92 4UFHA 2WSVA 3RWNA 4Z1VA 1AUYA 3A0KA 3UK9A 2WA3A 4FXKB 5K0UB 5FR3A 2OVUA 4Y33A 5FP8A 1VBC2 3NV1A 1A34A 1RXFA 3DN7A 3B69A 1FV2A 2J1TA 3IDBB 4R9BA 2W47A 2ET7A 3WR0A 3HN3A 4BYYA 4D7YA 5HI0A 2VO5A 3HQUA 3H3LA 3WCRA 1YFWA 2LRPA 1AZDA 2PQQA 2RM23 3BIWE 2RM21 5I0UA 1TME2 3R4UA 3CF6E 4RHV2 5IK8A 1NCRA 4AW7A 4CE8A 4XZPA 5B4NA 5FPXA 4P02B 4BB3A 3AYAA 4NOTA 3MGUA 4N53A 1W2AX 1TE1B 1LB2A 4XJZA 2DCYA 2QQOA 4FPLA 1C8M2 3BGAA 3ZKUA 1JYTA 2B9UA 3GBWA 1X33A 5JMCA 4AFDA 5LEKA 3UYJA 1GLHA 4CDWA 2ZZJA 2R073 1DQ2A 3N9OA 4IV3A 1R083 4LBKA 4RS5A 4DXTA 2VPVA 1QJX3 1R081 4INDA 1DCSA 4XACA 3I3QA 1QJX1 3ZN5A 3C7HA 4JGYC 5C3SA 4PLMA 3T0DA 3JXSA 3O1PA 3AKQA 4XAEA 2AZ5A 4OI2A 2GMEA 1XE8A 4A4AA 2AACA 4QGLA 1NLRA 2JDMA 1XJAA 5F1RA 2XG3A 3WQ7A 3CDZB 1UL9A 1FPN2 3DEMA 4ZHNA 3AKRA 1OKOA 4UFMA 4I09A 2PLV3 1FATA 2GH2A 4FPOB 4GWNA 3SLIA 2PLV1 2CWMA 3AJZA 1HXS2 1MS5A 3AXDA 5I8SA 2ZGQA 3ZFFB 1XNCA 4Z92B 4A45A 1JI6A 4PCRA 5DZFA 5GM0A 2WFF1 4QB2A 3H8RA 3ACIA 4MG2A 1PX4A 3MF6A 1AYM3 4JGZB 1ZRIA 4WM8A 1AYM1 2W5FA 4WM7A 5SV5A 4XBNA 2HEWF 3RI9A 2P6HA 3UT0A 1N1TA 2VAUA 3AYEA 3UV9A 2XXZA 3SQOA 4AOCA 3OBTA 3E5XA 2ZOEB 3Q8CA 1QOTA 2JJ6A 5IATA 4AI8A 5IFTA 3OOXA 2BOIA 1RUE3 2HWB2 3J9SA 4LE4A 1RUE1 4FFFA 1QJEA 5A6XA 2XHKA 3HQRA 4WBBA 3LA2A 4HSJA 3S7IA 5SV8A 2ZZQA 1NLSA 4EE2A 4GH4B 2E33A 4QQLA 1HN1A 5IK5A 3JQWA 5CKQA 3WT3A 3MDPA 5JCTA 1EP0A 1SEFA 1WCSA 5CIRA 3GJBA 4X6QB 3PUIA 4NUBA 1MZFA 1W05A 3W58A 3VBHB 4CCJA 2HWE2 1A8DA 1JU4A 3IDAA 4RYDA 2YBPA 4D6QA 5CFDA 4OI1A 3VZJA 1ZRRA 4LK6A 1BK1A 2Q5TA 4NWVA 4LHNA 2WZ8A 2RS52 1AHSA 3AP4A 2YPDA 4UW4A 4CU7A 4OVEA 4XCBA 2JKBA 1NCQB 1WBLA 2VZQA 1WGPA 3J8F2 3M1HA 5E6HA 1VIWB 1MR5A 2DBNA 4QQ2A 3GF6A 2CSGA 2ZGMA 1V9U1 4Z8BA 1YQ5A 3B9IA 4FT8A 4Q8LA 1V6JA 5FMOL 5DG1A 1NAEA 2B5HA 2CAVA 3J4UH 4ITCA 2XONA 5FZIA 3HAGA 2WT1A 5C70A 1UU4A 2DUOA 2RG4A 4Q26A 1OH3A 2A6ZA 3SCFA 4GXLA 1VLNA 4J1XA 2Q8EA 3B02A 4BA6A 4QX1A 4V2WA 3RSJA 1DQ4A 1JZ8A 3AP5A 3QCWA 1VAMA 1GSLA 1CAXB 3LE0A 3VV1A 1REDA 3OSDA 3WW3A 1C1LA 2JDZA 2XVGA 4HKWA 4I2OA 2MEV3 1QJZA 3BOPA 1ST8A 3I8TA 2E51A 2VZVA 1Z7S1 1BEV1 3VZLA 5JOZA 4XFHA 4FP2A 4NIAA 3PVBB 1ENXA 4QQHA 3I4IA 1UXXX 3ZYBA 2WBKA 5CYYA 4A3ZA 1CIYA 2TUNA 3EQEA 4CEYC 2JENA 3TNPB 4DXSA 4QPIA 4OI4A 4P9YA 1R093 2G4IA 1FI2A 2RS13 2ARXA 1UZVA 2EXJA 3O0WA 1WCDJ 2BEOA 2E26A 3LWCA 1POV0 4JZRA 4D0QA 2EXKA 3B93A 4P9GA 2R072 4CEWB 1F9KA 1ULGA 2VOKA 3AFKA 2YUEA 4RFRB 2WSUA 5CZKA 2B9VA 2C9KA 1DU3D 1OLMA 2W52A 1DGWX 4OUSA 1BBT2 4LKEA 4LO6B 4CU8A 1W0NA 5FZ0A 3I3MA 3OGGA 3PDQA 3B5LB 1YIFA 3ZFEB 5T50A 1O4TA 5FP3A 4BIFA 3RYPA 4Y1XA 3ZYRA 2PA7A 3O7OA 1JYCA 5JZGB 1OA3A 1KJLA 1JUIA 1VB2A 3ACGA 3NWKA 4TYSA 3UGFA 1RINA 5EJ1B 1TMF2 3ZIXA 3OTFA 3VB9A 5LBBA 2XL9A 3SC7X 1QJU2 4RSUA 4DEQA 1KRIA 3NJXA 2ZX3A 1YXWA 3GBGA 2P1BA 2OQ6A 3RZHA 5IVVA 5F5IA 4AI9A 4MGZE 3ZYGA 1E57A 1RUH2 1ZBA3 3BVCA 1QH6A 3PTYA 1JMUB 1FOD1 2HYKA 2Q4SA 3NV2A 2IFWA 4L97A 4F8AA 5ISLA 3NV4A 1HV1A 2BDRA 3USUB 1VBE2 2R16A 1ZVFA 2DVBA 3FBYA 3KHBA 2JDPA 3G6JB 4P9WA 4WV8A 3F95A 2JE7A 5F9TA 3I3DA 4G9SB 3EMRA 2VQUA 4XPVA 4QHOA 4DB5A 1CAWB 1JYXA 3LQCA 4CUGA 2NMOA 1S0EA 4HKLA 1M4WA 1YLLA 4PF1A 1KEXA 2WNVA 2JE8A 5IUQA 3NVCA 2ZGLA 2Y26A 3I2JA 4FPFA 4KL1A 3PUAA 4AI0A 3HVDA 5FPAA 2B8MA 3UJOA 4A7ZA 3EYPA 4GKYA 4RGKA 4AVSA 3VD4A 3NAPB 3H0OA 3AZVA 2WO7A 2VQ0A 5FQ0A 2F17A 3GNEA 3H7JA 4NHLA 5CB7A 5CADA 2ES3A 2CYFA 1GP5A 4ZXKA 1PVC1 3T08A 5CFCC 1DGRN 4YG6A 4IETA 2C9AA 4YNIA 1WW7A 4UT5A 5K0UC 3VLBB 2HWD1 2XJPA 1VAVA 1UX7A 5DAWA 5FO7B 3SMHA 3WXPA 1ACCA 1YWKA 3K3NA 2VG9A 4JKKA 2R1BA 3V64A 1ULEA 5DDJ3 3WQBA 1EUUA 2B39A 5IHRA 1DQ5A 1XNKA 1PZ7A 1WLWA 4HZFA 4BWOA 3NJYA 5FUPA 1KFUL 4CDWB 3E1F1 4Q5OA 4BQ1A 5FYHA 3O1RA 5EIYB 3KSCA 3PVEA 5A3TA 2C6SA 2KA3A 1FT9A 2AUYA 2JEMA 1QJY3 1QJY1 3JBG1 3HR9A 2Q30A 3U0ZA 1OPOA 4Q4W1 3K4AA 4NHKA 3U07A 3BTXA 3ENRA 1OVPA 3WDYA 2XVLA 1W2OA 2DTWA 2YC4A 1UOBA 1W6NA 3ZXLA 4IEOA 3VBSB 4IGQA 3M3CA 1OHFA 1COV3 2VZSA 1D7PM 3ZVXA 1COV1 2PHXA 5JSOA 5KR7A 2ARBA 1PGW1 5LBCA 3TNQA 1R092 1G9DA 1XNAA 2O8QA 3KWVA 4LO4B 1MZ6A 3INAA 5A3MA 4BCUA 1VBA1 5DUUA 4A7YA 5FZ6A 1NQJA 1L3JA 4OZOA 4WM8B 4YW3A 4D69A 4NHMA 4Y5SA 1SZBA 4ET7A 5A1AA 3CKHA 1H0BA 2XH6A 1VP6A 2RS31 5FKCA 4M3CE 4ZY9A 2JG8C 3ZFFC 4PDWC 1V6LA 1XYPA 3MICA 4PBOA 3OB8A 4CEYA 1RYYA 1Q43A 1SDDB 5ANNA 3EJKA 2E32A 3FHQA 4J25A 2B45X 5FKBA 2QTWB 2DDUA 1G9FA 4OMDA 1NX9A 1UOFA 2WQ8A 4IEWA 2XKPA 4JGZC 1AR72 3GZUC 2E7QA 3AXEA 3VHOA 1KS5A 4ONUA 1UMHA 3VZNA 3WNOA 1MS3A 2VZ3A 4XXPA 3SNMA 2XQXA 1EAH1 3R0RA 2P5BA 4P9XA 4GQ7A 4UW6A 4BDVB 4CP1A 4WVWA 5LY2A 4YVSC 3LOIA 2VULA 4X8NA 4NVPA 1W6OA 3H8XA 2IC1A 4CVUA 3KD4A 4PIYA 2ZHKA 5A3UA 1EV12 4N43B 5C71A 2A1XA 5J37A 3VZKA 2QQPA 5FZ1A 5I8TA 1LGBA 1UNBA 2I74A 4GH4C 3WF2A 1G6NA 4COZA 2A6WA 1GWKA 2WO1A 1V6OA 1GZ9A 4FOQA 2FDJA 2ZX1A 4LHKA 1IS4A 3V0AA 5KC6A 1RUF1 2OUHA 4K3UA 5BNOA 5I8YA 1JN2P 1VMHA 5T5OA 4KMQA 2LTNA 3W21A 4ES9A 2ZGPA 4YGDA 3K4DA 3PU8A 1W9WA 2ARAA 5FZOA 4Y5TA 4YZ5A 3GM8A 2ZMNA 1RUC1 3O5SA 3PMEA 1VBB2 1UY3A 1W0PA 2JD4A 4GB32 4MGSA 3VBOC 5L36A 4OHYA 1NCQC 2EAKA 3OPWA 2QQLA 4YZ1A 2P3IA 4GWJA 4HOOA 3BKZA 4CCCA 2JIGA 1X36A 4GMP3 2D6OX 3N36A 2YXSA 1WCUA 4Y20B 5K9YA 4UOJA 2VOWA 2VZTA 3AK0A 3PUHA 3MLJA 2J42A 3HN1A 4W6YA 1H4HA 2LUWA 3MLKA 3PIGA 4O9EA 1VBD1 4Z2AA 4ZU7A 2VR4A 2YGLA 3OUIA 5LCWL 4OLLA 3VKMA 3VDBA 3VL8A 4BM8A 3FHIB 1WW4A 1UU6A 5GLTA 4KQ7A 2D3RA 4E27A 3U11A 2VECA 3ZKYA 3ETPA 4LBQA 3C8XA 2R042 2PQSA 3AKTA 3LEKA 1GQPA 1VMFA 3NNMA 4CDXB 4JDMA 1FYUA 2DUPA 1DLCA 4IEZA 5ABJA 3JD72 1LCLA 4QD2A 1OI6A 1W8ZA 1KDMA 4QU1A 4AFCA 5C3QA 2ZX2A 3HPNA 4NE9A 5KHGA 1LOBA 1AR81 2WYSA 1QQP1 1LNSA 4IV1B 5K0UA 4AQ2A 4BH9A 4AEJA 1BVP1 1CZTA 2WRAA 1MVQA 4CXXA 4BIOA 1C3HA 2VGDA 5T52A 1AJOA 4L11A 1JZ4A 4MHRA 3JB8A 2WYFA 4B7KA 4DOUA 3RZMA 4A6OA 3PJYA 3VBUB 1K5MC 4YVWC 3T09A 3RZJA 2XGXA 2R1DA 1JBCA 3MUZ1 3RPQA 1S1AA 5DUXA 1OD5A 1HQLA 4DUWA 5KBFA 2I45A 2W1WA 3KV5A 4SBVA 1Y9QA 2KM2A 4XDQA 4JGYB 3AP6A 4Q0VA 4KNCA 2R063 1YNAA 4KG8A 2R061 1YI9A 4HETA 5T3NA 1PMJX 1DQ6A 4HL0A 2VMFA 4XUQA 4JQTA 1ASJ3 2R0HA 5EZWA 1DGRA 5JZGC 5A32B 5A80A 1LHNA 4CPBA 5HCHA 4XILA 4ATFA 5J1XA 2JIJA 4BJ0A 4OHXA 4PIXA 4MGTA 1H8TC 4RQPB 4CXWA 2DVFA 2VUJA 1IGOA 4U2AA 1MS8A 3M3OA 1X8EA 3ELNA 3THCA 5FYBA 3MW3A 3ORJA 2BZDA 4YWAA 3ON7A 5C5TA 5J09A 4BXSV 2GSYA 4FPYA 3RJRA 4A2UA 4AZZA 2VMGA 3SHRA 5AC91 1D2QA 5ANQA 1U5IA 2R30A 4XHBA 1NY72 5FYYA 5A6QA 2UWCA 3WG1A 3ZFFA 4HK9A 3K75B 2L9LA 2E9QA 3AB0A 3I3BA 3VBRC 4AVVA 1RIRA 2YZ4A 4IGPA 2ZHMA 5CU1A 3NL1A 4ORFA 5A7WB 2BVVA 2P2KA 4Y1UA 2QBXA 1X7NA 3T3YA 4Q4Y3 3AL6A 5LK5A 4OQ8A 4Q4Y1 5JSPA 3NO8A 4MGYE 4JGZA 4P9LA 4CCKA 3C7OA 1AR93 4FXGB 4XQDA 5FYCA 5IJRA 4F7ZA 2ADDA 2Q8OA 2QQNA 2QQMA 3POFA 2H0BA 4S2FA 4YVSA 3A23A 3VL9A 3NNLA 1HV0A 2HH9A 4QHZA 5LRSA 2GP5A 3VBFB 1ZBE2 3PU3A 2JDUA 2EIBA 2WLQA 2G9GA 3ES1A 2A3WA 1CAUB 3FN9A 1NLQA 1PIV3 1W04A 1QDOA 3POGA 1PNGA 4EROA 5KXEA 5A70A 1YQ6A 2DVAA 3HWJA 1OUXA 1JOBA 4GH4A 4I01A 4B3NA 4QKBA 3ILFA 5B4XA 3GXUA 3QD6A 2R7EB 2R0FA 4IE4A 3URFA 3VBHA 4C1WA 2NMNA 4CTEA 4JTOA 2CL2A 2V5YA 4GKXA 4GD4A 3LDRA 3UGGA 4JRLA 3S5AA 4I30A 2F4LA 5K4LA 3ZR6A 5AFBA 3S6PA 4QXBA 4JV4A 4COYA 5FPVA 1JOPA 2QQWA 1HRV1 1RUD1 5JIUA 3MIBA 1NCQA 3DCQA 3NKGA 5F2SA 5JXIA 2A75A 5A3WA 1RUOA 2WS91 4NAOA 3G7DA 3SKVA 1O7FA 3VN4A 1J3QA 1DFQA 4IESA 1CAVB 1OF3A 3WNMA 4NAMA 5BNNB 1BCXA 1LHWA 4MZUA 1U5ZA 4YW4A 3V65A 2BFUL 4AVBA 2RMU2 4R9CA 1RVF3 5L9RA 5HXVA 3B94A 4XF3A 4XJ9A 4XXAA 1T6BX 2EALA 3RZZA 4CCEA 4XQWA 4UBHA 5FY4A 2OS2A 1BMV2 3DL3A 2YHJA 1TME1 2G9ZA 1LULA 2D44A 2BNNA 2IUWA 2JWPA 4PI2A 1O3SA 4K7JA 3I2DA 3I97A 1CAXA 4MOAA 2XBO3 2A5ZA 2XBO1 2W3JA 2SBAA 1VRH3 4BQ5A 1HRI2 2WNUC 1VRH1 3I49A 1UZ0A 2HWF3 1CX1A 3IKWA 1DLLA 2HWF1 4RGAA 5FY9A 1RUJ3 1NUKA 1C8M1 3H3UA 4PLNA 5KXDA 4ZKTB 1UIKA 3HBKA 2JECA 3AMMA 1H4GA 1IKPA 4EJRA 1FX5A 1Y43B 4QKNA 1OQDA 4ZZ5A 3RWKX 5FZEA 1I3HA 2ZGTA 2D6NA 2IZWA 5FPLA 3WX5A 1MEC2 4CA9A 2ZGOA 1LTEA 1RXGA 3ATGA 3H8OA 1F4AA 4D7SA 3MHZA 3HNBM 3WP3A 2A6VA 5FYSA 4YVWA 3BUCA 1H1IA 3AC0A 2GDFA 4CEWA 5D8AC 3N9LA 3LFIA 2VTXJ 1G9CA 2AGSA 3QH6A 4MUVA 1S2KA 2QQJA 2Z2SB 1LHVA 1KQRA 1AYN2 2QCSB 1J59A 3CJIC 5FXVA 4I0WB 4QWNA 4Y26A 4N43C 3ZFEA 5J36A 3WF0A 4AEDC 1OD3A 1JYIA 2DUQA 2WZR2 1GKBA 3ZXEA 3GHNA 5JZGA 1JH5A 1PO12 1P8JA 3PVNA 2RR13 3BU0A 2IXHA 2RR11 4LORA 5CBLA 4DY5A 1GICA 4LO8A 3GZTB 3VD5A 5FXXA 4MXVA 4PQQA 2BWAA 3WW4A 1BJQA 2W91A 3NJVA 4IEQA 1OSGA 2BWCA 4YZ4A 4AFBA 5JI7A 1HB4A 1CGPA 1PO23 2KXLA 1SLAA 3AP9A 4XJ8A 4CYDA 2B42B 2H6BA 2VD7A 4LOSA 4G3YC 2IWGB 3KT1A 5J7MA 5FBJA 5FZ9A 4JTNA 1UWWA 3HT1A 4Q4X3 5IVCA 4Q4X1 3NJZA 4L2NA 5LATA 3RGBA 3J7MA 4RA0A 3IPVB 4L0PA 4XJAA 2Y60A 3OCPA 1CAWA 1WD4A 4KWKA 4C91A 3ZN6B 1PMIA 3EB7A 5J48A 4LOTA 1XB9A 1LAJA 1W8FA 2GZWA 5LA2A 1QGLA 1SACA 4LQRA 5FYMA 5CFCB 5GKAC 3CO2A 3KMHA 1YEWA 5FLIA 1ULFA 3AMQA 3ILNA 5C33A 1X9TA 4YW2A 1ODNA 3NAPA 4CDXC 5HXMA 2HWC3 1Q8VA 2HWC1 2NZ9A 2ZGUA 4NRMA 5FO8B 1VAKA 3ZXGA 4QX8A 5FY8A 2ILMA 2J7MA 3QACA 1GOGA 1WKYA 1XRUA 3DYPA 5IAXA 2VNVA 4IV1C 2K2SA 3QBQA 5GJ6A 4PT6A 4ZS2A 1DBNA 3A0NA 2XR4A 2YU1A 1CESA 4AEMA 3AYDA 3LD8A 3I59B 4MGIE 2VZPA 2QQIA 1KS4A 5JI9A 4CDUB 1EPWA 2YV8A 5E8AA 1UOGA 3VBUC 4FQZA 1RHI2 2A3XA 1JYVA 2OZ6A 2RDQA 5FREA 2BBAA 1TZOA 1O3RA 1M06G 1C1FA 1U5XA 2Y6KA 4K9SA 1ZZBA 4GULA 2FHRA 2WQZC 1AL22 5GALA 1JTZX 5JDBA 4X8PA 4QX2A 3POIA 1UZWA 4FCAA 2BGOA 2PXJA 1PM4A 2R32A 1UY0A 2CAUA 2CDPA 4OHWA 3WF4A 4B4RA 2Q1FA 5FK8A 5FPUA 3MV11 3SITA 3O1TA 3OPZA 5FMOS 1RUJ2 4CDQB 3U78A 5C4WC 3VBSA 1JS9A 5E16A 5C3OA 4Q4V2 1YQ2A 4RQPC 4LA2A 3DF0A 3WNLA 2JG8B 3OBZA 4PDWB 3SISA 3KQRA 4YRDA 4YM0A 4QQPA 3Q8FA 4NIIA 2WFF3 5JVVA 1J3PA 1KGYA 1BBT1 2VNRA 4EN6B 3WLUA 1SBDA 4QXKA 1IG3A 1QNWA 3OYWB 2FDFA 1OQEA 2OUJA 1NE6A 1UY1A 3RMYA 3ASIA 3E5QA 2GNTA 2H6CA 3KQ4B 4LHSA 4COUA 4K8FA 1C57A 4M00A 4E4ZA 3PUSA 2YG0A 4MSVA 3RQ0A 3T2TA 1GZTA 4YVSB 2A3YA 4QPYA 2B46X 2XPJA 4URAA 1W3VA 1DHKB 2P3YA 3FX3A 4YGBA 1QJU1 1RGSA 3MI8A 3NRUA 3OD4A 4XFAA 2VQAA 1BHGA 1QOOA 3CNAA 1FMD2 2VNOA 3AVSA 1H6XA 4XW3A 5C6CA 1KDKA 2OX0A 1RUG3 3FUOA 3AZZA 1LENA 1RUG1 3LEMA 4R4ZA 5H9QA 1GZCA 5CKNA 1RUH1 3JB4C 2R49A 2O8OA 1PZ9A 3KGZA 4XFFA 4V1PA 4QB1A 4NIHA 3VZOA 2EA7A 3P1IA 3OF1A 4P08A 4XJUA 3VBFC 1NA1C 4Q0PA 4DRRA 1I5PA 3M4FA 4XUPA 4AR2A 1UXZA 4N43A 1W6PA 4KWLA 1FXZA 5FZKA 3WOGA 5EYYA 4YZ3A 3WV6A 5IT6A 1JZ6A 2VOTA 3B9CA 2CGPA 1S0DA 3ZSEA 3VBOB 2AYHA 2JXAA 2C5DA 1OLRA 4IEPA 1F5JA 4H7LA 3IM0A 4NPRA 3MO4A 1V9U3 2JX9A 4FFGA 2UY8A 4BK5A 3T1LA 2VW2A 1D4M1 4GZ9A 5FZ7A 3RS6A 2BBVA 3Q8EA 1N3PA 5FV3A 5F39A 3A21A 3H50A 1IG0A 2VUCA 2BERA 2O1QA 1ZA7A 2QE3A 2EAAA 4WVZA 5A7OA 1FNYA 1SLCA 1UYXA 2VXJA 5LEJA 4GJYA 2IXIA 4SLIA 4LULA 3T0AA 3UGHA 3ES4A 3ZXJA 4E4HA 4C0HA 1W39A 2ZGNA 2JG9C 5BNNC 4XF0A 1V6KA 4DZGA 2IVIB 3MPBA 4N8MA 2RM22 4YGCA 3UETA 3ALQA 1Z7S3 1BEV3 4Y20A 4E9KA 3LDKA 4LITA 3Q8AA 5CKMA 1MZEA 3HOBA 2BNMA 1ZNPA 3OBAA 2O0OA 4L92A 2Q8DA 4Y1YA 2OT7A 1NE4A 3T4VA 4PLOA 5IFPA 3RZKA 1UAIA 3VDCA 1UPIA 2ZGSA 1ALYA 1ENRA 1W2NA 1S0FA 2BGPA 1ONAA 1HN0A 1W8OA 5FXWA 4MGQA 5L73A 4CCLA 4IDZA 1C4RA 4CDXA 1GMMA 4HPKB 3V0BB 3KHCA 4LKDA 4MXWB 2YFZA 3POYA 5EPAA 1K5MB 3ME2A 4YVWB 5BNPC 4N90A 4XF1A 4ZONA 1R082 4LBNA 1QJX2 1POQA 4IV1A 2YMZA 4QX5A 1CPNA 2GC0A 5FJKA 5IWFA 1G9BA 4FPJA 3T2PA 3AP7A 4AHWA 4CRQA 3FE5A 4YLZA 2ZGRA 1UPSA 2ERFA 3OGJA 4ARXA 4NPLA 3RRDA 1KD7A 2V5DA 1RUI3 2ARCA 2DURA 1RUI1 1UYZA 3VBUA 4CP9B 4DFSA 1OUSA 1L7RA 2VW1A 2E53A 2XQRA 5C9AB 5JR7B 4FPKA 2PLV2 2UU8A 2WNOA 1S0BA 2XOMA 1H8TB 5FZMA 4JGYA 3RZGA 4AFMA 1GBGA 1IHMA 2ZGKA 1Z0HA 3KZ4C 1DDLA 1LU2A 1S0JA 1ULCA 1ZZ8A 1JOJA 2VZRA 4MGKE 4N9HA 1JXNA 2FBEA 3ZYJB 2XJVA 2OKXA 1E5SA 1AYM2 1CN1A 3VKNA 3EO6A 1FOD3 5A32A 3DV8A 4EQVA 5EHDA 3C7FA 3IDEA 1QJFA 5KHHA 1B35C 4EZ4A 1MS4A 1OXCA 3KS7A 5GZFA 4AE2A 2JKXA 2XJSA 3OBRA 4RQPA 1AR71 3H9AA 5LWBA 3H3ZA 1MS0A 3OGRA 2W87A 5LBEA 5A3LA 3VBRB 4CU6A 2EICA 2YPJA 1RUE2 4BPZA 4ASKA 3OEBA 2QKDA 4XDPA 2DCZA 4TZDA 3FMGA 4E2SA 2QJVA 2VMIA 4R4XA 4UBGA 3D0SA 1ZZ7A 5FZ3A 4JHZA 2GN3A 1I6XA 2VJXA 4NROA 4GMP0 4O65A 4AQ6A 1WW5A 1DZRA 4A41A 1L7LA 2VBPA 4QGMA 1PVXA 1RITA 2QNKA 2Y0IA 3CZUA 4B7EA 4NRPA 4DIQA 5A7WA 4HK8A 4LUMA 5LRRA 5T5PA 3J7HA 3MIHA 1MVEA 4RL7A 2FCVA 1PVC3 4M4RA 2Q1MA 3FLRA 1OOPC 1CVNA 4B29A 1PM7A 5FRAA 4B4QA 2CNAA 2HWD3 4XFIA 3TBDA 3O1SA 1MQTB 2ZBJA 1G9AA 3B00A 2WNEA 1ND3B 2B4KA 4XEZA 2W68A 1VE0A 3LSEA 3WEZA 4WZCA 1VBB1 4GB31 4B4PA 5ACA3 5ACA1 4BXFA 1K12A 3CMGA 4NJ4A 4XMIA 3VBFA 1NA1A 1IS3A 1Q56A 4LLOA 3WDXA 1CAUA 2E31A 3WP5A 3ZFGC 4MVTA 4AGRA 1V70A 4R8HA 5L9BA 1C5HA 4Y1ZA 1VRBA 4Z82A 2A6XA 2P17A 4S2GA 1W2TA 4IEVA 1V6NA 4JDOA 4IGOA 3NW4A 4MO3M 3SH5A 3GHMA 3QH7A 1KFXL 4MH0E 4UW5A 2VCAA 2G19A 2XB6C 3BTYA 2GH8A 3JBG3 1S0GA 3MIFA 4ARYA 3EHKA 2MEV2 2F6BA 4CDUC 4Q4W3 1QU0A 4Z2WA 4QKFA 1H9WA 1QDCA 4EN7B 2OYZA 4O61A 2W1UA 2AREA 4BU2A 4COVA 2R041 2K46A 1K5JA 2RDRA 4PF5A 4FSJA 2VTFA 1GV9A 4NR1A 1ZA4A 1OA2A 4COWA 1J1TA 2WO2A 2Y8KA 5LA9A 5E1RA 2RS12 2QQKA 2UYAA 2A70A 1CAVA 2JB4A 2JG9A 3A7QA 4Y24A 1OKQA 3SH3A 4F83A 5BNNA 1SLBA 1UW8A 1VBA3 3U37A 2WNUB 4CXYA 4CDQC 1WLCA 1I1EA 4IXLA 1GUIA 1SMVA 4CCDA 3ZPOA 2RS33 5KXCA 2J1SA 4W50A 1UYPA 3N9PA 5EQUA 2A6YA 2VZ1A 3ZPYA 1AX1A 4A6SA 5FCCA 1WLTA 1GOFA 1HX6A 3MV01 5F7UA 1ND2C 1PGL2 5FZ8A 3I2GA 1W06A 2XWBB 4N7UA 5J98B 5FZDA 1JW6A 1LECA 4W6XA 1PK6C 1JZ7A 1W8HA 2WN3A 2WABA 4TN7A 3DPRB 3GZAA 5D8AB 1EAH3 1DF0A 2PAKA 1DG6A 5AVPA 4EWEA 3LDBA 4QDSA 2X09A 3RI8A 3Q8BA 1LKNA 3S57A 3PVOA 4R52A 4FP3A 5E89A 3DECA 4KU7A 3I2OA 1POV1 1U12A 4CUBA 1LOAA 4AAXA 4EWDA 3APBA 3CJIB 2VMCA 5DABA 1W6PB 1F8VA 1HIXA 1ZBA2 4Q2FA 3MPPG 2GN7A 4Q0UA 4QT6A 1BZWA 4AEDB 1EYBA 4FAHA 5I0RA 5A7NA 1DYOA 1TQ5A 3WHTA 4UWDA 5FY7A 2DU0A 3CJXA 4IL7A 1RUF3 5H9PA 2HBTA 2VMDA 3SH4A 3TN93 1NY71 2W1SA 3SEPA 3TN91 1WMDA 1XXNA 5EV7A 2CGOA 3T2QA 2O14A 4CP2A 2YBSA 3DXTA 1YCIA 3K48A 1RUC3 5FZ4A 3TYJA 3WD5A 4DQAA 1A78A 5J3UA 3POWA 2W92A 1R1A1 5FYVA 3VKOA 4QGNA 5AFEA 3MIEA 4IE7A 3Q9OA 3B3QE 3ZXDA 4HVQA 5JUVA 5I0TA 1C28A 2YDEA 1A6CA 1BKZA 5FP7A 5JXGA 4NRQA 4W65A 4I3PA 2DFCA 2FCTA 4QXHA 5FIXA 2LW8A 3HMYA 1CD3G 2FD8A 4QB6A 4CZSA 4HN1A 5DPNA 2CHHA 2FZ2A 4DXRA 3WQ1A 3WF3A 1W03A 5EJZB 1PVC2 3ZSLA 1ULDA 3O14A 1PZ8A 2VXRA 1HKDA 1VBD3 1ZBE1 1RMU3 3RVHA 1YRZA 1RMU1 4UFIA 2ZKNA 1LODA 5DUWA 3ZOIA 3IMMA 2GP3A 3B01A 3T1MA 1ZREA 2QQVA 5FP9A 2UURA 3IPVA 5DDJ2 3SCHA 2NYYA 5F37A 2J22A 5BUVA 3C7EA 4IUGA 4AI1A 3ZN6A 2NN8A 5IVEA 2ZX4A 1G86A 2XJUA 1ULOA 2DFBA 2JB8A 2DF7A 3I2IA 3JU9A 3NNGA 4NIDA 5CFCA 1AR83 1QQP3 3DGTA 3BN6A 2VU9A 1LEDA 1DYPA 1UOJA 1KITA 5LA0A 2EIDA 4YM3A 5JIAA 1QJY2 3KV9A 1VB4A 1AR63 1UMIA 4EV0A 1AR61 4YM1A 1G7YA 3K51A 1UZYA 3BPZA 4Q4W2 5T55A 1BQPA 2OA2A 3ITQA 1RUNA 5JMOA 3TEWA 2AC1A 1UU5A 1KJRA 1W9TA 5KC5A 5BYNA 2ZJCA 3IMNA 3WW1A 1COV2 3RNSA 4CU9A 3OG2A 1PGW2 4S2DA 4LBLA 1W8UA 2VC9A 1NKGA 2ZHNA 3I59A 3VKFC 3BOWA 4AVCA 3L2YA 5G05L 3W9AA 2DCJA 1S2BA 5JSRA 2XVKA 4YFWA 4CDUA 4BMBA 4OCTA 3BIEA 2FMDA 2E6VA 4IE6A 5C9AC 5E88A 1Y9GA 5C4WB 5EYXA 4EN0A 5FMDA 2EF6A 3LEGA 1VMJA 3AMHA 4Y1VA 5C5UA 4K1ZA 3MLLA 4QHBA 3IB3A 3GCWA 5IW0A 3LF7A 5F5AA 5FJHA 5IYYA 4OHZA 2G1MA 2CDOA 3ECQA 4CDQA 3LFMA 5AC93 3NV3A 1K3IA 1NYWA 1W8NA 1EAH2 2BFUS 3CLPA 3LPFA 1SHWB 3M8LA 2DCKA 1ZRDA 4XETA 4LNVA 2JG8A 1AJKA 4PDWA 4D7TA 4QX3A 1UMZA 1FNZA 4BLJA 4D6RA 1CPMA 2OPKA 2UWAA 2WZPP 3U14A 4MLOA 3WDVA 2C4XA 2BW8A 4OUEA 1LR5A 4M3CB 4DEVA 4X6RB 1JODA 5K7PA 1SFPA 4H3WA 4LKSA 4AYUA 3OYWA 2DYCA 3SEEA 4ZS3A 5A3NA 5L7OC 3FFQA 5LBFA 3S7EA 3T0BA 2FMYA 1XYOA 4C8DA 4Y4RA 2UWBA 3AL5A 4UAPA 2FDKA 4GA9A 5FZHA 1WD3A 4KH9A 3T30A 2TBVA 3B7MA 1WBFA 3S0MA 1ENQA 3BALA 1XNDA 4Y3OA 5DUVA 1NA1B 3CIHA 1RUC2 4XUOA 1DGLA 4XUNA 3TWIA 1NZCA 2JICA 5A7QA 2P3JA 1WW6A 1MQTC 4LKFA 4C1XA 1YUDA 3ZO0B 1ND3C 4DO0A 1O3QA 3GBFA 4UYBA 2W08A 1YC61 4ZU5A 3WSOA 4K20A 1A3KA 3H7YA 4AWDA 1CR7A 4W6WA 2C26A 5GLUA 4KGQA 2XJQA 2XJRA 4XAAA 4FPHA 4AGVA 4IERA 4LBMA 1YIPA 1AX0A 1HRV3 1RUD3 2JDYA 1O5LA 3AVRA 2HYXA 3VBOA 5IVJA 2BOJA 2RJ2A 2SLIA 2WS93 4M4PA 3MFCA 2W94A 3LPGA 3E6BA 1H8VA 1NCRC 1EY2A 1GQGA 1B09A 2JG9B 5F3IA 1US3A 1VBC3 1LGNA 4N53C 1VBC1 1W99A 4C90A 1ODMA 4UFLA 1TEIA 2Q1ZB 3A4UA 2VY0A 1OH4A 4BOWA 1QQP2 4RD7A 1OF4A 1QXRA 4JCKA 1TME3 4IV3C 4RS5C 1BK0A 4RHV1 4FBFA 4ZZ8A 1T2XA 3AYCA 4FI9A 2IXJA 1N1VA 2VVEA 3D82A 4PIZA 2BTVC 2GC3A 1HQWA 1F35A 2XWJB 5JWPA 1OA4A 4HSLA 3PURA 5BNPB 3OY8B 1C8M3 3RZLA 3CEWA 2QVSB 1LOCA 4EYUA 5IK7A 5FAXA 2ID4A 2QZ3A 3NKTA 2P37A 4KG0A 3BI3A 3LAGA 1SLLA 5FOBB 2R062 3HEIA 3PHMA 1OFNA 4OHVA 4XFBA 3GCXA 2YC0A 4FFHA 4V2VA 3V0BA 2VBBA 4HPKA 1URXA 3W5MA 2VOXA 3KT7A 1IOAA 1ASJ2 1I9RA 1UF2C 1AL21 4MXWA 5CNAA 1LOEA 1K5MA 4WVVA 1OMIA 1XQNA 2BYVE 2Y6JA 3DPRC 1D2SA 4FOYA 4IEXA 5C8CB 5FOJB 3TEYA 1GWMA 5K8SA 1FPN3 1WMXA 2WR9A 1FPN1 5F3EA 4WM7C 4IE5A 5FMCA 3R05A 5FZCA 2AR6A 1Q8SA 1AL0G 1WA4A 4QX0A 4QQOA 2PYTA 1CX4A 1HXS3 3ZM8A 1RC6A 1HXS1 5EFUA 1YFXA 5FY5A 4XC9A 4BQWA 1HLCA 4P5YA 4C0BA 3H1WA 4CP9A 1H2LA 1LJ7A 2TNFA 4JC1A 3ETQA 1BXHA 4EN8B 5C9AA 3HIFA 4O9GA 1B35B 4AK3A 1SFNA 2ORZA 4B1MA 1H8TA 3HD8B 4TLFA 1UO9A 2GNMA 4GIQA 4XMAA 1OURA 4K6BA 3VD7A 2ADEA 2XL7A 1T6GC 5FXZA 5GLWA 4Q4Y2 1DP0A 1GQHA 2KR2A 2X5IB 3D3AA 2UYBA 5CFDC 2YGMA 4ZXEA 1AR92 3GYDA 1GZWB 2K0GA 2VVDA 2HWB1 4XIKA 3WG4A 2W95A 3WNKA 3KV4A 4AL9A 4IQPA 3ST7A 2AENA 4IE0A 1FMD1 3AJYA 1ULPA 3VGIA 2J1UA 5DAXA 4HMZA 3VBRA 2TEPA 4KWJA 3S30A 4WVMB 3I54A 3NQHA 3H1YA 1JZ5A 1PIV2 2WT2A 1YJKA 3KVBA 2HWE1 2D7FA 5HBAA 4LEJA 2Y6GA 2PMWB 3IT8A 1OOPB 2QUOA 4PJYA 3ZXFA 4BK4A 1C5IA 3D8CA 4CUAA 5F3CA 2RVAA 3LOBA 3N9MA 2RS53 4KGGA 2VCCA 1OLQA 2RS51 4Q0QA 1A8MA 4M01A 4N7IA 3WF1A 4TXWA 1CONA 1SBEA 2Y6LA 1WWYA 3WG2A 4W8JA 3J8F1 2BVBA 2D5HA 4H14A 4BLIA 5B2GB 3D0JA 1NOVA 3ZN4A 5GZEA 3M3IA 3ZFGB 3W59A 4AQSA 4DUVA 5BV6A 5JPMB 1Q8QA 4BZ4A 2MHFA 3FHAA 1YQ8A 3R4DB 5D1IA 1RUD2 1VALA 5LASA 5HV4A 4JHTA 2DWRA 4K21A 1MQTA 4UW3A 4META 2ZEZA 1S0CA 3BODA 1ND3A 4AGGA 2V4VA 1UKGA 1QNYA
chains in the Genus database with same CATH topology
3TOJA 4DPNA 4S2HA 2RJLA 2VNGA 4QPIC 1RVF2 3VHRA 3MFAA 4IEUA 1W6QB 2IXKA 1IPJA 1RTVA 4Q29A 2GAUA 5CA6A 3JCIA 4M0HA 1GYKA 5A33B 2XBO2 1SFYA 2ZKLA 4QPGC 1DGWA 1VRH2 4H7MA 4Y22B 2HWF2 4Q8KA 1ZYBA 3WUCA 2RHPA 3M7AA 3RYKA 5JAXA 2UY9A 3IDCB 1WLDA 4HT1T 2OZJA 1I5ZA 3KGLA 1LRHA 3KLSA 2GC2A 4PBPA 3KCCA 2D6LX 2R071 5KHJA 2D40A 3WDWA 1ND2B 1OQ1A 5EXOA 3ZYIB 1IPKA 1QF3A 1LGCA 5KWRA 4XF4A 1BBT3 3D6EA 2GALA 2WNUA 2YROA 1PK6B 3AKPA 4F3JA 3LB9A 3O12A 1ZZCA 1DQ1A 1MZ5A 4AHZA 3FBMA 4LT5A 1TMF3 2HKXA 3DKWA 2Z5WA 1TMF1 2CY6A 2WIIB 1QJU3 4YW1A 1ZRCA 4XTPA 4FAGA 4ZU4A 1QOSA 4ATEA 3E97A 3DPRA 3X29B 2WNVC 3ZX7A 2RR12 5D8AA 1RUH3 2K9ZA 2XLFA 5DXDA 3WY6A 3RG0A 2LALA 4BMEA 4AG4A 2WL1A 1Q8PA 1VBE3 4XIOA 2DVDA 1VBE1 2PHDA 1IZ3A 1LOGA 3CJIA 3JUUA 2D43A 4XJWA 1PO22 3N3HA 4G4FA 4AHXA 3D5OA 4AEDA 3E6CC 2D6KA 4YGEA 2BNOA 2OIIA 2ZABA 3FLPA 4Q4X2 5CVRA 2Y38A 4E4SA 5HI0A 3LOBA 3N7MA 4E4DX 4Q27A 2Y0OA 3POSA 1D4M3 1IKQA 1QXPA 4HVRA 2EVXA 1LEMA 1H30A 4LTAA 3U4XA 5CAZA 3E6DA 4TWTA 1BYHA 2AH2A 2WA4A 1Q3EA 1R1ZA 3J26N 5JOXA 1SDWA 2ZA9A 2PHRA 2HWC2 1ENSA 3LKJA 4FPGA 3OJBA 4NO4A 2XJTA 3WQ0A 1S0IA 3CL1A 4OI0A 3AKSA 3M3EA 3PNAA 2B7YA 1NXD1 4FO9A 2V73A 4FOWA 2GC1A 4LA3A 1AF9A 2ZX0A 3WP4A 1BVVA 2GNDA 2VVFA 4DNYA 4NWWA 1D0GA 2GNBA 1LHUA 4LE3A 1PGSA 2MEV1 4LUKA 2HJIA 1HQNA 4Y5Z0 5HCFA 4OFGA 4RFT0 4DMIA 3FLTA 4LO7A 3MF9A 4LBJA 3H8UA 2DCTA 3FWEA 2MPFA 2ZPXA 3HT2A 4HFSA 1R091 2YY1A 1FV3A 3B9IA 3KS7A 2RS11 5DG2A 1NXMA 5C8CC 2D97A 2P3KA 4HKOA 2CWSA 3N35A 2OW4A 4L99A 2WFPA 4U36A 4P5HA 1U5YA 1QWRA 2PHFA 1DIWA 3FZ3A 4I0BA 4DXZA 2DU1A 4AVAA 1DZTA 1WMEA 3RYRA 1OPMA 2WFF2 3P3NA 1VJ2A 1H2NA 3N7KA 1UD1A 4QPGA 3ZMNA 3BCWA 1W6MB 1PGL1 1N3OA 5T5JA 3UKNA 1RJ7A 5C4WA 3EBRA 1AR73 4RR3B 1CIWA 3LA3A 4RGGA 5FFOC 5GLZA 4PQ9A 2H0VA 3CU7A 5BNOC 3BB6A 1J58A 4ASMB 2X5IC 3BU7A 1NQDA 4Y4YA 1EV13 2XLGA 2QDRA 3RJ2X 1G9BA 1RUG2 1EV11 5GZDA 4I2OA 3M2MA 3PMSA 5L7OB 1ZBA1 3KM5A 1H9PA 4DINB 2PHTA 4XOGA 3WG3A 5BY5A 1NG0A 4NN0A 1YJLA 2WJSA 2HEYF 4HVOA 4XBQA 3VDDB 3VZMA 1REEA 2Z69A 2Z79A 4M3CA 3AX4A 3WUDA 1YFUA 4ISRA 4OULA 2BPA2 4GALA 2WT0A 1ZRFA 5BNQA 2D93A 1VBB3 2RJKA 1V9U2 3AFGA 4GB33 3WCSA 5FDBA 1D4M2 1W0OA 1TNFA 5EWSA 4XBLA 4E2GA 3V56A 4LR4A 4LBOA 1FAYA 4IEYA 1UX6A 5ABJC 4AVTA 4P9IA 4AXOA 1D4VB 1V6IA 2GU9A 1Q8OA 2V09A 3HBZA 5GZCA 1AVBA 1XYNA 4R9AA 1NCRB 1YHFA 5CG9A 5JOYA 1SLTA 2G9FA 2VW0A 1DQ0A 1CJDA 1BEV2 1Z7S2 2D98A 4N53B 3WDUA 5GZGA 2R043 5DDJ1 4ES8A 2HEVF 4E2QA 3ACLA 1W2UA 3JD73 3BTAA 3JD71 3LZZA 4IV3B 4RS5B 4TSVA 1O4YA 3THPA 1RJ8A 2EXHA 2VOVA 2PTMA 1F2NA 3ZIWA 1UIJA 2MNGA 1WMFA 4MX3A 4XHXA 2ATFA 1V6MA 2BQPA 3WZ1A 2WKKA 4J6GA 1XU1A 4UXAA 2ZS6B 5H9SA 4DRVA 3IWZA 2P34A 5T54A 1RUI2 3RMXA 4YM2A 2YYOA 5F5QA 1AXZA 5BNPA 2BGCA 3OY8A 2WINB 2W0XA 4XE9A 3TRSB 5FBZA 3WINE 3KCYA 3N7JA 2RE9A 1C8NA 4HBNA 4WM7B 2WC2A 3ZXAC 1POV3 1ZZ9A 2PHUA 3IN9A 2QDNA 3UKVA 3WDTA 4Q1RA 2QZ2A 4AF9A 3N4MA 1N1SA 3PJQA 1FOD2 2EXIA 5C8CA 3LCPA 5LK7B 2A71A 5JOWA 4URTA 5BPXA 2X53S 4FOVA 3QLQA 1QKQA 4YARA 4BE3A 4HLTA 2A73B 3R6SA 2NPIA 2PHLA 4P14A 3ZSJA 4FTSA 1QXJA 1VR3A 1R1A3 4P9JA 5CFDB 1EPZA 4JDNA 1XU2A 1B35A 1GNHA 1UKRA 3AZXA 1TNRA 1X82A 1RL3A 5H9RA 1IS6A 5GLVA 3OD0A 1HW5A 3VBHC 2X5IA 1S55A 1KXGA 1ZBE3 2ZACA 1OFSA 1GZWA 1AXKA 2E63A 2HWD2 4N9IA 4ASLA 4K40A 2E7AA 3ZSKA 4AI3A 2FZ1A 4EWAA 5J96B 5ACA2 3FJSA 3LGRA 2PAEA 4WVMA 5TSWA 1UZZA 4GMP1 2CV6A 1GNZA 3U10A 1YO8A 1LESA 4XFGA 3MW4A 4FPEA 5KHIA 1D0HA 1OOPA 4I3GA 4QMAA 1H2KA 5HCAA 4LHLA 1DYKA 3GALA 3ZXKA 3JBG2 1QY4A 1WUVA 3VHNA 4QPIB 2ZCWA 1DZQA 3FFZA 3M70A 2DTYA 1YFYA 3ZFGA 3MEPA 1J1LA 1G8WA 4KU8A 5JPNB 3FUQA 4JAAA 3VHPA 2RMU3 5FO9B 2RMU1 5C8WA 2IXCA 3L2HA 4OZXA 1IS5A 3LA7A 4AHYA 2VH9A 1BMV1 1H1AA 2ENRA 2C1FA 1VBA2 2CTVA 4QPGB 4JQRA 1LOFC 4D94A 1HDKA 4FTBA 1ZX5A 4M3CF 3IBMA 2RS32 2PFWA 1W6QA 1HRI3 1HRI1 1Z78A 2D6PA 2PN5A 4CEWC 4DS0A 1YYNA 3EXUA 4FVVA 5A33A 3TB0A 2ETEA 2NM1A 3C2UA 1XNBA 4I0AA 4QM9A 4YZ2A 4Y22A 1MEC3 3UL2A 3ZFEC 4MV2A 1LHOA 1MEC1 4LO5B 4AEKA 4BHPA 2ZTNA 1PNFA 3DUIA 2GMMA 1UN1A 2ZMLA 4RR3C 1ASJ1 1SQ4A 4ISQA 5DZGA 2LM3A 3ILRA 3AZWA 1ND2A 3O0XA 2FQPA 1REFA 2D5FA 1AYN3 1H1MA 1AX2A 1AYN1 3WNXA 1MACA 1PK6A 1O5UA 3QOPA 4YG3A 2F4PA 2WNVB 2WZR3 3JQXA 2WQ4A 1RUF2 4FPCA 2WZR1 1PO13 1PO11 4H55A 1Y7BA 4J1WA 1O91A 1X8MA 5HCBA 3TN92 3VDDC 3MYXA 2I2SA 1WCKA 3WW2A 3MIGA 3C3VA 1O4ZA 3IIAA 3WVJA 3L9JT 3AZYA 1JUHA 4QU2A 1R1A2 5FQ0B 2Q0AA 3SCGA 2NLRA 4YSFA 4K1YA 5FLJA 1O3TA 2JE9A 3AM2A 1AR91 4AI2A 5I93A 2XLAA 4YFZA 3VUOA 2BUKA 2WLPA 3M3QA 3USSA 4XQ4A 3NAPC 3FC0A 1SCRA 3HQXA 4LLFA 1ZZ6A 5DZEA 3E5UA 1VBD2 1RMU2 2CGNA 2D6MA 4L8QA 5FLHA 1PIV1 1X50A 4EN9B 4JRAA 3SXWA 4CP0A 1SCSA 4A3XA 5JLVA 2ZHLA 4OUMA 5KHKA 2W39A 3WHUA 1AR82 3ROUA 5BXXA 1AXYA 4M0NA 3N7LA 3UKTA 1W6NB 4D3WA 4CDWC 4DY3A 5FTTC 2ZMKA 4RHV3 1JHNA 1QHDA 1AR62 2I07B 2IFRA 2ET1A 1V00A 3KB5A 1F5FA 2E7TA 1MS1A 4JVAA 4QM8A 4L9BA 2GMPA 4KBBA 3AMPA 1GR3A 2Z42A 1RHI3 4YW5A 1RVF1 4WZFA 1RHI1 2XKOA 2VMHA 3VBSC 3JZVA 1RB8G 2EIGA 2NQYA 2C0ZA 2D3PA 3RDIA 3D4KA 3LSDA 3P3PA 4A7KA 2D3SA 4MYEA 5F6KA 4CEYB 5AVAA 1AL23 3VKLA 3THTA 3ZMOA 3ZDSA 2R6QA 4WM8C 3ZSMA 2IXLA 1CQ9A 4GWMA 2QFEA 1RUJ1 3UJQA 1SBFA 2NP0A 5FPZA 4Q4V3 2VUAA 4Q4V1 3MZHA 1GFF2 3H1MA 3O0VA 4XF9A 4XTMA 4Z07A 1W6OB 3PLQA 3MIDA 5EJ3A 1LOFA 5AC92 3I7DA 4Q0SA 1N47A 1Y3TA 3R4SA 4XYXA 5IK4A 5F6LB 1QH7A 4LBQD 4YG0A 3AMNA 3KT4A 4XFCA 3V0AB 2PHWA 5BNOB 3TAYA 1YI7A 1W6MA 1UCXA 1Q5OA 1U0AA 2HWB3 1N1YA 2ZAHA 2X29A 2PELA 4RR3A 4AFAA 1FMD3 4YYOA 1F31A 1H2MA 4B8EA 1QMJA 1MS9A 2ZAAA 2XUMA 4Q1PA 4FTEA 1ZM1A 1IQAA 1CJPA 3ZYPA 5T5LA 2HWE3 1GANA 4FQ4A 5I0SA 5L19A 1LU1A 5L7OA 3WP6A 1PO21 1SLIA 4HANA 2PAMA 4I02A 1XE7A 1APNA 3USUA 3KCXA 2WWSA 3J8F3 5CG8A 3VDDA 3NSTA 2N7GA 4LBQB 2A7AA 5I91A 1J3RA 1PHMA 1N3QA 2DV9A 2X8KA 5ABJB 1HRV2 4HN0A 5KXBA 2DVGA 3MW2A 4AQTA 4R9DA 2WS92 2WSVA 3RWNA 4Z1VA 1AUYA 3A0KA 3UK9A 2WA3A 4FXKB 5K0UB 2OVUA 1VBC2 3NV1A 3DN7A 3B69A 1FV2A 3IDBB 4R9BA 3WR0A 2ET7A 4BYYA 4D7YA 3WCRA 1YFWA 2RM23 1AZDA 2PQQA 3BIWE 2RM21 5I0UA 1TME2 3R4UA 3CF6E 4RHV2 5IK8A 1NCRA 4AW7A 5FPXA 4XZPA 3AYAA 4NOTA 3MGUA 4N53A 1TE1B 1LB2A 4XJZA 2DCYA 4FPLA 1C8M2 2B9UA 3GBWA 1X33A 5JMCA 4AFDA 5LEKA 1GLHA 4CDWA 2ZZJA 2R073 1DQ2A 4IV3A 4LBKA 1R083 4RS5A 2VPVA 1QJX3 1R081 4INDA 3ZN5A 1QJX1 4JGYC 4PLMA 3AKQA 2AZ5A 4OI2A 2GMEA 1XE8A 4QGLA 1NLRA 5F1RA 2XG3A 3WQ7A 1UL9A 1FPN2 3AKRA 4I09A 2PLV3 1FATA 2GH2A 4FPOB 4GWNA 3SLIA 2PLV1 2CWMA 3AJZA 1HXS2 1MS5A 3AXDA 5I8SA 2ZGQA 3ZFFB 1XNCA 4Z92B 4PCRA 5DZFA 5GM0A 2WFF1 3MF6A 1AYM3 4JGZB 4WM8A 1AYM1 4WM7A 5SV5A 4XBNA 2HEWF 3RI9A 1N1TA 3AYEA 3UV9A 3OBTA 3E5XA 2ZOEB 1QOTA 2JJ6A 4AI8A 3J9SA 1RUE3 2HWB2 4LE4A 1RUE1 2XHKA 4WBBA 3LA2A 4HSJA 3S7IA 5SV8A 2ZZQA 1NLSA 4GH4B 4QQLA 5IK5A 3JQWA 3WT3A 3MDPA 5JCTA 1EP0A 1SEFA 1WCSA 5CIRA 4X6QB 1MZFA 3W58A 3VBHB 2HWE2 1A8DA 5CFDA 4OI1A 3VZJA 1ZRRA 1BK1A 2Q5TA 4NWVA 4LHNA 2RS52 1AHSA 3AP4A 4UW4A 4OVEA 2JKBA 1NCQB 1WBLA 1WGPA 3J8F2 3M1HA 1VIWB 1MR5A 4QQ2A 3GF6A 2ZGMA 4Z8BA 1V9U1 4Q8LA 4FT8A 1V6JA 5FMOL 5DG1A 2CAVA 2B5HA 3J4UH 4ITCA 3HAGA 2WT1A 1UU4A 2DUOA 4Q26A 2A6ZA 3SCFA 4GXLA 1VLNA 4J1XA 3B02A 4BA6A 3RSJA 1DQ4A 3AP5A 3QCWA 1VAMA 1GSLA 1CAXB 3VV1A 1REDA 3WW3A 1C1LA 2JDZA 2XVGA 4HKWA 2MEV3 1QJZA 3BOPA 3I8TA 2E51A 1Z7S1 1BEV1 3VZLA 5JOZA 4XFHA 4FP2A 3PVBB 1ENXA 4QQHA 3I4IA 2TUNA 3EQEA 4CEYC 2JENA 3TNPB 4QPIA 4OI4A 4P9YA 1R093 2G4IA 1FI2A 2RS13 2ARXA 2EXJA 3O0WA 1WCDJ 2BEOA 3LWCA 1POV0 2EXKA 3B93A 4P9GA 2R072 4CEWB 1F9KA 1ULGA 2VOKA 3AFKA 2YUEA 2WSUA 1DU3D 2W52A 1DGWX 4OUSA 1BBT2 4LO6B 3OGGA 3B5LB 1YIFA 3ZFEB 5T50A 1O4TA 4BIFA 3RYPA 4Y1XA 3ZYRA 2PA7A 3O7OA 1JYCA 5JZGB 1OA3A 1KJLA 1JUIA 1VB2A 3NWKA 4TYSA 1RINA 1TMF2 3ZIXA 3OTFA 2XL9A 1QJU2 4RSUA 1KRIA 2ZX3A 1YXWA 3GBGA 4MGZE 3ZYGA 1E57A 1RUH2 1ZBA3 1QH6A 3PTYA 1FOD1 2HYKA 2Q4SA 3NV2A 2IFWA 4L97A 4F8AA 3NV4A 1HV1A 3USUB 1VBE2 2R16A 1ZVFA 2DVBA 3FBYA 4P9WA 3G6JB 4WV8A 2JE7A 5F9TA 4G9SB 4XPVA 4DB5A 1CAWB 2NMOA 1S0EA 4HKLA 1M4WA 1YLLA 2WNVA 5IUQA 3NVCA 2ZGLA 2Y26A 4FPFA 4KL1A 4AI0A 3UJOA 2B8MA 4A7ZA 4GKYA 4AVSA 3NAPB 3H0OA 3AZVA 2VQ0A 5FQ0A 3GNEA 3H7JA 4NHLA 5CB7A 5CADA 2ES3A 2CYFA 4ZXKA 1PVC1 5CFCC 1DGRN 4YG6A 4IETA 2C9AA 4YNIA 1WW7A 5K0UC 3VLBB 2HWD1 2XJPA 1VAVA 5FO7B 3SMHA 3WXPA 1YWKA 2VG9A 2R1BA 3V64A 1ULEA 5DDJ3 2B39A 1DQ5A 1XNKA 1PZ7A 1WLWA 4HZFA 4BWOA 1KFUL 4CDWB 4BQ1A 3KSCA 3PVEA 2KA3A 1FT9A 2AUYA 2JEMA 1QJY3 1QJY1 3JBG1 3HR9A 2Q30A 3U0ZA 1OPOA 4Q4W1 4NHKA 3U07A 3ENRA 3WDYA 2XVLA 2DTWA 1W6NA 3ZXLA 4IEOA 3VBSB 3M3CA 1OHFA 1COV3 3ZVXA 1COV1 2PHXA 5JSOA 2ARBA 1PGW1 3TNQA 1R092 1G9DA 2O8QA 4LO4B 1MZ6A 3INAA 5A3MA 4BCUA 1VBA1 5DUUA 4A7YA 1NQJA 1L3JA 4WM8B 4YW3A 4D69A 4NHMA 1H0BA 2XH6A 1VP6A 2RS31 4M3CE 2JG8C 3ZFFC 4PDWC 1V6LA 1XYPA 3MICA 4PBOA 4CEYA 1Q43A 3EJKA 2B45X 1G9FA 4IEWA 2XKPA 4JGZC 1AR72 3GZUC 2E7QA 3AXEA 3VHOA 1KS5A 4ONUA 3VZNA 1MS3A 4XXPA 3SNMA 1EAH1 3R0RA 4P9XA 4GQ7A 4UW6A 4CP1A 4WVWA 4YVSC 3LOIA 2VULA 4X8NA 4NVPA 1W6OA 2IC1A 3KD4A 4PIYA 2ZHKA 1EV12 4N43B 5J37A 3VZKA 2QQPA 5I8TA 1LGBA 2I74A 4GH4C 1G6NA 4COZA 2A6WA 1V6OA 1GZ9A 4FOQA 2ZX1A 3V0AA 4LHKA 1IS4A 5KC6A 1RUF1 2OUHA 4K3UA 5BNOA 5I8YA 1JN2P 5T5OA 2LTNA 4ES9A 2ZGPA 4YGDA 4YZ5A 2ZMNA 1RUC1 3O5SA 3PMEA 1VBB2 2JD4A 1W0PA 4GB32 5L36A 3VBOC 4OHYA 1NCQC 2EAKA 4YZ1A 2P3IA 1X36A 4GMP3 2D6OX 3N36A 2YXSA 4Y20B 5K9YA 2VOWA 3AK0A 3MLJA 3HN1A 4W6YA 1H4HA 2LUWA 3MLKA 4O9EA 1VBD1 4ZU7A 2YGLA 4OLLA 3VKMA 3VL8A 4BM8A 3FHIB 1WW4A 1UU6A 5GLTA 4KQ7A 2D3RA 4E27A 3U11A 2VECA 4LBQA 4CDXB 2R042 3AKTA 4JDMA 1FYUA 2DUPA 4IEZA 5ABJA 3JD72 1LCLA 4QD2A 1OI6A 1KDMA 4AFCA 2ZX2A 5KHGA 1LOBA 1AR81 1QQP1 4IV1B 5K0UA 4AQ2A 4BH9A 4AEJA 1BVP1 1MVQA 4BIOA 1C3HA 2VGDA 5T52A 1AJOA 4L11A 3JB8A 4B7KA 4DOUA 3PJYA 3VBUB 1K5MC 4YVWC 2XGXA 2R1DA 1JBCA 3RPQA 1S1AA 5DUXA 1OD5A 1HQLA 5KBFA 2I45A 4SBVA 1Y9QA 2KM2A 4XDQA 4JGYB 3AP6A 4Q0VA 4KNCA 2R063 1YNAA 4KG8A 2R061 1YI9A 4HETA 5T3NA 1DQ6A 4HL0A 1ASJ3 2R0HA 5EZWA 1DGRA 5JZGC 5A32B 1LHNA 4XILA 4ATFA 4OHXA 4PIXA 1H8TC 4RQPB 2DVFA 2VUJA 1IGOA 4U2AA 1MS8A 3M3OA 1X8EA 3ELNA 3MW3A 5J09A 2GSYA 4FPYA 3RJRA 4A2UA 2VMGA 3SHRA 5AC91 1D2QA 1U5IA 2R30A 4XHBA 1NY72 2UWCA 3WG1A 3ZFFA 4HK9A 3AB0A 2E9QA 3VBRC 4AVVA 1RIRA 2YZ4A 5CU1A 2ZHMA 3NL1A 4ORFA 2BVVA 2P2KA 4Y1UA 1X7NA 4Q4Y3 5LK5A 4Q4Y1 5JSPA 3NO8A 4MGYE 4JGZA 4P9LA 1AR93 4FXGB 4XQDA 4F7ZA 2Q8OA 4S2FA 4YVSA 2H0BA 3VL9A 1HV0A 5LRSA 3VBFB 1ZBE2 2WLQA 2G9GA 3ES1A 2A3WA 1CAUB 1PIV3 1QDOA 1PNGA 4EROA 5KXEA 4I01A 2DVAA 3HWJA 4GH4A 4B3NA 3ILFA 3QD6