1R0AH

Crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
225
structure length
225
Chain Sequence
QITLKESGPGIVQPSQPFRLTCTFSGFSLSTSGIGVTWIRQPSGKGLEWLATIWWDDDNRYNPSLKSRLTVSKDTSNNQAFLNMMTVETADTAIYYCAQSAITSVTDSAMDHWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPADC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*A*TP*GP*CP*AP*TP*CP*GP*GP*CP*GP*CP*TP*CP*GP*AP*AP*CP*A
publication title Nonnucleoside inhibitor binding affects the interactions of the fingers subdomain of human immunodeficiency virus type 1 reverse transcriptase with DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
total genus 45
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r0aH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r0aH01
6FABH 1YUHB 2EC9T 3IS0X 3HI5H 5FUZL 1F4YH 1N6QH 2WMPA 5DHYA 4ELKA 2G2RA 3WXVH 1X5XA 2FD6H 3TZVD 4YXLH 3OR7B 3WLBB 4XVUC 1MCSA 1SM3H 4M61B 1P84K 1ND0B 4ZAKA 2MWCA 1AFVH 5E70A 1YC8A 1NH6A 3NFPA 4X98A 2EEDA 1NCAL 2CH8A 3QDGA 1VDGA 3DSNA 3V6OE 2FWOB 2GITA 3QEQA 5F6IC 3DO3A 3QG7L 5T3ZD 1RPQA 1R3HA 3VD9A 4UMGA 3UO1H 3RKPA 1ZHNA 1F4XL 2VQUA 5HI5D 1KYOK 1A4JB 1DQJA 3ARQA 1GZPA 5L2KE 4F7PB 3MBXL 3D25A 2NTFA 1HHJA 5DRXB 5GGQL 5DUMH 1ZHKB 5DVLA 4PLJD 1MRCL 1M6OA 4NWTL 1YMHB 4WGVB 4LSUL 1WBYB 1T89C 3I9GH 1DANT 2AEWA 2XICA 3BOVA 1U8MA 4XAWL 1NPUA 5TFSH 1AP2A 3EZ8A 1HXYB 1F3JA 1MREL 1M1SA 4U1IB 5KVDH 3HTLX 1I1YA 5IB4A 5BZWA 5GS2H 5C7XL 5B39G 4EXPX 1KBGL 4MJID 1MJ8H 5B38G 1JGDA 3D18A 3G6AA 2DQTL 2ZSWA 1V7ML 2CO7B 5BV7L 2Y7QB 2VITA 1K8IB 4H26A 5GJSL 1IGYB 3VGAB 4AYFA 4YDKH 1UZ8B 3ZO0A 1LMKA 2K1MA 5DSCA 1C16B 1XH3A 2CDGA 32C2B 3IDXL 3QUMB 2J12B 1U92A 3CX2A 1SVZA 1MNUH 2ZJSL 3FQRB 1TPXC 3MUY1 2AXFB 4ZFOB 2OM5A 3HUJF 1IKFL 4ORZC 2FO4A 2DICA 2XZAL 2P8LA 1C5BH 3MRJA 3KJ4C 4QTIL 1G1CA 1JPTH 4DQOH 5DJ8B 3BT2H 5FECB 5JXAL 2NCMA 1T2QL 4JHZA 5C0BD 2A9MH 1NFDF 2YA1A 4MAYC 4Z76B 4P2YA 3HMWL 2GKIA 2HG5A 5ICZA 5EUOA 3RGVD 1EGJL 1R3IL 3RUGF 4GJTB 4CBPA 4IDLA 4BFBD 3RWHB 4H1LB 4CVZB 2X4NB 4HBCH 1LO0L 3ORJA 3MRLA 1AQDA 1WCBA 4WUUE 3PDDA 3V0WH 1IFHH 4YPGB 2W9EL 3FN0L 5B4MD 4U1NB 2IAMC 3NCYP 3REWB 4KGLA 4XCEB 3RDTC 4HUKB 4I18C 3GSUA 4MA1B 3OX8A 3QUMH 5D5MB 3WS6A 4JGMA 4NOFA 3UJJH 1U8JB 4IS6A 2PCPA 5TE4H 4LSTL 2R2HA 5KSBB 5EBWA 2CPCA 2BJMH 4PGDA 4R8WH 3LV3A 4S2SB 4NQED 5E1AB 3BZEA 3I02B 4CN1A 1KC5L 1TJHL 1SBSH 5DEFB 3Q3GA 4LKCA 3LAFA 3PWPD 3SOBH 4C83A 2NYYD 1ZANH 4ZUVA 1I1AB 2WBWB 3JWNC 5HHVH 4JDVA 4JPKH 1AQKL 4Q6IC 5EU6D 1MCLA 3H0TB 1S9WA 2QKIB 4H1LH 3TT1H 3RX5A 1INQA 3X14A 4G6FD 2GJJA 4C59B 2C7UB 2Y9RT 5I1DA 2HMID 5IV2A 4PY7B 5I16B 3L3IB 1XF3A 4JFFE 4MWFA 1Q1JH 1S5HA 4PJXF 5D7LD 5ANMA 3QUYD 2JIXB 1MI5D 5T1DH 5KBNC 2YMXL 4K7FB 1XF1A 1N6UA 4GT7A 3H7BA 4YBLB 1JP5A 2P5EE 3PL6B 1MFDL 4YBHA 1BZ9B 1LO2H 2GFBA 1JVKA 4XMPL 1A1NA 4POUB 3CC5B 4X83A 4FA8A 4IOFD 4OCWH 1PKQA 5FHAL 4TUJB 2E7LA 3ARGC 1RZGB 2NY1C 3QISA 1YDPA 3IFOA 3HLAA 4OI9A 5JNYB 4EXKA 5JXED 4F7EA 2YUXA 3U6RB 4NZUL 3M07A 3K0WA 2VLKD 4RNRB 1MHPL 3E3QE 4KUCF 4QLRA 3QXTA 3S4SA 1G1YA 5B21A 1JL8A 3NA4A 1MVUB 5HHMB 5FKAA 4JZOA 1GYAA 3R1GL 3PGFH 3KS0J 5E7FA 1QA9A 5IT2L 4HIXL 4MCYA 4MMZC 5FAAA 3GBLA 4GRLB 4X80H 1CFSB 3T1FA 1AI1L 4NYLA 3GGWB 1HQRB 4WJ5A 3TNMB 4R96B 3ZE2E 4R97B 1A6VH 1A9EA 4OTXL 4G9FA 4WEBL 5FHBH 3RWIB 1ZXQA 3DO7B 2FJFB 3X3FL 2EKSA 2ICWB 4TQEH 5BS0E 4WFEE 3QDJE 4OD3L 1MIMH 3UTZB 4KRNA 1J0JA 3GRWH 4PJ7B 2QADD 1ORSB 2WLYA 1A7OL 4EVNB 3SEPA 2O5ZH 2Q3ZA 3BMWA 3MJ9A 5EO0B 4LCCA 4XBPB 1F4HA 2IANE 1U3YA 5EA0H 1QQDB 8FABA 3PIQB 5E8OA 1BAFH 1RV6X 3PUCA 5C0IB 4PJBB 3O0RL 1DFBL 2B5IC 3ZYIA 4XH2B 1XCTB 3FB5A 1CFNB 4HJ0D 1GH7A 2VXSH 3R4DA 2PKDA 1ZT4B 3G5YB 3DROA 3FKUS 4P23B 5GQBA 1UZ6F 1UM4H 1AKJD 4AM0A 3BUYB 1EHAA 3DURA 3FONB 2F53A 2CD0A 5IQ7L 2Z35B 1AD9B 4MD0A 4ZFZB 3Q48A 1W0YT 3MLYH 4HLZG 1S8DB 3W5MA 1KPVA 2FYYB 3SGKC 3W5NA 3EJJX 3QDHA 4XBEH 1QD0A 3SDXE 1KCUH 3PNWA 1WSST 4YHYC 1QNZH 3QCUH 3ROOA 2X6MA 3BP4B 5ITFB 4GW1A 2XZZA 4WY7L 3ZDZE 2H26A 1G7JB 3NFNA 4H5SB 3ZE1E 1CG9B 3S35X 2WIMA 3RWEB 2LU7A 1FZOA 1F6AA 1NC2B 3KWWB 1RIUL 4L9DA 5ETUA 1EPFA 2BFVL 5EU3A 4MQXC 5IFJA 4O2CA 4JM4H 5GS0H 2DQCH 2YN3A 1QLFA 1MY7A 2FGWH 4XTRC 5AZ2L 1QHOA 3QIUD 4YZFE 3QXAA 3ZTNH 3L3DA 2D7OA 3OHXA 3C60A 3MRKB 3VGHA 4MSWA 4ZXBA 3IB4A 2VDOH 4Y5XC 4JFEA 4JRYB 3DNKA 3GHBH 1YEGH 2FX7L 4APQA 1DVFA 3TYGL 4Z7OF 1X5HA 2EYTA 3F12A 5C08A 4K3JL 4M7LL 4FXGB 4P4KA 4PRPA 2MOVA 5C0CB 2IMMA 2MQ0A 5HYJE 2V5TA 4YHMH 3TO2A 2WWMC 4N5ED 2PYFB 4KPHL 3CVIL 1T7YA 3GMOA 5JA9A 3MQIA 3QNXB 1QG3A 4UB0H 1ZS8A 1UM5L 1AD0B 2PNDA 5E9DE 5INCA 4QRRA 4NPYB 1U93A 5D1ZB 3BHBB 3PWUB 4BKLA 2LV4A 4F8QA 3HC0A 5FCUL 4LSRL 5E4IA 3SGEH 3U4AA 1RUQH 4N0UE 2R29H 1PLGH 1NBYB 4NKOA 5FXCH 3TPUA 4XCFL 2YWZA 3IKCB 3LDBB 3HZYB 4K71C 3KPOA 3QCTH 4PJCF 4TVSa 2J8OA 3BP7A 1WEJH 2HTLC 5KOVC 2F5BH 1K6QL 2E6JA 1G9ML 2XPGB 1P7KA 1YQVL 2NY4B 2VLRA 2XFXB 3SBWC 5HDBF 5C0JA 5I74C 1KLFA 2R0ZH 3CDYA 5C0EB 1TZIB 1WUNT 5FYKD 1I85A 1H3UA 5CJOH 3ME0A 4PRBB 3D69A 3CCHB 3CVHL 4I4WA 4QT5B 5KS9B 1YJDH 3SO3C 1SEBA 1BQHG 3ARYA 5I76B 2APVA 4LNRB 5A1AA 3O3BA 4NBXB 1HYRC 2DMKA 1IT9H 3NIFF 3RVWC 3U30B 4F8TA 3HG1A 5TH2B 3O8XB 1T1XB 2GTZA 3LS5L 4M1GH 1AGFB 3MX0A 1YA5A 2XXCB 4PPTA 2XV6B 3WFEH 1AGDA 2PO6B 2XTJC 2VN7A 1U8PB 1FYHB 4CVXA 1QSED 4HH9A 1DDHB 3HMXA 4N0RA 5EZOH 4NQSB 4WFGE 2XA8H 3UYPA 5E8NA 1SY6L 1HILB 4FXKA 4ZOCA 2OZ4A 5JO5A 1Y6MR 1A6UL 2A1WH 5I1IL 4MS8C 3SQOH 3B43A 5I2IA 4YHPB 3CZJA 4YE4H 2E5EA 3FCTA 3RVXD 3RWJB 4F7CB 4MQTB 3NCEB 2V17H 3QIWA 2EDJA 3MLZH 4RFOH 2BNRD 2ZZUT 2GW5A 1UXSB 4EOWL 1GHFH 4FRWA 3VFRB 2Y36H 3I3BA 3QIBD 2MPAH 2IEPA 3MOBH 1IBGL 4MNHB 5J13C 1KG0A 4KV5E 4W4NA 1FZKA 2YD8A 1UACL 3BVNA 4MAYD 4NKIH 3LPFA 3S34H 4EI5A 1H0DA 1SJHB 2OMBA 2JE8A 1HHKB 1IGMH 4HCRH 2BVUA 2F9BT 4X6CB 3KNBB 4JFOB 5DJAB 5FO9B 3Q2CA 2I9LB 2VJXA 2C3HA 5JR1L 3HNSL 5C07D 3V5KA 3VFVB 5BV7C 1UKTA 2X1QA 2IG2L 4L5FL 5EO1A 3O2WL 1CF8L 4YIQB 4XXDA 1UB6A 2AJSL 3BZFA 4IEFB 3P9LA 5C09B 4ZS7L 4IOIA 5L9DL 1CGWA 2EIEA 5ESQA 1T2XA 3PGDB 3I75A 1TCRA 1T22A 2K7PA 4QHUB 3V52H 3D0VA 4FMKA 3IAPA 5FGSA 3RDTD 3ZYZA 5E4EC 1KTDA 5F93C 1FL6A 5BRZA 5A2KH 4D0CB 2FZ3B 3BEWA 3O45A 4BUGA 4MJ4A 2DM3A 4OLXH 4U1JA 1LP9F 5D72L 3BEVB 5EBMA 2EDLA 2YXMA 2VDQL 2NY3C 1RZJH 5SWZE 4XCYB 4XVJH 4WU5A 1WAAF 1YNTA 4UTBH 1D7FA 4B53A 1Z9SA 2IH1B 1MY5A 3TN0C 5JHDE 5AUMB 5T1LD 2XKNB 1T21A 4RA3A 1JIBA 2BVOA 5KG9A 4I3RL 1EHLH 1WJ3A 43CAB 2WBJC 4QRQA 5SX5K 1K8DA 2D31A 2VABA 3HB3D 3SO5A 4P3WA 5TPWH 4PGBA 1MHEB 4O02H 2YUZA 1AIFB 1F11A 1P7QB 1ZA6A 1QBMH 3QQNA 4KQ4H 4RMRA 5C0GB 1KN2L 2P8PA 2MSPA 2ICCA 4NO3B 3E0GA 4GRWE 1KJMB 1BJ8A 1IJ9A 1MCFA 3DJ9A 4RMSA 4U1HB 1RIVH 1D5ZB 3VFNA 5DQDL 3UBXB 5TE6H 3SKOB 4AG4L 4DKDC 3O4LD 4PJ5E 4Y16A 2YD4A 3ILPB 3RL1A 5DHVB 1GOHA 4LOUC 4O51B 5T1KD 4PJHB 3P0GB 3VXME 2XWBB 4ENEC 5DO2C 5J11C 3IFPA 4HMDA 5CSZA 4P3DB 1VHPA 3OGOE 4IRSC 3T2QA 4N0FB 1NAMB 3VWKC 2M2DA 5IMKA 4KROC 5I9QB 1T83A 5HD8C 3O4OB 3H2WA 5DD3L 1HOCB 1PGRB 1Z3GL 2QQKH 4HXAL 2B1AH 1A64A 5JDSB 2DBJA 1I7ZA 1QFUL 4IBLT 3WXWH 4LCUA 4NQXB 1WT5C 1PG7X 4AENA 1K4CA 1PSKL 4G8FB 4I48A 2V6HA 1B4RA 4KZDL 5GISH 4XNMA 4OLUL 5ADOL 1JWMB 5T3XD 2UYLA 5E2VH 1S7SA 1P4IH 1Y18A 4JO4L 4JFZH 1PEZA 4E41D 2Z8RA 3O6MH 5EZIL 4MVBD 3VD3A 5DHVH 3FRPA 4HPOH 1L6XA 1FE8L 3HZMA 5DHYB 4ELKB 3D6GA 2G2RB 4NZTL 4UV4H 5EFIA 3S37L 2KBGA 4QGYA 3VFMA 2UV3A 2Q8AH 4LIQE 1KENL 4ZAKB 2WM0A 4X98B 5HYSG 1NAMH 1W2KT 2FEEI 1OSPL 3EO1A 3QEQB 4Z9KB 1R3HB 1FYTB 2X4SB 4V1DE 2OTPA 2X4QA 4QXTA 4PRNA 1DQJB 1GZPB 3C9NA 3I85A 5JORB 3QDMA 2NTFB 1HHJB 4Z7QE 1ZSDA 3BAEL 1MOEA 4OBRA 4ZO9A 5EBLA 5JPMB 3MLRH 4PB0L 1J8HD 1IGFL 1U58B 1U8MB 4JRXD 2N1KA 4LSSH 4YQXL 1F3JB 1F3DH 4LSPL 4YR6A 2FB4H 5ICXA 3CSPA 2VH5H 8CGTA 5BZWB 3NZHL 3OF6D 4HIJA 3FFDA 2Q8BH 1S9XA 4X6DB 2VITB 4H26B 3QEHB 1KB5L 2ATPA 2YD7A 2OI9B 3S36L 1Q0XL 4KKCD 3AUVA 5DSCB 5GXBB 2YPVH 1TNNA 3ARDD 4HIEB 3EJYC 5IVOA 2CMRL 3QHZH 3AREC 4BQ6A 5ESAA 5IBTL 3BZDA 3UTSE 2DKMA 2FO4B 5DJDA 2P8LB 3AU1A 5JW3L 1N64L 3MRJB 2ZSVA 4G6AC 3SE4A 3MLSH 3EO0A 1HWHB 5L2JB 1C08A 4MQXD 3TJHC 2YD1A 3V9FA 2FL5A 4HS8L 2PW1A 2UUDK 2I9TA 1X6LA 5ICZB 3D2UD 5D1QB 4S1QL 3SDYL 4JDZA 4FQQB 1EZVX 2APTA 2CQVA 2O5YL 4JFDE 2GQHA 2R4SL 1HHGA 2O5XH 2GYSA 3QULB 1U2CA 2FIKB 4MD5A 5EG6C 3OXSA 1BD2D 3GSUB 4Y2DC 5CEXA 4F7TA 4NKMA 5IVXF 3QNYB 4L4TE 3WUWB 3JWDC 4IS6B 2PCPB 4F57H 3ZDYE 1BECA 1XGUB 4PGDB 3VRIA 4DAGH 4M7JH 3LV3B 4U1GB 4XZUB 2CLVB 5E00A 5F96H 1U8QA 3RVUC 4QHNB 4NQCE 3S6CA 5I1HL 1G9NH 3MTRA 3Q3GB 1XEDA 4LKCB 2HWZL 5GS2D 4C83B 3U9PL 4F37F 3UJTL 3QQ3B 4ZUVB 2DM4A 1HYSD 2WP3T 4LGSB 5E6ZA 5T5FH 4OZIF 4TTDD 2OSLA 1INQB 2BY0A 3RA7H 1E4XH 3FZUC 4PGJA 4OGYL 4ODVL 5J1TC 3GSWA 5JOFB 5IFHH 4TNVK 5IV2B 1FHGA 1WVZA 2X9YA 4G8IA 1XF3B 2DMBA 4MWFB 4AEIH 5K9KA 1S7QA 4LMQI 2WUBL 3TT3H 3AY4C 3C5ZB 1DBML 1H15A 3H7BB 3MUHL 3LQAH 4KAQL 5I0ZA 4GKOA 4YXKL 3PDGA 3QJFA 1A1NB 4LLQA 4PY8I 1F00I 4UIKL 4NKQB 3ZKMC 4CMHC 2AEQL 2DLEA 5A43C 5I30H 3RJQB 3ZE0E 2JELL 1YDPB 3IFOB 4HHAB 3HLAB 2B4CL 4OGAC 4F7EB 4UBDC 4G7VH 1HWGB 5T3XL 3MMEA 3U79A 1DJSA 2QSTA 1FGVH 5FUOL 3MO1A 2AXGA 4OT1L 3VWJC 1NEZG 2H9GB 5ILTH 5EOQH 4U6YA 1GGUA 3U7WH 1S7TA 1VKXA 3BH8B 5FKAB 3LS4L 2I26N 4CAGA 5EN2A 2DWDB 2D2OA 1QA9B 1XGPA 4DGIH 3QCVL 4MCYB 4ZUTA 5MP6L 2FLBT 2X9XA 3HZKA 3SGEI 4AEFA 1NGPL 2CJUL 4M62H 1JNJA 4WW2B 4MZ2A 4NYLB 5I1KL 1BEYL 3DYMA 1YEFL 2H32B 4X7FC 3C6LA 2C4FT 4B0MM 3MNVB 2CDFA 1A9EB 4G9FB 1TETH 1EEYA 4EIZC 3KXFE 2EKSB 1V7NL 4GLRH 4NN7B 4DKFL 4EI6B 3H9YA 3MRPB 5D4QA 3VFSB 5IHUL 4O00A 1OARL 2EEAA 1FLRH 1KPRA 1BBJB 5CUSH 5KANI 4E5XB 4GKZA 4U6HA 5HJ3A 3G6JA 4P3CL 3GJEA 1MHCB 3RTQA 4NGHH 3FQTA 2HT2C 2XWJB 4OM0H 4ZMAT 3ARZA 2C1PA 4LU5L 5E8OB 1CLOH 1PY4A 1S9YA 4FQHA 4PGCA 2AJUH 2QSCL 2NZ9D 4FQJL 4R4FH 3H42H 1FNSH 4GXUN 1NGQL 2YR3A 1URLA 3FB5B 1E4WH 1KFAL 5KW9L 2HRPL 4OAWA 3BP6B 2EXYC 1VACA 4OFVA 2XZQH 4Z7NE 3DROB 4CUCA 1MCBA 3ZYJA 1IGIH 1UFUA 2H32H 4AM0B 4LPTA 4PJAA 3DURB 2X09A 2F53B 1Z5LA 4KH2A 3MV9D 4OBSA 4X9GA 2NY3D 3T4YA 2QQLH 4XCCH 1FQ9C 1KGCD 1RMFL 1FIGH 1I1AD 4MD0B 3O9WC 4XPBL 3LKNB 5E99H 2G75A 1T1ZA 1KPVB 3T3PE 1D6VL 4GS7C 5T33H 3THMH 5EWIL 2FECI 1MWAA 2YSSA 4RQQA 3K4AA 3MJ9H 3VXUA 4NQTA 3S96A 3ROOB 1N6QL 2ARWA 4G9DB 3WXVL 2FD6L 3F65A 4D8PA 4GW1B 3VFTA 3K1DA 4XHJD 4YXLL 5KSAA 2ESVE 2X89D 3NFNB 2FEDC 4GH7B 1AFVL 1FZOB 4QHLA 1F6AB 4ZO7A 5ETUB 2EO9A 5IFJB 1ZHBA 3CFCH 3OXRA 4CJ1A 1JPFA 4O2CB 4LVOC 1T0MA 3UO1L 3V0AC 4PJ8C 5CJ5A 1P9MC 3LHPH 3SDXB 3QXAB 4DEPB 3S3SA 2Z8WC 3QI9C 5MENA 2JB5L 4XNZC 2G60L 4RMUA 3L3DB 1CFVH 3OHXB 2GK0A 3C60B 4JKPL 4LOUD 4EUPH 1MCKA 1A6WH 3L5WA 2D4FA 4MSWB 4Y4KA 4ZXBB 5IEKB 1LK3L 3CJJA 3WS3A 4JFEB 3P77A 4ENED 3I9GL 1H3VA 4G8GE 7FABH 4I9WE 3VFUA 4IRSD 4NCDA 4APQB 5TFSL 4BQ8A 3IDYC 5D7IA 4Y1AA 1UWGH 5C08B 5C70A 4KROD 1HCVA 4LBEB 2GJ6E 4P4KB 2L7UA 4Z7UE 5HD8D 5KVDL 4N8CL 1CU4H 1LDPL 5FFLA 2DD8L 5HGDA 3WHE0 4A6YA 5LQBH 4UOW1 3GMOB 3O3AB 1K2DA 4XI5C 3A6CL 4WU7A 3UBXG 3C08H 3BIKB 4L8SB 4E0RA 1DL7L 4YDKL 5I71C 4QRRB 5LXGH 4GMTL 4KHTH 4P5TA 5IW6A 5J9PA 4BKLB 3QUZC 4QOKA 1F6LL 4BZ1L 1ROWA 3H3PH 4NJAL 4UV7H 3SCMB 1T0NB 3KYMA 2H2PC 4HK3J 4Y4FA 5DMIL 1MNUL 1A1MB 4N8PA 4CMMA 3L1OH 1A0QL 3TPUB 1C5BL 5CEYA 1J1OH 4BK5A 3GBNH 3KPOB 3T0EE 3BPNC 4JLRB 3BT2L 2HFTA 4W6YB 5L88L 3BP7B 1A3RH 5HYIA 4HIHA 3C5SA 2A9ML 2VLJE 4QNPE 2UUDH 5SWSD 1UM6H 4PB9H 4YFEA 4OCRH 1CGSH 3ALWA 3P0YH 3V4PH 4U31A 1CK0H 4Z95H 2D9QB 4M00A 3BN3B 5FA3A 5C0JB 3Q6GH 5F9JA 4KRPB 4N0UB 3EOAB 2CRMA 5E94A 3D69B 4GW5A 1LK2A 4H20H 4HBCL 2DKUA 2V5MA 3OKKA 1RUML 1IFHL 4DZ8A 2NY0B 5I1GH 2J5LC 5E6IA 5GS0D 2N56A 3GSRA 4HKZA 3V6OC 2NXYC 3O3BB 2CKBA 3JV6A 2YZ1A 1N0XH 5F7NC 5JHLH 4FNLH 3ZE2F 3HG1B 3QUML 1NSNH 2MQCA 3RRQA 2GTZB 5GGVH 3D3VE 3UJJL 4BSJA 4KI1A 4ZFOL 1T5WA 5TE4L 2DQIH 4JFHE 4U49A 4P2CG 4UT7H 2ZNWA 4CVXB 5BVPL 3MLUH 4J6RL 3VRJA 4WO4A 5E8NB 2HA1A 2UVFA 3LEYH 4FXKB 1YEJH 1SBSL 1I7TA 1OAZL 2DQUH 3SOBL 4H88L 5FV1L 2YRPA 4OM1L 2EZ0C 3FCTB 1QRNA 1RHHA 1BVZA 4BZYA 4KKBC 1EFQA 4HFUH 4WWKA 1NBVL 1NC2D 3WE6A 3L95A 2X40A 3NZ8A 4LSVH 2ED8A 4KVNH 4G6JL 3P4OA 1OTUC 4JREB 3CMGA 1FZKB 2JJWA 3BVNB 2W07A 5J7CC 4NM4H 3T0VA 4EI5B 4WI2A 4UNUA 5T1DL 3MLVL 4XXCC 1MCRA 5FYLH 1ZT1A 4ESKA 4PS4L 5DLMH 3HI6H 3PV7A 4PRIA 4M1DL 3V5KB 3TC9A 1LO2L 3HCVB 4GSDL 2PR4H 5EO1B 4WCYH 4DFIA 3HMXH 4OCWL 3GM0A 4XXDB 4Y19D 1UB6B 4DVRH 3P9LB 5TQ0H 2OZ4H 3TA3B 4LL9A 3TJEH 4JE4B 5C0CD 4WWID 2ZUSA 3DVNB 1FPTH 4KK5C 3DRTA 5GRUH 1TCRB 2CSPA 2W9DL 5E2UL 4F2MA 5B8CC 2L7JA 1Q9LB 3LQAC 5DD0H 3D0VB 1Z0NA 4P9MH 3ZDZF 4Y2DD 1KTDB 1EX0A 4IJ3C 2BRQA 4UNTA 5DURD 3OKLA 1FL6B 3EFDH 1NDGB 1J1PL 5D1ZD 4O58H 3O45B 1WGOA 4U1JB 3BXNA 3O6FC 1LD9A 1S7UA 2I07A 1LO4L 3CFDA 3VGEA 3DARA 3MJ8B 4YZFF 1VA9A 3UAJD 3RVUD 4WU5B 2ZCHH 5D7JA 4WUKH 5E24E 4L8DA 1SJVA 4XP1H 3W39A 1E6JH 2DYPA 1LEKB 1A6VL 1T21B 1A4KA 2EDRA 2VTFA 5KG9B 1C12B 3BP5B 3IXAB 4QRQB 5D1XB 3INUL 2NY4D 3ARUA 5JPNA 3VGBA 4ODUA 1KB9K 3FZUD 1F11B 5F7WC 5F89A 1QYGH 3FAWA 1OAKH 2P8PB 3C5ZC 3B9KA 2Q7YA 3PHQA 2O5ZL 5ANME 4ZSOE 1R5VB 4NNXA 1VGKA 4TNWF 2DLGA 3NPZB 3VFNB 4LAQH 1ZT7A 3C6SA 2CXKA 5EA0L 4LK4A 4JN1H 3PQYE 1WFOA 2GT9A 4Y16B 1YPZA 3RL1B 1FFPA 3OB0K 2KKQA 1QR4A 4F7MA 4Y5YC 1OHQA 4ZUSA 3O8XD 5EC1A 2VZ1A 5EUKB 1AXTH 2PO6D 2Z91A 3IFPB 1ZVYA 2VXSL 4FQ2H 1UH4A 4WDIA 1D9KA 4JM2C 4HUXA 5IMMA 1I4FA 4G3YH 4FQXC 2HFGH 1ZV5A 5IMKB 4P46C 4CVUA 4Z77A 1DUYA 5E1HB 1IEHA 4KWUA 2R8SH 4NRXA 5I18H 4LCUB 1E27A 4KMLB 2EDTA 1RD6A 4ODSH 4AENB 1K4CB 3CMOH 3DX8B 4MNGE 4I48B 5HHOE 4XNMB 3OBAA 4S10A 1W0WA 3E3QC 4OQTA 1G7IB 1KCUL 3TZVA 2UYLB 3QCUL 1S7SB 1H3WM 3PF2A 3RY5A 4JHWH 5FO8A 3AXLA 1PY9A 2D7QA 4M48H 1UT9A 1A7PH 5IGXH 5A3IC 3EDJA 4IMKA 4AT6A 1E4XI 3HZMB 2B4CC 3MRNA 1P6AB 1JE6A 5EFIB 3CFKA 5TDNA 1VB9A 3VFMB 4OIAA 1MCOL 2BVQA 3N9GH 4JM4L 5EIIB 5GS0L 2DQCL 1KIRB 4R7NB 2FGWL 3S4SG 4GRWH 4MXVE 4HT1H 3O41A 3RZCC 4AMKH 1NCWH 1FFNA 2HRLA 1WK0A 2C9AA 4RGNE 4IRZH 2HT2D 2C1OA 1I75A 4EBQH 3ULUH 2X4QB 4QXTB 1NMBL 4AIXA 1IAOA 2XYCA 3C2AH 1SYVA 1YEGL 5CILH 5HYQA 5HPMA 2NX5E 4H8WH 4M93C 4LASH 3C09B 4Z6AT 5DRWB 5ERWA 1FZJA 1IZJA 2X5PA 5I1LA 2DAVA 3JUYA 4MJIA 3CDGA 4YHML 1UJ3A 4KJQC 3QXDA 1IC5L 4I5BA 1WTGT 3BSZL 5C3TA 1YY9D 4NP4H 2J4WL 4Q97A 5HVFB 2ZCLH 3WDHA 3KPMA 2AJZA 1NLBL 4GUPA 2E8ZA 3GJFK 5IBUB 1QVOA 3HE6C 4HIJB 4LEOA 1QEWA 5H94B 4OSUH 2VDLH 3FFDB 2J6EA 1S9XB 1NL0H 5IR1B 3I6LE 2ATPB 5F9WB 3F7RA 1RUQL 1H3PH 2R29L 4PJFA 3DUUB 3A6OA 1J0HA 1P7QD 1EIBA 4XP4H 5C0BA 2EH7H 2IPTL 3IETA 5ESAB 2GAZA 3KLAB 2YD9A 3SDAC 3VXNB 3SQBA 2YC1A 3RGVA 2ZSVB 4GG6B 3VXTB 3EDEA 4GLRI 4LPYA 4ONFH 1C08B 5KSBF 3OZ9H 1J0ZA 4U4BA 4LIQH 1FORH 4X4ZA 2ZUQB 2UZYB 5CJOL 3WFHA 3EUUA 4OF0A 4PJ8D 5DUPH 4QWWC 1B0WA 1JFQH 4QO1A 1SEQH 1YJDL 5CHNB 2N4IA 3UTSB 4JDZB 4H0IA 4K23L 5M94B 5H37G 4N0YL 5ACMA 2WWKO 5HHQA 2DJ4A 3HRZA 4CVWA 4XWGL 3RX7A 3HI1A 1AGBA 5F6HI 4HK0A 1R3JA 4M1GL 5INDA 1JNLH 4R9HA 4PRPE 3RY6C 2B0SL 4MD5B 4OGXL 3RP1A 3WFEL 1XIWC 3G04B 4NQEA 3NIGE 2R0LH 5CEXB 1MFAL 4NKMB 2VLME 1SMAA 4P2QA 2Q86B 4BM7A 2QSQA 5IF0A 2V9RA 3PWPA 4XI5D 1V8HA 3SQOL 1X6NA 4X0KB 3LSOA 4XHQA 1JZ7A 1A7NH 4OLYH 5FOJA 5EU6A 1U8QB 1VEMA 2V17L 4OCXH 3WJLA 2H2PD 3IU4H 3IFNL 2BOBB 1BP3B 5JOPD 2UZIH 5F72S 3TBWA 3P9MA 1EUTA 2MPAL 2R1XA 3MOBL 3QRFM 2VZOA 1L0YA 4ZAKD 4OV6F 3TPKA 2XQYG 1FLTX 5D7LA 2OSLB 3FQNA 5DA0B 3NMEA 3GSWB 4NKIL 3EYQC 2VLRE 3HN3A 4G8IB 1FYTD 1IGML 2DL2A 4QY8B 1A22B 4NQCB 4C56B 1RZFH 4ELME 2OP4L 5HHPA 3C8HA 5K9KB 1S7QB 2YD2A 3RHWK 2ED7A 4KVCH 3MRFB 4TRPL 4WV1B 3QFJA 1H15B 4JCMA 3CXHK 3CAFA 5JXEA 2P1YA 3IDGA 2ADIA 1IQWH 1FFQA 2J8UE 2VLKA 3QJFB 4LLQB 2JJVA 2NXYD 3VMPA 5BZDA 3V52L 4P57A 2BOCA 5I6XB 1OAQH 3E2HB 4MXWH 1P6FA 5L2KD 4JJ5B 1KJ2B 4ZD3H 3A0OA 2VR5A 3T04D 1P2CA 1FL3A 3MMEB 3S3PA 2FBJL 4XVTH 4U7KA 4LF3A 4PJ7F 5DDHA 1S9VA 4OF7A 4B5EA 2R69L 1L6ZA 1RZJL 1XGQB 2HKHH 4Z7WE 1FAKT 3B2VH 1QFOA 4U6YB 1D5XA 4HW6A 1SY6A 1S7TB 3A6BL 3W11C 4PG9A 1VKXB 4R7DA 3PJSA 3TBYB 5EN2B 1BIHA 3IU3B 1XGPB 1YNLH 5K9QG 2EZ0D 5EIQA 2HFFA 4PJBF 4KKBD 1EHLL 4ZUTB 5EU4A 1PFCA 3HZKB 4OD1L 3ELAT 4RBPK 2BHYA 5TPWL 4FG6D 3C6LB 2Z92B 2IBZX 2UWEF 1QBML 1WICA 4KQ4L 1EEYB 1OTUD 3VH8B 4FABH 2VZSA 4MJ2A 1KTLA 5D1QD 2VXQL 2X1OA 2WUCH 2PUQT 5TE6L 1OAXH 2C3WA 3QHFH 1K4DB 1NANH 4YHIA 4J3XA 4PRHA 4GKZB 4U6HB 4U1MA 5LKNA 2A38A 5HJ3B 1BJ1H 1KJ2H 3FT3B 3G6JB 3GJEB 3FFCB 3RTQB 3RY4A 4L3AA 4UIMA 3EOYG 1NCUA 1JYVA 3SY0A 2C1PB 4JB9H 1DEDA 5CGYC 5I73C 2EDBA 1S9YB 3BIBX 1VADB 4FQHB 4PGCB 4P2RE 1X4ZA 3OAZK 1AKJA 4ZTOH 5GZNC 4YAQA 4PJIA 3KR3H 1J88A 4OAWB 5AZEH 5BRZE 3S97C 2QQKL 5I1AA 1AXSB 4K8RL 1EAJA 4YUEL 3IVKA 4FQIH 5DI8A 1QR1B 1KT2A 3LH2H 3ZTJH 3QXWA 4FS0A 3SDCC 4PJAB 2BSSA 2VDRH 4PREA 2HTKC 4NRYA 4XNQA 3T4YB 5GRWA 2PYEE 4MMXC 4NUJA 3FAXA 1OP5H 2HT3D 1LGVA 1P4IL 1T1ZB 4JFZL 2Q20A 1P4LB 4WI8A 3ARBC 2NNAA 1MWAB 4RQQB 5C6TH 3D39E 3VXUB 3LEVH 4HPOL 3S96B 3BRGC 4ZDHA 1MJUH 4UV4L 4Z5RA 4D8PB 1GZQA 3MV11 3VFTB 5KSAB 3QIUA 1NGYA 4U0RB 5CEZH 2BCKA 3P73A 4QHLB 3C5ZD 3VD4A 1NAML 1DN2A 3VFWA 1ZHBB 3OXRB 3L3OA 4JQIL 1JPFB 2XN9E 3L5IA 1AGCB 2Q7NA 1L7TL 3MRDA 5C3LD 4NDMB 5MENB 1F90L 4CL7A 5GPRA 2GK0B 3SKMB 4JFFD 2BDNH 1DTUA 5BO1H 4Y4KB 5SV4A 5DMKA 3WS3B 3GSNA 3T1WA 3P77B 3U36A 3MLRL 3VFUB 3UPRB 3R0NA 1KEGL 3KG5A 4MQSB 4JM2D 4N8VA 4LSSL 4FQXD 1E4KA 1J10A 3DWTA 2IF7A 1MWAH 4NFBA 2FB4L 4Q9RH 4JQVA 2HYMA 5HGDB 3CZFA 4LQ1A 4L1DA 1BQSA 4MA7H 1E0OB 1CD0A 4WU7B 2JJSC 3VCLA 4N5UA 1WZMA 4E0RB 1JN6A 3FN3A 5KS9F 5J9PB 1QLEL 2DBLH 4HMEA 4QOKB 1IZKA 4NC0B 2YPVL 3KYMB 3PWVA 3DTXA 3QHZL 4G9FD 4EZMA 1T4KA 1MHHA 4Z7UB 1J5OH 2JCCA 1UB5B 4QHKI 4YHLL 1QACA 4Y4HC 2DM7A 3QPXH 5A3ID 1VCAA 3MLSL 3B6SA 2QHRH 4ETYA 5DC4B 1CLYH 4HIHB 1IL1A 4PJGA 3SE8H 3Q1SH 4M6AA 4GAYA 4ODWA 5DC9B 3DX9A 4HJJH 1WC7B 5IW1A 2AJ3A 1DQDH 1H8NA 5FA3B 3NACL 1CFQB 1N59A 5F9JB 4MXQC 1B9ZA 5DD6B 3ZLQC 5E94B 3DUHA 4WFED 1IC1A 1T89A 1FO0A 3QDJD 3GK8H 4GW5B 4Z7VE 5ELIA 3OKKB 3T0EB 1U36A 2O5XL 4L8BA 2KZWA 3TYFA 1DSFH 5E6IB 3LN9A 3LQZA 4HKZB 3MGOA 3WNLA 1YEKL 1UA6H 2VUOA 5FYJU 1QSEA 3BKMH 4OZHA 3Q5YA 1N5YL 2P5WE 3G6DL 2OYPA 5GGSA 1ZLVK 3KHOA 2BVTA 4WI5A 4KJQD 2HFEA 4KMQA 4F57L 1OAYL 2GTWB 3S5LA 4DN4L 4M7JL 3VRJB 3V6FA 4WO4B 4BH7A 3RIFK 5F96L 3AROA 2BNRA 4KK9D 5C9KA 3P40A 1G9NL 1WBZA 2B20A 2DQHH 4S1SH 5GRJH 4JZJB 2YPLE 3QIBA 2IC2A 3UC0H 1U8HA 5LGKA 4J8RA 3WO4B 1QRNB 1RHHB 1CI5A 2ZUVA 4BH8B 3WE6B 4MAYA 3L95B 4XB7A 5L0QC 3RA7L 1E4XL 3NZ8B 5F1NA 1IAKA 1EMTH 2LU4A 2ZUQC 4KC3B 1NMCC 4QGTA 5IFHL 4WEUD 1F58H 2ICWJ 4HG4K 3JUZA 5C07A 1E6OH 5DEZA 1MH5A 3B9AA 4OD2A 4AEIL 4LPUA 3QEGH 4RZCA 3C60D 3SKJH 3TT3L 5H35A 5D7SH 3MRGB 3GUTA 3CK0L 4ZXBD 1ZT1B 4MDIA 1QO3B 3EHBD 5E5MA 1TDQA 2P8MA 1MELA 4PRIB 3TP4A 3HKFA 4LQFL 2WV3A 3KDMA 3ULVE 4APQD 4JPIA 3RDTA 3VFPA 3EGSA 4I18A 3PV6A 3T3PF 5I30L 4N68A 2D3VA 4O5LL 4UT6L 1JHTA 1U8IA 5J6HA 3DRTB 1QKZL 4FTVE 4PJEF 1RZ8A 4F2MB 4Q0XL 3MOAL 4N9GA 3ZKNC 1FGVL 3OKLB 4QRRD 4GAGL 4QRSB 5HVWA 2AV7B 5ILTL 1X5GA 3VMNA 2R1YB 3U7WL 3SCMD 4HFWA 3BXNB 2ADGB 3FQUA 3NGBC 4HLJA 4KI5D 4XCNA 1JMZA 5T1LA 1LD9B 1S7UB 2FJHA 2I07B 4NHUA 3CFDB 5HDOA 5MEPB 4DGIL 3DETC 1QSVA 3LZFL 5HYJD 1G7LA 4P5KA 4RBPH 4PJHF 4U6XB 3UYOD 5DK3A 4L8DB 5FYJE 4TVPH 3W39B 4PJ9C 3MRQA 2VYRE 5E9DD 5HI4D 1TETL 4M4PA 4LVEA 4ODUB 5GJTH 4U3HA 3IRPX 5F89B 3EYQD 5ITBH 4MB5A 1FLRL 2Q7YB 5CUSL 1XR9A 1A7RL 5DEGA 1N8ZA 4NGHL 5T1KA 2NY0D 4OM0L 4R2GB 3EJZC 3C6SB 3ARGA 3EOTL 4UAOB 2GT9B 5FB8A 1CLOL 1YPZB 1EVUA 1FFPB 1PG7H 3OAZH 4R4FL 3H42L 3DVGB 1FNSL 2YK1H 4QXUL 3KJ6H 3QFDA 2EDWA 5F1SA 5EC1B 4NWUL 5FYLD 1BIIA 1E4WL 3EFFA 4HXBL 1W8OA 5JLZA 3MRCA 2PETA 4WDIB 1D9KB 1U3HB 4PFEA 4OCYH 2XZQL 5EH1A 3MUJA 5IMMB 4M6OL 1I8KA 1IGIL 1AC6A 4LSQH 4Z77B 2EH8H 1DUYB 3L5JA 4YH6A 5CP3A 1O0VA 1EO5A 5CP7A 3ZT6A 4NRXB 4XCCL 3OL2A 1ADQA 2ZWLT 4E41A 5AEAA 2GY7B 2ZUUA 4ISVA 5CMAA 2CIIA 5IB5A 4I2XA 4C54A 5T33L 2R0KH 3MV8A 5HBBA 3TZVB 3F62A 3MJ9L 1RJLA 4WFGD 1RU9H 5C92A 3IRZA 2YPKA 3F58H 3N1MC 4YC2B 2W0KA 1ZTXH 4M5ZL 4AT6B 5C71A 5C0AA 3MRNB 3UX9B 4HUVA 1A9BA 2QR0B 3CFCL 5TDNB 3CFKB 3X12A 5GRZA 2BVQB 3JTSB 4H0GA 3N50A 15C8H 4JGJA 4YBQD 5HHOB 2QQNH 1S3KH 3RAJH 1T1WA 4XAKE 3LY6A 3V7AE 4POYA 4ODBD 5D7KD 3TA3D 4OZGA 3O81A 1RVFH 2VWEC 2BNQE 1NFDE 5J12B 3ARXA 5CGYD 1D6EB 4U33A 1IAOB 4JRXA 7FABL 1Q0YL 3RUGE 2I5YH 1SYVB 5HYQB 5HPMB 1T7WA 4JDTH 4RAVB 4JVUA 3LQMA 3AS3A 4HC1H 3F7YA 1FZJB 5ERWB 2W60A 2Y5TA 4NQVA 5BXFA 1CU4L 5I1LB 3CDGB 1GC1L 3OGCB 3X3GH 3QXDB 3MZTA 4RGNB 4HV8A 3SGKA 2VR9A 3IFLH 4ZOAA 5EUOF 1RIHH 5LXGL 3ARDA 4IMLB 3MV01 2M8XA 4GUPB 1QVOB 5GGRA 3NAAH 1NMAH 4LEOB 2XRAH 4UV7L 4ZNEE 1SYSB 1A2YA 2YEZB 5D1XD 1HHHB 3L1OL 1HE7A 2BP3A 1T1YA 2YS4A 3IS1X 4RIRA 3F6IA 4PJFB 3GBNL 5I1JH 1TTUA 4FFZH 2IADA 3DHMA 4EN3C 3IETB 1U2HA 4X4XA 5SWZD 2GAZB 1A3RL 5A40E 2YC1B 3RGVB 4JG0L 1WLHA 3D2UA 4PB9L 4OCRL 1T7VA 2NLJA 1CGSL 3P0YL 3V4PL 4XBGA 5JHDD 2RQ8A 4QRTB 1BQLH 1EO8H 1TTGA 2KQNA 4ODXA 3Q6GL 4RISH 4X5WA 2DQFA 2PF6A 4Y5XA 1BZQK 4X5LA 3B4NA 4H20L 4GAJL 3LRHA 3LD8B 1UKQA 5I1GL 4FFWC 2E8YA 3GSXA 1PD6A 5C0FA 1ES0A 5TDPA 5IWLC 2EIZA 3VFOB 1BLNB 4PJXE 1BD2A 5HHQB 4HWBA 3PWLA 2DIJA 1U8KA 5D7IE 4KDTC 1Z6JT 4FNLL 4Y1AE 5MI0B 1AGBB 4HK0B 1ZLVH 1NSNL 4PJ5D 1R3JB 2PXYC 5GGVL 5INDB 3ULUD 2J6EH 1PYWA 5CBEA 1HQ4A 2CXGA 4W4OC 2GSIB 3QBTB 5DZLA 2DQIL 1CDIA 2FHBA 2P44B 1S7VA 4NQEB 5J1SC 5FO7A 3SHSA 1P4BH 4BK4A 3MLUL 2XIDA 3VXMD 4P2QB 4JQXC 3W82A 1NUGA 1ZLWH 3LEYL 1RULH 3NABH 3MODH 1U91B 3QAZB 4CU7A 1YEJL 4CN6A 5EOCH 2KDGA 1ZVSA 3KYOB 3OR7A 2D9CA 3WLBA 2DQUL 3LSOB 2F19L 3K2UH 3QPQC 1ND0A 4L4VE 1XF4B 2MCG1 4HFUL 1VESA 2WINA 2XKSA 1J12A 3AM8C 1HSBA 2DMCA 4LSVL 4U2YA 2P4AB 3TBWB 4LCIH 3P9MB 2R1XB 1U8LB 3Q0HA 4OLEA 3TESA 1A4JA 3SBWA 4RCAA 4IOSD 3FQNB 3QXUA 1YMME 2XTJE 3VG9C 4L3EA 1J0KA 2D7PA 4HQQH 4NM4L 5GGRY 1VFBB 1OCWL 3MRIA 5FYLL 2XI9A 1FAIL 2FLRT 4FP8L 5DLML 4M6NH 5HHPB 3G5VA 4MXQD 1HXYA 2PR4L 2Y06H 4WCYL 3V95A 3HMXL 4DVRL 3QFJB 4KY1L 2OZ4L 5TQ2H 4JY5H 3IDGB 1RI8A 2OBGA 1RUAL 3GFUA 3UPCA 4DZBB 1A7QH 2VXTH 2X4PA 4X5XA 2VLKB 4NO5B 5GRUL 2Y7QA 4WHTA 1K8IA 1TMCB 5BZDB 2BOCB 5IB3A 2IPUK 5F44A 4OF3A 3EFDL 32C2A 5IG7B 5C2UB 1X5AA 3FQRA 1FL3B 2CKNA 2I24N 3OB8A 2AXFA 1UXWB 3FO2A 1Q8MA 2X9WA 2FHCA 4K3EL 5DFWH 2E3VA 1MCEA 4MXVF 4O2FB 2MNUA 1JHKL 5DJ8A 5FECA 1D5XB 1CVRA 5A2JH 4EKXA 4WUKL 1DEEA 2P45B 4R7DB 3PJSB 4XP1L 1E6JL 2HFFB 1BF2A 1SBBA 2BY2A 1NFIA 1KELH 1DBJH 4PP1C 1IC7L 4K7PL 4ODHH 1NGZA 4RSVA 3RWHA 4H1LA 2X4NA 5IESL 1QYGL 4LDOB 5C0NC 5EOTA 4QTHB 2GJZA 2LVCA 4YPGA 3V79C 2F54E 2C3XA 4FQCH 2NQCA 3IDNB 4PD4J 2ZKHL 4LAQL 3REWA 3UTSD 1TVDA 1CWVA 4YHIB 1JHLL 5C0RL 4PRHB 5D5MA 2DTMH 1WTLA 1U8JA 3GNMH 1J9CT 3SY0B 4MX7A 2R2EB 3NFSH 5DMYA 5DQ9A 1AXTL 4FQ2L 3BW9A 3S37X 4JPVL 4G3YL 2DQJL 2FR4B 1NDMA 2AW2A 3JWOH 4YAQB 5CSGA 3MV9A 5JW5A 5E5UB 2BZDA 3DGGB 4JFDD 5I1AB 1I1AA 1OQXA 1I8MA 3IVKB 2R8SL 5DI8B 5I18L 1CGVA 4D9RE 1CR9H 3IJYA 3ARVA 2QKIA 1MCWM 2OR9H 4K9EL 2AK1H 3CMOL 3TN0A 3QA3B 4JHAH 5ALBL 2Z9TA 4PREB 2C7UA 2H1PL 4NRYB 1I8IB 3FQXB 1FN4A 4XNQB 2EYSB 4F58H 4P2RB 4NUJB 2DF3A 3DETD 4HZLA 3L3IA 3KPQA 2KQMA 1OTTD 5JA8B 3FQWA 2X89A 2APFA 4URTB 3KYNA 1FBIH 1GVIA 1ZAGA 5GIRB 1FIEA 4RWYL 4M48L 2NNAB 1KULA 1A7PL 5IGXL 5J3HD 4NQDA 2DDQL 4Z5RB 4NQCD 1CBVH 1MVFA 1GZQB 4C56D 1BZ9A 3K4ZA 1NGYB 2BCKB 1NKOA 2PYEB 3NIGF 4K07A 4WTWA 1RZGA 4RFEB 1NCWL 5DVOA 5I8KH 3GRWA 3VFWB 4PJCE 4U0QB 2LABA 3BPOB 3UDWC 3ULUL 4EBQL 3ILQC 3WD5L 2NXZB 1CICC 4YO0A 4G5ZL 1NCDH 4IRSA 4PJDA 1OD7A 3C2AL 3VMOA 3MACH 5HDBE 4OCNC 4UOW0 2CGRH 3HNTL 4OJFH 1HIMH 1MVUA 4FFVC 4HK3N 2ICEB 3GSNB 4GQPH 4R0LC 3U36B 2HLFC 4TSCH 5DT1H 4N8VB 2FH6A 2R4RL 4NP4L 4RAHA 2E7LC 5ICYA 1HQRA 1KJVA 2QL1A 3AMKA 3NIFE 5DTFB 1CQYA 3WN5C 3TV3L 5JUEH 1N3NA 1EBPA 4WTZG 5C9JA 3T0BA 3VCLB 2X4OA 3V8OA 2VZVA 1JN6B 1G6RH 2OL3A 4OIIL 1H3PL 3OQ3B 5CIPA 3RQ3A 4YC2C 1JRHH 3PWVB 3TWCL 4XMLH 3DTXB 3DXAE 3MCLH 1T4KB 2J8UF 3FT4B 5EO0A 5SWSA 1ZHLA 4XBPA 3OKDB 2JCCB 3UJIH 3ROLA 5T3ZE 2A0LC 3B6SB 3PIQA 1T5XA 3OAUL 3SGJC 5F6IB 1MF2H 1QBBA 3OZ9L 1IL1B 1RJZA 1FORL 3FFCD 3RTQD 4GAYB 4Z78B 2BVEA 2BRRL 3GSNH 3DX9B 5B3JF 1ZA3B 2AP2A 5IW1B 4Y5VB 5DUPL 3WV0A 1JFQL 3X17A 2AJ3B 2O93L 1XF5A 5F7LB 1D5BA 5HGHA 1WFTA 3BD3A 1SEQL 4Z7WF 1EFXA 3G5YA 1N59B 4J12A 4P2OC 1GRWA 5CEZD 4YDLC 3RNQA 3V4VH 1FO0B 4KRMB 3KPRE 4RMQA 3K8MA 3FMGH 4L8BB 4D0BB 3TYFB 4HS6A 1EBAA 4LCCC 3LQZB 1JNLL 5HI3C 3MGOB 4ZFZA 4BUHA 4MJIE 1S8DA 4XNUL 2DLFH 2J3SA 4NFDA 3U4BH 1N4XL 3SJVB 2R0LL 2A6DB 5D2LA 3LKPB 5GGSB 1II4E 1AH1A 1X7QB 3GSOA 1QFHA 1RZKL 1ZLSH 1O7VA 3GKZA 4Z0BH 2BY3A 3S5LB 3CFJA 4LPWA 1G7JA 1HH9A 4TULH 3NPSB 3V6FB 1A7NL 4OLYL 3L3GB 4K94L 5FYKH 3AREA 2BNRB 3SGDH 1JGVH 1NCCL 1TPXB 1WBZB 5ACLA 1OW0C 5DD1H 4DCQB 1JK8A 4AL8L 4CNIB 1WBXA 1LP9E 1N26A 1RFDH 1YEDA 5IUSA 2P5WB 1GIGL 3KJ4B 1U8HB 2UZIL 5KSAD 2Y07H 4XPGL 1A8JH 1G6VK 3MXVL 4EN3D 2HP4A 5JIIA 4HD9A 3PG2A 2AV1B 4MAYB 1B6DA 1WAAE 1FO0H 3U0WH 5F1NB 5D8JL 5GS3A 1IAKB 1MEXL 2ZOKA 4XC3H 3WFDH 4DWHA 5IFAL 4J3VA 1RZFL 1RZIA 5FM5O 1MH5B 4PV8A 1CGYA 4YDVB 2CO6B 3M45A 4RZCB 4Y19A 3TBSB 4XWOD 4KVCL 2ESVD 2Q1EA 3LRSA 3GUTB 2F74A 4MDIB 4E9LA 5E5MB 4FFWD 1BFVH 2IALA 2P8MB 1IQWL 2IAMB 4LCWB 1KCKA 4JPIB 3RDTB 4I18B 3VFPB 4Y2DA 4NO0D 5I1CL 1AD0A 2IBGA 5DFVC 3REVA 4QF1A 4G6MH 5D1ZA 3BHBA 3PWUA 2ORBL 4X7DC 2PXYD 1JHTB 1U8IB 2ARJB 4ZD3L 3WNKA 1RZ8B 4XVTL 2X41A 3U4EB 5IEHA 4N9GB 4OFPA 1DVFC 2YKLH 3MLXL 2HKHL 4G8GD 2J2ZA 4I9WD 3B2VL 4YWGL 2VISB 1BM3H 4HFWB 4XCNB 5T1LB 2BMKA 1NCBL 2IFGA 5GHWL 2FJHB 5F7YC 5ESVB 2DI7A 5BW7C 1F2QA 4Q6IB 1QBLL 2DKSA 1BMGA 3F6LA 4YHZH 1G7LB 4P5KB 4LARH 2XFXA 4X9IA 1OGAE 3BD4A 1C1EH 5DJCA 1YY8B 1KXQE 1XT5A 4QT5A 1MI5E 4MLSA 4FABL 3AY4A 1PVHA 2WUCL 1OAXL 4GQ9H 4KXZI 3K74B 4LEXL 4UU9B 5ISZE 3EDDA 5TH2A 3N1QC 4HCRA 3T0ED 1AGFA 5E8EA 5F97E 4S1RH 1G7PA 2E27H 3ARGB 2A6KB 2NY1B 2VLJD 4JANA 4AY0A 5FB8B 2Z31B 3I6KA 2P43B 2VE6A 3P30L 3PWNB 5DVNA 2QV2A 3QFDB 3HC4H 3KS0H 3U1SL 4JFQA 1BIIB 3EFFB 5F8RC 5D9SA 5AZEL 4JKKA 5JLZB 3ZHLA 3VWJA 4N1HB 4ONGL 3UZVB 4FQIL 3C8DA 1WCQA 4WO4D 3L3HA 4JO3H 5JW4R 3S35L 5J8OA 4QEGA 4JZNA 3VFRA 2VDRL 3BDYH 4PLOB 3ARRA 5CP7B 1JF5A 3C8KA 2D7TH 4QXWA 4MJ6A 4MNHA 1ZK9A 2HLAA 4JO2H 4MA3A 1QRND 2R15A 3D3VD 4KTYA 3EBAA 5CMAB 2CIIB 4JFHD 4R6UA 5IB5B 3O6LH 1CCZA 5L7XH 5C6TL 4Z7VF 1HHKA 3MV8B 4OLWH 4X7TA 1RJLB 1VGEH 4D2NA 5D2NE 2I9LA 5FYJH 4PTUB 5IBLC 3VXRE 4K2UH 2A77L 4YFLF 3GZKA 3VFVA 2EDQA 2YPKB 4EQ3A 2AK4E 4DOHE 3ZHKA 4G8EB 5CEZL 5IVZA 3WUZA 3QIWC 4UQ2A 4AIZB 5C0ND 5C0AB 2H2SD 4HUVB 4TVPD 1A9BB 3T0WA 1B2WH 3X12B 3PGCA 4R26H 3WYRA 3PGDA 4ZPVA 1C7SA 4QHUA 1T1WB 5L8JB 4D3CH 4GW4A 1GGIH 4J3UA 2B5IB 4OZGB 2W92A 2FZ3A 5FK9A 4GAFB 1IQDA 5CP3H 5BO1L 4P49A 1MCQA 4I77H 3BEVA 4JRXB 4XMKH 2YZ8A 4LFHD 5B3NA 1UWEH 4XCYA 2WLZA 3HUJB 3L6FA 5I66B 1FCGA 1MWAL 1A6TA 2W60B 1TZHB 2Y5TB 4NQVB 2VZ3A 2IH1A 5EU7E 5KOMC 5BXFB 1C7TA 2EO1A 4Q9RL 2QQQA 3QH3B 5AUMA 3SKUD 5HGBA 43CAA 4MNQE 4HV8B 1RHFA 1JTOA 4X9HA 2VQTA 4NN6C 3W9EB 3DVFA 5BOPA 1QFPA 1T7ZA 1X5YA 1MFEH 3FOLA 2V2XB 5C0GA 3DVIA 4NNPH 3U0PA 4U1SB 4ZTPL 5JW4N 4RMVA 4FFYH 1A2YB 2Z93A 4LHQB 5EORH 1OM3H 3T2NH 3ULVF 4PLKC 2WAHA 2DL9A 3OV6A 3QPXL 3QUXC 4JO1H 2IADB 5J89A 1CLYL 1U3JA 4X4XB 1JGLL 2DM2A 4LRIC 5DHVA 3UTPD 3SE8L 3Q1SL 4PJ8A 4J4PC 2F58H 1P9MA 3D2UB 4R3SB 3QI9A 5IVXA 4UZGA 1V3KA 4R2GD 1FVCB 4S0TD 4XBGB 1DQDL 2AEPH 3VI3F 1QSFA 4X5WB 1XZ0A 1IGCL 1Q94A 4Y5XB 4DGYL 3MGAA 5JIHA 3I50H 1CICD 1WZ1H 4A6YL 5JQHC 12E8L 2FX9H 3GSXB 1WQVT 5FOBA 3IDUA 1FVEB 2J8HA 5C0FB 3UTTE 1D9KD 1U3HD 4NQXA 3PP4H 1BD2B 1EERB 5I8EB 1QLRA 1YN6B 3BKML 3PWLB 4YDIL 1T66C 1U8KB 4QKXB 3DOSA 3UEZA 3DX6B 4OZIA 5KTEH 3PQYD 5CBAA 3OR6B 1PYWB 5CBEB 1HQ4B 2QSVA 1GAFH 4LRNH 5E2TH 1S7VB 3O3DB 1B0GA 1H5BC 3QUZA 4HKXB 1MRFL 4G42A 1AO7E 1S9KC 3EO9H 1F3RB 1MCPL 1LO3L 2RFXA 4PJXB 4S1SL 1ZVSB 4D94A 1TVHA 4YHNA 4FZ8L 4K71B 3VRLF 1LE9A 5BVJB 1FP5A 1N0LA 1BQUA 5DMGC 1LEIB 1X4YA 2DLTA 2WINB 3PP3H 4X7SH 3MUGB 4KQ3L 4QRPA 1FYTA 1HSBB 2X4SA 1OP3K 1B90A 1DQMH 2A0LD 4N8VG 4Y5VC 5HHOD 1CXIA 5JORA 5EZJB 5I74B 3GMPA 5HVGB 2HKFH 4HWBH 4HJGB 2CKBL 35C8L 2F5AH 4L3EB 2D0HA 5CAYB 4C4KO 3LN4A 5JPMA 1OQOA 3SO3B 3R8QA 3MRIB 5E0QA 5B38A 5HPOA 3GIZL 4F3FA 2NY5C 5D96C 1U58A 3V6OA 1A5FH 5D71L 4P2OD 2HH0H 3G5VB 4PBVC 4UT9H 3L7FA 5FM5M 1INDH 3HAEB 2MCPH 1QFWI 5HVHB 5L2KA 1KLGA 5K33A 1X5JA 3QT2A 1R5WB 4OZHE 2X4PB 4X5XB 1TENA 5HI3D 1YMMB 2FX8L 2XTJB 4HDIA 5E2WH 1RURH 1BHGA 4RGND 4X6DA 4WHTB 3ECBA 3QEHA 2CLRB 5IB3B 4DTGH 1CL7H 4R90H 3NPSC 4KDVA 4HIEA 5HDQH 2EC9U 3ARFC 5F3HA 3FO2B 4JVWA 4WHCA 3UMTA 4DKEL 3HZVB 4RGOL 2Y6SD 1GGBH 3LVEA 3ZL4L 5L2JA 5E03A 4OKVA 1ZLUK 3WJJC 1DEEB 3VXPA 4TVPL 3BE1L 1JRHI 2EDHA 5J13B 3NA9H 4M5YL 3DHJA 3ESUF 1NFIB 4KZEH 2RCSH 5D1QA 3UTOA 3D5OF 1T0PB 3HAEH 1NGZB 4FQQA 5FUZH 3MV7B 1F02I 3NCFB 1INEH 4JFYB 1T3FA 5C07E 4XXCA 3I6LD 5EOTB 3VE0B 1RZKC 2GJZB 3J7HA 3QULA 4FQ1L 5BV7B 4PJAF 1M4KA 1DANU 2CIKA 1H3TA 2FIKA 3S5LG 1IARB 3AGVA 5JZ7C 5D93C 2NMSA 5ALCH 4WTXA 3QNYA 1VSCA 1UKSA 3WUWA 2YK1L 1BBDL 5B8CA 2QTEA 4MX7B 5L6YH 1TZGL 1XGUA 5E4EB 5DQ9B 5GGQH 4WUUA 4EEEA 4XZUA 5DFVD 2CLVA 3GMLA 3BW9B 3P11L 4QHNA 1FL5B 2Z0BA 1I3VA 4P2QD 3DV4A 4LSQL 2YRLA 5GRVL 1NDMB 2EH8L 3MV9B 3ULVC 1F4WL 2NY3B 3F7PC 3QWRD 5JW5B 3QQ3A 1I8MB 1MREH 3QQ4A 2ADFH 3IJYB 1CGXA 5TE7L 1KJ3H 5C7XH 3TN0B 3O11A 2B1HH 4P9HL 3SGDI 4GO6B 3ALPA 1FN4B 5JOFA 2WBJB 5BV7H 3VXSB 4YHOL 5GJSH 4HZLB 1PAMA 2R2BA 2VLMD 3KPQB 1RU9L 3FQWB 3HR6A 2C3GA 4LP5A 3KYNB 5IP4A 1GL4B 3F58L 2E9BA 3C5ZA 1HI6A 2ZJSH 4NQDB 1ERNA 5D7IF 2ZP0T 2BC4A 1IKFH 5FGCE 3O4LE 4WHYG 1L7IH 1MCJA 5DVMA 4F15C 4TUKH 15C8L 2VC2H 5JXAH 2QQNL 1T2QH 3RAJL 1YECL 4GKSB 4Y5YA 2AQ2A 4U1LB 4BFIA 3QFJD 4JFFA 2Z31C 3G9AB 3HMWH 4HHAA 3RKDC 1FNAA 5FGRA 1EGJH 1R3IH 1PX4A 2EE3A 3LB6C 5J11B 1OLLA 1EDQA 1I9RH 4YO0B 4IRSB 4PJDB 2V5SA 1U0QA 2R1WA 1DBKH 4JM2A 5ABDE 2W9LA 2P5EA 5CZVH 5DC0A 3VWKB 4FQXA 1TQCC 4KROB 1LO0H 2H9GA 4G80A 3LIZH 4JDTL 4J23A 3BH8A 4LPXA 1TIUA 4OQTL 2DWDA 4M9OA 2NY2C 3X3GL 1T03L 1F97A 2P48B 4MJ5A 1FSKC 5T3XE 2YD5A 1K5NA 2K3TA 2FCBA 4WW2A 5ICYB 1YYML 1KJVB 1RIHL 2H32A 5EDXA 4E41E 4LSTH 2A74B 3MNVA 3MA9L 2G9HA 5T3ZL 2XXMB 3T8XA 1LE5A 1N3NB 5C9JB 3L3JA 2X4OB 3KPSE 4PG2A 1R0AH 4Q9QL 2VIRA 4EI6A 1I1FA 3DYPA 4MAUL 2OL3B 3MRPA 3VFSA 1KC5H 4HUWA 1TJHH 5CIPB 4OZFB 1BBJA 2QLVB 2QHLA 4E5XA 4ETQA 5I1JL 4WVRA 1MHCA 5SWSB 1ZHLB 4YHKH 4BYHA 3D0LB 2A9NL 2AI0L 2XWJA 4NUGL 1AQKH 1MAMH 1CFTA 3ROLB 4BSVA 3RZCA 3H9SE 3QB7C 4P5MB 1T5XB 3GMRB 3QZWG 4BZ2L 1BQLL 4PRHD 3KLHC 1AR2A 4DVBA 5BS0A 1RJZB 4UI2A 3QDJA 4LGPB 2JLLA 2ZCKH 5C86A 3DI3B 1XF5B 3BP6A 1D5BB 5HGHB 1V3MA 1D5IL 2X1WL 2ZUXA 3CDFA 4RWHA 4HGKC 1EFXB 2VO5A 2YMXH 1J8HE 4I0CC 4GMSL 1ETZB 3RNQB 4O4YL 1MFDH 1ZGLM 4EUPA 1MJ7L 4POZD 1FVDA 4BELD 4XMPH 2DTSA 4WI4A 1YZZA 4HS6B 2J6EL 2JJTC 3LKNA 2OL3H 5SX4I 3IJSA 5EC2A 5CIPH 4OZFH 4NHCH 5F7MC 1OLZA 1BJ1J 4KJYA 2X70A 5D2LB 4F9LA 2WW8A 4NZUH 3GSOB 1RULL 1MHPH 5KSUB 2AXJA 1IAII 3MODL 4P2RD 4G9DA 5EOCL 1WISA 3CFJB 3KPRB 1HH9B 4LLDA 2MTPA 3AREB 3NIDF 1DN0B 3SDAA 1JK8B 1AY1L 1OT1A 1WBXB 4NRZA 1YEDB 3LN5B 4X8JA 4HIXH 2CR3A 1OP3H 4LCIL 1AI1H 3SDXA 3QUXD 3OMZA 5BMFL 2PYED 2E9WA 4OFIA 1MQKH 4M43L 1U8NA 4OTXH 2IQ9H 4J4PD 5TF1H 3X3FH 5IEKA 2ZOKB 3D48R 4S11A 1FDLL 3O2VH 2NXZD 1RZIB 4H0HB 3D39D 4PV8B 4F37K 3B3IA 5EULV 2A83A 1LP9B 4Y19B 1A3LH 3B5HA 2Y06L 2H6PA 4M8QA 4LBEA 5CJQH 1WFNA 3LRSB 1FRGH 2F74B 3OKMA 3B8YA 5TQ2L 2IALB 5IHBA 1HHIB 1A7QL 1XIWA 3O3AA 5DK2A 4X9FA 3FOMB 1DBAH 4Y2DB 3BIKA 2YHGA 4L8SA 5DURB 3L5XH 3REVB 4QF1B 1DFBH 3GHEH 3SCMA 1T0NA 1QRKA 1RQ5A 4OQ1A 1A1MA 5IEHB 5CINH 4DW2L 5HYJA 1N5AA 3V7MA 5I1EL 3DLQR 3RWGA 4JLRA 1T2JA 3LMJH 1ZLUH 4JAMA 5CZXC 2BMKB 5E9DA 4XVUD 3U2SA 3PE9A 1RUKL 1BQHA 5F9AC 5ID1A 2IFFH 1YNKH 1KELL 5DMGD 4UTAL 3HFML 3O3UN 4P5TC 5DJCB 1BJMA 4N0UA 3EOAA 3H3BC 1QHPA 1MAJA 5IW3A 4Y4FC 2BHZA 4WY7H 4J3TA 3H3KA 1RIUH 2CK0H 1DBBH 3JWDH 1J1XH 1B0RB 4XPTH 3WLWC 4JEGB 5DA4A 5HVHC 3Q6FA 3K3QA 5AZ2H 1CE1L 1YEIL 4BFGA 5E8EB 3GNML 3UP1A 1G7PB 4CMHB 4LLMA 2OTUA 4JANB 4X6EA 4R4NC 3I6KB 2YN5A 4RDQG 1UH2A 5DJ6A 3SJVD 2VE6B 3FO1B 4AK1A 5DYOB 4JFQB 3MLWH 3MZGB 4L4JA 5D9SB 3TYGH 1KIPA 5JIKA 5ISZB 2WZPD 3T4AA 3VWJB 9CGTA 4K3JH 4TOYH 4OGZA 3QNZA 1EVTC 3HA0A 2XA3A 3ZKXC 3L3HB 2X2YA 5I17B 3UXFA 3TFKC 2OR9L 3CVHB 4JHAL 4JZNB 5EO9A 1V5JA 4F58L 3C8KB 2P5WD 4MJ6B 4F9PC 3Q5TA 2HLAB 4MA3B 4KHXH 5DZOA 1TTFA 3ARPA 1T20B 5IQ9B 4FXLA 2WIIA 3KHQA 2Y23A 5DZNA 4X7TB 1JF6A 5GGVY 2OMNA 4MCZA 3QO0A 3V6BR 2ZOLA 1ACYH 3HCVA 2YPLD 2HT4C 5IVZB 4UQ2B 4WWKC 2XG4A 3TA3A 1AGEA 1CN4A 5I8KL 2IGFH 1YQVH 4NJ9L 3DVNA 1YEEH 2MKWA 4ZPTA 3EZJB 3PGCB 1FC2D 2IAMD 4ZPVB 3LKSB 5D5ME 4LCWD 1Q9LA 3DYOA 4EQ2A 5JZ7D 5DWUH 5D2NB 3B9VA 5KSBE 4GW4B 3MACL 1NDGA 4U3XA 3CVHH 5FK9B 1IQDB 1TJGL 4OJFL 4V2CB 1HIML 4PJFF 2OS7A 3MOQA 3KYKL 3MJ8A 2DQDL 5DT1L 4LLYA 1EEZA 1ZEAL 3L6FB 1OL0A 4H1LG 3LS5H 1A6TB 1CL7I 2BNUB 5FGBA 1LEKA 3O9WB 5HGBB 4M7ZC 4JKMA 3U7AA 1C12A 3BP5A 3IXAA 5D1XA 4QYOB 1I7UB 3BYTA 4GS7B 3W9DA 4JPWH 4FTVD 5HHXL 3TO4C 3MRHB 3FOLB 5EZLA 2BVYA 3U0PB 5SWZA 1R3LB 1BVLB 1JRHL 5F70A 4XMLL 4OCSL 1R5VA 2Z93B 4M4RA 3RZWA 3VDBA 5E2JA 5E8PA 3UJIL 1UWXK 4KJWC 5JHDA 4GBXC 4AEHH 5FEBA 4EOWH 3V6ZB 2BHUA 2BY1A 5D7JC 1MF2L 2JB6A 4LVOB 4YJZL 2NW3B 4PJ8B 4YNYB 3GSNL 2XY2A 5EUKA 3QI9B 5IVXB 5FYJD 4XNZB 3D9AL 3ARGD 2NY1D 2Z31D 2Y25A 5KVMC 1QSFB 1Z9OA 2ADJA 2Q87A 1XZ0B 2BSRB 2C5DC 1WIUA 3I6GA 1Q94B 3LB6D 3B9KC 1AE6L 1CLZH 1FV1A 5JR1H 4PJ5A 1F45A 3M8OL 1HKFA 2IG2H 3FMGL 3WIIL 3IDYB 3O2WH 4M3JA 4QRUA 1JPSH 5FOBB 3BO8A 1FGNH 1CF8H 5GRXG 5HHME 4ZNCD 1MCNA 2AJSH 2D03H 4K7PY 4JFPB 3NVQA 4ZS7H 5L9DH 5CKAA 2GIYA 1QLRB 3VXMA 3DX8A 2W38A 3U4BL 2DIBA 4OZIB 1G7IA 5CBAB 2JJSA 1QUNA 1W8NA 5I71B 4Z0BL 5DVKA 1B0GB 1TQBC 1WWBX 3QUZB 3HPJA 4U6VH 3K7UA 3W0WE 4TULL 4G42B 5FYKL 1JGVL 5LBSH 4J3OC 3UTTB 5KZCD 2RFXB 3MV8D 5DD1L 2VDQH 4KK6C 1TVHB 2CRYA 3EYVB 4YHNB 1RFDL 4PJ7E 4L3CA 1GPOL 4Y4HA 5EIIA 1ODAA 1KIRA 4R7NA 3BPNB 2NZIA 2Y07L 4E42B 4JR9H 1LE9B 5JDJA 5DF0A 3S88H 5ID0B 5DQJA 5LWYL 5C0AD 1E28A 1FO0L 4QRPB 3ZSSA 1ITCA 4RMWA 1J0YA 4P48A 4XC3L 3WFDL 4PJBE 1G0XA 3LKRA 2ENSA 1M7DA 2VAJA 3MFFA 3GMPB 3KLHD 2VLLA 4OFYA 1IEBB 1NUNB 5HHNA 3MA7A 3FT2A 4WIQA 4DUXA 2UWEE 5DRWA 5B39B 3LN4B 1FJ1A 4M3KB 2J5LB 5B38B 4LP4A 4F3FB 5DQDH 1BFVL 2NXYB 4LKXA 1VEPA 1DE4A 2NW2A 4NZRL 1XGTA 3L7FB 4V1DA 1VFAA 5CJBA 4FOMA 4CU8A 5L2KB 1KLGB 1XCQA 3DECA 3HS0A 4PLJC 3TNNA 5CGMA 4NQUA 5D70H 4ZUUB 2X1XR 4HDIB 5H94A 1MAKA 3B5TA 3OPZH 1KCLA 5F9OL 2VL4A 5CJ8A 5IR1A 1OT2A 3ECBB 3T65B 5I15L 3FRUB 2VL5B 1FH5L 2ATKA 2EE6A 4IIQC 2YKLL 5JW4Q 3DUUA 1H3XA 5DD3H 4HSQA 3KLAA 5FF6A 5F3HB 3VXNA 4Z18A 4LSDA 1LILA 4JCLA 1UJ3C 1ZGLB 4OKDA 1HXMB 4GG6A 2AABH 4NKDB 2VN4A 3VXTA 1PSKH 4YHZL 4HAGA 4LARL 4OKVB 4RX4D 1XR8A 3V4UL 4OLUH 1F8TH 3CFIC 2KL6A 3ARSA 3VXPB 5I8CB 3VG0L 1T04A 2HJFA 4KFZC 3GBML 4XTRD 3RNKA 5DR5H 4LLVB 4U05A 2BXZA 1I9IH 4MHHI 5CHNA 3W2DH 4PJIF 3UTSA 3IDIB 1JZ4A 1T3FB 3AFLA 4JRYE 5CD3A 4TSAH 4NZTH 3FO0H 3JVGC 3HNVH 4WFHE 3S37H 4NOBA 4HIIA 1JF1B 2CIKB 5C0CE 3G04A 1JPST 2YBRB 1IM3A 3KPTA 2VXUH 4HKBA 2WWMD 5K9JL 3S7GA 2Q86A 4RFNB 5B8CB 5KJRL 3HC4L 4JFDA 4X0KA 1WV7T 4IJ3B 4WUUB 1UH3A 5B4MC 3BAEH 4TNWK 3GMLB 2M1KA 4N90E 1P5VA 3MROB 1MSPA 4PB0H 3DV4B 2BOBA 5AYUH 1IGFH 3O6FB 5K9OA 1RZ7L 2I25N 1SMOA 4LDEB 1EJOH 4JY4A 4YQXH 4FZEL 2IWGA 3VXOA 1XGYH 3QQ4B 2D7TL 4L4TA 4JO2L 4KKAC 4TSBL 3QO1A 3NZHH 2HTLD 5CZXD 3O11B 5MEQB 3WNMA 1HKLH 1BGXL 3CDCA 3OKOA 4QY8A 4NQCA 2BX5A 2R2BB 2NYYC 4C56A 3WKML 1Q0XH 4K2UL 5TJWK 5KS9E 3MRFA 1HI6B 5IBTH 4WV1A 3WJLC 4L3ED 4KUCD 2BC4B 1UCBH 3OAYK 5DJYA 5EOCJ 4GOSA 4L4VD 4MDJA 5LGHH 5JW3H 1B2WL 4N9OB 2LTQC 1TITA 3MRBA 3P9WB 4LVHC 4R26L 1FNLA 1UVQA 4U6TA 1KV3A 4KUZH 1NEZA 4C57C 3RVWD 4Y5YB 4D3CL 4BFIB 4JFFB 3BKCH 3WLWD 4HS8H 1GGIL 3QUYC 5KVEH 4JJ5A 1KJ2A 1EHNA 1S7RB 3QDAA 3VFGH 1OWWA 1G9MC 1YMMD 2XTJD 4I77L 4JG1L 4BSWA 2R1WB 4L9LC 4WI6A 4JM2B 4XMKL 1ADQL 4R4ND 2P5EB 3ZDXE 4FQXB 2Q76A 1XGQA 1UWEL 4P46B 1F5WA 2JCCF 4G80B 3LPWA 1A1OA 1WFUA 3BDXA 4MS8D 3RVVC 3TBYA 5JXEC 2DJSA 3IU3A 2PTVA 5DUBA 4HWEH 4PJGF 4MJ5B 5SX5H 4HS3A 1K5NB 4ZUWA 5C6PB 3TFKD 1AJ7H 1TFHA 2Z92A 1MFEL 3T8XB 2G9HB 3DSFL 4NNPL 2XQBH 1LE5B 3T0XA 2VWEE 3L3JB 3VH8A 1P1ZB 2VIRB 4FFYL 1I1FB 3I2CL 1OM3L 5T1MA 3RBSA 1MCCA 1UWXH 1L9NA 2IH3B 4HUWB 4X6CE 1IMHC 3BGFC 1JPGA 3MV7D 4XNYH 2X7LB 1K4DA 2HWZH 4JO1L 4ETQB 2VZTA 3U9PH 3FB8A 3FT3A 3UJTH 3FFCA 4OZHF 2R9HC 1DLFL 2XWTB 1CGUA 5C09E 2O61B 3GI8H 5LCVH 1CFTB 4UQ3A 2HT4D 4BSVB 3RZCB 1A02N 3ETBF 1VADA 3PDOA 5DGRA 4OGYH 2AEPL 1U3ZA 3KXFA 3KPSB 1TJIH 4DVBB 5BS0B 5D2NC 2QADC 1N6VA 3QDJB 4HPYL 5GZOC 2HJLB 5HY9A 3IDMA 4ODTH 3I50L 3V2AR 2AQ3A 2ZPKH 1AXSA 2FX9L 2CUMA 2RJMA 4M93B 3UPAA 4S1DC 3CH1B 3BESR 4XPHL 4PGEA 1QR1A 4TYUA 1DBMH 2IANB 1PX3A 2F54D 2GHWB 4U1KB 4X8XA 3H9SB 4KAQH 4D9QE 5C1MB 1IEAA 4EUPB 1FVDB 1RK1B 2GUOA 1KCSH 2AEQH 4LRNL 3IJSB 5E2TL 5EC2B 5DJXB 1P4LA 1XFPA 2B4CH 3HE6B 4KJYB 3TN0D 2X70B 3MFGB 6FABL 1M71A 2C4FU 3VDAA 3HI5L 3GJFA 1F4YL 2WBJD 2PTTB 4PBWD 3VXSD 4HKJA 4PJEE 5FUOH 3IKKA 4GXVH 2WANA 4OT1H 2AJYH 4O9HH 1SM3L 1Q9WA 2EKJA 2D0FA 4LLDB 4EN3A 5EU7C 2AJXH 1C5DA 4DKAA 3RIAF 5IJKC 3SDAB 2VOTA 4NQDD 3EKCA 3KYAA 3D85B 4NRZB 2LVEA 4X8JB 3CPLA 3BH9B 1AGCA 5MP6H 2MHAA 3GSVA 1NGPH 2CJUH 3D1MC 4HLZH 5M7QA 3CIQA 4GBXD 1DQML 4NDMA 2KUTA 1YEFH 3AB0C 4PJHE 1EXUB 1U8NB 2ED9A 5DUML 3SKMA 2HKFL 4HWBL 2ESVA 1KNOA 1V7NH 5DO2D 5IIEA 5IMOA 4OCMC 4PRAA 3UPRA 5IHUH 5IWLA 1A5FL 3QIUC 2R2CA 3B3IB 2A83B 3WNOA 2HH0L 4NO0A 3VWKD 1A6ZB 2E9IA 4C4KT 2H6PB 4M8QB 1U8OB 1INDL 4KDTA 4GKNA 2F15A 2MCPL 3VU2A 3EYOA 4NBYB 1MRDH 2PXYA 3RWCA 3OKMB 3G5XA 1XIWB 1MJ8L 5DK2B 2I60H 2QSCH 1X5ZA 2V5RA 1UJTA 4RMTA 4G8GA 4DTGL 5F1OB 2Y1VA 2HRPH 4N5EC 2GJ6A 1J11A 4I0KA 4Z7UA 3K81A 4U7SA 3TVMC 1UB5A 3G9VA 5E7BA 3NOIA 5HYJB 4IRJC 1N5AB 4CKVX 3NTCH 2VSCA 1GGBL 1GCFA 3WFBH 1JPTL 4DQOL 3RWGB 3U46A 4JAMB 4KMTH 1DUZB 3AM8A 2ILLA 4KK6D 5E9DB 2Q6WA 1FFOA 4XPBH 3U2SB 4YXHH 3QDGE 1WC7A 5CLWA 2QEJA 3QEQE 1BQHB 3WEXA 5ID1B 3P4NA 1MFBH 4KZEL 5EWIH 1P5UA 1CFQA 5DD6A 1INEL 3V0WL 1QSZA 3T0EA 4QHMA 3DXAD 2VLJA 1EFXD 4YGAB 5CD5C 1GOFA 5GRYA 4LNVA 3RI5F 5ALCL 2CLZA 3Q6FB 3RBGA 3WBDA 4LLMB 2JB5H 5L6YL 1KXVC 2G60H 2OTUB 2BJML 1AHWC 4X6EB 2GTWA 4R8WL 4RGMC 4JKPH 2VDKH 3RFZC 3K46A 5DJ6B 4X6DE 1LHZA 4U2ZA 1LK3H 1DLHA 4JZJA 2X4TA 5F7FA 1KIPB 1ZANL 3T4AB 5HHVL 3KPRD 1CD9B 1KN4H 5AAMA 2ADFL 3D3VA 4JFXA 3QNZB 1ULVA 3LCYA 3EJYD 4JPKL 4N8CH 2EDFA 1LDPH 4BH8A 2DD8H 3ARED 3X13A 1EJ6A 1KJ3L 3TT1L 2B1HL 3ES6A 4JJHA 5EO9B 3A6CH 3M1BB 3U83A 4G6AD 4OZGF 4I0PC 1DL7H 2ICES 2VB5A 1NGWA 4GMTH 4XPAH 5IB2A 1E4JA 3RVXC 3T77B 4BZ1H 2FEEL 4NJAH 4WI3A 1Q1JL 5EUOE 3TJHD 4CRPA 2OQJA 4OUOA 5DMIH 2WIIB 1R24A 3MRGA 3VDCA 1KSRA 3ZZ1A 3OAYH 1N2RB 2EDXA 1A0QH 4MCZB 3QO0B 1QO3A 3QIBC 4M8VA 3NBNA 2ZOLB 1L7IL 4B50A 4TUKL 4Q2ZB 2VC2L 5L88H 5DK0B 3HRPA 5JMRA 2DI9A 1AGEB 1CD1B 2FSEB 1CDYA 1NJ9A 3OG4B 2V2WB 3IT8D 4ZPTB 3TCXA 4X99B 4RFNC 5I73B 3EYUH 2XY1A 1V3LA 3E6FB 3T0DA 1BOYA 1I9RL 2C26A 1DBKL 5CZVL 4QRSA 2AV7A 3LIZL 2NPLX 1RUMH 4X6BA 2R1YA 5AD0B 3MBEC 2MKLC 2ADGA 4FMFA 5MEPA 3PGFL 3SE3C 2FNBA 4LLYB 1EEZB 1CE6B 3K80A 3SDCB 4X80L 3CXDH 4U6XA 3H7LA 4O2EB 4NCC1 3KPPA 5FHBL 1AR1C 2VXVH 5BVPH 4J6RH 1R0AL 1G0DA 1WITA 4KKAD 3MYJA 3W9DB 4TQEL 2BXYA 3ARBB 4NN5C 5F7EH 1MIML 5F21B 3DMMC 3GRWL 5EZLB 1OAZH 5SWZB 3WUWG 4H88H 2NY7H 1ITBB 4CDGC 4OM1H 3G08B 3QUKA 3TH2T 4JHBA 4YHKL 5E8PB 5F71A 3TIDA 1V3JA 3AAZB 1NBVH 1MAML 5JHDB 1I7RA 3HB3C 4YLQT 2P7TA 1BAFL 1FG2A 2B39A 5MERA 3MRRA 2JB6B 3TM6A 4G6JH 3GDBA 5CKGA 1PKQE 3UDWA 1PZUB 3DVGA 1HH6B 1OGAD 1CICA 2JF1A 5AWNH 4ZFFB 2AKRB 2ZCKL 3ZKMD 3ESVF 5FDYA 5I75C 1IKNC 3EOBA 1SHMA 2NY6C 1U3HA 2YUWA 4GRWB 4ZSOA 3IXTA 3MLVH 2ADJB 4OGAD 2OX5A 4UBDD 1UM4L 3I6GB 4R0LA 4U3CA 4ZOEA 5IK3B 5J6GA 1FV1B 2KPNA 4PS4H 2VAAA 3CD4A 3PQYA 4PJ5B 1MUJA 4M1DH 5D6DC 3DRQB 4GSDH 4RDQF 4QRUB 3BO8B 2EDKA 5ISZD 3VWJD 3RPIB 2OL3L 3MLYL 3JXAA 2XKUA 3RVVD 3VXMB 4JVPA 3WN5A 4NHCL 2SEBA 2EDDA 4HC1A 4XBEL 5E2UH 2W9DH 1J8KA 3F7VA 5TF0A 1QNZL 3C87A 2CK2A 4G9FE 3HPJB 1J1PH 1T6WA 5GS1C 5HYSB 3MNZA 4JY6B 1OSZA 2OTWB 1H9VA 1LO4H 1W72B 2QR0A 1NGXA 4L3CB 4MNGA 3JTSA 3VGDA 4Y4HB 5HHOA 4GRMA 2R56H 3SGJA 1EK3A 1MCDA 2GEEA 2APXA 3TCLA 4MVBC 3ZTNL 1CD8A 1MQKL 5DQJB 1E28B 2R9HD 2B8OT 2IQ9L 5TF1L 3INUH 3TGXA 3W0WB 3HE7C 1IC4H 5CWSA 4L29A 2CUHA 2VDOL 1D6EA 5F7HA 3LKRB 3O2VL 1DP0A 2XT1B 3JZ7A 4AEEA 5MEOA 1M7DB 3MFFB 1CLCA 1KCVH 1KEMH 4P2OA 1OPGH 3GHBL 5HYEA 2VLLB 1NUFA 4UUJA 3PXJA 5HHNB 3MA7B 1A3LL 4RAVA 3VXRD 5GZOD 5JQ6H 3FT2B 5CJQL 1FJ1B 4LVNC 2AK4D 1FRGL 2DOCA 1KLUA 2EXYD 4OI7A 2XZCH 1MLCA 3OGCA 3WDJA 4M7KH 4S1DD 3QRGH 4LKXB 1DE4B 43C9A 3BQUC 3SDDC 2NW2B 1XGTB 2F53E 4V1DB 4UB0L 1VFAB 1DBAL 1LWRA 5CFHA 3L5XL 1XCQB 3HS0B 4J2XA 4IMLA 3TNNB 5C8JB 5FKPB 3GHEL 3VGFA 1W72H 2NX5A 4X4MA 3O9WD 5IHLB 4MLIA 1SYSA 2UWEB 2YEZA 2RR3A 1HHHA 5CINL 1DQQB 1PLGL 2ATKB 1A14H 2J7LA 1MQ8A 1OW0A 4HULB 1G0YR 1LNUA 2BSTB 3QCTL 5ADPH 3LMJL 4PV9A 4IDJH 3WIFA 1WEJL 5FF6B 2F5BL 4BQCA 1A6AB 5D5MF 4EDXA 5IMLB 4F33B 2FEDD 4DFHA 2IFFL 5L0QB 3MREA 1YNKL 1DZBA 1OP9A 3M17A 4KKCC 1XR8B 4NC1C 4QRTA 1HEZA 4YGVA 3MR9A 2R0ZL 4MNQD 2H41A 3ARDC 2X4UA 3CSYA 1NMCB 4EUPG 4X6FB 1T04B 2HJFB 1F42A 4LHUD 3RNKB 5EBGA 3QI9D 3BN9C 1ZE3C 4JFEE 3VFOA 1BLNA 1Z2KA 5CD3B 1QSFD 1P69B 2CK0L 1DBBL 3FTGA 3JWDL 3GMNA 1IT9L 1J1XL 3FB7A 4HIIB 4NBZB 1MCOH 4XPTL 3O2DH 5C08E 1H8SA 2VNCA 1WWCA 3GMMB