1R0FA

Gallium-substituted rubredoxin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
b'MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Metal-substituted derivatives of the rubredoxin from Clostridium pasteurianum.
pubmed doi rcsb
source organism Clostridium pasteurianum
molecule tags Electron transport
total genus 8
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2003-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1r0fA00
1B2OA 4ME3A 3MPSA 5AI3A 1RDVA 2MS3A 4YWMA 1RDGA 2KKDA 2QL0A 1B13A 1BQ9A 5AI2A 1BFYA 1RYTA 2HR5A 4K9FA 1IU5A 3KYVA 8RXNA 3SS2A 2M4YA 3QVDA 1YK5A 4TPUA 1T9OA 1QCVA 1T9PA 2PYAA 1QYBA 4AR5A 1BE7A 1C09A 1E8JA 7RXNA 1BRFA 1DX8A 1LKPA 2DSXA 1SMUA 1H7VA 2K2DA 1CADA 1LKMA 3RYGA 1B71A 3KYUA 1RWDA 1S30A 1YV1A 4AR3A 3PWFA 1YK4A 1T9QA 2LCQA 2VL6A 4POFA 2GMGA 3KYWA 1YUXA 1VCXA 1R0JA 2RDVA 4RXNA 2KN9A 1BQ8A 2PVXA 3KYYA 4POGA 4AR4A 2V3BB 6RXNA 5IY0A 3RZTA 3KYXA 2PVEA 3RZ6A 1RB9A 5RXNA 1B2JA 1FHMA 1R0IA 4YWLA 1DVBA 3A44A 1JYBA 4AR6A 1IU6A 1ZRPA 3PZAA 1YUZA 1FHHA 1S24A 1R0HA 1IRNA 1IROA 1SMWA 1R0FA 1R0GA 1LTLA 1LKOA 1SMMA 1NNQA 1CAAA 1S2ZA
chains in the Genus database with same CATH superfamily
4LHNA 2VUML 4A93L 1Y1WL 2KKDA 4AYBP 5C44L 4K9FA 3MQKB 2AYJA 2JA8L 4TPUA 1T9OA 1QQTA 4BBSL 4AI1A 2NVTL 4AR5A 2XJSA 2JI3A 1C09A 1BRFA 2XJUA 1LKPA 5IYDL 1WCML 1TWCL 5GAHc 3J7Y1 3QQCE 1H7VA 1LKMA 3RYGA 5MF6A 3KYUA 4BY7L 2B63L 1ODHA 5MGNA 5GADc 3RZOL 4AR3A 3PWFA 4POFA 4ZN1B 2PPTA 1YUXA 4Y7NL 2O5JD 5DM61 2AUSB 2PVXA 2JA5L 5M3ML 2JI2A 3M4OL 6RXNA 5C4XL 1TWGL 2WB1P 2PVEA 1I6HL 2XJTA 2A68D 1R9TL 1R0IA 5EINC 1JYBA 4QIWP 4A3JL 2JA6L 2V0FA 3GTGL 4A3BL 2M6PA 2Z3RB 1SMWA 5EIOC 4E6YA 4A3FL 5MLC3 4XXBB 1R0GA 1LTLA 5MFPA 2XJRA 4UY81 2EY4E 5C4JL 2E2JL 2YU9L 4C3JL 3PIO1 4AI2A 2MS3A 5AN9H 3S2HL 3I4ML 1BQ9A 1OWCA 3PL5A 3GTPL 1NXEA 1RYTA 2CKAA 3K35A 1IU5A 3HOZL 8RXNA 4AI3A 5IYBL 4U671 3H97A 4G6BA 3B0AB 2XJVA 1Z92B 7RXNA 4A3CL 2R93L 2C6BA 2DSXA 3FDJA 2K2DA 1CADA 1B71A 1RWDA 4BXXL 2AQCA 3H3VM 3PKJA 1YV1A 4GS7D 3M3YL 3LWPB 3S1NL 1VCXA 4A3IL 2NVXL 4BY1L 4V196 3S16L 4X6AL 3KYYA 3RZDL 1RYQA 2H12A 2V3BB 5DM71 3KYXA 4BBRL 2NYDA 5RXNA 3I4NL 4XGHA 5M5XL 1OWBA 4WFN1 2L0ZA 3VPBE 3GTML 3S15L 1VZHA 1YUZA 1FHHA 1S24A 2ERSA 1IROA 2M4VA 1WJVA 1PFUA 3B08B 4B8CD 2R7ZL 3LPEB 2R92L 4C3HL 1NNQA 4AI0A 4Y52L 1S2ZA 5C3EL 1RDVA 1K83L 3H99A 4YWMA 1RDGA 3GTLL 2CKCA 1TWAL 2QL0A 4ZN3B 1NXGA 5AI2A 1BFYA 1PFVA 2NVYL 3KYVA 3HOXL 3SS2A 3MSUA 4LHLA 2M4YA 3QVDA 1QCVA 1T9PA 2PYAA 3HOUL 3PO2L 1BE7A 1E8JA 5GAEc 1DX8A 5K2ME 2V0EA 4TVMA 3GTKL 3LWRB 1SMUA 2XJPA 2BE5D 4AHYA 3S1RL 4JAFA 1YK4A 1T9QA 2LCQA 2VL6A 3H9BA 3KYWA 3S17L 4A3LL 3GTJL 1IW7D 3FKIL 4RXNA 3HAXC 2KN9A 1BQ8A 4POGA 4A3DL 1RB9A 2NVQL 3HOWL 3NFPI 2Y0SP 1FHMA 5FJ8L 2A6ED 4YWLA 3S1QL 2E2IL 1TWHL 3A44A 1IU6A 5IP9L 3PZAA 3WWNB 1PFWA 1P7PA 4A3KL 3HOYL 1I50L 1R0FA 1SFOL 5MFZA 5M3FL 3HOVL 2A6HD 3GTOL 3S14L 2PMZP 1B2OA 2APOB 2ERJA 3H0GL 3P8BA 3HJYB 3H9CA 4ME3A 3MPSA 5AI3A 2J9UB 2RFKB 1VZIA 1I3QL 1B13A 1Y1VL 3S1ML 2B5ID 3PO3L 2CR8A 2HR5A 3CQZL 4AHWA 2JI1A 2JA7L 3HJWB 1YK5A 1VZGA 3P2AA 1QYBA 3ZG6A 4A3EL 4JADA 4C3IL 3GTQL 2M6OA 1S30A 2Z3QB 5IP7L 5IYCL 3LNLA 1TWFL 2C6AA 4C2M1 5FLML 2GMGA 1R0JA 2E2HL 4AHXA 2RDVA 5JVG1 5M5YL 3HKZP 4AR4A 5JVH1 3JR7A 2A69D 4AHZA 5IY0A 3RZTA 4A3GL 2XJQA 3RZ6A 1B2JA 3IU3I 4A3ML 3PKIA 3LWOB 5GAGc 2WAQP 3LWQB 1DVBA 4AR6A 1ZRPA 1PZXA 2ZIXA 2PSMC 1PFYA 3K7AL 3J7Z1 1R0HA 5H1Sc 1IRNA 3S2DL 5M5WL 1LKOA 2HVYC 3PIP1 3LWVB 1SMMA 1F4LA 4JAGA 1CAAA 3WWLA 4JAEA
chains in the Genus database with same CATH topology
1B2OA 2ERJA 3P8BA 4LHNA 4ME3A 3PIO1 3MPSA 5AI3A 1RDVA 4AI2A 2MS3A 2J9UB 4YWMA 1RDGA 2KKDA 2CKCA 2QL0A 1VZIA 5AN9H 1B13A 4ZN3B 1BQ9A 1OWCA 1NXGA 5AI2A 2B5ID 1BFYA 2CR8A 1NXEA 1RYTA 2CKAA 2HR5A 3K35A 4K9FA 1IU5A 3KYVA 8RXNA 4AHWA 3SS2A 3MSUA 4LHLA 4AI3A 2AYJA 2JI1A 2M4YA 3QVDA 1YK5A 4U671 4TPUA 1T9OA 1QCVA 4AI1A 1T9PA 1VZGA 3P2AA 2PYAA 1QYBA 4G6BA 4AR5A 3B0AB 2XJSA 2XJVA 2JI3A 3ZG6A 1BE7A 1C09A 1E8JA 1Z92B 7RXNA 4JADA 1BRFA 5GAEc 5K2ME 2XJUA 1DX8A 2V0EA 1LKPA 5GAHc 3J7Y1 2C6BA 2DSXA 4TVMA 3QQCE 1SMUA 2M6OA 1H7VA 2K2DA 1CADA 1LKMA 3RYGA 1B71A 3KYUA 1RWDA 1S30A 5MF6A 1ODHA 5MGNA 2Z3QB 2XJPA 2BE5D 3LNLA 3PKJA 5GADc 1YV1A 4AHYA 4GS7D 4AR3A 2C6AA 4JAFA 3PWFA 1YK4A 1T9QA 2LCQA 2VL6A 4POFA 4ZN1B 2PPTA 2GMGA 3KYWA 1YUXA 1VCXA 1R0JA 1IW7D 4AHXA 2RDVA 4RXNA 2O5JD 2KN9A 1BQ8A 5DM61 2PVXA 5JVG1 4V196 3KYYA 2JI2A 4POGA 1RYQA 2H12A 4AR4A 2V3BB 6RXNA 5JVH1 2A69D 4AHZA 5DM71 5IY0A 3RZTA 3KYXA 2PVEA 2XJQA 3RZ6A 2XJTA 2A68D 1RB9A 2NYDA 5RXNA 1B2JA 3NFPI 1FHMA 3IU3I 4XGHA 3PKIA 2A6ED 4YWLA 1R0IA 5EINC 5GAGc 1OWBA 4WFN1 1JYBA 1DVBA 3A44A 2L0ZA 3VPBE 1IU6A 4AR6A 1ZRPA 2ZIXA 3PZAA 1VZHA 2PSMC 3WWNB 2V0FA 3J7Z1 1YUZA 1FHHA 1S24A 1R0HA 5H1Sc 1IRNA 2ERSA 1IROA 2M4VA 2M6PA 1WJVA 3B08B 2Z3RB 1SMWA 4B8CD 1R0FA 3LPEB 5EIOC 4E6YA 5MFZA 5MLC3 4XXBB 1R0GA 1LTLA 1LKOA 5MFPA 2A6HD 3PIP1 2XJRA 1SMMA 1NNQA 4AI0A 4UY81 4JAGA 1CAAA 3WWLA 4JAEA 1S2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2O A;  4ME3 A;  3MPS A;  5AI3 A;  1RDV A;  2MS3 A;  4YWM A;  1RDG A;  2KKD A;  2QL0 A;  1B13 A;  1BQ9 A;  5AI2 A;  1BFY A;  1RYT A;  2HR5 A;  4K9F A;  1IU5 A;  3KYV A;  8RXN A;  3SS2 A;  2M4Y A;  3QVD A;  1YK5 A;  4TPU A;  1T9O A;  1QCV A;  1T9P A;  2PYA A;  1QYB A;  4AR5 A;  1BE7 A;  1C09 A;  1E8J A;  7RXN A;  1BRF A;  1DX8 A;  1LKP A;  2DSX A;  1SMU A;  1H7V A;  2K2D A;  1CAD A;  1LKM A;  3RYG A;  1B71 A;  3KYU A;  1RWD A;  1S30 A;  1YV1 A;  4AR3 A;  3PWF A;  1YK4 A;  1T9Q A;  2LCQ A;  2VL6 A;  4POF A;  2GMG A;  3KYW A;  1YUX A;  1VCX A;  1R0J A;  2RDV A;  4RXN A;  2KN9 A;  1BQ8 A;  2PVX A;  3KYY A;  4POG A;  4AR4 A;  2V3B B;  6RXN A;  5IY0 A;  3RZT A;  3KYX A;  2PVE A;  3RZ6 A;  1RB9 A;  5RXN A;  1B2J A;  1FHM A;  1R0I A;  4YWL A;  1DVB A;  3A44 A;  1JYB A;  4AR6 A;  1IU6 A;  1ZRP A;  3PZA A;  1YUZ A;  1FHH A;  1S24 A;  1R0H A;  1IRN A;  1IRO A;  1SMW A;  1R0F A;  1R0G A;  1LTL A;  1LKO A;  1SMM A;  1NNQ A;  1CAA A;  1S2Z A; 
#chains in the Genus database with same CATH topology
 4LHN A;  2VUM L;  4A93 L;  1Y1W L;  2KKD A;  4AYB P;  5C44 L;  4K9F A;  3MQK B;  2AYJ A;  2JA8 L;  4TPU A;  1T9O A;  1QQT A;  4BBS L;  4AI1 A;  2NVT L;  4AR5 A;  2XJS A;  2JI3 A;  1C09 A;  1BRF A;  2XJU A;  1LKP A;  5IYD L;  1WCM L;  1TWC L;  5GAH c;  3J7Y 1;  3QQC E;  1H7V A;  1LKM A;  3RYG A;  5MF6 A;  3KYU A;  4BY7 L;  2B63 L;  1ODH A;  5MGN A;  5GAD c;  3RZO L;  4AR3 A;  3PWF A;  4POF A;  4ZN1 B;  2PPT A;  1YUX A;  4Y7N L;  2O5J D;  5DM6 1;  2AUS B;  2PVX A;  2JA5 L;  5M3M L;  2JI2 A;  3M4O L;  6RXN A;  5C4X L;  1TWG L;  2WB1 P;  2PVE A;  1I6H L;  2XJT A;  2A68 D;  1R9T L;  1R0I A;  5EIN C;  1JYB A;  4QIW P;  4A3J L;  2JA6 L;  2V0F A;  3GTG L;  4A3B L;  2M6P A;  2Z3R B;  1SMW A;  5EIO C;  4E6Y A;  4A3F L;  5MLC 3;  4XXB B;  1R0G A;  1LTL A;  5MFP A;  2XJR A;  4UY8 1;  2EY4 E;  5C4J L;  2E2J L;  2YU9 L;  4C3J L;  3PIO 1;  4AI2 A;  2MS3 A;  5AN9 H;  3S2H L;  3I4M L;  1BQ9 A;  1OWC A;  3PL5 A;  3GTP L;  1NXE A;  1RYT A;  2CKA A;  3K35 A;  1IU5 A;  3HOZ L;  8RXN A;  4AI3 A;  5IYB L;  4U67 1;  3H97 A;  4G6B A;  3B0A B;  2XJV A;  1Z92 B;  7RXN A;  4A3C L;  2R93 L;  2C6B A;  2DSX A;  3FDJ A;  2K2D A;  1CAD A;  1B71 A;  1RWD A;  4BXX L;  2AQC A;  3H3V M;  3PKJ A;  1YV1 A;  4GS7 D;  3M3Y L;  3LWP B;  3S1N L;  1VCX A;  4A3I L;  2NVX L;  4BY1 L;  4V19 6;  3S16 L;  4X6A L;  3KYY A;  3RZD L;  1RYQ A;  2H12 A;  2V3B B;  5DM7 1;  3KYX A;  4BBR L;  2NYD A;  5RXN A;  3I4N L;  4XGH A;  5M5X L;  1OWB A;  4WFN 1;  2L0Z A;  3VPB E;  3GTM L;  3S15 L;  1VZH A;  1YUZ A;  1FHH A;  1S24 A;  2ERS A;  1IRO A;  2M4V A;  1WJV A;  1PFU A;  3B08 B;  4B8C D;  2R7Z L;  3LPE B;  2R92 L;  4C3H L;  1NNQ A;  4AI0 A;  4Y52 L;  1S2Z A;  5C3E L;  1RDV A;  1K83 L;  3H99 A;  4YWM A;  1RDG A;  3GTL L;  2CKC A;  1TWA L;  2QL0 A;  4ZN3 B;  1NXG A;  5AI2 A;  1BFY A;  1PFV A;  2NVY L;  3KYV A;  3HOX L;  3SS2 A;  3MSU A;  4LHL A;  2M4Y A;  3QVD A;  1QCV A;  1T9P A;  2PYA A;  3HOU L;  3PO2 L;  1BE7 A;  1E8J A;  5GAE c;  1DX8 A;  5K2M E;  2V0E A;  4TVM A;  3GTK L;  3LWR B;  1SMU A;  2XJP A;  2BE5 D;  4AHY A;  3S1R L;  4JAF A;  1YK4 A;  1T9Q A;  2LCQ A;  2VL6 A;  3H9B A;  3KYW A;  3S17 L;  4A3L L;  3GTJ L;  1IW7 D;  3FKI L;  4RXN A;  3HAX C;  2KN9 A;  1BQ8 A;  4POG A;  4A3D L;  1RB9 A;  2NVQ L;  3HOW L;  3NFP I;  2Y0S P;  1FHM A;  5FJ8 L;  2A6E D;  4YWL A;  3S1Q L;  2E2I L;  1TWH L;  3A44 A;  1IU6 A;  5IP9 L;  3PZA A;  3WWN B;  1PFW A;  1P7P A;  4A3K L;  3HOY L;  1I50 L;  1R0F A;  1SFO L;  5MFZ A;  5M3F L;  3HOV L;  2A6H D;  3GTO L;  3S14 L;  2PMZ P;  1B2O A;  2APO B;  2ERJ A;  3H0G L;  3P8B A;  3HJY B;  3H9C A;  4ME3 A;  3MPS A;  5AI3 A;  2J9U B;  2RFK B;  1VZI A;  1I3Q L;  1B13 A;  1Y1V L;  3S1M L;  2B5I D;  3PO3 L;  2CR8 A;  2HR5 A;  3CQZ L;  4AHW A;  2JI1 A;  2JA7 L;  3HJW B;  1YK5 A;  1VZG A;  3P2A A;  1QYB A;  3ZG6 A;  4A3E L;  4JAD A;  4C3I L;  3GTQ L;  2M6O A;  1S30 A;  2Z3Q B;  5IP7 L;  5IYC L;  3LNL A;  1TWF L;  2C6A A;  4C2M 1;  5FLM L;  2GMG A;  1R0J A;  2E2H L;  4AHX A;  2RDV A;  5JVG 1;  5M5Y L;  3HKZ P;  4AR4 A;  5JVH 1;  3JR7 A;  2A69 D;  4AHZ A;  5IY0 A;  3RZT A;  4A3G L;  2XJQ A;  3RZ6 A;  1B2J A;  3IU3 I;  4A3M L;  3PKI A;  3LWO B;  5GAG c;  2WAQ P;  3LWQ B;  1DVB A;  4AR6 A;  1ZRP A;  1PZX A;  2ZIX A;  2PSM C;  1PFY A;  3K7A L;  3J7Z 1;  1R0H A;  5H1S c;  1IRN A;  3S2D L;  5M5W L;  1LKO A;  2HVY C;  3PIP 1;  3LWV B;  1SMM A;  1F4L A;  4JAG A;  1CAA A;  3WWL A;  4JAE A; 
#chains in the Genus database with same CATH homology
 1B2O A;  2ERJ A;  3P8B A;  4LHN A;  4ME3 A;  3PIO 1;  3MPS A;  5AI3 A;  1RDV A;  4AI2 A;  2MS3 A;  2J9U B;  4YWM A;  1RDG A;  2KKD A;  2CKC A;  2QL0 A;  1VZI A;  5AN9 H;  1B13 A;  4ZN3 B;  1BQ9 A;  1OWC A;  1NXG A;  5AI2 A;  2B5I D;  1BFY A;  2CR8 A;  1NXE A;  1RYT A;  2CKA A;  2HR5 A;  3K35 A;  4K9F A;  1IU5 A;  3KYV A;  8RXN A;  4AHW A;  3SS2 A;  3MSU A;  4LHL A;  4AI3 A;  2AYJ A;  2JI1 A;  2M4Y A;  3QVD A;  1YK5 A;  4U67 1;  4TPU A;  1T9O A;  1QCV A;  4AI1 A;  1T9P A;  1VZG A;  3P2A A;  2PYA A;  1QYB A;  4G6B A;  4AR5 A;  3B0A B;  2XJS A;  2XJV A;  2JI3 A;  3ZG6 A;  1BE7 A;  1C09 A;  1E8J A;  1Z92 B;  7RXN A;  4JAD A;  1BRF A;  5GAE c;  5K2M E;  2XJU A;  1DX8 A;  2V0E A;  1LKP A;  5GAH c;  3J7Y 1;  2C6B A;  2DSX A;  4TVM A;  3QQC E;  1SMU A;  2M6O A;  1H7V A;  2K2D A;  1CAD A;  1LKM A;  3RYG A;  1B71 A;  3KYU A;  1RWD A;  1S30 A;  5MF6 A;  1ODH A;  5MGN A;  2Z3Q B;  2XJP A;  2BE5 D;  3LNL A;  3PKJ A;  5GAD c;  1YV1 A;  4AHY A;  4GS7 D;  4AR3 A;  2C6A A;  4JAF A;  3PWF A;  1YK4 A;  1T9Q A;  2LCQ A;  2VL6 A;  4POF A;  4ZN1 B;  2PPT A;  2GMG A;  3KYW A;  1YUX A;  1VCX A;  1R0J A;  1IW7 D;  4AHX A;  2RDV A;  4RXN A;  2O5J D;  2KN9 A;  1BQ8 A;  5DM6 1;  2PVX A;  5JVG 1;  4V19 6;  3KYY A;  2JI2 A;  4POG A;  1RYQ A;  2H12 A;  4AR4 A;  2V3B B;  6RXN A;  5JVH 1;  2A69 D;  4AHZ A;  5DM7 1;  5IY0 A;  3RZT A;  3KYX A;  2PVE A;  2XJQ A;  3RZ6 A;  2XJT A;  2A68 D;  1RB9 A;  2NYD A;  5RXN A;  1B2J A;  3NFP I;  1FHM A;  3IU3 I;  4XGH A;  3PKI A;  2A6E D;  4YWL A;  1R0I A;  5EIN C;  5GAG c;  1OWB A;  4WFN 1;  1JYB A;  1DVB A;  3A44 A;  2L0Z A;  3VPB E;  1IU6 A;  4AR6 A;  1ZRP A;  2ZIX A;  3PZA A;  1VZH A;  2PSM C;  3WWN B;  2V0F A;  3J7Z 1;  1YUZ A;  1FHH A;  1S24 A;  1R0H A;  5H1S c;  1IRN A;  2ERS A;  1IRO A;  2M4V A;  2M6P A;  1WJV A;  3B08 B;  2Z3R B;  1SMW A;  4B8C D;  1R0F A;  3LPE B;  5EIO C;  4E6Y A;  5MFZ A;  5MLC 3;  4XXB B;  1R0G A;  1LTL A;  1LKO A;  5MFP A;  2A6H D;  3PIP 1;  2XJR A;  1SMM A;  1NNQ A;  4AI0 A;  4UY8 1;  4JAG A;  1CAA A;  3WWL A;  4JAE A;  1S2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...