1R0GA

Mercury-substituted rubredoxin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
b'MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Metal-substituted derivatives of the rubredoxin from Clostridium pasteurianum.
pubmed doi rcsb
source organism Clostridium pasteurianum
molecule tags Electron transport
total genus 8
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2003-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1r0gA00
3RZ6A 1BFYA 1YUXA 1SMWA 2GMGA 1SMMA 3A44A 1LKOA 1YV1A 1IU5A 1S30A 7RXNA 1T9OA 1RYTA 5AI3A 3SS2A 1B13A 1JYBA 4RXNA 1R0GA 1R0IA 3KYVA 3PZAA 2K2DA 2PVXA 3PWFA 2V3BB 3KYXA 2DSXA 4POGA 1BQ9A 1YUZA 3MPSA 1B2OA 1IROA 1LKPA 1B2JA 8RXNA 1QCVA 4YWMA 4YWLA 1S24A 3RZTA 1SMUA 1DVBA 2HR5A 1BE7A 1R0FA 2PVEA 1C09A 1DX8A 1QYBA 1IU6A 1CADA 1VCXA 1E8JA 2M4YA 3QVDA 6RXNA 1RDVA 4TPUA 2MS3A 1R0JA 1YK5A 1FHHA 3KYYA 2KN9A 4K9FA 4AR5A 2QL0A 1FHMA 1LKMA 3KYUA 1IRNA 1R0HA 4ME3A 1T9QA 1S2ZA 2KKDA 1BQ8A 2VL6A 1ZRPA 5IY0A 1B71A 1RB9A 2RDVA 1LTLA 1BRFA 4POFA 4AR6A 3KYWA 1YK4A 2LCQA 5AI2A 1H7VA 1CAAA 1T9PA 4AR3A 3RYGA 1RDGA 1RWDA 2PYAA 4AR4A 5RXNA 1NNQA
chains in the Genus database with same CATH superfamily
3RZ6A 2VUML 1SMWA 1YV1A 1PZXA 2M6OA 2JA5L 5IP9L 5EINC 5GAGc 3VPBE 7RXNA 5JVG1 1T9OA 2M6PA 1Z92B 2APOB 2XJQA 1B13A 2R93L 4RXNA 1R0GA 3PZAA 2K2DA 2XJPA 4WFN1 3S14L 2A6HD 3H9CA 3MPSA 1B2OA 3FKIL 3LWPB 5MF6A 1QCVA 4YWMA 1DVBA 2XJUA 3HOXL 5K2ME 4UY81 2JA7L 3S1ML 3PIO1 3GTPL 1Y1WL 4G6BA 3HAXC 6RXNA 4A3CL 4A93L 2NVQL 1IW7D 5H1Sc 5DM61 3MQKB 5DM71 3S15L 5IYBL 2KN9A 4AR5A 2R92L 3HOUL 4A3GL 2ERSA 3PIP1 1ZRPA 3I4ML 1B71A 3IU3I 4A3JL 1BRFA 3KYWA 3ZG6A 4A3ML 3PL5A 4AI1A 1Y1VL 2Z3RB 1RDGA 4E6YA 5RXNA 4V196 1WCML 2E2JL 3GTML 3K7AL 3GTJL 1SMMA 1PFWA 3H3VM 1LKOA 4JAGA 2WAQP 1IU5A 5IP7L 1S30A 1RYTA 3PO2L 1I6HL 3KYVA 5GAEc 2V3BB 2B63L 3I4NL 2DSXA 3M4OL 1PFVA 1BQ9A 1YUZA 3RZDL 4BXXL 2NVTL 2Z3QB 2H12A 1LKPA 4C3IL 8RXNA 3LWOB 3RZTA 2V0FA 2ERJA 4ZN3B 2PVEA 2NVXL 1SFOL 1QYBA 1IU6A 4BY1L 3S17L 4QIWP 1ODHA 2HVYC 5M5YL 2M4YA 4TPUA 2V0EA 3WWLA 1F4LA 2PPTA 1FHHA 4K9FA 1TWAL 1FHMA 1LKMA 4XXBB 2PMZP 3H9BA 3M3YL 4AI2A 5C4XL 1T9QA 1BQ8A 3S16L 2WB1P 5IY0A 2A6ED 1RB9A 2RDVA 3K35A 4BBSL 2RFKB 5M3ML 5FJ8L 1P7PA 3HJYB 4A3KL 1BFYA 5EIOC 1QQTA 1YUXA 2JI2A 5MFPA 2GMGA 2EY4E 3S1QL 4AHZA 1OWBA 2XJSA 2XJVA 5IYDL 4A3EL 1VZGA 3PO3L 4ZN1B 5M3FL 3MSUA 5AI3A 4U671 4AHWA 1PFYA 2JA8L 1JYBA 4A3LL 2PVXA 2XJTA 3LWQB 3H99A 5MLC3 3HOWL 3PKJA 1TWCL 3J7Y1 4XGHA 2CKCA 2E2HL 4YWLA 2A68D 1SMUA 2HR5A 1BE7A 1K83L 3P8BA 4Y7NL 5MGNA 1R0FA 1C09A 1DX8A 2C6BA 3B0AB 1TWFL 2AQCA 2BE5D 3LWRB 4BBRL 1VCXA 3HKZP 2NYDA 3HJWB 4AHYA 1E8JA 2PSMC 1RDVA 2AYJA 3WWNB 3S2DL 1R0JA 3B08B 2QL0A 4A3BL 1IRNA 3P2AA 3S1NL 1R0HA 5M5XL 1S2ZA 2R7ZL 5AN9H 5MFZA 4C2M1 3J7Z1 2YU9L 1LTLA 3HOVL 4AI0A 5C4JL 2Y0SP 4AR6A 3GTOL 5FLML 1NXGA 2CR8A 1T9PA 5M5WL 3HOYL 1RWDA 4C3JL 3HOZL 3CQZL 4AHXA 4LHLA 1TWHL 2AUSB 5IYCL 1NXEA 3A44A 4A3IL 2C6AA 1I3QL 1OWCA 1VZHA 2XJRA 1WJVA 2NVYL 4JAFA 3SS2A 3GTLL 1R0IA 2JA6L 3GTKL 3H0GL 3PWFA 3KYXA 1I50L 4AYBP 4POGA 2ZIXA 4A3FL 3S2HL 1IROA 2JI1A 4B8CD 2CKAA 1B2JA 1S24A 4BY7L 2A69D 3GTQL 3LWVB 1CADA 2L0ZA 2E2IL 1PFUA 5C44L 2O5JD 4JADA 3QVDA 4AI3A 1VZIA 4GS7D 1RYQA 2MS3A 4A3DL 1YK5A 3KYYA 3LNLA 3KYUA 3NFPI 4JAEA 4Y52L 4ME3A 5C3EL 2KKDA 5GAHc 1R9TL 3GTGL 2VL6A 3QQCE 5GADc 4X6AL 4POFA 2JI3A 1TWGL 2J9UB 3S1RL 3H97A 1YK4A 2LCQA 5AI2A 2B5ID 1H7VA 3PKIA 4C3HL 3FDJA 4TVMA 1CAAA 4AR3A 5JVH1 3LPEB 3RYGA 2PYAA 4AR4A 4LHNA 3JR7A 2M4VA 1NNQA 3RZOL
chains in the Genus database with same CATH topology
3RZ6A 1BFYA 5EIOC 1YUXA 2JI2A 5MFPA 1NXEA 1SMWA 2GMGA 1SMMA 3A44A 4AHZA 1LKOA 1YV1A 4JAGA 1OWBA 2XJSA 2M6OA 2XJVA 1IU5A 2C6AA 1S30A 1OWCA 1VZGA 5EINC 3VPBE 5GAGc 1VZHA 7RXNA 2XJRA 4ZN1B 5JVG1 1WJVA 1T9OA 1RYTA 3MSUA 5AI3A 4U671 2M6PA 1Z92B 4AHWA 4JAFA 3SS2A 2XJQA 1B13A 1JYBA 4RXNA 1R0GA 1R0IA 3KYVA 3PZAA 2K2DA 2PVXA 2XJPA 3PWFA 4WFN1 5GAEc 2V3BB 2A6HD 3KYXA 2XJTA 2DSXA 4POGA 1BQ9A 1YUZA 3MPSA 2ZIXA 5MLC3 2Z3QB 1B2OA 1IROA 3PKJA 2JI1A 4B8CD 3J7Y1 2H12A 1LKPA 2CKAA 4XGHA 2CKCA 1B2JA 8RXNA 5MF6A 1QCVA 4YWMA 4YWLA 1S24A 3RZTA 2A68D 1SMUA 1DVBA 2HR5A 1BE7A 2A69D 2XJUA 3P8BA 5K2ME 2V0FA 5MGNA 1R0FA 4UY81 2ERJA 4ZN3B 2PVEA 1C09A 1DX8A 1QYBA 1IU6A 2C6BA 3B0AB 1CADA 2L0ZA 3PIO1 2BE5D 1VCXA 4G6BA 2NYDA 1ODHA 2O5JD 4AHYA 4JADA 1E8JA 2PSMC 2M4YA 3QVDA 4AI3A 1VZIA 6RXNA 1RDVA 2AYJA 3WWNB 4TPUA 2V0EA 1IW7D 4GS7D 1RYQA 2MS3A 1R0JA 5H1Sc 3WWLA 5DM61 1YK5A 5DM71 2PPTA 1FHHA 3B08B 3KYYA 3LNLA 2KN9A 4K9FA 4AR5A 2QL0A 1FHMA 1LKMA 4XXBB 3KYUA 3NFPI 4JAEA 1IRNA 3P2AA 4AI2A 1R0HA 4ME3A 2ERSA 1T9QA 3PIP1 1S2ZA 2KKDA 1BQ8A 5AN9H 5GAHc 1ZRPA 2VL6A 5MFZA 5IY0A 3J7Z1 1B71A 3IU3I 2A6ED 1RB9A 3QQCE 5GADc 2RDVA 3K35A 1LTLA 4AI0A 1BRFA 4POFA 2JI3A 3KYWA 2J9UB 3ZG6A 4AR6A 4AI1A 1YK4A 2LCQA 5AI2A 2B5ID 1H7VA 3PKIA 1NXGA 2CR8A 2Z3RB 4TVMA 1CAAA 1T9PA 4AR3A 5JVH1 3LPEB 3RYGA 1RDGA 1RWDA 4E6YA 2PYAA 4AHXA 4LHLA 4AR4A 5RXNA 4LHNA 4V196 2M4VA 1NNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZ6 A;  1BFY A;  1YUX A;  1SMW A;  2GMG A;  1SMM A;  3A44 A;  1LKO A;  1YV1 A;  1IU5 A;  1S30 A;  7RXN A;  1T9O A;  1RYT A;  5AI3 A;  3SS2 A;  1B13 A;  1JYB A;  4RXN A;  1R0G A;  1R0I A;  3KYV A;  3PZA A;  2K2D A;  2PVX A;  3PWF A;  2V3B B;  3KYX A;  2DSX A;  4POG A;  1BQ9 A;  1YUZ A;  3MPS A;  1B2O A;  1IRO A;  1LKP A;  1B2J A;  8RXN A;  1QCV A;  4YWM A;  4YWL A;  1S24 A;  3RZT A;  1SMU A;  1DVB A;  2HR5 A;  1BE7 A;  1R0F A;  2PVE A;  1C09 A;  1DX8 A;  1QYB A;  1IU6 A;  1CAD A;  1VCX A;  1E8J A;  2M4Y A;  3QVD A;  6RXN A;  1RDV A;  4TPU A;  2MS3 A;  1R0J A;  1YK5 A;  1FHH A;  3KYY A;  2KN9 A;  4K9F A;  4AR5 A;  2QL0 A;  1FHM A;  1LKM A;  3KYU A;  1IRN A;  1R0H A;  4ME3 A;  1T9Q A;  1S2Z A;  2KKD A;  1BQ8 A;  2VL6 A;  1ZRP A;  5IY0 A;  1B71 A;  1RB9 A;  2RDV A;  1LTL A;  1BRF A;  4POF A;  4AR6 A;  3KYW A;  1YK4 A;  2LCQ A;  5AI2 A;  1H7V A;  1CAA A;  1T9P A;  4AR3 A;  3RYG A;  1RDG A;  1RWD A;  2PYA A;  4AR4 A;  5RXN A;  1NNQ A; 
#chains in the Genus database with same CATH topology
 3RZ6 A;  2VUM L;  1SMW A;  1YV1 A;  1PZX A;  2M6O A;  2JA5 L;  5IP9 L;  5EIN C;  5GAG c;  3VPB E;  7RXN A;  5JVG 1;  1T9O A;  2M6P A;  1Z92 B;  2APO B;  2XJQ A;  1B13 A;  2R93 L;  4RXN A;  1R0G A;  3PZA A;  2K2D A;  2XJP A;  4WFN 1;  3S14 L;  2A6H D;  3H9C A;  3MPS A;  1B2O A;  3FKI L;  3LWP B;  5MF6 A;  1QCV A;  4YWM A;  1DVB A;  2XJU A;  3HOX L;  5K2M E;  4UY8 1;  2JA7 L;  3S1M L;  3PIO 1;  3GTP L;  1Y1W L;  4G6B A;  3HAX C;  6RXN A;  4A3C L;  4A93 L;  2NVQ L;  1IW7 D;  5H1S c;  5DM6 1;  3MQK B;  5DM7 1;  3S15 L;  5IYB L;  2KN9 A;  4AR5 A;  2R92 L;  3HOU L;  4A3G L;  2ERS A;  3PIP 1;  1ZRP A;  3I4M L;  1B71 A;  3IU3 I;  4A3J L;  1BRF A;  3KYW A;  3ZG6 A;  4A3M L;  3PL5 A;  4AI1 A;  1Y1V L;  2Z3R B;  1RDG A;  4E6Y A;  5RXN A;  4V19 6;  1WCM L;  2E2J L;  3GTM L;  3K7A L;  3GTJ L;  1SMM A;  1PFW A;  3H3V M;  1LKO A;  4JAG A;  2WAQ P;  1IU5 A;  5IP7 L;  1S30 A;  1RYT A;  3PO2 L;  1I6H L;  3KYV A;  5GAE c;  2V3B B;  2B63 L;  3I4N L;  2DSX A;  3M4O L;  1PFV A;  1BQ9 A;  1YUZ A;  3RZD L;  4BXX L;  2NVT L;  2Z3Q B;  2H12 A;  1LKP A;  4C3I L;  8RXN A;  3LWO B;  3RZT A;  2V0F A;  2ERJ A;  4ZN3 B;  2PVE A;  2NVX L;  1SFO L;  1QYB A;  1IU6 A;  4BY1 L;  3S17 L;  4QIW P;  1ODH A;  2HVY C;  5M5Y L;  2M4Y A;  4TPU A;  2V0E A;  3WWL A;  1F4L A;  2PPT A;  1FHH A;  4K9F A;  1TWA L;  1FHM A;  1LKM A;  4XXB B;  2PMZ P;  3H9B A;  3M3Y L;  4AI2 A;  5C4X L;  1T9Q A;  1BQ8 A;  3S16 L;  2WB1 P;  5IY0 A;  2A6E D;  1RB9 A;  2RDV A;  3K35 A;  4BBS L;  2RFK B;  5M3M L;  5FJ8 L;  1P7P A;  3HJY B;  4A3K L;  1BFY A;  5EIO C;  1QQT A;  1YUX A;  2JI2 A;  5MFP A;  2GMG A;  2EY4 E;  3S1Q L;  4AHZ A;  1OWB A;  2XJS A;  2XJV A;  5IYD L;  4A3E L;  1VZG A;  3PO3 L;  4ZN1 B;  5M3F L;  3MSU A;  5AI3 A;  4U67 1;  4AHW A;  1PFY A;  2JA8 L;  1JYB A;  4A3L L;  2PVX A;  2XJT A;  3LWQ B;  3H99 A;  5MLC 3;  3HOW L;  3PKJ A;  1TWC L;  3J7Y 1;  4XGH A;  2CKC A;  2E2H L;  4YWL A;  2A68 D;  1SMU A;  2HR5 A;  1BE7 A;  1K83 L;  3P8B A;  4Y7N L;  5MGN A;  1R0F A;  1C09 A;  1DX8 A;  2C6B A;  3B0A B;  1TWF L;  2AQC A;  2BE5 D;  3LWR B;  4BBR L;  1VCX A;  3HKZ P;  2NYD A;  3HJW B;  4AHY A;  1E8J A;  2PSM C;  1RDV A;  2AYJ A;  3WWN B;  3S2D L;  1R0J A;  3B08 B;  2QL0 A;  4A3B L;  1IRN A;  3P2A A;  3S1N L;  1R0H A;  5M5X L;  1S2Z A;  2R7Z L;  5AN9 H;  5MFZ A;  4C2M 1;  3J7Z 1;  2YU9 L;  1LTL A;  3HOV L;  4AI0 A;  5C4J L;  2Y0S P;  4AR6 A;  3GTO L;  5FLM L;  1NXG A;  2CR8 A;  1T9P A;  5M5W L;  3HOY L;  1RWD A;  4C3J L;  3HOZ L;  3CQZ L;  4AHX A;  4LHL A;  1TWH L;  2AUS B;  5IYC L;  1NXE A;  3A44 A;  4A3I L;  2C6A A;  1I3Q L;  1OWC A;  1VZH A;  2XJR A;  1WJV A;  2NVY L;  4JAF A;  3SS2 A;  3GTL L;  1R0I A;  2JA6 L;  3GTK L;  3H0G L;  3PWF A;  3KYX A;  1I50 L;  4AYB P;  4POG A;  2ZIX A;  4A3F L;  3S2H L;  1IRO A;  2JI1 A;  4B8C D;  2CKA A;  1B2J A;  1S24 A;  4BY7 L;  2A69 D;  3GTQ L;  3LWV B;  1CAD A;  2L0Z A;  2E2I L;  1PFU A;  5C44 L;  2O5J D;  4JAD A;  3QVD A;  4AI3 A;  1VZI A;  4GS7 D;  1RYQ A;  2MS3 A;  4A3D L;  1YK5 A;  3KYY A;  3LNL A;  3KYU A;  3NFP I;  4JAE A;  4Y52 L;  4ME3 A;  5C3E L;  2KKD A;  5GAH c;  1R9T L;  3GTG L;  2VL6 A;  3QQC E;  5GAD c;  4X6A L;  4POF A;  2JI3 A;  1TWG L;  2J9U B;  3S1R L;  3H97 A;  1YK4 A;  2LCQ A;  5AI2 A;  2B5I D;  1H7V A;  3PKI A;  4C3H L;  3FDJ A;  4TVM A;  1CAA A;  4AR3 A;  5JVH 1;  3LPE B;  3RYG A;  2PYA A;  4AR4 A;  4LHN A;  3JR7 A;  2M4V A;  1NNQ A;  3RZO L; 
#chains in the Genus database with same CATH homology
 3RZ6 A;  1BFY A;  5EIO C;  1YUX A;  2JI2 A;  5MFP A;  1NXE A;  1SMW A;  2GMG A;  1SMM A;  3A44 A;  4AHZ A;  1LKO A;  1YV1 A;  4JAG A;  1OWB A;  2XJS A;  2M6O A;  2XJV A;  1IU5 A;  2C6A A;  1S30 A;  1OWC A;  1VZG A;  5EIN C;  3VPB E;  5GAG c;  1VZH A;  7RXN A;  2XJR A;  4ZN1 B;  5JVG 1;  1WJV A;  1T9O A;  1RYT A;  3MSU A;  5AI3 A;  4U67 1;  2M6P A;  1Z92 B;  4AHW A;  4JAF A;  3SS2 A;  2XJQ A;  1B13 A;  1JYB A;  4RXN A;  1R0G A;  1R0I A;  3KYV A;  3PZA A;  2K2D A;  2PVX A;  2XJP A;  3PWF A;  4WFN 1;  5GAE c;  2V3B B;  2A6H D;  3KYX A;  2XJT A;  2DSX A;  4POG A;  1BQ9 A;  1YUZ A;  3MPS A;  2ZIX A;  5MLC 3;  2Z3Q B;  1B2O A;  1IRO A;  3PKJ A;  2JI1 A;  4B8C D;  3J7Y 1;  2H12 A;  1LKP A;  2CKA A;  4XGH A;  2CKC A;  1B2J A;  8RXN A;  5MF6 A;  1QCV A;  4YWM A;  4YWL A;  1S24 A;  3RZT A;  2A68 D;  1SMU A;  1DVB A;  2HR5 A;  1BE7 A;  2A69 D;  2XJU A;  3P8B A;  5K2M E;  2V0F A;  5MGN A;  1R0F A;  4UY8 1;  2ERJ A;  4ZN3 B;  2PVE A;  1C09 A;  1DX8 A;  1QYB A;  1IU6 A;  2C6B A;  3B0A B;  1CAD A;  2L0Z A;  3PIO 1;  2BE5 D;  1VCX A;  4G6B A;  2NYD A;  1ODH A;  2O5J D;  4AHY A;  4JAD A;  1E8J A;  2PSM C;  2M4Y A;  3QVD A;  4AI3 A;  1VZI A;  6RXN A;  1RDV A;  2AYJ A;  3WWN B;  4TPU A;  2V0E A;  1IW7 D;  4GS7 D;  1RYQ A;  2MS3 A;  1R0J A;  5H1S c;  3WWL A;  5DM6 1;  1YK5 A;  5DM7 1;  2PPT A;  1FHH A;  3B08 B;  3KYY A;  3LNL A;  2KN9 A;  4K9F A;  4AR5 A;  2QL0 A;  1FHM A;  1LKM A;  4XXB B;  3KYU A;  3NFP I;  4JAE A;  1IRN A;  3P2A A;  4AI2 A;  1R0H A;  4ME3 A;  2ERS A;  1T9Q A;  3PIP 1;  1S2Z A;  2KKD A;  1BQ8 A;  5AN9 H;  5GAH c;  1ZRP A;  2VL6 A;  5MFZ A;  5IY0 A;  3J7Z 1;  1B71 A;  3IU3 I;  2A6E D;  1RB9 A;  3QQC E;  5GAD c;  2RDV A;  3K35 A;  1LTL A;  4AI0 A;  1BRF A;  4POF A;  2JI3 A;  3KYW A;  2J9U B;  3ZG6 A;  4AR6 A;  4AI1 A;  1YK4 A;  2LCQ A;  5AI2 A;  2B5I D;  1H7V A;  3PKI A;  1NXG A;  2CR8 A;  2Z3R B;  4TVM A;  1CAA A;  1T9P A;  4AR3 A;  5JVH 1;  3LPE B;  3RYG A;  1RDG A;  1RWD A;  4E6Y A;  2PYA A;  4AHX A;  4LHL A;  4AR4 A;  5RXN A;  4LHN A;  4V19 6;  2M4V A;  1NNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...