1R0HA

Cobalt-substituted rubredoxin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Metal-substituted derivatives of the rubredoxin from Clostridium pasteurianum.
pubmed doi rcsb
source organism Clostridium pasteurianum
molecule tags Electron transport
total genus 8
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2003-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1r0hA00
1IROA 4POFA 1BRFA 1E8JA 1B2JA 1ZRPA 1H7VA 3KYXA 1S30A 3MPSA 5AI2A 3RYGA 3A44A 2RDVA 1S24A 4POGA 1T9PA 5IY0A 3PZAA 2PYAA 1IRNA 2DSXA 1LKPA 2K2DA 1IU5A 4TPUA 3SS2A 3KYUA 3RZ6A 1JYBA 8RXNA 1NNQA 2PVXA 1R0GA 1LTLA 1RB9A 1BFYA 1B2OA 1T9OA 1S2ZA 1RDGA 1YK5A 1QCVA 1SMUA 1LKOA 1CAAA 4K9FA 1SMMA 2GMGA 2QL0A 2LCQA 4RXNA 1R0FA 3PWFA 5AI3A 1CADA 2KKDA 4ME3A 1VCXA 1YV1A 5RXNA 3KYWA 1FHMA 1QYBA 1LKMA 2VL6A 4AR5A 6RXNA 2MS3A 1B13A 2V3BB 1BQ8A 4YWMA 1FHHA 1BE7A 1DX8A 4AR6A 3RZTA 1SMWA 3KYYA 1RYTA 3QVDA 1T9QA 3KYVA 4YWLA 1R0JA 1DVBA 1YK4A 1RWDA 2M4YA 1B71A 2HR5A 1C09A 1YUXA 2PVEA 1IU6A 1RDVA 7RXNA 1BQ9A 4AR4A 1R0HA 4AR3A 1R0IA 2KN9A 1YUZA
chains in the Genus database with same CATH superfamily
3J7Y1 5FLML 4JAFA 4POGA 1T9PA 5IY0A 4C3HL 2DSXA 1LKPA 3JR7A 4ZN1B 1PFVA 4X6AL 5M5YL 4A3FL 2CKAA 1OWCA 2NVYL 3H9CA 4A3KL 3LPEB 1LTLA 3I4ML 4V196 1S2ZA 3P8BA 4GS7D 1I3QL 1YK5A 5EIOC 5MGNA 4Y52L 5C4JL 2QL0A 5DM71 3PWFA 3GTPL 2A69D 1TWAL 2KKDA 2V0FA 5M3FL 4TVMA 2XJQA 3S1QL 5RXNA 2B5ID 2ZIXA 4BXXL 3PL5A 3S14L 1VZGA 2M4VA 3VPBE 4BBRL 3RZTA 2A68D 4WFN1 3KYYA 1RYTA 1Y1VL 1T9QA 4YWLA 2R93L 1OWBA 2PSMC 3HKZP 3IU3I 3S17L 3RZOL 3HOWL 1B71A 2XJPA 2HR5A 1TWCL 2PVEA 2C6AA 2M6PA 4XGHA 2JI2A 1BQ9A 1PFUA 4AR3A 3PKJA 2M6OA 5IYDL 2KN9A 4A3ML 1Z92B 1IROA 4UY81 1B2JA 1H7VA 3KYXA 4A3EL 5AI2A 3PIP1 3M4OL 4BY7L 4A3LL 2O5JD 3SS2A 4JADA 1F4LA 4AHYA 3RZ6A 3H3VM 5K2ME 1WCML 1JYBA 3K7AL 1P7PA 4A93L 1NNQA 4JAEA 2EY4E 1R0GA 1RB9A 3H99A 3S15L 1B2OA 3M3YL 1RDGA 4AHWA 4Y7NL 2CR8A 2JI3A 1CAAA 2R7ZL 4K9FA 1SMMA 2ERJA 2NVTL 4A3JL 5AI3A 2AQCA 3CQZL 4AHXA 4AYBP 4B8CD 3HOVL 1VCXA 1PFWA 1VZIA 6RXNA 2MS3A 4G6BA 3WWNB 2NVQL 1FHHA 3H97A 2AUSB 4AI1A 2JA7L 3S2DL 1ODHA 2Z3RB 2NYDA 5MFZA 4BY1L 2PMZP 3WWLA 3LWPB 1YK4A 1RWDA 3HOYL 2AYJA 2JI1A 5MLC3 4C2M1 1WJVA 4JAGA 1R0HA 1R9TL 5M5WL 4AI0A 2XJTA 4LHLA 2XJVA 2ERSA 8RXNA 3HOUL 4POFA 2H12A 1E8JA 1ZRPA 5GAEc 1QQTA 3HJWB 3A44A 2RDVA 3S2HL 5M5XL 2JA8L 2PYAA 5C4XL 3PO2L 2K2DA 1IU5A 3PIO1 3KYUA 5C3EL 3S1NL 5GAHc 5GADc 3GTLL 5IYBL 2A6ED 2NVXL 4A3CL 5DM61 4A3IL 2XJSA 1T9OA 3HJYB 1QCVA 2YU9L 2LCQA 4RXNA 2JA6L 2XJRA 3LWRB 1CADA 1RYQA 4ME3A 1NXGA 4AI2A 2A6HD 1QYBA 4BBSL 1LKMA 2VL6A 1B13A 2V3BB 1BQ8A 1BE7A 2E2HL 4AR6A 3ZG6A 2L0ZA 1SFOL 3LWVB 3QVDA 5IP9L 2VUML 1R0JA 3H9BA 3I4NL 2HVYC 5M3ML 4A3GL 1IW7D 3GTKL 3J7Z1 3RZDL 3B08B 1Y1WL 1TWGL 2WAQP 5JVG1 4E6YA 3HAXC 1R0IA 2B63L 3B0AB 1K83L 1BRFA 3S1ML 4C3IL 3GTGL 3LNLA 1S30A 3MPSA 3RYGA 5H1Sc 1NXEA 1S24A 2JA5L 2WB1P 3PZAA 1VZHA 1IRNA 2Z3QB 3GTOL 2J9UB 4TPUA 5FJ8L 1PFYA 4AI3A 2Y0SP 1TWFL 1PZXA 1I6HL 4C3JL 4AHZA 5IP7L 2PVXA 1BFYA 3S1RL 2BE5D 3HOXL 3NFPI 1I50L 3GTML 3GTJL 3K35A 3QQCE 1SMUA 1LKOA 2GMGA 3LWQB 1R0FA 3PKIA 5MF6A 3PO3L 4XXBB 1YV1A 5IYCL 3KYWA 1FHMA 5C44L 4AR5A 4YWMA 3FDJA 1DX8A 4LHNA 5JVH1 3MSUA 3S16L 2APOB 2E2IL 2E2JL 1SMWA 5EINC 4A3DL 3H0GL 4QIWP 3KYVA 2C6BA 5GAGc 4A3BL 1DVBA 2M4YA 5MFPA 5AN9H 3GTQL 2PPTA 2R92L 3HOZL 3FKIL 1C09A 1YUXA 2CKCA 1IU6A 1RDVA 3MQKB 7RXNA 4ZN3B 3P2AA 4AR4A 4U671 2V0EA 3LWOB 1TWHL 2RFKB 2XJUA 1YUZA
chains in the Genus database with same CATH topology
1IROA 4POFA 3J7Y1 4UY81 1BRFA 2H12A 1B2JA 1E8JA 1ZRPA 5GAEc 1H7VA 3KYXA 1S30A 3LNLA 4JAFA 3MPSA 5AI2A 3RYGA 3A44A 2RDVA 5H1Sc 3PIP1 1NXEA 1S24A 4POGA 1T9PA 5IY0A 3PZAA 1VZHA 2PYAA 1IRNA 2DSXA 2Z3QB 2O5JD 1LKPA 2J9UB 4ZN1B 2K2DA 1IU5A 4TPUA 3SS2A 3PIO1 3KYUA 4JADA 4AHYA 3RZ6A 4AI3A 5K2ME 5GAHc 5GADc 2CKAA 1JYBA 1OWCA 8RXNA 2A6ED 1NNQA 4AHZA 4JAEA 2PVXA 1R0GA 3LPEB 1LTLA 1RB9A 5DM61 1BFYA 2XJSA 1B2OA 2BE5D 1T9OA 4V196 1S2ZA 3P8BA 3NFPI 1RDGA 4GS7D 1YK5A 1QCVA 4AHWA 5EIOC 3K35A 3QQCE 5MGNA 2CR8A 1SMUA 1LKOA 1CAAA 2JI3A 4K9FA 1SMMA 2GMGA 2QL0A 5DM71 2LCQA 4RXNA 2ERJA 1R0FA 3PKIA 2XJRA 3PWFA 5AI3A 5MF6A 1CADA 2A69D 4AHXA 4B8CD 1RYQA 2KKDA 4ME3A 2V0FA 1VCXA 4XXBB 4TVMA 1NXGA 2XJQA 1YV1A 5RXNA 2B5ID 4AI2A 2ZIXA 2A6HD 3KYWA 1FHMA 1QYBA 1VZIA 1LKMA 2VL6A 4AR5A 6RXNA 1VZGA 2MS3A 4G6BA 1B13A 2V3BB 1BQ8A 2M4VA 3WWNB 4YWMA 1FHHA 1BE7A 3VPBE 1DX8A 4AR6A 3ZG6A 4LHNA 5JVH1 3MSUA 2L0ZA 2A68D 1SMWA 4AI1A 3KYYA 1RYTA 3RZTA 4WFN1 5EINC 3QVDA 1ODHA 1T9QA 2Z3RB 2NYDA 3KYVA 5MFZA 4YWLA 1OWBA 2PSMC 2C6BA 1R0JA 3IU3I 5GAGc 1DVBA 3WWLA 1YK4A 1RWDA 2M4YA 5MFPA 5AN9H 2AYJA 2PPTA 2JI1A 5MLC3 1B71A 1IW7D 2XJPA 2HR5A 1C09A 1YUXA 2CKCA 2PVEA 2C6AA 1IU6A 2M6PA 3J7Z1 1WJVA 1RDVA 3B08B 4XGHA 7RXNA 2JI2A 4ZN3B 3P2AA 1BQ9A 4JAGA 4AR4A 1R0HA 4AR3A 4U671 5JVG1 2V0EA 4E6YA 3PKJA 1R0IA 4AI0A 2M6OA 2XJTA 3B0AB 4LHLA 2KN9A 2XJVA 2XJUA 2ERSA 1Z92B 1YUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRO A;  4POF A;  1BRF A;  1E8J A;  1B2J A;  1ZRP A;  1H7V A;  3KYX A;  1S30 A;  3MPS A;  5AI2 A;  3RYG A;  3A44 A;  2RDV A;  1S24 A;  4POG A;  1T9P A;  5IY0 A;  3PZA A;  2PYA A;  1IRN A;  2DSX A;  1LKP A;  2K2D A;  1IU5 A;  4TPU A;  3SS2 A;  3KYU A;  3RZ6 A;  1JYB A;  8RXN A;  1NNQ A;  2PVX A;  1R0G A;  1LTL A;  1RB9 A;  1BFY A;  1B2O A;  1T9O A;  1S2Z A;  1RDG A;  1YK5 A;  1QCV A;  1SMU A;  1LKO A;  1CAA A;  4K9F A;  1SMM A;  2GMG A;  2QL0 A;  2LCQ A;  4RXN A;  1R0F A;  3PWF A;  5AI3 A;  1CAD A;  2KKD A;  4ME3 A;  1VCX A;  1YV1 A;  5RXN A;  3KYW A;  1FHM A;  1QYB A;  1LKM A;  2VL6 A;  4AR5 A;  6RXN A;  2MS3 A;  1B13 A;  2V3B B;  1BQ8 A;  4YWM A;  1FHH A;  1BE7 A;  1DX8 A;  4AR6 A;  3RZT A;  1SMW A;  3KYY A;  1RYT A;  3QVD A;  1T9Q A;  3KYV A;  4YWL A;  1R0J A;  1DVB A;  1YK4 A;  1RWD A;  2M4Y A;  1B71 A;  2HR5 A;  1C09 A;  1YUX A;  2PVE A;  1IU6 A;  1RDV A;  7RXN A;  1BQ9 A;  4AR4 A;  1R0H A;  4AR3 A;  1R0I A;  2KN9 A;  1YUZ A; 
#chains in the Genus database with same CATH topology
 3J7Y 1;  5FLM L;  4JAF A;  4POG A;  1T9P A;  5IY0 A;  4C3H L;  2DSX A;  1LKP A;  3JR7 A;  4ZN1 B;  1PFV A;  4X6A L;  5M5Y L;  4A3F L;  2CKA A;  1OWC A;  2NVY L;  3H9C A;  4A3K L;  3LPE B;  1LTL A;  3I4M L;  4V19 6;  1S2Z A;  3P8B A;  4GS7 D;  1I3Q L;  1YK5 A;  5EIO C;  5MGN A;  4Y52 L;  5C4J L;  2QL0 A;  5DM7 1;  3PWF A;  3GTP L;  2A69 D;  1TWA L;  2KKD A;  2V0F A;  5M3F L;  4TVM A;  2XJQ A;  3S1Q L;  5RXN A;  2B5I D;  2ZIX A;  4BXX L;  3PL5 A;  3S14 L;  1VZG A;  2M4V A;  3VPB E;  4BBR L;  3RZT A;  2A68 D;  4WFN 1;  3KYY A;  1RYT A;  1Y1V L;  1T9Q A;  4YWL A;  2R93 L;  1OWB A;  2PSM C;  3HKZ P;  3IU3 I;  3S17 L;  3RZO L;  3HOW L;  1B71 A;  2XJP A;  2HR5 A;  1TWC L;  2PVE A;  2C6A A;  2M6P A;  4XGH A;  2JI2 A;  1BQ9 A;  1PFU A;  4AR3 A;  3PKJ A;  2M6O A;  5IYD L;  2KN9 A;  4A3M L;  1Z92 B;  1IRO A;  4UY8 1;  1B2J A;  1H7V A;  3KYX A;  4A3E L;  5AI2 A;  3PIP 1;  3M4O L;  4BY7 L;  4A3L L;  2O5J D;  3SS2 A;  4JAD A;  1F4L A;  4AHY A;  3RZ6 A;  3H3V M;  5K2M E;  1WCM L;  1JYB A;  3K7A L;  1P7P A;  4A93 L;  1NNQ A;  4JAE A;  2EY4 E;  1R0G A;  1RB9 A;  3H99 A;  3S15 L;  1B2O A;  3M3Y L;  1RDG A;  4AHW A;  4Y7N L;  2CR8 A;  2JI3 A;  1CAA A;  2R7Z L;  4K9F A;  1SMM A;  2ERJ A;  2NVT L;  4A3J L;  5AI3 A;  2AQC A;  3CQZ L;  4AHX A;  4AYB P;  4B8C D;  3HOV L;  1VCX A;  1PFW A;  1VZI A;  6RXN A;  2MS3 A;  4G6B A;  3WWN B;  2NVQ L;  1FHH A;  3H97 A;  2AUS B;  4AI1 A;  2JA7 L;  3S2D L;  1ODH A;  2Z3R B;  2NYD A;  5MFZ A;  4BY1 L;  2PMZ P;  3WWL A;  3LWP B;  1YK4 A;  1RWD A;  3HOY L;  2AYJ A;  2JI1 A;  5MLC 3;  4C2M 1;  1WJV A;  4JAG A;  1R0H A;  1R9T L;  5M5W L;  4AI0 A;  2XJT A;  4LHL A;  2XJV A;  2ERS A;  8RXN A;  3HOU L;  4POF A;  2H12 A;  1E8J A;  1ZRP A;  5GAE c;  1QQT A;  3HJW B;  3A44 A;  2RDV A;  3S2H L;  5M5X L;  2JA8 L;  2PYA A;  5C4X L;  3PO2 L;  2K2D A;  1IU5 A;  3PIO 1;  3KYU A;  5C3E L;  3S1N L;  5GAH c;  5GAD c;  3GTL L;  5IYB L;  2A6E D;  2NVX L;  4A3C L;  5DM6 1;  4A3I L;  2XJS A;  1T9O A;  3HJY B;  1QCV A;  2YU9 L;  2LCQ A;  4RXN A;  2JA6 L;  2XJR A;  3LWR B;  1CAD A;  1RYQ A;  4ME3 A;  1NXG A;  4AI2 A;  2A6H D;  1QYB A;  4BBS L;  1LKM A;  2VL6 A;  1B13 A;  2V3B B;  1BQ8 A;  1BE7 A;  2E2H L;  4AR6 A;  3ZG6 A;  2L0Z A;  1SFO L;  3LWV B;  3QVD A;  5IP9 L;  2VUM L;  1R0J A;  3H9B A;  3I4N L;  2HVY C;  5M3M L;  4A3G L;  1IW7 D;  3GTK L;  3J7Z 1;  3RZD L;  3B08 B;  1Y1W L;  1TWG L;  2WAQ P;  5JVG 1;  4E6Y A;  3HAX C;  1R0I A;  2B63 L;  3B0A B;  1K83 L;  1BRF A;  3S1M L;  4C3I L;  3GTG L;  3LNL A;  1S30 A;  3MPS A;  3RYG A;  5H1S c;  1NXE A;  1S24 A;  2JA5 L;  2WB1 P;  3PZA A;  1VZH A;  1IRN A;  2Z3Q B;  3GTO L;  2J9U B;  4TPU A;  5FJ8 L;  1PFY A;  4AI3 A;  2Y0S P;  1TWF L;  1PZX A;  1I6H L;  4C3J L;  4AHZ A;  5IP7 L;  2PVX A;  1BFY A;  3S1R L;  2BE5 D;  3HOX L;  3NFP I;  1I50 L;  3GTM L;  3GTJ L;  3K35 A;  3QQC E;  1SMU A;  1LKO A;  2GMG A;  3LWQ B;  1R0F A;  3PKI A;  5MF6 A;  3PO3 L;  4XXB B;  1YV1 A;  5IYC L;  3KYW A;  1FHM A;  5C44 L;  4AR5 A;  4YWM A;  3FDJ A;  1DX8 A;  4LHN A;  5JVH 1;  3MSU A;  3S16 L;  2APO B;  2E2I L;  2E2J L;  1SMW A;  5EIN C;  4A3D L;  3H0G L;  4QIW P;  3KYV A;  2C6B A;  5GAG c;  4A3B L;  1DVB A;  2M4Y A;  5MFP A;  5AN9 H;  3GTQ L;  2PPT A;  2R92 L;  3HOZ L;  3FKI L;  1C09 A;  1YUX A;  2CKC A;  1IU6 A;  1RDV A;  3MQK B;  7RXN A;  4ZN3 B;  3P2A A;  4AR4 A;  4U67 1;  2V0E A;  3LWO B;  1TWH L;  2RFK B;  2XJU A;  1YUZ A; 
#chains in the Genus database with same CATH homology
 1IRO A;  4POF A;  3J7Y 1;  4UY8 1;  1BRF A;  2H12 A;  1B2J A;  1E8J A;  1ZRP A;  5GAE c;  1H7V A;  3KYX A;  1S30 A;  3LNL A;  4JAF A;  3MPS A;  5AI2 A;  3RYG A;  3A44 A;  2RDV A;  5H1S c;  3PIP 1;  1NXE A;  1S24 A;  4POG A;  1T9P A;  5IY0 A;  3PZA A;  1VZH A;  2PYA A;  1IRN A;  2DSX A;  2Z3Q B;  2O5J D;  1LKP A;  2J9U B;  4ZN1 B;  2K2D A;  1IU5 A;  4TPU A;  3SS2 A;  3PIO 1;  3KYU A;  4JAD A;  4AHY A;  3RZ6 A;  4AI3 A;  5K2M E;  5GAH c;  5GAD c;  2CKA A;  1JYB A;  1OWC A;  8RXN A;  2A6E D;  1NNQ A;  4AHZ A;  4JAE A;  2PVX A;  1R0G A;  3LPE B;  1LTL A;  1RB9 A;  5DM6 1;  1BFY A;  2XJS A;  1B2O A;  2BE5 D;  1T9O A;  4V19 6;  1S2Z A;  3P8B A;  3NFP I;  1RDG A;  4GS7 D;  1YK5 A;  1QCV A;  4AHW A;  5EIO C;  3K35 A;  3QQC E;  5MGN A;  2CR8 A;  1SMU A;  1LKO A;  1CAA A;  2JI3 A;  4K9F A;  1SMM A;  2GMG A;  2QL0 A;  5DM7 1;  2LCQ A;  4RXN A;  2ERJ A;  1R0F A;  3PKI A;  2XJR A;  3PWF A;  5AI3 A;  5MF6 A;  1CAD A;  2A69 D;  4AHX A;  4B8C D;  1RYQ A;  2KKD A;  4ME3 A;  2V0F A;  1VCX A;  4XXB B;  4TVM A;  1NXG A;  2XJQ A;  1YV1 A;  5RXN A;  2B5I D;  4AI2 A;  2ZIX A;  2A6H D;  3KYW A;  1FHM A;  1QYB A;  1VZI A;  1LKM A;  2VL6 A;  4AR5 A;  6RXN A;  1VZG A;  2MS3 A;  4G6B A;  1B13 A;  2V3B B;  1BQ8 A;  2M4V A;  3WWN B;  4YWM A;  1FHH A;  1BE7 A;  3VPB E;  1DX8 A;  4AR6 A;  3ZG6 A;  4LHN A;  5JVH 1;  3MSU A;  2L0Z A;  2A68 D;  1SMW A;  4AI1 A;  3KYY A;  1RYT A;  3RZT A;  4WFN 1;  5EIN C;  3QVD A;  1ODH A;  1T9Q A;  2Z3R B;  2NYD A;  3KYV A;  5MFZ A;  4YWL A;  1OWB A;  2PSM C;  2C6B A;  1R0J A;  3IU3 I;  5GAG c;  1DVB A;  3WWL A;  1YK4 A;  1RWD A;  2M4Y A;  5MFP A;  5AN9 H;  2AYJ A;  2PPT A;  2JI1 A;  5MLC 3;  1B71 A;  1IW7 D;  2XJP A;  2HR5 A;  1C09 A;  1YUX A;  2CKC A;  2PVE A;  2C6A A;  1IU6 A;  2M6P A;  3J7Z 1;  1WJV A;  1RDV A;  3B08 B;  4XGH A;  7RXN A;  2JI2 A;  4ZN3 B;  3P2A A;  1BQ9 A;  4JAG A;  4AR4 A;  1R0H A;  4AR3 A;  4U67 1;  5JVG 1;  2V0E A;  4E6Y A;  3PKJ A;  1R0I A;  4AI0 A;  2M6O A;  2XJT A;  3B0A B;  4LHL A;  2KN9 A;  2XJV A;  2XJU A;  2ERS A;  1Z92 B;  1YUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...