1R0KA

Crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
386
structure length
380
Chain Sequence
b'SQPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIADPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTVALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPFRTTSLAEMATVTPERAVQGAKISIDSATMMNKGLELIEAFHLFQIPLEKFEILVHPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAPDYERFPALTLAMESIKSGGARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPATPSSLEDVFAIDNEARIQAAALMESLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from Zymomonas mobilis at 1.9-A resolution.
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Oxidoreductase
total genus 126
structure length 380
sequence length 386
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2003-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1r0kA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1r0kA01
3B70A 3ZNPA 3BIOA 3UXYA 3IDSA 3W4KA 1N1GA 3BMOB 1MG0A 4NFHA 3JD2A 1GUZA 4R69A 1DLJA 2YFQA 4JJFA 4LK3A 4XYMA 4UUPA 4CQMA 5L40A 1YDEA 4ZVVA 4CMIB 3I9JA 5JCJA 4BNKA 1G0OA 3L9XA 4FGWA 3I83A 4TRNA 1ISIA 4RDHA 1E3WA 3G1TA 5IXSA 3RUIA 1R4MB 1NPTO 1PIWA 3P5SA 5LCXA 5DT9A 4J7CA 3U5TA 1JKIA 1GZ3A 4DWVA 1GV1A 1NAIA 1A27A 2A4KA 1EK6A 2EKLA 3GMSA 5A3VA 4ZQBA 2HSDA 2C7VA 2J5KA 3WBFA 3ZNQA 3O8QB 1GUYA 5AXCA 2GN9A 2HU2A 5DCWA 1JKJA 1V6AA 4GX2A 1P1FA 4LVUA 5EESA 2FR0A 2DT5A 2NQTA 2VWHA 1PWZA 3PJEA 1C0LA 2P5UA 5EPOA 3G1UA 3VVCA 2NVUA 3VZPA 4J6FA 5TGDA 4DA9A 5I7FA 2UAGA 5BNFA 2VWPA 4OKIA 2NWQA 1C0IA 4DRYA 1NAHA 1ENPA 2R2GA 3ZU3A 2DPHA 2P4HX 3RUCA 1E3JA 2HJRA 1YOVB 3ZWXA 3OJ0A 3UERA 5JYEA 3PHHA 5AOVA 2FZEA 3K2BA 4CM4B 3GHHA 1QORA 5A4DA 3FWNA 5DN9A 3NRCA 3WGQA 1MW1A 4OM8A 1L1FA 2OHXA 4RGBA 2Q46A 3PZBA 4PRKA 3UHAA 1PSDA 1I36A 4RJTA 4R01A 4OOEA 4NK4A 1TI7A 3DTTA 3EAGA 3PYLA 4B8WA 4XR9A 3K73O 4RPJA 2NVBA 1EUDA 3GAZA 5U4QA 3BYZA 1ZZEA 4CM9D 4PG5A 4J1SA 4BGEA 1X14A 4O0LA 5FF9A 3ROPA 1VJ0A 3QVTA 3WX0A 4DC1A 1JW9B 4B4WA 5JAMA 2BGLA 1XA0A 4BUCA 4BOYA 1O8CA 4WCFA 4XYEA 2NM0A 1HZZA 5C37A 2J3HA 1NR1A 3SC4A 5K6AA 3QWIA 2D4AA 1QYWA 3TFQA 1RM0A 3AM5A 3JQ8B 3HNPA 3RUEA 2O2YA 5CFZA 3B1FA 3N74A 3FF4A 3AY6A 4W9NA 4UULA 3TOZA 4L74A 3B1KA 1NPYA 1X1EA 3AU9A 4QTZA 4GSKA 1PR3A 3W4JA 3K92A 2DBZA 3AOEA 1OOEA 1S6YA 4KWIA 1LLCA 1LTHR 1OMOA 1Z73A 1VC2A 2DC1A 2ZJ1A 4UAGA 1KVRA 2JCVA 5JAQA 3ZWBA 1R12A 4JROA 4DYDA 5TQVA 4BO9A 4BQPA 3ZW9A 2ZKLA 2RCYA 2J5QA 4YYZA 1EFLA 2EV9A 4IDFA 3WGYA 4DUPA 1W8DA 2GN6A 1KEVA 3JV7A 1NHGA 3VOSA 5EMHA 3RIHA 3F1KA 1SPXA 4CM8B 5CEEA 5A03A 4RVHA 5F1PA 4XGIA 1A4IA 1LQTA 1SCUA 2NV6A 5IZ4A 2C2YA 2BI8A 3H9EO 4NU5A 3AFNA 4GMGA 5DBGA 4IJKA 5ILGA 1I3LA 1A72A 4JBHA 5HM8A 3OF2A 4NMHA 3WFIA 2BELA 3TZ6A 1ZEJA 4D46A 1P33A 2JJYA 5HS6A 1FDUA 1Q0HA 1HDRA 1Z75A 2VTEA 2EP5A 2QQ5A 4UVIA 4B3JA 1T25A 2RH4A 5KNLA 2BLLA 2JAPA 3GG9A 3OA0A 4DBZA 5KCZA 4BNMA 1HLDA 2YJZA 3DHYA 1R0LA 1RM5A 3Q3CA 4Y8VA 4QFCA 5I9NA 1J5PA 2NQ8A 1GY8A 1U5CA 2TMDA 3BMCB 3QVXA 1ZEMA 5G4KB 5IZCC 3GA0A 4Y67A 1X7DA 2AG8A 5IN5A 4MKXA 3GC6A 3ENKA 4NG5A 1R6DA 2YQ4A 3GDGA 3BMOA 4HV4A 5FI3A 4N7RA 3JQGB 4XRGA 5L9AA 5F1OA 3ZV4A 4ND1A 4E30A 1T24A 1PQUA 4XB1A 1QV6A 2C59A 4EBFA 3JYLA 5HS4A 4FW8A 3VZQA 4J4BA 5MGBA 2W98A 4KTVE 4MJLA 3C8MA 4KOAA 5TS3A 3QWAA 4Z9FA 3NGLA 4U7WA 4Z9YA 5JDCA 5DNAA 4DMMA 7MDHA 5AQ1A 2Y1DA 1HYGA 3DO5A 1B2LA 2E6UX 4F6CA 1Y8QB 1SC6A 1YBAA 2FPIA 2C5AA 5JLAA 1SMKA 1LU9A 1YVEI 1LDNA 4J2OA 1ML3A 1ADGA 1ONNA 4TRJA 4RO0A 3WB9A 1HEUA 5G0SA 4H7PA 2C2XA 3OMLA 2HRZA 3ST7A 1Z7BA 2Z5LA 5L4LA 2OZPA 1PJBA 2V7PA 3KEOA 2I5PO 2WEKA 3PJFA 2VUUA 4JBGA 4MVJP 1JKFA 4WJZA 3U62A 1SAYA 1NP3A 1O0SA 4LGVA 5T67A 1I33A 2P68A 5FI5A 1GAEO 3PIIA 4MPDA 1DJNA 3H3JA 2PTGA 4QFDA 4XDYA 2GASA 3AI3A 1T26A 1ZH8A 2EGHA 2PFGA 2VN8A 2G76A 3VVBA 4F45A 3TFOA 2Q99A 3E9MA 1ZNQO 4E5PA 1C14A 3M1AA 2E4AA 5KVVA 4KUHA 2EKQA 2VUSA 1X7HA 1H0KA 4GAEA 2NVWA 1VSVA 2WYUA 2CUKA 5TC4A 1MA0A 1UAYA 1VJTA 5DP2A 4YT5A 5T64A 4BNWA 4CV1A 5CAEA 2DBRA 1Z45A 1OC2A 2GF2A 3GZ4A 1KVTA 3LLSA 3MJEA 4NU6A 4HWKA 3PJDA 2ZTMA 4YJFA 4E5NA 2X22A 2ZQYA 3ZHBA 4FPXA 2XF8A 1HSZA 3G0OA 4XQEA 1EQUA 4XKJA 4YXFA 1PL6A 4J0FA 3L9WA 1CF2O 1SNYA 2AA3A 4UVDA 2MAOA 2ET6A 4B4VA 1K6IA 2OORA 3WIEA 3KBOA 4DC0A 4CR8A 4BNFA 4BKQA 3VKUA 3MOGA 3DZBA 1WZIA 1SC5A 1YQDA 3BZUA 1M76A 1I32A 3EY4A 4FOSA 3RROA 1R66A 2WSBA 3OQ6A 1B16A 3UUWA 4CR7A 1U28A 3JQAA 4PVCA 4E3ZA 1Q2XA 3GEGA 5JMPA 3F47A 3UW3A 1E3IA 2GRAA 3FSRA 1EDOA 3FNFA 3JYQA 4CMBA 4PVDA 2RH8A 5FYDA 1X7GA 3AY3A 3WJ7A 4LUPA 1KETA 4BNJA 1U8XX 3V5NA 3F6YA 1EUCA 2DTEA 3LVFO 3PHJA 1HZJA 1U7TA 1MC5A 1G0NA 2DUWA 4I8XA 1C1DB 4GGPA 3Q11A 1ZS2A 1FDVA 4ND4A 3G17A 5C7OO 3JQCA 1MW0A 4MVJF 4WASA 2DQ4A 4XYGA 2EG9A 1GCOA 2AW5A 1HTBA 3E9QA 1HDXA 2YW9A 3LC1O 4R1NA 5L7YA 4L73A 1MLDA 1P1JA 4TZTA 3WG9A 4R3WA 4RPKA 1E6UA 4QECA 3S8MA 1NR7A 2PGLA 4R9RA 1UXIA 1E5QA 3UH1A 4E2WA 4GGOA 1O9BA 4Q3NA 3RVDA 1OFGA 4MVJE 3RCBA 1IY8A 1DO8A 9LDTA 2NLOA 4BO2A 4R1TA 3R0IA 4WLOA 3DMTA 1RM4A 2GGSA 2VTDA 4NBTA 1DB3A 2I67A 2B4RO 1HDZA 3DMYA 3ONDA 3RFTA 1PQPA 5CPBA 4AVYA 3DAGA 4E6PA 3H2ZA 5CDYA 1KC1A 4IZIA 2OMEA 1P44A 4NDNE 2DTXA 3WS7A 4NJOA 3WNQA 1PZGA 3H5RA 5I7SA 2QYTA 1SB8A 4NQZA 1QYCA 3QVOA 3HJAA 3PGXA 2VHWA 2E37A 2WJPA 4KZPA 5ENDA 1AGNA 4EGFA 3FPCA 4H16A 2BGMA 3X2FA 3ZCXA 1RYDA 4DL9A 1A9ZA 1PZFA 3B1JA 3PHLA 1PX0A 1HKUA 2JFHA 1BVUA 3BMNA 3RQSA 3D7LA 4BO3A 4ZICA 3DZHA 4DGSA 1VL0A 4FJ2A 4E5YA 1Z82A 3NTQA 1X1TA 5TX7A 2I66A 4GI2A 4WLFA 4D0RA 2C82A 4CM7A 5IAAA 4NIMA 2VHXA 3E18A 3M1LA 4CV0A 3ICPA 2GN8A 1TT5B 2YQ5A 4U8GA 3LU1A 3QSGA 3TOXA 1W73A 1QMGA 3F3SA 3DAFA 2C20A 1UXJA 1PJCA 4PGFA 2XPCA 5CDSA 3BTVA 1E7QA 4H3VA 4YJGB 3EVNA 4IS3A 3ABIA 2DVMA 3VC7A 1UP7A 3H8VA 1MX3A 1EFKA 1J0XO 3LF1A 4FN4A 4HFNA 2P5YA 1ZSYA 4P4NA 2E48A 4M86A 4W6ZA 2NTVA 1XCBA 1PGPA 4E0BA 5L4SA 1ENZA 5JFOA 3PTZA 3M2TA 1UXGA 1DIBA 2Q2VA 1B7GO 3WIDA 1Y1PA 2Y1EA 3LT1A 3BMQA 3DBLB 2HK8A 3NTOA 2BMAA 4E31A 5COAA 2FPGA 3I6IA 1ENOA 3G49A 5CG1A 2X8LA 4HXYA 1AN9A 3IMFA 3WYEA 4YDRA 3SBOA 1UUFA 3CUKA 4EEXA 1F0YA 1PEDA 4BMSA 4AJNA 3DR3A 3AWDA 3WICA 3HZZA 3C24A 1T2CA 4AJ4A 1ZW1A 3L4BA 5IDWA 4EUEA 4W9NC 5BT9A 1A7AA 2ZTVA 4FFNA 2Y1GA 3O26A 4D7AA 3RC9A 1MW2A 1LQUA 4J1TA 2X7HA 4UEOA 3AOEC 3WYBA 2EP7A 3DL2A 4I9UA 4EZBA 2I3GA 3I9KA 4IY1A 1GV0A 3PI7A 2D59A 3EDMA 1IPFA 1XU9A 4MVJG 4AL4A 4XEHA 5AXBA 1K6JA 1W6UA 3DBHB 4UUOA 5HA5A 2EEZA 4BO5A 3UCFA 3RASA 4IBOA 4XQ9A 4IUYA 3NT5A 1EVYA 3W6ZA 1YJQA 4AJPA 2VZ9A 2VT2A 3DFZA 3GN2A 4RPHA 1FDTA 3GEDA 2Y67A 1KY4A 2HK9A 3E6AA 5F3RA 1YRLA 2HMWA 3TSCA 2Q1SA 3GUCA 3TZCA 3GDOA 4J4HA 1P1IA 3K8ZA 1KC3A 4DVJA 1VLLA 1DFIA 3GVPA 1HLPA 2BD0A 1A7KA 2CF6A 3ADOA 2O50A 1I0ZA 2EJVA 1DXYA 3D5QA 5A5EA 2MAPA 1KOLA 4BS9A 5ILOA 2ZJ0A 3MJVA 1H6AA 3KXDA 1HE5A 5TJ9A 4CMCA 3INGA 2ZCVA 4YTEA 3RKUA 4CL8A 1K2WA 3CZKA 1B14A 3RAJA 3QHAA 4BO1A 1QKIA 3A1NA 1QV7A 1MUUA 2VYVD 1E1KA 2PKQO 2YDYA 3HE3A 3R1IA 2FOIA 1O6ZA 5T5QA 2O23A 3K30A 1U7HA 1FF9A 3F46A 1HDOA 2Y0DA 3F5QA 4XRRA 1Y81A 5IG2A 1E6EA 3CEAA 4BO0A 2BFAA 3PQFA 1UDCA 4N18A 1PJSA 1DIGA 3H65A 1CIVA 4NBRA 4OGWA 4ALLA 2JFFA 3CZMA 1X0VA 2GSDA 2IRWA 2R00A 1IOLA 1U3VA 2J5RA 2VZ0A 3CZRA 3GY0A 3WMWA 1BHSA 1GR0A 1X13A 4L76A 2IZ1A 2DPGA 3WNVA 3Q9UA 4DTIA 5JXWA 1IUKA 2A35A 3KM0A 2PK3A 4PLHA 5EQDA 4ZQGA 3MEQA 1P3DA 3HQ4O 3H9JA 2WDZA 1QG6A 4BNLA 2WE8A 5C5IA 4PG4A 1YGYA 1JDJA 4FFMA 1HL3A 1NFRA 5IFLA 5AYVA 5A1TA 3DB2A 3I4CA 2VCYA 4ZGWA 3ZWCA 3KZVA 1LRKA 2AG5A 1K0UA 2NUAA 5A06A 5K0ZA 4L4XA 1HDYA 1H9AA 3MCVA 3DZFA 1BXGB 1EEHA 4KTTE 1ADFA 1S46A 1JN0A 4OHUA 4IMPA 1TT7A 2FR1A 1B15A 1LBEA 5AXDA 4KMSA 1MGOA 4BV8A 4NNJA 4TROA 3AOGA 3ZWYA 3ANNA 3P19A 4AJJA 5JMWA 1GQYA 1KEWA 3ZN2A 2RHRA 1JVBA 5T8KA 3IL2A 2PH3A 2VT3A 4ALJA 1I30A 3R3SA 3RBVA 1TT5A 3WR5A 3RUAA 2X5KO 4CV3A 2JFGA 4M49A 4IJUA 1U3WA 1C1XB 3AU8A 4YWJA 3KSZO 1BG6A 4HX5A 3V2GA 4ND3A 4AJ2A 4LMPA 1B8VA 5JC1A 2H6EA 4MVJD 3I23A 3I9NA 4N5LA 2Q2QA 3K2EA 1ZJYA 4WK6A 5DOZA 5JW6A 3HSKA 2IE0A 4UUMA 5TSDA 2PZJA 3ZNOA 5BNTA 4R54A 2Q2WA 5FEUA 1GPDG 4K1LA 3N7UA 4A03A 2VNSA 3DBLA 1R4NA 4HNHA 3GZNB 1F17A 1GPJA 2O7SA 3ANLA 1CQIA 1D7OA 6ADHA 2BI7A 4BNGA 1HF3A 3CINA 3LK7A 4M87A 1RWBA 1WXDA 2AE2A 3NGXA 4BKOA 4U6SA 4UVHA 2O4CA 1ZXLA 1E1MA 4TVBA 3EZYA 3D3WB 2EW8A 4MP8A 2FY8A 4S1VA 4CMJA 5JBIA 1B26A 4OL9A 3N58A 3U0BA 3JYPA 1E6WA 4IDCA 1RP3A 3GK3A 3L07A 4KUGA 4RPGA 5LC1A 2Y66A 4FDAA 1HT0A 4ZHSA 5GZ1A 3P2OA 4YT2A 4Y6PA 4J7XA 1YDWA 2W8ZA 5ADHA 1YB1A 4F6LA 4JNKA 2JCXA 2HLPA 1IE3A 4B79A 1HRDA 2A94A 3OIFA 4IMRA 4DXHA 4FLRA 1PGOA 4WNCA 4YJHB 3S1LA 5J23A 3WGTA 3UCEA 4FBGA 1VI2A 2OOSA 2WD7A 4RL6A 4FJ1A 1YL5A 3KLMX 1PJ3A 4OQYA 1L7EA 1ZO8A 3C7DB 3ZU2A 4IQ8A 1B3BA 1QYDA 2VOEA 3PYXA 1LRJA 4MOWA 4B8ZA 2FR8A 1UZMA 1SOVA 4XZ3A 3VH3A 3HN2A 4LSWA 2POQX 3UCXA 2PD6A 2DKNA 2YY7A 1BGVA 2D3TA 1ID1A 2AQIA 4IIUA 4X54A 5KJFA 4I5GA 5F1KA 1EVIA 5CG2A 2HMSA 3FBGA 1QSGA 5KVCA 4BL5A 3ZHYA 3WQSB 1HYEA 1V9LA 3KYBA 3BHJA 1Y9EA 3PHGA 1JWBB 1F8FA 4RQUA 1GEEA 1DC3A 3STHA 4A7PA 3VPHA 3DMTC 3GAFA 3KYCA 4GKVA 1NVGA 2Y1FA 1W0CA 5ICMA 3CZLA 3C1OA 3MWEB 1LLUA 2A9FA 2V6MA 2HAEA 5EL0A 3TNLA 3D4OA 3KYDA 2PA3A 5ITWA 2AQHA 4DIBA 2G5CA 4JXKA 5G4LA 1U4OA 2GERA 5EINA 2EKPA 3AK4A 2GPTA 1VPDA 2GYYA 4LN1A 4I9HA 1YQXA 2IODA 3WGHA 3DHNA 4UVEA 5L4NA 1LSOA 2AXQA 4J7UA 1RKXA 2JD1A 3JD1A 4XD2A 2Y05A 4GKBA 4NJMB 3FNEA 4PLWA 4BGVA 3KO8A 4J4TA 2FSVA 4ZU3A 2Z1MA 1JWAB 3L6EA 2WYWA 1DIHA 3OIGA 3PGJA 5G2OA 4BO7A 4ZRNA 1PTJA 1K89A 5CDUA 3WMXA 1O5IA 4GQAA 2B69A 4MDHA 2C5EA 4URFA 3A4VA 3U4IA 3PLNA 3C7AA 3SVTA 3S2EA 2HMTA 4RV9A 5C7IO 4KUEA 5G0UA 4JP3A 1N9GA 5B4TA 3INTA 4HFMA 4RZHA 4I5EA 1K5HA 1VE9A 1WW8A 1U8FO 3KSUA 5DULA 1Y5MA 2B35A 2JKVA 4IXWA 4WOJA 1DFGA 4Z3KA 1QXSA 1IYZA 1Z74A 2FZWA 2ILTA 1U5AA 1ZFNA 4D42A 2Y1CA 1MC4A 3KOUA 1Z7EA 1ZVMA 1C1XA 2H1SA 1E3EA 3E5MA 2GD1O 4JK3A 4PLTA 3KVOA 3GHYA 3L4BC 3FN4A 1N1EA 1PL8A 1RPNA 1DC6A 3TF5A 3H2SA 3MJSA 4BO8A 3LT0A 3GOHA 4B3IA 3OEWA 3NYWA 1P77A 4ZRMA 2EERA 2BFOA 4BNIA 3TZKA 1KS9A 1WP4A 1H93A 2G0TA 5B4VA 2PR2A 3QIVA 3DDNA 4Z0TA 3CE6A 3L4SO 3KB6A 5DZSA 4L4RA 3U09A 2Q3EA 1NWHA 1V0JA 3GZNA 1DIRA 1LDGA 3RC7A 3W6UA 3PFWO 3R6DA 1M6HA 3HFSA 3TDKA 2B83A 1QLJA 4NFSA 4B7CA 3BTOA 1IHYA 1T1SA 3JQ6A 2Y93A 4FCCA 3S2FA 4TKMA 4EITA 5IN4A 2Q1UA 1H94A 1KEPA 2B37A 2GN4A 2VOJA 3M2PA 4O5OA 5A9RA 2YV2A 3FNGA 1H2BA 3GVXA 4GMFA 4CM9A 1CRWG 1PL7A 3DFUA 1ULUA 1PGJA 3ZWVA 4CMIA 4P22A 3I3OA 4M89A 3F4BA 1ISFA 3U9LA 3ETEA 1EE2A 2D8AA 3GRKA 4HBGA 4LSMA 5JY6A 1GQQA 1H6DA 2XAAA 3OQ1A 1CQJA 1M75A 1R4MA 1TB4A 2QZ9A 3PWSA 5DBFA 3GPDG 4R3NA 5G0VA 1Q7CA 2VHVA 2NTNA 4TQGA 2WM3A 4YT8A 3SJUA 4JN6B 3Q2KA 3I9OA 4DMLA 1I5RA 5ITVA 3QQPA 3RI3A 3O8QA 3WYCA 4RF3A 4Y6RA 2B5VA 3PQDA 3S55A 4FC6A 2C0CA 3O9ZA 4BGIA 1W4ZA 1AHIA 3PHIA 4GVXA 3GMDA 1A71A 4NBWA 2FMUA 3QW2A 2O3SA 1FDSA 6LDHA 4FC7A 4I08A 4IIVA 4XGKA 4FLSA 1PGQA 1PJLA 3ONFA 4IPTA 4FS3A 3DZKA 2NU9A 3PVZA 4RVGA 4QO8A 4YAJA 1UXKA 2NNLD 4P38A 3VDRA 5L53A 3HDJA 1F8GA 3ETDA 4CV2A 1YOVA 1I2CA 2R00C 1GD1O 1NQ5A 2VUTA 5H82A 4CM4A 4OKNA 3T7CA 4FGSA 4FFLA 4DIOA 3ONEA 4NBUA 4CLHA 1YONA 5EIOA 1I8TA 3ZV3A 4XCVA 1DAPA 1JTVA 4PFJA 2XOXA 3VPXA 5T57A 4KQXA 1Q1NA 1KVQA 3A06A 2GO1A 1VKOA 1CYDA 4I5DA 1YO6A 3PFFA 4EJMA 3ZGYA 5C3MA 1UXHA 3CZEA 3UF0A 1PGNA 4RVSA 5TLSA 1VKNA 1U9JA 4RZIA 2UDPA 2VHZA 5U9CA 1PJQA 3E48A 1JLLA 4KWHA 4MIYA 3O38A 1GZ6A 2OL4A 4ALMA 1UJMA 2UUOA 5BSFA 5TIIA 4JJGA 4AJ1A 1XEAA 2I6TA 5T8KC 1BMDA 3JQ8A 2GLXA 1KEUA 3RSHA 2AEMA 4BNXA 3OM9A 1IHXA 1BW9B 4G65A 3CIFA 2HUNA 4CLDA 4HUJA 4K6FA 2I9PA 5I7EA 4UVGA 1JVSA 4CM5A 3CMMA 1LXCA 3WGZA 1LA2A 4JQCA 5C7LO 4CLXA 5L7WA 4CPDA 3SX2A 2ZYDA 2P91A 4Q3EA 1E3SA 4RCVA 3E8XA 2VNAA 3I9LA 4YVFA 1HSOA 4FR5A 1U4SA 2ZCUA 2X5OA 3HB5X 3OBBA 2AQ8A 4G5HA 3LT4A 4CM8A 5KJ1A 2IEDA 5A9SB 3TL3A 3RFVA 1EQ2A 4WLUA 2VWQA 1EUZA 3MOIA 1F14A 2BH9A 3UGKA 1AXEA 2W2KB 4AYSA 4CXFA 3TWOA 4PG6A 3QWHA 1UP4A 4DPMA 1TXGA 3W1VA 3LYLA 1LEHA 1GTMA 1T2EA 2UYYA 3SJ7A 2NU7A 3RJ9A 1E7SA 4PG8A 3ZU5A 4KP7A 3WSVA 2V6GA 3EVTA 2X9GA 3IAHA 1J4AA 3RKRA 3TPCA 2WYVA 5BR7A 4R16A 3DHEA 3GFBA 2NU6A 2JCYA 2O3RA 3GDFA 5B12A 1XQ1A 1NFQA 3OHSX 2OBNA 1GU7A 1OC4A 2EW2A 4W4TA 4XJSA 4BNTA 5KWEA 3OIDA 3GUYA 4CLRB 3BMCA 4IDEA 4F46A 5G4KA 1E7MA 3PIDA 4CLOB 5BSEA 3UKOA 1LDYA 3H3FA 3GGGA 3ZV5A 4BHTA 2QW8A 3VPFA 1E7YA 3GVCA 2X0RA 5CEFA 1VM6A 2DAPA 3JQGA 4PLYA 1C0PA 2J6IA 3OJEA 1GUFA 1N92A 4E5MA 1LC0A 4BB5A 2YDXA 1NTOA 1KYQA 4MIOA 5EJ2A 4NQWA 1Y8RB 1J6UA 3OECA 2ZB3A 5CDGA 1GDHA 1Y8QA 1XQ6A 1ZK0A 5JNLA 3RBXA 1YBMA 3HWRA 4ILKA 3HFGA 1DHTA 2P2SA 4Z9XA 3H4VA 1C0KA 5A05A 3D4PA 1G6KA 4OXNA 5GZ6A 2UUPA 4QEDA 3RFXA 4U6QA 2DBQA 4Y9DA 3ZHXA 3ORFA 3RBZA 4CUZA 2O2SA 1CJCA 1K3TA 4XJTA 3AFMA 2B4QA 2OP1A 5BSGA 2PKQP 3F9IA 4LCJA 5CHEA 4BKRA 3ZZNA 3CPSA 3DZIA 3Q6IA 3BA1A 4C7KA 1NQAO 1Q0LA 3GF4A 4YAGA 3MTJA 4ITUA 4XA8A 4WLEA 2X0IA 2VRBA 1PS8A 1I2ZA 2B36A 4PLFA 1E3LA 1DSSG 5JO0A 3DZJA 2JL1A 3CKYA 3RUHA 4DLAA 2YV1A 2OUIA 3GT0A 2CNBA 3IJRA 1BTOA 3JQBA 1KVUA 4PLVA 3DC2A 4CQLB 3U49A 2G82A 3MJ4A 5DP1A 1QP8A 5JS6A 3D5TA 2CVOA 1SB9A 2D0IA 2O4UX 4WNIA 3OEYA 2EXXA 3EUWA 5H81A 1LI4A 1V3UA 2I76A 1PJ4A 4Z3DA 1B8UA 3GQVA 4YQZA 5HRUA 1I3NA 4Y6SA 4WECA 1AE1A 5I8WA 4R51A 4W82A 3E82A 5JPIA 3ZWOA 2Q4BA 1P31A 1KVSA 1O94A 4FIZA 2DLDA 1Y9AA 3IIEA 3FR8A 5B1YA 3V1TC 4YA6A 4QT0A 2R6JA 3GVHA 1H3LA 1ULSA 2CZCA 1BWSA 4FFRA 4W7IA 3QVWA 1ONOA 3QA9A 5ENVA 1GZ4A 3W8EA 3BHMA 1DLIA 3ANMA 3CMCO 5BSHA 2H5LA 4HFRA 4OSOA 4BNVA 4UREA 3DBRB 1EBUA 1E1LA 4E2XA 5A02A 1ZKMA 2UVDA 5DDIP 3I5MA 4GX5A 3W4IA 4EI2A 3PPIA 4OXKA 9LDBA 1PU2A 3SLGA 3H6KA 4ND2A 3NDJA 1ZBQA 5HBRA 3ZWPA 4R5MA 5JYDA 1MP0A 2YHUA 3EW7A 1ZK4A 1XELA 3PK0A 1NPDA 1RM3A 4RQTA 5JDIC 1UDAA 3JQ9C 2WMDA 2X9NA 3GLQA 2X86A 1U3TA 3KV3O 4TSKA 4ALNA 2NVUB 1C1DA 4BKUA 2PNFA 4OSPA 3VPGA 4AJEA 5A9SA 2CMDA 4UEJA 4H15A 3CSDA 3OQBA 1U1IA 2HK7A 1IULA 4XYLA 2GR9A 1OR7A 2BGKA 2E82A 2W2LD 1HYHA 3VPSA 1D3AA 4LVCA 4ZA2A 1YKFA 4QSMA 4R5HA 3H7AA 3NX4A 3UEQA 3HDYA 3JQDA 2SCUA 5K9ZA 3W8FA 4D45A 1Q7BA 4GLOA 3C3XA 1MG5A 3IJPA 4J91A 4I5FA 4ZQEA 2HCTA 4R4JA 4R1SA 3ROMA 3I1JA 5G0TA 3LT2A 2X0NA 3AW9A 4M1QA 3ITKA 4AJIA 5GY7A 4PZCA 4CMHA 1NBOA 2IZ0A 5TNXA 1YH3A 2H9IA 3BTSA 2ZK7A 5CEJA 3E1KA 1SOWA 4K9DA 4PLCA 3CH6A 3KHUA 4CLOA 3ZV6A 3FCOA 1MFPA 1ZMOA 3BXXA 4WCFB 5JAIA 4A10A 3UAGA 4II3A 2EJWA 4J90A 3EK2A 2VRCD 4E21A 4S3MA 4YRBA 5EQFA 1MFZA 2I3AA 4D0SA 4DBVO 4B3HA 2PGJA 4MO2A 4YR9A 2DU8A 1EVZA 3DEYX 1VJ1A 5A9TA 1YQGA 3DAPA 3V1UA 3GEMA 1G5AA 4CMAA 4XR4A 1TEHA 3K6JA 3NT2A 1HETA 2FP4A 4MINA 5KKAA 1UP6A 2ZQZA 3EHEA 3WWZA 3ZDFA 4E32A 1QYVA 2D1YA 3HN7A 1X0XA 3INRA 2O3TA 4IGEA 4D79A 4GX1A 2RIRA 4GWGA 2F00A 3ICCA 3PEFA 4YJGA 4L8VA 3VZSA 1E5LA 3PDJA 4RLHA 1VL6A 2CD9A 3GN1A 1KIFA 5CPFA 1IZ0A 3PRJA 4EJ6A 4AJKA 3AUSA 2ZB7A 4U0KA 4IDAA 5B4UA 4J1NA 4CM6A 2RBEA 5IDQA 3W8DA 4BMVA 4C7JA 2HDHA 4DLLA 4MIEA 2P9EA 2CSUA 1MXFA 4A26A 4HNGA 4L75A 2VYVA 1GCUA 3AUUA 4E5KA 4N5MA 2AHRA 4R41A 3RJ5A 2YFHA 4B7UA 4IJWA 5AVOA 4GVLA 2O48X 1PWXA 4FLOA 2DM6A 5GMOA 1XLTA 3ZI0A 4ZD6A 4A27A 2IXBA 3GVIA 3L77A 1RYEA 3U4CA 3WLFA 2W90A 1BDBA 4DQXA 1UH5A 3H5AA 1O89A 1NWCA 3WOHA 3QWBA 1ARZA 3PLRA 4D3DA 4BV9A 4WPGA 4PLPA 4G81A 4A5OA 4Q39A 3SXPA 3JQFC 4YAEA 3GR6A 3DOOA 4BVAA 3P7MA 3D4NA 4NBVA 4PRLA 1C3VA 1WDKA 2CVZA 3DBHA 3WFJA 3ON5A 4HY3A 5GZ3A 4EUHA 4QO7A 1DRUA 4AG3A 4PIVA 5L95A 3JSAA 2D2IA 4EUFA 4WCDA 5FFFA 1XWFA 1IL0A 2WE7A 1P9LA 2PD3A 1M67A 1NQTA 1MV8A 1JU9A 1PJ2A 3VHRA 1BSVA 1HE4A 3UVEA 2PZLA 3VKVA 1DDOA 4XX0A 1R16A 2LDBA 4CM1A 4ESOA 5A3JA 1QRRA 2GZ3A 3ZW8A 4R68A 1E77A 4Q9NA 4MP3A 1HXHA 2VRCA 3LSYA 1WDMA 4M55A 5TT1A 2D5AA 1HWYA 3OETA 3DBRA 1EE9A 3F1LA 3TZQA 3ENNA 2DTDA 2VWGA 3DQPA 3QY9A 1JA9A 1LDMA 1ZSVA 3HADA 3KLPX 4IDGA 3ZHZA 2HO5A 4MVJI 3TN7A 1XIVA 1ZK1A 4HKTA 3HDQA 1EK5A 1ADCA 4AJHA 3RC2A 1RJWA 1WDLA 1EDZA 2ZTLA 2HKIA 4JIGA 3WGOA 4MVJA 4MVJM 5I7VA 4JJIA 1WLYA 4HFJA 3DZGA 5COBA 1QLHA 5U1PA 4CMEC 4OAQA 4RF2A 3AM3A 2P9CA 4A73A 2C29D 2O3UA 2CY0A 3NTRA 4DLBA 2ZTUA 3S2IA 2JAHA 5THKA 3CXRA 1I24A 2AE1A 1ZCJA 4W7HA 3DOCA 2P4QA 2V6FA 2WD8A 3IKVA 2Q1TA 4JGBA 5B37A 3V2UA 5ICSA 4INAA 2E49A 2V6BA 1DIAA 3NV9A 4M8SA 3RC1A 4CMGA 5L51A 3GNTA 3IQDB 4KQWA 3IKTA 2GNAA 3NDIA 2EF1A 1V3VA 1A9YA 1YE3A 4GBJA 4RDIA 4CM3A 4YJFB 1ADBA 1GFSA 2PH5A 2DFDA 3DOJA 3WQRA 5F21A 3KTDA 2PV7A 1N5DA 1ZK3A 3HDHA 3LLVA 4TZKA 1B8PA 1EVJA 3TL2A 1WWKA 3A14A 4BO6A 3GH3A 3K9QO 4UUNA 1T2DA 4FB5A 3GPIA 3E5RA 3K96A 1BXGA 4YQYA 3T4EA 2V65A 1LUAA 2AMFA 2D5CA 3IUPA 3FI9A 3MZ0A 3I4FA 2ZATA 4J0EA 2GCGA 4JLWA 1NFFA 2AEFA 2JHGA 3JQAB 5MDHA 1DRVA 3ZWMA 4Z6KA 2C07A 2ZYGA 5G0WA 3TRIA 3VH4A 4D3FA 2NACA 4BNUA 1P74A 4YEDA 4J49A 1LX6A 4GH5A 2VHYA 3WXBA 3BTUA 4GX0A 2BF7A 4GL4A 5JO9A 3OFSA 3JQBC 1Y7TA 3IOYA 3PWKA 3D1LA 4XIYA 2X0JA 2X6TA 2X23A 2J3JA 1I01A 4G2NA 3D3EA 4JBIA 1FXSA 4CR6A 3C1TA 5JDIA 4BNZA 3JQ9A 1XSEA 4TWRA 2Y0CA 4BB6A 3MJCA 1U3UA 1BDMA 3ITDA 3NAQA 1UR5A 3L0DA 5I9MA 1GYQA 3QLJA 1SZJG 1B3RA 1P1RA 4EEZA 4HP8A 4AJLA 4ZJUA 4LW8A 4OO3A 3MJTA 2OFPA 3BAZA 3IUSA 1YB4A 1BXZA 3LQFA 3HHPA 2RHCA 4CUJA 4QX6A 1MW3A 3JYNA 4XDZA 1K6XA 1TA4A 2OO5A 4ID9A 1N7GA 3E03A 1ONPA 4YB8A 5JSFA 3D3WA 5TT0A 3GG2A 3LC2O 5KJCA 4WOKA 1H5QA 3K31A 8ADHA 1CERA 4E2ZA 3OJLA 2LDXA 4BNNA 4TRRA 3JCZA 2J3KA 2VQ3A 5TRTA 2XXJA 3EYWA 4NR0A 4QUKA 3AUAA 1ORRA 4W99A 1FK8A 3FNHA 4PG7A 3ETGA 3NJ4A 3ZWAA 4EDFA 3T7EA 4BGUA 1NHWA 3B6ZA 4K28A 3AM4A 3BMNB 3WJAA 2QRLA 4U5QA 1PS0A 1NNUA 3JD4A 4DQUA 3JQAD 3KUXA 4YJHA 3CZGA 3D0OA 2AEJA 1E7RA 5DF1A 3PYMA 3I6QA 3WDSA 2BFPA 4Z0PA 2C54A 2YV3A 1LLQA 3L6OO 3ASUA 2OXIA 2Q1WA 4OYRA 1XHLA 2ZB4A 2PZKA 1DHRA 2OP0A 1Y5RA 3PWZA 4CMKA 4IGFA 3NKLA 3NDRA 2HRBA 4DYVA 3VH2A 1JQBA 1V3TA 3JQEA 3KSDO 3QP9A 4B4OA 5LDHA 5TJHA 3AI2A 2PZMA 1WAMA 2CDBA 1H2HA 2HMVA 5DCUA 2AQKA 4IDDA 4PZEA 3WTBA 4ALIA 1QYXA 3ADPA 5BNIA 1J49A 3RD5A 4A0SA 1NYTA 1NVTA 4E13A 1EZ4A 1YWGO 4OQZA 4E33A 5BQFA 4YAKA 5JAZA 4QXMA 3KETA 5JY1A 5F5LA 5L45A 3BMQB 2VZ8A 4XYBA 4EYEA 5EN4A 3EZLA 1WPQA 4FSHA 4GWKA 3LDHA 2J8ZA 3X2EA 5THQA 1B0AA 1UAGA 1DC5A 5FWNA 5IJZA 1JAYA 3JYOA 2CDCA 4NZ9A 3U4DA 3GNQA 5JCXA 2QG4A 1YBVA 2X58A 3BHIA 4R9SA 3IC5A 1U2GA 1YL7A 3RUDA 3FWZA 1OAAA 4FD3A 1WMAA 3H9UA 2BFMA 1VL8A 3QE3A 1XR3A 4DPLA 3RU9A 4NJMA 1M6WA 4Y98A 1ZMTA 4ND5A 2I65A 4L9RA 4MP6A 4PLGA 4E2YA 3DTYA 4TMFA 5IDYA 4ALKA 1GL3A 2FHSA 2QYSA 3OICA 3JQFA 1ZJZA 4IM7A 2PY6A 4WKGA 3TQHA 4DPKA 1U2DA 4XB2A 3K5PA 4RF5A 4EJ0A 2Y0EA 4YBZA 4PCVA 4D44A 3AUTA 4FLQA 2Q49A 2GZ2A 2HQ1A 4BIIA 2QHXA 3ULKA 4DREA 3JQ7B 1V8BA 3PDUA 1P45A 3DXFA 1I3MA 5IDXA 4F3YA 1N8KA 4WEOA 3H9QA 4LISA 1AHHA 3ZU4A 2O7QA 2GZ1A 2Q45A 2XXBA 3VDQA 4ZQFA 1SEPA 2CFCA 2JD0A 2IZZA 3PZRA 1FMCA 4MKRA 4E12A 3TJRA 2JD2A 4O59O 1PR9A 3I52A 4B4UA 3B20A 4J9UE 4BNYA 1I3KA 2QRKA 2W4QA 1ZXBA 1LRLA 3QWFA 3RU7A 3C1AA 4FOOA 1P1KA 4N5NA 1EBFA 5H83A 1GYPA 4P4LA 3ZH2A 3M6IA 2OBYA 1ISMA 5LDGA 1MVYA 1HE3A 1Y6JA 3T0YA 5ES3A 4ONEA 3FHLA 1LSUA 1LSSA 4YAIA 2PLAA 1WNTA 1YL6A 2B4TO 4J3FA 4R1UA 4RVUA 4Z0HO 1P0FA 3GNSA 2ZB8A 1LLDA 4WLNA 4YJDA 4HADA 1E7WA 4AJOA 2O7GA 3SEFA 1DAOA 2RAFA 1OI7A 5TF4A 1WVGA 1FJHA 3FRJA 4ZN6A 3VH1A 4CMEA 3FBTA 2Q50A 1CDOA 4FJ0A 1V35A 3KEQA 4Q3CA 3OH8A 2Z1NA 3A9WA 1NVMB 4LRTB 3FD8A 3L6DA 1E92A 4A2CA 4BNHA 1XG5A 2TMGA 3HUDA 4XWYA 1DPGA 1GEGA 2GDZA 3QV1A 4IDBA 4NH4A 4NPCA 3R3JA 4D43A 3S2GA 2IDZA 3HB4X 4Q3DA 5CDTA 5KKCA 3AJRA 4BO4A 4IJVA 4J9VA 3T4XA 7ADHA 2FSSA 2P9GA 1JAXA 3D64A 4FFOA 4N54A 1T2FA 1DC4A 1SEVA 2HJSA 3F4LA 4NI5A 2G17A 4OXYA 3H9GA 4O1MA 1QR6A 3FR7A 3Q2IA 4P8RA 1XYGA 1IZ9A 2YZ7A 5KVQA 1ZIDA 1S7CA 3NT4A 4QQRA 1N7HA 1F12A 3ZWNA 4J1QA 2BKAA 1D8AA 3WQQA 1DJQA 3SLKA 3VAZA 1A4UA 1PJTA 2FN7A 4O63O 2X4GA 2B5WA 3CTMA 4OIMA 2YUTA 1YXMA 3MTGA 2BRUA 1XKQA 1ISGA 1WMBA 2OGUA 1D1TA 1MB4A 4AFNA 2YHIB 1F06A 1YS4A 4I9NA 3RWBA 1UDBA 1DFHA 5IF3A 2PD4A 1LDBA 3RUFA 3UICA 5KJ6A 1R0KA 1Q7GA 5EERA 5T6BA 4WUVA 3AI1A 1UZLA 1ZSNA 1PZHA 1GYRA 3Q9NA 3WLEA 2EWMA 3WWYA 4ZQHA 2IYOA 2QZZA 4K26A 4L4SA 4RLSA 3PP8A 4GPD1 2EHDA 1PQWA 2O3JA 4IINA 3TZHA 1R4NB 4J43A 1HDCA 5L3ZA 3EC7A 3EGOA 3LC7O 2FPPA 3I9MA 4MVJH 2HMUA 2YYYA 1HE2A 3U3XA 1L7DA 3P2YA 4WCFC 3UCQA 2IXAA 5I8ZA 3UN1A 3ROKA 5K6AC 4OMUA 1WZEA 4FFPA 1HDGO 1D1SA 1T2AA 3C85A 5AXAA 3VZRA 1EMDA 3IS3A 4Q3BA 4NK5A 4TRMA 4CQMB 1H9BA 3ASVA 4J2HA 4RVFA 2UV8A 5DBIA 1ISHA 1R15A 1T4DA 2VYND 4YRAA 2NU8A 4FQ8A 1R0SA 3DWFA 4RPLA 1KBZA 1E3WB 1KERA 4BQRA 4JP2A 1BW9A 2EGGA 3LF2A 3ROQA 4XIJA 4XQCA 2FWMX 4KDEA 4DQVA 3H5NA 5IZCA 4O6VA 1AUPA 1BVRA 1PZEA 3V8BA 2BHLA 4CUKA 3GRPA 1NXQA 2O3QA 1ZK2A 1GQ2A 2WD7B 1GADO 1G1AA 2PWZA 4AICA 4UEKA 4WEQA 1P0CA 3O03A 3QRWA 2H63A 3FPLA 1UZNA 4KDFA 2CDAA 3JQ7A 2G1UA 4OH1A 1ENYA 3G79A 4YCAA 1N2SA 5DCYA 4PN3A 1DBVO 3QJ5A 3VTFA 1LJ8A 2NSDA 4GSLA 4WGGA 3V1YA 3SC6A 1DEHA 2J3IA 2Z95A 4PLZA 1Q0QA 4IQGA 2DUUA 3JTMA 2Y1OA 4J16A 1TLTA 2W2KA 4IZHA 2Y68A 3GGOA 3E9NA 3FTPA 1I2BA 3OP4A 3FTNA 1XGKA 3KYCB 2QX7A 3OJFA 2A92A 5A5FA 3IP3A 5HTOA 4WLVA 1P1HA 1XU7A 3PQEA 2DFVA 2NTJA 3JD3A 4IS2A 5L7TA 2F1KA 4U0JA 1LNQA 4YT4A 4YACA 3KYDB 3NUGA 2DBVO 2WPGA 4JCOA 4ROSA 4D41A 1BXKA 3V2HA 3LZ6A 2CVQA 3NJ8A 4CQMD 4RORA 1O95A 1DOHA 3KRTA 1BRMA 4CLRA 4WE3A 5JCJD 1LSJA 5KVSA 3Q0EA 3OSUA 4LRSB 4JX8A 3JD0A 4B7XA 4OOFA 1NASA 4XQGA 3ZWWA 5KIAA 1NM5A 3ZNNA 1VSUA 4II2A 2QRJA 1D4FA 5ER6A 5JDCC 1ISJA 1SBYA 4NHEA 2CF5A 1T1RA 1M2WA 4LMRA 3NEPX 4DIFA 1NQOA 1JG9A 1VRWA 2Y99A 5COQA 2PKRA 3GFGA 2I99A 2FRDA 3OA2A 1DRWA 1T4BA 1X15A 1H6CA 1Y8RA 8LDHA 1OZAA 4XGNA 2VYNA 3WTCA 2WWRA 4MKZA 4I1IA 3WGGA 4D3SA 3O4RA 1FDWA 3PXXA 1PS9A 2X5JO 2JHFA 1SO8A 4TKLA 4E4YA 4RF4A 5IXYA 2QIOA 4L0QA 1H6BA 1KY5A 3UFXA 3UOGA 5KTKA 1N9GB 3MWDB 4BKPA 3PJGA 3VTZA 5A04A 1JGIA 5KJEA 3WSWA 1A5ZA 3Q1LA 2B0JA 4M54A 1IB6A 2X1HA 4K6CA 4CL3A 3GGPA 2IEBA 1NX6A 1YB5A 4OJNA 5JE8A 1AXGA 3U4HA 4CLEA 1TVEA 2YHIA 3DONA 1CWUA 1CEQA 1Z6ZA 1E0DA 3F5SA 5I9LA 1YJ8A 3A28A 2GUGA 5CP8A 2NADA 1M66A 5KOIA 3WGIA 5ER9A 2IYPA 4YPOA 4RVDA 3COSA 1LC3A 3EMKA 5DOVA 4CODB 4Q3AA 1XDWA 5F5NA 3C7CB 4P4GA 4TVOA 5JC8A 2W2LA 4LCEA 1LDEA 4BMNA 1R37A 1MXHA 1ZUD1 1I10A 4CQLA 5HWSA 2PGDA 1CETA 3G3EA 1OBFO 3QVSA 3WBBA 2ZYAA 1IPEA 2ZIZA 4GLLA 2X9VA 4IQ0A 2Q4EA 2WTBA 3AY7A 1E1NA 2C7GA 4CJXA 4PZDA 3OJOA 3IP1A 3HG7A 4IXTA 3DBVO 2EIHA 4NFYA 4YRDA 4EW6A 4C4OA
chains in the Genus database with same CATH superfamily
4RHEA 3ZNPA 2IH4A 3RSQA 1DUIA 3G85A 4LBWA 3O1HB 1WCIA 1DCMA 1MG0A 4Y0AA 2PSFA 2NIPA 4XN5A 1K27A 4HWGA 2O8DA 3KCQA 2JVJA 4JLBA 1IUPA 1UBFA 4UUPA 4CKXA 1AUOA 3MWLA 1QE3A 5L40A 3FYUB 3H2IA 4CMIB 1EDBA 4RQAA 2R96A 3JAKA 2FWAA 3B3GA 2WMYA 3I83A 5AHXA 1ISIA 3SHOA 2JEZA 1E3WA 3G1TA 1N9ZA 3TQSA 3FCUB 1CQXA 1QZTA 2XMGA 5DBEX 1CQJB 3EBHA 1R4MB 2RAVA 3CH5A 2ZIFA 3P5SA 2JK1A 5LCXA 3OT4A 2E4YA 4RHXA 5BXYA 1U2RA 1XZMA 3IQFA 3E9DA 2A4KA 2EAUA 2C94A 2C7VA 3WBFA 1JQLB 3ISJA 1QFMA 3THSA 4D8TA 1ZI6A 1SQMA 2FW7A 2ANCA 3N5CA 1V6AA 1K2VN 4LVUA 2FR0A 4G3XA 1FZQA 2VWHA 1BMFD 5JJ5A 4WH0A 1KI8A 2VF7A 3PSHA 5FUBA 1R9MA 3LT5A 3R0VA 1PVOA 2P5UA 5E8RA 1WXEA 3G1UA 2BZSA 2R1TB 1ZUIA 1AQLA 1J06A 1FMLA 2NVUA 3PFGA 4KH0A 5EE1A 2CLHB 3OZAA 4XJVA 5TGDA 1N34B 1F2TB 1CYEA 1ZIYA 4OKIA 1V1RA 5HIAA 1V5WA 5E3IA 3ZU3A 2DPHA 3RUCA 2ZEJA 1VKJA 4OXXA 4UBKA 4ZI5A 5B1IA 1R18A 1KQGA 3K2BA 2JATA 3BXEA 3CGWA 3GHHA 1E6LA 2L42A 2RHJA 4FDLA 1YJAA 1MC8A 1NYRA 1WUIS 5INTA 1TK3A 1ZOLA 3FWNA 5JZVA 2OKGA 1IBMB 1THZA 1MW1A 4OM8A 3WDKA 4G26A 3PZBA 5JG7A 3FPGA 2G1KA 2H1WA 1I36A 1UBMS 2PBFA 3IP6A 4Y2XA 4V0MA 3PYLA 2XD4A 3DTTA 1Q74A 3EAGA 1X94A 3X1MA 3K73O 1CC1S 1N5IA 2ZUWA 1JFFB 4OVKA 5CLQA 2VDJA 1CF4A 3FWHA 4FK8A 4OATA 5CVDA 3ZDDA 1Y1KE 3PS9A 4J1SA 1F48A 3VX4A 3TUJC 3DM9B 3ROPA 1U2QA 1VJ0A 5KYGA 1RRVA 5HFNA 5AHOA 3T7IA 2RGEA 1EKXA 3AY0A 4QDXA 1JG7A 2CCJA 3IHWA 4H6PA 2HEGA 4HH0A 5K6TA 4TKVB 4KW7A 1RM0A 5AW7A 5LYJF 1FDRA 1XTPA 1Q77A 3SVZA 4OAOA 1NPYA 1T8PA 1NMXA 2Z6VA 2GTHA 4KNVA 4QTZA 4GSKA 1MO3A 2GO7A 2W11A 5LZ9A 1M7HA 2QIPA 4DJ5X 1AKUA 3TTSA 1XDZA 1ZH0A 2HSJA 2VI5A 4FT4A 1JEDA 3QMMA 4D4LA 1JQ5A 4NYIQ 4B2IA 1S3FA 1VC2A 1V5GA 3FUIA 2XMRA 5P8WA 1BHJA 1II8B 4UAGA 3AVYA 5FBKA 1KVRA 3JU3A 4JROA 4BTVA 5SY6A 3TTYA 1UT5A 4BO9A 4EGJA 4NCAA 5C80A 4YRTA 2BGGA 5CNKA 1YOBA 2W00A 3CLUC 3K71B 3IV9A 4KCGA 1KQNA 2IU4A 3JV7A 1D2CA 5SYNA 1TF7A 5CCEA 1NXSA 4AR9A 1WUHS 1XKXA 3KD2A 3KKKA 4YP7A 3F1KA 4L85A 5HTKA 1SPXA 3LMKA 3UEOA 1XA3A 2QSZA 3JZMA 4KI0A 5FOXA 1RJ9B 4XGIA 2AYYA 1SCUA 1Z4LA 3GIDA 2I3DA 3QI2A 2NV6A 1Z6AA 2BI8A 3N5KA 3NHBA 3DOUA 4C7OB 2LCFA 1BO6A 1EAMA 5CB4B 2V3CC 4YP1A 5CVJA 4NICA 1I3LA 5F76A 1QB7A 1EP9A 1NJGA 3C3AA 1RXEA 5ITSA 1H2YA 1N5JA 3KPJA 2NU7B 1JHYA 3GJ5A 2V97A 3RG2A 5T4BA 1X7XA 3KJEA 3EEIA 1Q0HA 1HDRA 1XD9A 3GRRA 2QQ5A 4KFUA 1MB9A 1IZ7A 3I53A 3WK7A 4MJ7A 4PC3A 2J5BA 2YN0A 2JAPA 2R60A 2P67A 2J46A 5M34A 3BCUA 2VF2A 4HDMA 4XD7D 1S2DA 5CM8B 2FZ5A 5FLXA 3UWDA 1F2DA 1GKYA 2XGMA 4BNMA 1V8ZA 1HLDA 2YJZA 4F3KA 1R0LA 4YMIA 1QVRA 5JOQA 2H65A 4IYJA 2H00A 3L92A 2ODNA 1V71A 3P71T 2PKYX 3PD1A 3P9QA 1MT0A 4KYUA 3QVXA 4K7JA 3QXCA 4ISCA 2QSJA 4ZAWA 5IZCC 4L3OA 3U7JA 2AG8A 3PUVA 1J8VA 1E18A 5FUMA 5SICE 4X7PA 2YBDA 3EFEA 2IYSA 4I50B 3KWMA 4TXLA 2YQ4A 5FTJA 4O08A 1P1CA 3Q6MA 1HG0A 3IQEA 3QKWA 4KMRA 3JQGB 4HYEA 2OHOA 1PBTA 5L9AA 2P9BA 3AHEA 4E30A 1T24A 1PQUA 3DDHA 1S3SA 3KLNA 3OZTA 5GPBA 1FLVA 2WTMA 3PXDA 4PZ0A 1AF7A 3JYLA 1J00A 5HS4A 3EGEA 5CM2Z 1A9XA 2JVIA 3HM2A 3OCUA 4IO1A 4J75A 1YZHA 4J4BA 3FMIA 3VZQA 2YVLA 3N76A 4K5MA 3QWAA 4KOAA 3ETLA 3NGLA 4U63A 5CU7A 5DNAA 1DAIA 4Z9FA 5JDCA 4NX2A 5AQ1A 1FBNA 1CZLA 1M10A 1ZISA 3J7AC 1YC5A 3S2SA 2E6UX 2ZYSA 3SKXA 1Y8QB 5CA1F 2G1PA 4EENA 3T8VA 5DHAA 4YMWA 4UBLA 2FPIA 1RCFA 2C5AA 4JXZA 4AR1A 2Z5VA 1LDNA 1LPMA 1QHIA 3DUFA 3TD6A 1ML3A 3TKAA 5M7EA 5CIYA 1ADGA 1D5WA 2XDWA 2OXTA 4KKXB 5FQNA 3LUPA 3NH9A 4XGRA 1JR3E 4RO0A 3N0RA 4CHTA 1HEUA 2Q21A 3OMLA 3DDOA 3P9RA 1LJLA 2V7PA 3G7NA 4WJZA 3PJFA 1J21A 1SCDA 4BVKA 1SAYA 2W6OA 1IMOA 1NP3A 1EFVA 1G5FA 5T67A 3S3TA 4M7PA 5FI5A 1KDZA 3PIIA 1DJNA 2HA0A 3I58A 2TSYB 3CJTA 4QPPA 1S1MA 2RBGA 4Q9JA 1EWKA 2YWBA 4V0NA 4XDYA 5KEIA 1X1AA 2X4DA 1W94A 4E4TA 2PFGA 3GRAA 3JZAA 1S7GA 2G76A 2JCGA 4F72A 4DUZB 1KYZA 4R7GA 1C14A 3W5DA 1QZ3A 4ZHQB 2E4AA 5KVVA 3B8HA 4MUBA 1Z4KA 5LWHA 1ZRSA 1Y1SA 4BPBA 4BN4A 2P41A 4GAEA 5TARA 1RBQA 2LNDA 3VFDA 4Z7NB 1OKKD 3ZOZA 4LQDA 3TLGA 7REQA 1KP3A 1M6NA 2XTZA 3O8DA 3QG5A 5KDOA 5C8YA 1G2OA 2G04A 1K08A 3GLFA 3ZCRA 4FB4A 3WL8A 2XNCA 4UAVA 5DWQA 3QENA 1OXBB 4YQFA 3VJRA 3GZ4A 4YMGA 1Z5WA 5K0NA 4OX9Y 3CRMA 4HWKA 2OAQ1 3DL4A 3PJDA 1KHHA 1J1UA 1USUA 1E2LA 3ZHBA 2OXEA 2XV1A 4FPXA 4L9SA 1HSZA 1KJYA 2AB0A 1ONBA 2VLIA 4LJ6A 5IDVA 5WRFA 1PVVA 3WIOA 4A82A 4YXFA 4XWTA 4ZMRA 1CF2O 1QO7A 2XDQA 2HQRA 1Q91A 4G56A 3D0RA 2ET6A 3FNQA 1J99A 3UJ3X 5DW0A 2HLNA 4K5LA 1E5DA 1DQRA 2K6GA 5G1PA 5KQPA 4CN9A 2C57A 4A15A 3DZBA 4BNDA 3LIPA 4PYMA 4Z1MD 1SC5A 5M29A 3G8YA 2CJFA 1ATZA 1M76A 3EY4A 4FOSA 1K7SN 1NF9A 3LQQA 4G9BA 1P7ZA 4YRFA 4QARA 3GI1A 2CUTA 5KAMA 1NYLA 1JPJA 1TVMA 1U28A 4PAQA 1D6MA 3K05A 5IKPA 3LWDA 1JPNA 3JQAA 4QXPA 3SYNA 2X76A 5JMPA 1SBHA 4CT5A 3GO4A 4JOCA 3NM4A 1EDOA 3QU7A 3FNFA 4RVOA 1JDVA 5JSHA 3CE9A 4BQSA 5U4XA 3DULA 5HNKA 1FFGA 1Q6YA 1TUBB 1Y7PA 2I22A 3AY3A 3IEUA 2UVPA 3MWFA 5KNDH 3SR3A 3RRYA 3EUFA 2O0LA 1EUCA 2DTEA 1SHJA 2Z4SA 5AI4A 4C5AA 1NRXA 3PHJA 1AMNA 1HZJA 1MAUA 4D25A 1U7TA 3HU3A 4M9CA 1GAXA 3SS9X 3Q11A 1ZS2A 4ZX4A 3NNNA 4F7DA 4JR1A 4POAA 4WJLA 1GIAA 4FYHA 4ND4A 3HLYA 1M6EX 2GAOA 1AD2A 5C7OO 3JQCA 1KDYA 5FPTA 2W8BB 4WASA 3AMVA 2EG9A 4XYGA 2G7MC 3DNFA 3LXMA 3PX3A 3E9QA 2P9TA 2QX6A 4GOJA 4ZTBA 2YW9A 3LC1O 5G3YA 3UIEA 4UE6A 5K8TA 1R9JA 3B2QA 4NLLA 3WJ2A 4MR8A 9GPBA 1XJCA 1YV9A 1NA5A 3LVQE 2ZJZA 1E99A 3IALA 3G5AA 2QI9C 1E6UA 3F97A 4R3WA 1NR7A 2GNPA 4R9RA 4RPKA 3TTVA 1M7BA 4PC2A 4W1QA 3LA6A 3ZIAD 4ND8B 3O4IA 2NAPA 3RCBA 3PVCA 3QBDA 1WDWB 4FWBA 2AK2A 4YECA 2H57A 4GL2A 2Q9BA 4UAJA 4M1OA 3R0IA 4WLOA 4XCQA 4O4LA 4W5RA 1YRWA 1RM4A 4COKA 4RTQA 1KDOA 2FEMA 3RFTA 4ZARA 4AVYA 4LXGA 1PQPA 5C31A 4YMLA 4ZV9A 2O05A 4LBYA 4E6PA 2VNHA 2OHHA 2A9PA 2ZSAA 1Z7YA 2A5YB 4U7HA 3WS7A 3DQQA 1X80A 1OKKA 3F6PA 5EUCA 3LPNA 1PZGA 4IFTA 4QBGB 2QYTA 4NQZA 4UFNA 1TIBA 4FEEA 4MI9A 4C2BA 2F8SA 2YZKA 1RWNA 4QGFA 4G25A 3BFVA 1MQ8B 4KZPA 2XIJA 1A04A 5TMPA 5ENDA 4AYWA 1QWSA 4QNRA 3FPCA 2BGMA 4XPIB 1EX6A 4RJ2A 4XNDA 4GU5A 5DEOA 3ZCXA 4DL9A 2P90A 7YASA 2DQMA 3B1JA 1S8NA 1PX0A 1SIWA 2HV8A 3P9XA 3QVJA 4O2AA 4P82A 2X0EA 3K72B 4G5OA 4WBXC 1D0VA 4IVNA 5ICGA 3RS8A 3D7LA 2R751 4NNPA 4FLMA 5K0CA 4BO3A 3EGWA 3N8IA 1EFDN 3DBIA 4QUOA 1HMYA 4ZEXA 2RDMA 1SR8A 4FJ2A 3NTQA 5FR1A 4P86A 1L8LA 3IDZA 1H4TA 4LECA 2IYAA 5TX7A 3WBKA 2QN3A 3WA7A 3IDAA 4CM7A 4F60A 5I8PA 3SWWA 1WW2A 2J9YB 2LV8A 1YA8A 2AOUB 4WL0A 2I3BA 3ORSA 4FWTA 2YQ5A 1YI1A 4U8GA 3TB6A 4Z1MA 2X5NA 2D6FA 3T52A 3AP1A 3L02A 4WZAA 3RV3A 2C8VA 1VIVA 5T6MA 2H8GA 3KOMA 1PJCA 2EFGA 4RH3A 4H3VA 3EVNA 3FUXA 2J9ZB 1H1DA 1PFKA 3ABIA 3NHPA 3VR2D 2QTAA 2FWIA 2HMAA 1E4OA 1SU4A 2V5UA 1UP7A 2WZCA 1FP6A 2XWSA 2FUG6 2Z57A 3VC7A 3ZTYA 1WQ3A 2P5YA 3OQNA 4P4NA 2G72A 1PGPA 1RKBA 4KI7A 2ZYVX 3RW9A 5K0JA 1A88A 1M72A 1WKVA 5JFOA 1APBA 1UXGA 4BATA 4L27A 1F5SA 1M2OA 2ZS7A 4WXHA 3AB8A 1AT1A 3KR0A 4X00A 3WIDA 4Z4GA 2AX4A 2HK8A 2BMAA 2A5DA 1EPUA 4L8GA 1VYUA 2W58A 2WR8A 3PKIA 5COAA 2FPGA 2GN1A 2ZUTA 5KI6A 3F2IA 1W581 3AINA 1AN9A 1HEYA 2P2LA 1FNDA 3JR3A 4HXYA 3SBOA 1G19A 1UUFA 3CUKA 4CFSA 1IWBB 4EEXA 3K1JA 3JATB 1G98A 1PEDA 2H59A 3OX3A 3WLRA 1ZJ4A 2P4EA 1HZZC 3N7AA 1MHPA 2GUWA 3IVRA 3K5WA 2DR3A 4GPEA 1XLUA 4DR5B 2IHNA 1U2ZA 4G5YA 4YRKA 5IDWA 4EUEA 2FJPA 1CUJA 1F2VA 2ZTVA 3NHFA 1KF0A 1OYYA 2Y1GA 3PQ2A 3O26A 4DR2B 4MWGA 4RD1A 1TQ6A 3ZGZA 4YCSA 1MW2A 4EZBA 1MZVA 2X7HA 1BN7A 1U7OA 1XVVA 3AOEC 4I9UA 2OXCA 2P2YA 3ZIAA 4CKEB 4IY1A 1ICIA 4UDXX 5LOVF 3KQMA 4XVUA 4DLRA 5KX5A 5IJAA 1QGAA 2IYFA 2ECFA 1AGYA 5AXBA 3I6ZA 2MJLA 2ZJ5A 5DXAA 5IKOA 2CXNA 4BQQA 5JI2E 3NPMA 3TQOA 2ZTSA 1NV9A 2Z58A 2VBCA 3CLSD 4Q1BA 3S81A 2V4ZA 5IKEA 1N6RA 5FOVA 1EVYA 2JK0A 5ESWA 5EWJA 4AJPA 2KX7A 2R5NA 5E7MA 4KIJA 1GPLA 4OHCA 1H2FA 3DFZA 4KQEA 2GFQA 4AUKA 3UWSA 1EFRA 3UGJA 1ECBA 1TKRA 4EYSA 4FQ5A 1CU1A 2Y67A 1KY4A 1T8UA 2OAP1 1Q57A 2QP9X 3PFCA 4TM7A 5F3RA 2IYEA 4NEQA 4MRAA 3S2UA 1LW6E 1N8TA 2G6BA 3CJQA 3GUCA 4HUQA 3V8NA 4FSDA 4J4HA 2O7NA 3K8ZA 4WXEA 5CFOA 2BKXA 4DVJA 2Q3LA 2HA3A 4YRPA 2Q8NA 3IUJA 3GVPA 4RJIA 1USWA 5DX0A 2VSNA 2WWXA 2Z8YM 2A0YA 4M60A 4M2LA 4O8CA 4CKWA 1FYWA 4R0MA 1KRHA 2IZ7A 5LQSA 3H1BA 1X74A 2H1LA 3MJVA 1E2KA 1H6AA 3Q9LA 4R0NA 1HE5A 5DTMA 1ZHHA 5TJ9A 4LRQA 1WULS 3INGA 3C2QA 3JQQA 4UCFA 1U8CB 3RKUA 2NP6A 1B14A 1HV8A 4HGNA 2QUJA 5FA8A 4BO1A 2FYTA 3A1NA 1OTXA 3F6BX 5I4IA 1UFKA 1E1KA 3HHEA 1QIJA 2LPMA 4FKBA 3T06B 2COUA 4PRYA 1DT3A 2O23A 3FPJA 1U7HA 2QTTA 3KJQA 1HDOA 3KKOA 2OECA 1YRBA 2UZ1B 2YYAA 2JEYA 3PKZA 4P3NA 3VR2A 5JADA 1JP7A 2FXVA 1QPBA 1E6EA 4BX0A 3CEAA 3P9PA 3FB1A 2BFAA 5K3BA 3PQFA 2WV9A 2BM9A 4TMZA 1DRKA 2HNKA 3PNSA 4A1FA 4JUFA 2VUHB 1FNNA 3QKTA 3K9GA 1VBMA 4OGWA 4ALLA 3OTGA 3LGSA 1BE8A 4M76B 4RJLA 4JSYA 3KZNA 4OQMA 2Q4TA 3BRQA 3JVUA 1OFTA 1QOPB 3G2HA 3RK4A 1U3VA 3GY0A 4IEEA 3CUEF 3PUXA 3R41A 4RA9A 1GR0A 1KMMA 1Z4OA 2R66A 5AIAA 2I87A 3B9PA 5A0TA 3A0RB 2CK3D 1IUKA 3KM0A 2Z43A 4COOA 3ILXA 1U6JA 1GDTA 3MN1A 2XADA 2E55A 4AMZA 2IH2A 1KZ1A 4KWCA 3N2KA 2C2BA 3U44B 3CM0A 4PG4A 5JS8A 1UKCA 1YUMA 2OBFA 2KMLA 3HXTA 4KXQA 5FULA 1ZP6A 1I7PA 1KK1A 2DR0A 2FLVA 3OIYA 2LIVA 4WY2A 1GJRA 2PUCA 5AW3A 5DHSA 3VU8A 3JS5A 4R2IA 4GLJA 3FSGD 3DB2A 3DE3X 2VBGA 1NXVA 2G70A 3PKJA 3PNVA 3H9CA 1CUCA 1T8RA 2KS6A 4WT7A 4YRNA 2AG5A 2NUAA 3TI7A 1P18A 2X41A 1NVEA 1QUFA 1HDYA 2JS7A 4IJ6A 1X7ZB 2OMKA 1SZDA 3HV0A 5KDLA 1TM5E 1ADFA 1WCWA 4OHUA 4BBJA 1KQPA 1B15A 1LBEA 2BE7A 3B2EA 5AXDA 2JI4A 4DIKA 4BP1A 1L5VA 3GUZA 1G8MA 4DMKA 1IN6A 2UVQA 1UBKS 4TROA 3OO1A 4KSCA 4AJJA 2BBTA 1JEJA 2KB0A 3IAUA 4MGIR 4OJTA 3WK8A 4BVGA 5T8KA 1WETA 4DANA 3V00A 2VT3A 3MC1A 5C5EA 4ZVRA 3I3SR 4KGXA 3R3SA 1HE8B 2FSUA 2VDLB 3Q3GE 3WR5A 1DMSA 3NBZC 2CWDA 3PJRA 2W93A 2JFGA 4M49A 3AEUA 3HEMA 1N2BA 1JA1A 4ZOLA 1S4QA 1N6KA 5K0EA 1ZH2A 1UF9A 3CU5A 1XROA 4NV0A 4QJ5A 5JC1A 3WWEA 4OGFA 5ISMA 3RYIB 3I9NA 1FQOA 2A7QA 2O1XA 2Q2QA 4LHEA 3K2EA 4FNMA 4MV8A 3S5UA 2JBAA 5DOZA 1GGJA 3J7TA 3MIIA 5TSDA 3FCXA 2BFDB 3ZNOA 2ZULA 5J4VA 4R54A 5FEUA 1N5LA 2XITA 2J87A 3N7UA 1NVAA 1CNEA 4K1XA 5L3VA 1EXDA 3DBLA 4MQEA 3R76A 5IVDA 3ZY4A 3GZNB 1GPJA 2A59A 4PNEA 3GPCA 1RWQA 4XOUA 5KNCH 5CGQB 3ANLA 3S1AA 6ADHA 1T9GR 1MVOA 3RFUA 3CUVA 3P2IA 5KYWA 3LK7A 4M0LA 3QVVA 2V7QD 1WXDA 4D4HA 3NGXA 1WXWA 3ZQUA 2B7CA 1U8YA 3CNBA 1TADA 1VMKA 3O3CA 4JOQA 1CVLA 2YC2C 3JQRA 4EYQA 3R0ZA 3AFGA 2M6SA 4PONA 2R8YA 4S1VA 2FDRA 2HSGA 1Y8ZA 2AH5A 2BEUB 2YNMD 1B26A 3D8UA 2DUMA 1XDBA 3ONVA 4NMWA 3TLXA 3JYPA 1SVNA 1IN5A 3GK3A 4F0JA 4RPGA 2AOTA 2I4TA 5EE0A 3EOBI 2Y66A 4UHFA 4ZHSA 1DJLA 5B5SA 4DBLE 1HOXA 1B8OA 3TIFA 1NE2A 1QP0A 4AULA 4HF7A 4RA6B 4YT2A 5K01A 2C00A 4ICIA 1IRXA 2FPRA 3WFZA 2JIOA 1P80A 2GCEA 2A94A 3OIFA 4HS4A 3FLEA 2WFMA 4FP9A 4YJHB 4XSHA 3S1LA 3KCNA 1T4CA 4JELA 2OOSA 1OIWA 3FSGA 4Q37A 5GVRA 3IHLA 3P0RA 4FTWA 4UPVA 4FJ1A 4YNBA 1UBSB 1ZNWA 4XIIA 1ZO8A 3C7DB 3W5CA 4HH1A 2G67A 1EJ6A 1U5BB 3O2JA 3QMPA 4J29A 4MEBA 5EKXA 1E79D 1LRJA 2FFRA 4PQEA 3VH3A 1XP5A 1SOVA 3CKMA 4R1QA 2M6RA 4LSWA 5FLEX 2POQX 5I5EA 4Z4QA 3ZVNA 2DKNA 2QKYA 1BGVA 4PX5A 2D7CA 4X54A 3W5SA 4B4KA 2ZUEA 3A6ZA 3FBGA 3STVA 2FSGA 5KVCA 4ZI7B 3DE0X 3KYBA 3BHJA 3OOEA 3PHGA 2Q1XA 4G1EB 4GDMA 4B71A 4B85A 4UXJA 4ON9A 4N76A 4EWLA 1JEEA 3C7TA 1N2ZA 1LB1B 5BSUA 1VSBA 1H85A 2I3ZA 1WUYA 4ZX5A 2HMYB 2IXFA 2VJAA 1G4HA 3AEXA 3GAFA 3KYCA 3KUKA 4RTSA 4ENRA 3H5OA 4XN4A 2P2ZA 3UFBA 2CE2X 3C1OA 1N2HA 3JSXA 3TBFA 2XKKA 1IBRA 4MRVA 5FNVB 2QAJA 4MRMA 1LLUA 3L1JA 1QC5B 1TM2A 1YVPA 3AFIA 1G8GA 2WFZA 3ROTA 1YCHA 4LHWA 3UTDA 1I1QB 4J0KA 4TM8A 3IOBA 4EPTA 3KYDA 2PA3A 3OFVA 3OLXA 1QPGA 5ITWA 5L8VA 1IONA 3CUUA 4DIBA 5EKUA 4JXKA 3A2NA 2VAMA 4P80A 2HNAA 5JR3A 1XTUA 1G6HA 2X7JA 5FPQA 3VA7A 3FUKA 3WLIA 2D1TA 2AMJA 1PLKA 2G7ZA 3ER8A 4CKBA 1GZUA 2FDCA 1W5BA 3IXLA 3R77A 3KALA 2A8YA 5H3LA 5AUPB 1YQXA 2IODA 5H16A 2FW8A 3IR7A 3SZ3A 2C2MA 1T9DA 2OFOA 1K88A 2ZBPA 4JUAA 5JIBA 3QPDA 4L02A 5HR5A 1BD4A 4Z49A 2VO1A 3EGVA 3PA6A 4LY0A 2B7BA 5AI6A 5NULA 3MGKA 4GKBA 4G8JA 3VYVA 2W42A 1RS0A 3M70A 4UHJA 4DNOA 5JAUA 1NZFA 1IQ0A 1I14A 1WB4A 2V1XA 4PLWA 4J4TA 2PGIA 2K7FA 4OGKA 4ZU3A 2Z1MA 2N47A 1JWAB 4TPKA 4RKRA 4MUYA 4HH3C 3RF7A 3AKCA 1DIHA 3PGJA 1YCGA 2C9ZA 2FG7C 3SBXA 2YNMA 3BRSA 1PTJA 4IOJA 2R84A 1K89A 2FTKE 1PW5A 1U3CA 3S2ZA 3CCFA 3WMXA 2WTUA 3ZWQA 1CLEA 3A9RA 3WKCA 5FR2A 2C5EA 4URFA 2GZAA 1M6VB 3NBAA 3C7AA 2OV2A 1F8XA 1YA4A 2WK1A 2HMTA 1E6MA 2XHZA 4RV9A 2MT9A 4TKZA 4WKOA 1TM7E 3R7FA 3UAYA 3ZHUA 1MIHA 4FR2A 4F96A 3INTA 3OMXA 4RBNA 5CNIA 1BS9A 4RZHA 1CF9A 3WL4A 4KL8S 2WV7A 2AC7A 3F7TA 1VE9A 4QWWA 2WT9A 1WW8A 3U7IA 2DB3A 1MVLA 2B35A 1RZ3A 2JKVA 3BG5A 2WFLB 1JLKA 4DR6B 4F7WA 1GITA 4ZJYA 2OOKA 2XIQA 2QYOA 3PXUA 4MNTA 2EFHB 5E4JA 2HFJA 1ZFNA 4D42A 2Y1CA 2BISA 3AVQA 4OI4A 1E79A 1Z7EA 3TQIA 1CTQA 2XUIA 4Q15A 3VHLB 1ETUA 1E3EA 1NUQA 2JAOA 2GD1O 2KJQA 2PKWA 3A6HA 2ZR0A 3KVOA 3NOXA 4JK3A 5DHUA 5BQOA 1ZONA 4JYPA 3SQNA 2ZAMA 3WNZA 1PL8A 4CTMA 2ZVPX 3MT9A 4GYWA 4WOBA 3EBIA 5HFJA 2DJIA 4J1TC 3OEWA 1P77A 1KI4A 2EERA 2WAOA 2BFOA 3NHYA 4BNIA 2BV3A 3SIXA 3H16A 2PZFA 3O75A 3RRZA 3FG9A 1EVKA 2B7LA 2KWIA 4QBFA 3V8MA 3GLFB 1A0OA 1X19A 3KJNA 1M2GA 4L0MA 4Z0TA 3IV6A 4BJ3A 3JAWB 2QXUA 3RC7A 1DIRA 3HFSA 2B83A 3QEAZ 1YDMA 2YZNA 4OYHA 2J48A 2WM8A 2WZGA 2WNSA 4BB0A 4QYTA 1KIMA 2VR1A 1POWA 4HTAA 4IHKA 3S2FA 4D2IA 1C8BA 2Q1UA 3M2PA 3F6SA 2GN4A 4JJAA 1RIFA 4G1UC 4QQKA 4I81A 4LYDA 4ZYZA 4ANFA 5BNZA 3GVXA 4ARCA 4MV5A 1RYBA 2GHTA 5C1OA 4FKMA 4GMFA 2P35A 5CNMA 1CD5A 5NLLA 4CM9A 2DXIA 4DLZA 3MTEA 1G8YA 2A58A 2MIIA 1PGJA 5D01A 2HJ9A 3I3OA 8MHTA 3OWOA 1BFKA 3ZBQA 2XOKD 3F4BA 3PC8A 1ZNZA 2FPMA 3K4HA 4PGHA 1RYHA 5JY6A 4OD0A 1KJNA 2XAAA 5CNJA 1RWMA 1N75A 3I0NA 2QZ9A 4GO1A 5EE5B 4R3NA 1N78A 1SBQA 1VG0B 3EODA 4OHVA 4AD8A 1HI9A 2NTNA 1DQSA 4TQGA 1EFUA 1MQAA 3BL6A 5E9JA 5DM60 2APJA 5HQJA 4DMLA 5ITVA 3QQPA 1KDVA 3RI3A 1VHDA 3O82A 4NAUA 4FDTA 4RF3A 3I61A 4FC6A 3CEPB 3QUSA 3X1WA 1W4ZA 1E61A 2NMVA 4U7JA 1NUAA 1U90A 2FMHA 3GMDA 1A71A 3I6YA 1S2IA 1GP2A 3D7NA 3LQRA 3UG6A 4BYGA 4FC7A 3M6AA 3FDZA 1Q0UA 3RS0A 2TS1A 1CJBA 4A2PA 3ONFA 2AD5A 3DOEA 4FS3A 4ZOBA 4PFKA 2NU9A 3KQTA 5C3UA 3PVZA 4UHKA 5JQGA 1ZOOA 1YZYA 5ADWA 1EDEA 1MJGM 1FNSA 1SQ6A 2DUJA 2DWCA 3M1IA 1UXKA 2NNLD 1VDZA 3DZCA 3UAOA 4C6SA 4ESVA 1F8GA 3ETDA 4AF6A 2R59A 2R00C 3BWMA 1NQ5A 3FVTA 3OT1B 3IQXA 3R3UA 3TSAA 3V7NA 4C0SA 1OREA 2X1VA 3N0WA 4CM4A 1TD1A 2B1RA 1VCHA 3M6LA 1X39A 4PQGA 3ZCVA 4C03A 2UZIR 5K0LA 5LP6A 5BWMA 5CITA 1C1HA 5ECYA 1LVUA 2X5XA 3WGMA 1GAWA 3DE4X 4X94A 2RCNA 2WINI 4HQNA 4HZUB 1ZINA 1NG9A 4YREA 2QJFA 3SZRA 1G64A 1Z33A 3NIDB 2BFCB 2HYDA 3ZV3A 5JRJA 4OA5A 4RULA 2IQIA 3KSBC 1T0JB 2XB2A 1DAPA 2QN1A 1RXIA 4PSKA 4WN3A 2R65A 1KVQA 4I1PA 1P2BA 6NULA 1I94B 1D2RA 1CYDA 1VKOA 4YWHA 3DEZA 5HUQA 1V7CA 4OHWA 3A2MA 3SDBA 4EJMA 3PFFA 5A4MS 2N1MA 4D5EA 3I34X 5C3MA 3B48A 4F93B 3FDXA 2QUAA 1Z8DA 3DO6A 1GZ7A 1JVNA 4QU5A 3MUOA 1M2JA 1Z8HA 4Q0MA 2AYXA 1U9JA 4RZIA 4CIBA 4CIAA 2UDPA 3PXBA 2VAWA 2VHZA 5U9CA 1PJQA 4D8YA 1ODTC 2AG6A 2ISSD 2KLHA 3E27A 3O38A 5F7JA 5HZKA 2IS1A 5ALHA 3EZNA 4Y2YA 4Q3LA 1UJMA 1AGXA 1NW7A 1OIXA 1KK2A 1XEAA 3EXHC 5AT1A 4MUFA 1EJ2A 3JQ8A 4QNMA 2CMGA 3QU9A 4BZPA 2WVGA 3RSHA 1RFLA 5E6RB 2C83A 4POOA 3K16A 5LBIA 2XTAA 4G5GA 3QZUA 3OM9A 4GPTA 4K88A 5FOUA 3WLSA 4BNXA 4URXR 3UMRA 4G65A 1T6YA 4RL4A 2WUGA 2HUNA 2IIQA 3NTVA 3LVBA 1ZXXA 4KXXA 1NXPA 3FJOA 1N4DA 3D8HA 4RX1A 3FAKA 4O4JF 4ZO8A 2A84A 5HKOA 5FOWA 3LCCA 1VBFA 4R7TA 5I7EA 5ALQA 2XTJA 3C70A 2QTVB 3GOQA 2POCA 2B92A 1DEAA 1H1LA 2XOKA 3E0QA 3IH5A 3WGZA 1RQRA 2GA8A 2IY9A 1NJ8A 2Y27A 4YJKA 3ZCQA 5JISA 1HPLA 3SX2A 1Q3HA 2PT9A 1UBCA 2P91A 3UMMA 2IZ6A 3DA8A 4DNQA 1OX4B 1W25A 1HSOA 3MLBA 3BWVA 2GI4A 1O77A 4JDPA 4PINA 2X5OA 3KHTA 3HB5X 1I2DA 3T7RA 4BE9A 4LMAA 4X1IA 3SM9A 3HA3A 3T1OA 3LT4A 1HGXA 2W6NA 2ZAOA 4PCUA 4CM8A 5KJ1A 3UMFA 1H4QA 3VQTA 3RFVA 1YR7A 1EG2A 4R1OA 2OM6A 4WLUA 5B6JA 2WF7A 3ED1A 1YU6A 1P0QA 1TU3A 1S8AA 3UGKA 3GH1A 1T29A 3LPLA 2OBLA 5CR9A 4GMDA 3R8CA 3ND5A 3TWOA 5BUCA 7AT1A 4J3BA 2J30A 5IKMA 2VQFB 2QUZA 4DPMA 2L2QA 4E1VA 4CTJA 4B3SB 3W1VA 3K35A 2CB0A 2NZ2A 3OFKA 1WBDA 3B3BA 4C76A 3R0QA 1KO1A 3E61A 3ZVRA 3EWNA 4KIGA 1NUPA 3TSOA 1MJNA 3ZU5A 2N1BA 3WSVA 1ST3A 2V6GA 4X1YB 1M2KA 4K81B 4ZCPA 2NGRA 1W9MA 2PZEA 4A0FA 5KTOA 1JFSA 4C6RA 1SIUA 3UWKA 3DHEA 3GFBA 4H17A 3HGTA 1N9KA 2JCYA 1UEJA 2GLUA 3GFQA 4RPCA 2BBWA 3V7FA 3NDBB 1TMOA 5B12A 3K0FA 2MWMA 4MWEA 4GPZA 3CKLA 4MPJA 4PNPA 2OBNA 1J1ZA 2VHTA 4KQMA 4JY7A 4QDOA 3E9ZA 4Y1EA 3T38A 3TQQA 4ENUA 1L8OA 4CLRB 2R4QA 2PTHA 3JVEA 2YMQA 1CUVA 1YKSA 5BSEA 1E7MA 3LL7A 2C5BA 1TPYA 2HWXA 4RK7A 3ZLVA 3P20A 1D09A 1QQ7A 2LD4A 3H3FA 3IAFA 3O7WA 4G97A 2QW8A 2OB1A 1TLFA 5LSAA 5FTKA 1E7YA 2FQYA 4NPAA 3UJHA 4L6IA 4E51A 5MGNA 5CEFA 5G02A 4YMSA 1TK9A 1Y5NA 1Z3CA 2O5RA 1Z0DA 3DV2A 2EKBA 3NHJA 5AHWA 4YRZA 4B81A 1J07A 1TYCA 3C14C 5FO1A 2OYSA 1M34E 4WWHA 1U1CA 4JBWA 3QHPA 1GUFA 4B7AA 1N92A 4FX2A 1R3DA 4ZOEA 2QNIA 5EIFA 4A0GA 1LC0A 4E5MA 2YDXA 4HZIA 2JFUA 1BWPA 4BX9A 3I4LA 4HGPA 2BMJA 4Y1RB 1P7WA 3IE1A 4P3OA 2C1ZA 5IH3A 3ASZA 4X63A 1USIA 3CXUA 1J9EA 2GAFA 2H8KA 4ESHA 2ZZNA 1FP7A 3UV7A 3ZWKA 4UHEA 4GZ6A 2FPKA 1ZK0A 4NYJQ 3RBXA 3W5VA 3WLTA 1ZM3A 4D96A 1J97A 1JR4A 3ZGNA 3V9PA 1CV2A 1U8EA 3H7IA 3HBNA 4YRMA 4ZXPA 3IQGX 2I6UA 5I6DA 3AVTA 5AI5A 2QJWA 2UYCA 3T7SA 3I09A 1CB0A 1UOQA 2LWIA 2C9YA 3A9TA 4KDRA 5GZ6A 3W2FA 2HCBA 2QP3A 3P4UA 4DG9A 3ORFA 3HYRA 3UJCA 1U3DA 2WJIA 3E1GA 3LY9A 3REQA 1L4FA 5D85A 3VYUB 1KJQA 3CN7A 3H4IA 2YKGA 3B7TA 3AFMA 3KDPA 2FMFA 2OGWA 5B58C 3A8TA 3HS3A 1Z38A 4AMGA 4G5RA 3GEHA 5C52B 4K2AA 1QKKA 5CHEA 1YIAA 1OT5A 3AEKA 3BX1A 4M0FA 1MRNA 3CPSA 3RV4A 3Q6IA 5FL7D 4GP7A 3VNAA 2J09A 1B42A 1NQAO 3EFOB 5E1BA 1MMFB 2ZUUA 3VR4D 2FFAA 4YAGA 4QC2A 1PT6A 4X20A 2B36A 2JGLA 4R1LA 3WL7A 3QXSA 1ZVKA 2ZM5A 1BX1A 3TTUA 3JSZA 2YV1A 5GTDA 5K5EA 2CNBA 2PIAA 1QVWA 3DJYA 3ZH9B 4EFNA 4W9RA 2GBFA 2RI6A 4LHXA 3KVNA 3TLZA 5DP1A 1O95D 2HK6A 3A9VA 1JR6A 4ID3A 2GBGA 2QVBA 1PYGA 4PBRA 4RH0A 1Z4IA 2D0IA 4IX1A 4WNIA 5K3CA 2F8MA 2O2DA 4MV1A 3AUYA 4G23A 1V3UA 2I76A 4ARAA 5HJ5A 3IBTA 1TJ3A 2HF7A 4MVXA 1AE1A 3BD9A 5FQOA 3AP3A 4C0HA 1P3JA 1WCIB 3N87A 5F51A 5A3QA 3GFTA 3DE7X 1VQ1A 2AJLI 1Y9AA 3OJCA 2LKCA 2Q9CA 2TMKA 4OU4A 3AETA 4JC0A 4Q34A 2H29A 4XJXA 1MA3A 3V1TC 4QT0A 3GVHA 4ENSA 1H3LA 3CLRD 4UDNA 1ULSA 2CZCA 5JATA 3BBPA 4OB7A 4QIRA 5E2BA 4KYIB 4TXJA 1KSHA 1G17A 5LP1A 1JYSA 4NENA 1PF7E 1DJOA 1GZ4A 1KFJB 3BHMA 1DLIA 3W8EA 4NHOA 3C15C 3NOQA 3MELA 4NMLA 4P0QB 1UPTA 5ED4A 2NZWA 1K9VF 1Q11A 1T13A 1EA7A 3H2YA 4OSOA 3DPIA 4E2XA 5C34B 1HUQA 1QRAA 1ZKMA 4C88A 3P4YA 1VG1A 3IUEA 5IFKA 5LIPA 3OG9A 4ND2A 3FVVA 3LAWA 5HBRA 3KEGA 3FUNA 1ODKA 1YZQA 3ZWPA 1MP0A 2YHUA 3PI6A 3KKLA 4GKAA 3REFA 4UNSA 3PEYA 3PK0A 4HR7A 2WYHA 4EI9A 1QIKA 4P5PA 3GWGA 5JDIC 3D2CA 2IHUA 3TLCA 3GLQA 2X86A 2Y77A 4BVHA 3UV3A 2O2XA 4ALNA 1KDRA 2P2CA 3E7XA 2NVUB 2P6UA 4ZZ3A 1FMTA 2ILVA 1ODFA 1QMPA 4OSPA 3VPGA 2P5TB 2QW1A 2ECQA 4UEJA 5CMLA 3OQBA 3PPXA 3DAYA 3IRUA 4REOA 2HK7A 1VGRA 1WTCA 4IIDA 4XYLA 1OR7A 2E82A 2W2LD 3VPSA 1HA3A 3B8EA 1RYZA 1UBRS 2GAAA 1WVMA 3E9RA 4ETMA 2I1VB 2OLEA 5AHKA 1C29B 1C9KA 5L3QA 4DMHA 1XZ8A 2BGIA 3G2KA 2JAQA 1ORIA 2G25A 1KYWA 4KJXA 3BCHA 2D5IA 1J22A 1YI0A 4UATA 3A1CA 2O0HA 3DVLA 3I73A 1D9ZA 3PFHA 5AENA 1UDWA 8ABPA 3C3XA 1MG5A 2OGSA 3O90A 5FL7A