1R0KA

Crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
386
structure length
380
Chain Sequence
b'SQPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIADPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTVALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPFRTTSLAEMATVTPERAVQGAKISIDSATMMNKGLELIEAFHLFQIPLEKFEILVHPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAPDYERFPALTLAMESIKSGGARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPATPSSLEDVFAIDNEARIQAAALMESLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
molecule tags Oxidoreductase
source organism Zymomonas mobilis
publication title Crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from Zymomonas mobilis at 1.9-A resolution.
pubmed doi rcsb
total genus 126
structure length 380
sequence length 386
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2003-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1r0kA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1r0kA01
3HB4X 2BD0A 3T7CA 5ITWA 5I8ZA 4D79A 2H1SA 3DZFA 4NU6A 3BA1A 1H9BA 2JD2A 1O89A 4CL3A 4PLVA 2Q46A 4OMUA 2Y1CA 1VI2A 4BO4A 2QW8A 3PPIA 4OL9A 3QHAA 3Q9UA 2Y05A 1RM3A 3AY7A 1MC4A 3IJRA 2I67A 4PLZA 2CMDA 1PS8A 5A9SA 2VYNA 1Y8RA 3HN7A 1ENZA 4Q3CA 1XGKA 4LVCA 4RLHA 2ZB3A 3U49A 1XYGA 2AG8A 1ZSNA 3DTTA 1JKFA 3AUTA 1XLTA 2HU2A 3W8DA 1ENPA 4WCFB 4A03A 1U7TA 3L4BC 3C7AA 5L4LA 3MJVA 2VTDA 4HFJA 2IXAA 3DB2A 4E12A 1ZBQA 4XYBA 2AQIA 2JHFA 5JMPA 2J5QA 4KUGA 1IOLA 4IXTA 3OIGA 2WTBA 4L8VA 4FLSA 1DC4A 3GDFA 3TFQA 1TA4A 2AA3A 2IZ1A 1LLDA 2OBNA 4IDAA 2H5LA 1D1SA 4XA8A 1E1MA 1HKUA 2H63A 1YQGA 4OOFA 2J3HA 4TRMA 4E32A 5TRTA 1DO8A 2UUOA 5K9ZA 3L6DA 3MZ0A 3MJCA 4ZQFA 4AJ4A 1DC6A 1NX6A 4JIGA 5U9CA 1I33A 4BMNA 5IZCC 4ZN6A 3BMQB 1O9BA 4U8GA 3UICA 8LDHA 1EMDA 3HFSA 1E77A 1RKXA 3GPDG 2YUTA 3CZKA 2WD7A 3GH3A 4G81A 3WYEA 2ZQYA 1E3LA 1KBZA 4I8XA 1PS0A 1HTBA 4D44A 4WCFA 3NTRA 4ZQHA 3I9OA 2VWHA 1T1SA 2X0RA 2Z1MA 2YZ7A 5T5QA 1HL3A 2P5YA 3QW2A 2E49A 2WMDA 4RZHA 4Q3DA 3UCXA 1T24A 4BNUA 3SVTA 3DMTA 3OA2A 4KQXA 4AJOA 4CL8A 2C5AA 3WTCA 2GD1O 3E8XA 2C2YA 2V7PA 3G1TA 1LDYA 1B15A 3WLEA 4EEXA 1MB4A 4ZRMA 1BXGB 1U2DA 4R1SA 1HWYA 4BO5A 4E2ZA 4E5PA 3U4IA 3NEPX 1YDWA 1GV0A 3FNGA 1NP3A 4MP3A 5JS6A 1TT7A 3OSUA 3UUWA 4XRGA 2XAAA 3PHGA 4CM3A 1NHGA 1R4NB 2Q1SA 4WGGA 5CDSA 2E82A 4B7CA 3I52A 1VM6A 4CLOB 3OBBA 1K2WA 2O7QA 1GUZA 3VC7A 3RFTA 2B83A 1NR7A 1H6BA 1VLLA 1LLCA 2JFGA 1H9AA 1MXHA 2XXBA 3O9ZA 4HUJA 3AW9A 4JGBA 5C5IA 1ENOA 1LRJA 2D0IA 4U0KA 2FOIA 4FQ8A 4H16A 4ZU3A 5B12A 1OZAA 1ZKMA 3JD4A 2EXXA 4J1SA 2J3KA 1FF9A 3NTOA 1ZMOA 4MKZA 2ET6A 4GX2A 4YXFA 4IDEA 1XQ1A 4XRRA 4KP7A 3V8BA 3PYLA 1JGIA 3KYCA 3ZWNA 2P9GA 4LMRA 1KS9A 4RF5A 1DSSG 1P44A 5DDIP 4M86A 5A5EA 3CEAA 1J49A 3MJEA 1EVIA 1F06A 5G2OA 4BNKA 1SPXA 1ARZA 3F6YA 3V1UA 4MO2A 1IB6A 3ZHXA 1NQOA 1C0PA 2FR8A 1QSGA 2JJYA 1X0VA 2X58A 4G65A 1OMOA 4YR9A 2F00A 1V3UA 2GDZA 1IYZA 4JJIA 3PQFA 2O7GA 3RKUA 2GRAA 5HS6A 3A28A 2PR2A 5FEUA 5JBIA 3WQQA 1E1KA 3ONEA 1ADGA 3TOXA 4PVCA 2AXQA 2HMWA 4D3SA 1YVEI 1EVZA 3VKUA 1ZEMA 1P1FA 4IXWA 4Y67A 1N7GA 5CP8A 3WGYA 1ZFNA 3SXPA 5G0VA 3GF4A 4WNIA 3RROA 5T67A 5I9LA 1LEHA 1NPTO 4JX8A 2FR0A 1H6DA 3SEFA 1T4BA 3E82A 1O0SA 2W4QA 1ZSVA 2Y0EA 3BMCB 3DBHB 4I9UA 1H6CA 1E5LA 3MWEB 3CUKA 1B8VA 2DUUA 3H9GA 4UUPA 5DCWA 3BHIA 4RPGA 1A7KA 4S1VA 3RSHA 2HRBA 3OQ1A 1ZH8A 1R15A 5JAZA 2X22A 1Q2XA 2CDAA 2E37A 2WYVA 3C85A 5I8WA 1ZS2A 3KLPX 4NQZA 5JDCC 4D41A 2WM3A 5JYEA 4J4HA 4Z9FA 4ZQGA 1X1TA 4DQXA 4DYVA 1GCUA 1V3VA 2FSVA 4YCAA 4D0RA 3JQGB 1YB5A 2X5JO 5BNFA 4GX0A 4GBJA 4C7JA 3RC7A 3QV1A 1XG5A 3GDGA 3GAZA 3E1KA 3CZEA 4LK3A 1LC0A 1LTHR 1ADBA 5JAMA 1LDNA 2UDPA 4CV2A 1NFQA 5EERA 4IMRA 1OI7A 3COSA 4M87A 3H9UA 3DZKA 4TVOA 5ES3A 4FBGA 4CQLA 4KTVE 5EQFA 2HO5A 3ZNQA 3ENNA 3RFVA 5BT9A 5CAEA 1IE3A 4R3WA 1B3RA 3E6AA 3HQ4O 4LRTB 1V9LA 3HDQA 4MP6A 4WNCA 3FTNA 1PIWA 3W6UA 4O5OA 3DHNA 5DT9A 1E6UA 1GPJA 2VOJA 1NM5A 3HWRA 4LMPA 4R51A 4ESOA 1YL5A 2DKNA 5IDQA 3R3JA 2OP0A 1LI4A 2GR9A 3C3XA 5IJZA 2IEDA 2PD3A 4INAA 4I5GA 4RPJA 3N7UA 1JA9A 2EEZA 1T26A 3FR8A 5BNIA 1ZEJA 3INGA 3IQDB 1SNYA 1J0XO 3ZH2A 4ZHSA 3PI7A 1A4IA 2DTEA 1EDZA 3PYMA 5A06A 5JE8A 1JAYA 2CDCA 5KNLA 3I6QA 1ENYA 1YO6A 3ZWAA 4EJ6A 4QFDA 1I3LA 3PHIA 2QZ9A 1U8FO 3BMCA 3DBHA 1X7HA 3K92A 4TZTA 4RVDA 5H81A 1KETA 1V6AA 5JDIA 3HB5X 5IN4A 4O59O 1JAXA 1U4OA 1D1TA 1C0KA 1SO8A 1AGNA 2CD9A 4D3DA 5CEFA 1UUFA 2OBYA 4E2WA 3F5QA 2JD1A 2DTXA 2BMAA 4PRLA 2J5RA 5I7FA 3JQGA 1P9LA 3HJAA 4B79A 5GZ1A 3PHLA 3MEQA 3BMQA 3Q6IA 5HRUA 2R2GA 4KDEA 3H3JA 4P22A 1E7YA 4A73A 4HY3A 1X1EA 1EQUA 4RVGA 1K6JA 3GNSA 4TROA 5CG1A 4MKXA 2W2LA 4MINA 3PLNA 4I9NA 1Q0HA 1FDWA 4B8ZA 3H3FA 2BH9A 2Q50A 3WGZA 1NQ5A 3GZNA 5JSFA 1P1RA 4WLOA 2J6IA 3MJSA 2QX7A 4BNMA 5F21A 3FBGA 4MVJE 5IXSA 2GCGA 1QMGA 3TFOA 5FWNA 4NFYA 4ALIA 3RASA 3GR6A 3S2GA 4NK5A 3A06A 2GPTA 3RJ9A 3HDYA 3L9XA 4Q3BA 1PL7A 3GVHA 1IUKA 3O26A 4OAQA 5TF4A 2GN4A 3VZQA 3DZGA 3EGOA 2Q49A 3KSUA 3JYLA 3ROQA 1JVBA 3VPXA 3MOIA 2Y0CA 2I66A 3WWZA 1PGJA 4XR4A 3WR5A 2R00C 3CKYA 4BO2A 3OP4A 4Y6SA 2A92A 4CMIB 2D5AA 3Q2KA 4CR6A 4WJZA 3DOCA 3V1TC 3UCEA 3CH6A 2HMTA 4NG5A 1A71A 1GDHA 2X23A 4B4WA 4YAKA 4XZ3A 1MP0A 5KVCA 1DBVO 4E30A 2AEFA 3C8MA 1DIBA 4AJLA 1RP3A 1JTVA 1VJ1A 1IULA 3IUSA 4PG6A 3ONDA 3JTMA 1VJ0A 3K31A 4HXYA 4LSWA 4YT4A 1U3UA 2CF6A 4UVGA 4JJFA 5FFFA 3WNQA 5BR7A 3PHJA 3KO8A 5TS3A 5TC4A 2EW8A 3LC2O 4CUZA 3CZLA 4O63O 1GCOA 4IGEA 2DPHA 3LT4A 4OKIA 4RF3A 5DCUA 4AJIA 5BNTA 1WMAA 3LLSA 3IKVA 1PJBA 4IS3A 4OSPA 1B2LA 3T4EA 1B3BA 3S2IA 2PLAA 3DTYA 1G1AA 4AG3A 4CQLB 5B37A 4YWJA 5KJEA 4L4SA 1YGYA 1KEVA 3WMWA 4YT2A 3WIEA 1LRKA 1Q7CA 3CMCO 4WUVA 2NLOA 4PG7A 4ALMA 1VSVA 1CQJA 5IDXA 1NPDA 4N54A 2FSSA 3UGKA 2OORA 5EMHA 3BXXA 2CNBA 3RFXA 3P5SA 1XKQA 2DBRA 3PXXA 4WOJA 5F1KA 3VH3A 3ZNPA 4UEJA 3GUCA 2E48A 3RVDA 1SBYA 1RYEA 1ZK3A 1PSDA 3AM3A 2JD0A 3WGQA 3F5SA 4BS9A 3DZHA 5KWEA 2BGKA 2PZJA 4HFMA 4IJWA 4Q39A 5JFOA 2IXBA 1NWHA 2CFCA 4CMKA 4DRYA 3LSYA 2D5CA 2EHDA 3CXRA 1N9GA 1KVRA 1EEHA 2NTJA 4KWIA 4R1TA 4WLNA 3LU1A 4YT5A 3V2HA 3ZWPA 1U5CA 1CERA 3RUIA 3QWIA 2D8AA 5GY7A 1KC1A 5TT1A 4WLUA 4AICA 1IPFA 4BGEA 2BFMA 3AM4A 1H3LA 3NGLA 7MDHA 2FN7A 4BO8A 2DM6A 5L9AA 2EERA 3JD0A 2ZQZA 1T2DA 3QVWA 4CM4A 3EW7A 1WXDA 3WBBA 4PG8A 1LLUA 1WP4A 1Z82A 3DXFA 5A3JA 4UVEA 1P77A 2QZZA 3PQEA 1PJSA 3CTMA 3QA9A 3QIVA 3QVSA 3QVOA 1MLDA 4FB5A 4HNGA 3SJ7A 4PLTA 1MUUA 3ZV4A 2OOSA 1YOVA 3IIEA 4DWVA 5A1TA 2NU6A 3LT2A 3E48A 2P4HX 1PJLA 1PZEA 3FRJA 3KXDA 1E3JA 4BHTA 4DXHA 2Z5LA 3NGXA 1NHWA 3G0OA 3PVZA 1LDBA 1WZIA 1XQ6A 4S3MA 1G0NA 1UXKA 3EYWA 3HZZA 1CIVA 1JKIA 5JC1A 2ZYGA 3DBLA 3GC6A 4UVDA 4FN4A 3QQPA 2Q4BA 4NFSA 3FR7A 5TX7A 1E7SA 2SCUA 3NJ8A 1UP4A 3VH1A 2GYYA 2X6TA 4ZJUA 3AU9A 1CDOA 3GK3A 1D3AA 3LVFO 3SLKA 2PV7A 2O3TA 1PJCA 4NBRA 1ZJZA 3U4HA 2RHRA 3EVTA 5B4UA 1E7QA 1UZNA 1XHLA 4AJKA 5K6AC 3R1IA 3O38A 2BFPA 2NU9A 5CPBA 4HFRA 4YRDA 2ZB8A 5G4LA 2DQ4A 4B7UA 2VT2A 4R4JA 4NI5A 4XDYA 4BOYA 4IIVA 1DAPA 4FS3A 3NDRA 1HDZA 4UUOA 3WOHA 4UREA 1HXHA 1AXGA 4G5HA 4EYEA 3F4LA 2EG9A 1IL0A 4Z9XA 3PJEA 2VRCA 2DAPA 3GGOA 4URFA 4IDGA 2GN6A 4U6QA 4IIUA 3LC7O 3F9IA 3PQDA 5TSDA 3ST7A 5CEJA 5I9NA 3LQFA 4R68A 2O7SA 4LRSB 1EVJA 4FC7A 1AHHA 3NX4A 5FF9A 3TWOA 3VZSA 1ORRA 1XU9A 4J6FA 1LSUA 3AUAA 4YQYA 2C29D 1GD1O 6ADHA 4CMAA 4EGFA 3EK2A 2EWMA 4PLPA 1ZO8A 4BL5A 3Q3CA 1VKOA 3A4VA 3UCFA 4BNXA 3JQ7B 1P0FA 4FFNA 1YS4A 4FJ1A 3K9QO 1XU7A 4JBHA 4P4GA 5CEEA 1LNQA 3I9KA 4JK3A 1HE3A 4BNWA 4RO0A 4I1IA 1I2BA 1CJCA 3ASVA 1S7CA 4GLLA 4JN6B 4MVJA 2Y1EA 1KEUA 1EFKA 4IINA 4GI2A 5IDYA 1KIFA 4B3HA 2FR1A 3FPLA 4D43A 1WAMA 3PHHA 4YA6A 3NTQA 4P8RA 3KZVA 3UHAA 3ZW9A 1ULSA 1B0AA 2BGLA 2YDXA 2GN9A 3DBLB 2Z1NA 1QKIA 1WLYA 3GZ4A 4IGFA 4W9NA 1GYRA 1I24A 1ZK2A 5CHEA 4IDBA 2XF8A 4R69A 4N5LA 5KKCA 4F6LA 3K6JA 1BWSA 1Z7BA 2R00A 4CM6A 2EF1A 4QECA 3S2FA 3VOSA 2ZTMA 1F14A 2ZTUA 1JDJA 1I3NA 1O8CA 3CMMA 2Y93A 3RQSA 1Y81A 4J1QA 1VJTA 5HA5A 2OL4A 1KYQA 3G3EA 2QRLA 3GRPA 1ONNA 4ALNA 5DBIA 5H83A 2RBEA 1HETA 2EJVA 3DDNA 5DCYA 1KC3A 4DPKA 1HF3A 3S1LA 4E5MA 2Q4EA 4Y6PA 2IE0A 3JYOA 3INRA 3IS3A 1DEHA 3KYBA 3VPFA 5A5FA 1VSUA 4NBTA 3IMFA 5HBRA 4UULA 3KUXA 3E9MA 3TJRA 5B4VA 4U0JA 1IHXA 4NBWA 4CM8A 5AXCA 3AWDA 3ANLA 2ZCUA 1PL6A 2WE8A 3WIDA 3KOUA 2UYYA 5KVQA 4WCDA 3F3SA 4ONEA 4YJGA 1DOHA 3RI3A 4K28A 3WGTA 2NUAA 1RM0A 2J5KA 4OXNA 4HNHA 4DPLA 1EZ4A 1KY4A 4D45A 4DLBA 3P7MA 3HN2A 3DHEA 1HE2A 4A0SA 1YKFA 3DBRA 3D64A 1GTMA 3ZZNA 3ZWBA 1M66A 1U28A 1DLIA 1OBFO 3AY6A 4TMFA 5TGDA 5T57A 4R9SA 2YYYA 3E5MA 4DTIA 1NVTA 2PH5A 4QSMA 1R6DA 4CV3A 1BDMA 2G0TA 3LDHA 3OMLA 3RUDA 4W7IA 2O3QA 4QXMA 3V2GA 4BNTA 4CQMB 1EBFA 1UH5A 1DHTA 1MX3A 4DC1A 2VUTA 3RU7A 4BO6A 3L07A 4IBOA 4O1MA 3TOZA 1M6WA 2AQ8A 3GUYA 5L95A 2X9VA 2X9NA 3HHPA 3DOJA 4GGOA 3WB9A 3WFJA 3ZU3A 3FTPA 1A27A 4EUEA 2W2KA 4Z0HO 3KEOA 2YFQA 2B4TO 5KKAA 4F6CA 4KQWA 2X0NA 1PZFA 3DBVO 1GYQA 1CRWG 1QLHA 1X15A 4MVJM 4BQRA 4BKOA 3DWFA 4NPCA 2B69A 4CLHA 1Z45A 2BELA 1WDKA 3ADOA 2IYPA 5F3RA 4BO3A 3BTUA 1UJMA 4R16A 3RD5A 4YAJA 3VH4A 3OIDA 5TIIA 4MVJI 1KVSA 3FCOA 2Y1DA 4U7WA 5JO9A 4TRRA 5COAA 3RC9A 2HK7A 5EJ2A 4DQVA 5T64A 1I30A 1SAYA 3AFNA 3NDIA 2JFHA 3JYNA 4W4TA 1BMDA 3GMSA 2J8ZA 4E13A 1DRWA 1I0ZA 4DBZA 4BO0A 4RCVA 5MGBA 1XA0A 5TQVA 1J4AA 1FDTA 3ITDA 2O50A 3JQCA 4J16A 3C7DB 4OSOA 2FPIA 3H8VA 1I32A 2O2YA 3WQRA 1SC6A 3AM5A 2JKVA 1Y1PA 1H93A 1PJ4A 1DFHA 1LX6A 1V8BA 1YOVB 2A35A 4GQAA 4YDRA 2WEKA 3DHYA 3IOYA 3KBOA 4J7CA 3QWHA 2P68A 2HJSA 2UAGA 2OP1A 3AI2A 2GSDA 3I9MA 3ON5A 4DLAA 3DZIA 2WD7B 1JWAB 3FHLA 4IZIA 3NT2A 4IJKA 4C4OA 3OECA 3PGXA 3JD3A 4XQGA 4KOAA 2GERA 2QYSA 4ZGWA 1JLLA 2B37A 1BSVA 3L6OO 5DF1A 4GPD1 1NFFA 1E3SA 2VWQA 4TSKA 4DGSA 4IM7A 2I3AA 1YONA 1O95A 4L75A 3KRTA 3VH2A 5JLAA 4XYGA 1T25A 1TEHA 4LUPA 4BMVA 1R0SA 2I65A 1V0JA 4HBGA 4E3ZA 1HDYA 3K2BA 4IQ8A 1XDWA 3FPCA 2I5PO 3AI1A 5DOZA 4CMIA 4BKUA 1QYXA 3M2PA 1B14A 3TZCA 1EE2A 3AU8A 4RPHA 2PD6A 3BTSA 1U4SA 4FDAA 1KVQA 3I3OA 4DREA 4J43A 4BV8A 4DPMA 4M1QA 4AFNA 4CM9D 3VDRA 3JQAD 5I7VA 1DRVA 3NV9A 1E3WB 3GVPA 2B0JA 4RVSA 1WWKA 4BNZA 3ZWOA 2VN8A 3JQBC 2Q45A 3GQVA 1EUCA 4IQGA 1QYWA 2Y1FA 2IRWA 4AL4A 2EIHA 3TZQA 2VHXA 3EDMA 1LU9A 1ZXLA 3ICPA 4M49A 4PVDA 3GVCA 3OJOA 1RWBA 4W7HA 2QIOA 1UAYA 2LDBA 3MJTA 4DYDA 5L51A 1U5AA 1P74A 3VZPA 2UUPA 4WLEA 4D0SA 4CPDA 4II3A 4CM7A 1T4DA 2HMUA 2VRCD 1HSOA 2YV3A 3ZI0A 3GPIA 4GX5A 4NBVA 3PJDA 3K96A 1Y8QA 2O2SA 3LZ6A 4J9UE 2X9GA 1FDSA 3ZWYA 3S2EA 3JYQA 3WJAA 3P19A 3ETDA 4CLOA 4AJPA 1PJQA 3NDJA 1Y9EA 3TQHA 2LDXA 4W6ZA 4CMEA 4KMSA 1QR6A 1GUFA 4MVJF 2OXIA 4CR8A 1OOEA 5JNLA 5DZSA 2HDHA 3N74A 5L3ZA 4A5OA 3NT5A 5MDHA 4BB5A 1A72A 4KTTE 4ZVVA 4B4UA 1VL8A 2NQ8A 1NFRA 1LRLA 2PD4A 5DNAA 1TI7A 3KB6A 4FSHA 1SEPA 5ER9A 5JCJD 4CM5A 4P4NA 2PZKA 3PK0A 2BGMA 1RPNA 3I23A 4FOOA 4CJXA 2HK8A 2OFPA 2PKRA 3GRKA 3H9QA 4J2HA 4WOKA 4EEZA 1PWXA 1GPDG 3R3SA 4RLSA 4XX0A 5EESA 4RVFA 3ZWWA 3SLGA 3WJ7A 4PLFA 1UZMA 1YQDA 1CF2O 2PWZA 5A05A 3ZN2A 3PDJA 3G49A 4IDFA 1HSZA 1HE5A 3NT4A 5G0SA 1GYPA 3ZV6A 1Y8QB 4E4YA 4I5FA 4N7RA 4OJNA 5JPIA 4RGBA 3RKRA 1D8AA 5C3MA 4N5NA 1KOLA 3GEGA 3JQEA 3DONA 2VUUA 1OC4A 3D4PA 3X2EA 1ZJYA 1L7EA 1MW1A 5G4KA 1HYGA 5B1YA 2AE2A 4HP8A 2EP5A 1E3WA 1I36A 5HWSA 2CVOA 2NWQA 4PFJA 3FD8A 5KVSA 5L45A 2CUKA 3I5MA 4NZ9A 3ETGA 1FDVA 1R0LA 4DUPA 1OAAA 4NU5A 1P1HA 3GFGA 2VYVD 4MVJD 4LN1A 1LQTA 1ID1A 2GLXA 4FD3A 4E2XA 1G0OA 3AUUA 1DJNA 1LA2A 2YFHA 4ZD6A 3P2YA 1K5HA 4DLLA 5T6BA 2VT3A 5L53A 3GMDA 1JG9A 3PGJA 5B4TA 4IJUA 1OC2A 5I7EA 1QRRA 2VHWA 2VTEA 2PGDA 1Z73A 4D46A 5K0ZA 1YB1A 3PIDA 1LLQA 1ZNQO 2O3JA 1Z74A 3UXYA 3KLMX 3QLJA 3RBZA 2BHLA 3JQ9C 4FCCA 1P1JA 2GNAA 2C7GA 2NM0A 1Y6JA 4OM8A 1U3WA 3GN1A 2D2IA 1XR3A 4U6SA 4UEOA 4ALLA 4UVIA 4TZKA 1ISMA 3RUEA 1BTOA 1N1GA 2FWMX 4LCEA 2PGLA 3PTZA 5JYDA 1GZ6A 4BNGA 4XQ9A 3W4KA 3MTJA 3CIFA 5L7YA 1MV8A 3JCZA 4TKMA 4CLEA 5BQFA 1LSSA 1Y5RA 4AJNA 2VYND 1XCBA 1LJ8A 1JN0A 1G6KA 1ISFA 1E1LA 1LQUA 3I9NA 4BMSA 1DXYA 1ISJA 4NDNE 1Y9AA 1RYDA 2NU8A 5DBFA 2G1UA 2EW2A 3ZU2A 1X7DA 5A9RA 3RUHA 4ZQBA 5ICMA 1HLPA 4BGIA 2WDZA 1YRLA 3OICA 5AXAA 1NQAO 4RVHA 1IPEA 5ITVA 3V2UA 1ZCJA 3MOGA 2GN8A 4UUMA 3K5PA 4LISA 1A9YA 1B16A 1C1XB 2JAPA 2Z95A 3M1LA 4CLRA 4K26A 3UAGA 1BXZA 4BQPA 5CDYA 2D4AA 2CDBA 1B7GO 3KYCB 4ND3A 2BFAA 4F45A 3SX2A 2FP4A 4CQMA 4XJTA 3F47A 1BRMA 1TT5A 1SEVA 3GZNB 3PWSA 4GSKA 2BI7A 3CE6A 3WSVA 1HDCA 4CV1A 1BXKA 3OHSX 1F8GA 3GDOA 4L9RA 4MKRA 3TF5A 1HDGO 3C1TA 1Y5MA 4BUCA 1Q1NA 2B36A 4FW8A 5F5LA 1HRDA 1HZJA 1JU9A 1V3TA 1A5ZA 3DAGA 4K6CA 3ZNOA 3BTOA 1UR5A 5L4NA 4RF4A 1T2AA 4BKPA 5FI3A 3EAGA 2D3TA 4WKGA 2X0IA 4BGVA 2C82A 1YJQA 4R1NA 2ZYAA 2MAOA 2TMDA 1PEDA 3GG2A 1KEPA 4OQYA 3UFXA 4CQMD 2IODA 1ZK1A 4PLYA 3TZHA 2WJPA 5AXDA 1QLJA 4ND2A 4W99A 2YDYA 2YV2A 2DLDA 4PLGA 5TNXA 4MPDA 3TSCA 2B4RO 2Q99A 4CM9A 1QYCA 1I01A 2PY6A 1Q0LA 1SB9A 4YAGA 5TJHA 1XIVA 1SC5A 4JBIA 3SC4A 3VPGA 3WTBA 2Q2VA 4PG5A 3DO5A 5KOIA 4CM1A 4FJ2A 5IG2A 3W1VA 1LUAA 4JP3A 3JQDA 3W4IA 3HFGA 1QYVA 3GFBA 4MIEA 5FI5A 4K1LA 2X0JA 2R6JA 1NASA 4MVJH 1AHIA 3F1LA 1HT0A 1T2FA 4FFMA 4HWKA 4AJ2A 4KUEA 1G5AA 2JHGA 4QO7A 2J3IA 3WDSA 1ONPA 1EK5A 1T1RA 1ULUA 4YJHB 5JCJA 1R12A 5L40A 1NXQA 4OOEA 4DIBA 2C2XA 2Y0DA 4XYEA 5COBA 4JNKA 1ZW1A 1PX0A 2C54A 3Q0EA 9LDBA 4XCVA 1UZLA 4HX5A 4ZA2A 3A1NA 2VRBA 4M55A 1GY8A 4TVBA 4RZIA 1R66A 1D7OA 4PG4A 3DOOA 2CVQA 3GY0A 3ROPA 3GN2A 4OGWA 3LF2A 1F17A 4PZCA 2DBQA 4J1TA 2GUGA 3C7CB 2Q1UA 3D5QA 3VDQA 3TDKA 1MXFA 3OQ6A 2JFFA 1LSJA 2P4QA 1XWFA 3WYBA 2D59A 1EUDA 3E9NA 4J4TA 3ADPA 2Q2QA 5I7SA 3GVXA 1OR7A 3KEQA 1RM5A 3NAQA 1E0DA 4J3FA 3BZUA 5A03A 1MW2A 3D7LA 3WQSB 1UXIA 1N9GB 3H5NA 3RUAA 3E03A 2YW9A 3JQ7A 1LDMA 3G17A 3GLQA 4RPKA 3NKLA 1XSEA 4RV9A 3NYWA 3CZGA 4L4RA 1PJ2A 1PL8A 4YJHA 3TZKA 4IUYA 3WYCA 4CMJA 4YBZA 5CDUA 2GGSA 4CV0A 3JQBA 2ZCVA 1K89A 2Y67A 5F5NA 2F1KA 2WD8A 3ASUA 2C07A 2QHXA 3CSDA 5FYDA 5L7TA 3VHRA 2VZ8A 3L4SO 4BNIA 5JMWA 1IY8A 2RCYA 4J2OA 3JV7A 3ENKA 1DIAA 3E9QA 4Z9YA 2HRZA 1YWGO 3GHYA 4Z0TA 4TRJA 2H6EA 1YL6A 2Y66A 5JAQA 1PTJA 2C7VA 2YY7A 1TLTA 1NAIA 2QRJA 4EBFA 1SZJG 3FBTA 1NVMB 3A14A 4XWYA 4NH4A 1FXSA 5CDGA 4TRNA 5IN5A 4DC0A 4XKJA 1I3MA 2NVUB 5DOVA 3KSDO 3OJ0A 1WMBA 2PKQO 1C1DA 1GQ2A 1PGPA 3M1AA 2B5WA 3BHMA 4JQCA 4GKVA 3ZW8A 5IAAA 1U3TA 2P9EA 2C5EA 1NWCA 2CY0A 2CSUA 4ND4A 4YYZA 3C24A 1W73A 3T7EA 3FI9A 3K2EA 5CFZA 1UAGA 3WLFA 3U4DA 5A4DA 2VQ3A 4BIIA 1PGNA 2DBVO 3PZRA 2YQ4A 2OGUA 2ZK7A 3F1KA 3PJGA 3L9WA 2VHZA 1R16A 3RCBA 3I6IA 2Q2WA 3STHA 2IZZA 3HSKA 3O4RA 4XJSA 3L77A 5C7LO 2CZCA 4RPLA 4WECA 3Q11A 1F12A 4Q9NA 2AEJA 4EUFA 4YT8A 4JBGA 2FPPA 5A04A 4GH5A 2ZATA 4WEOA 1DIHA 2NTVA 4O0LA 3IDSA 3D4NA 3JQ8A 1DPGA 3S8MA 4E5KA 1HZZA 3C1AA 3LYLA 2RH4A 2ZJ0A 3OETA 4YJDA 2VZ0A 1GQYA 1ISIA 2EP7A 3DMYA 3F46A 2O3RA 4CM4B 3D3EA 3RC1A 1Z75A 2NVBA 1YJ8A 3DAPA 4MJLA 3E5RA 1UDCA 4WCFC 1RM4A 4Q3EA 4CODB 3H9JA 3DQPA 1P33A 3KETA 3CZRA 3HNPA 4D7AA 4IS2A 5THQA 2A94A 1WNTA 3ZGYA 1AN9A 5DBGA 3BYZA 4FGSA 3AFMA 4NBUA 4EDFA 5JC8A 4K6FA 2P9CA 1GEEA 3FNHA 1YB4A 4E31A 3WG9A 4ITUA 1U9JA 2HMSA 4DBVO 4ZQEA 3PEFA 1MG5A 3ONFA 3WGOA 4BNYA 1C0LA 4AVYA 4J1NA 1CYDA 1HLDA 3HE3A 4CUKA 4YACA 3VAZA 1SB8A 4BVAA 2ZKLA 2P5UA 4FLRA 4J0FA 1E3EA 1C1DB 4CMCA 5C7IO 3B6ZA 4FIZA 1QP8A 4MVJP 4LVUA 4LW8A 4W82A 1W0CA 5F1OA 2DT5A 4I9HA 3UH1A 1I2CA 4Y8VA 3QWAA 4BB6A 4R1UA 4BGUA 3HADA 4PZEA 3I9JA 2DU8A 4IMPA 4UAGA 5THKA 3DFZA 5G4KB 3W8EA 1NQTA 1TT5B 8ADHA 3RBXA 1U8XX 2OZPA 3I4CA 1LXCA 1NTOA 4J9VA 3GT0A 1FMCA 1E1NA 4TQGA 1DFGA 3PWZA 4U5QA 4W9NC 3W8FA 3GEDA 5LDGA 4DMMA 4KDFA 5KCZA 2OMEA 4D42A 1VC2A 4OKNA 1VE9A 3QVXA 3PRJA 4NFHA 3IP3A 4XB2A 1PR3A 2JL1A 4G2NA 2FMUA 5GZ6A 2GO1A 1EK6A 2YHIA 4J0EA 3UKOA 1EVYA 1N8KA 3LT1A 4A26A 1R4MB 3UF0A 4FFPA 3KV3O 4IDDA 3FWZA 5EPOA 4DIOA 4BNNA 5ADHA 3ZHZA 1EUZA 2ZYDA 1CQIA 1R4NA 1TXGA 4DL9A 4XIYA 1PZGA 1C14A 2I3GA 3OEWA 3ZWMA 3ROKA 5AXBA 2V6BA 4KUHA 3OJEA 2Q1TA 4DQUA 1FJHA 1ISGA 3UEQA 2O23A 3ZNNA 3GOHA 3T0YA 2WYUA 1LSOA 3ORFA 3QRWA 4I5EA 1LDGA 1E7WA 1JVSA 3GNQA 1T2CA 4JP2A 4Z3DA 1TVEA 3KYDB 3O8QB 3VZRA 4QFCA 4A7PA 5HM8A 3AI3A 3D3WA 4FC6A 3U09A 2FZWA 4RJTA 4D3FA 5JO0A 1J6UA 5H82A 1PGQA 2ZTVA 3TZ6A 4CR7A 5LDHA 2O48X 5T8KA 3KHUA 4AJEA 4ND1A 3VVCA 4YJFA 3U3XA 3U5TA 2DPGA 1K0UA 4E21A 4NQWA 1DRUA 3TPCA 4OQZA 4BNFA 3C1OA 4HFNA 4AJJA 1Q7BA 3G1UA 3DZJA 4RQUA 2RH8A 1UP7A 4XGIA 4YB8A 2EKLA 1M76A 1C3VA 3RUCA 3I9LA 1PJTA 2UVDA 5KJ6A 3UERA 4ID9A 4IJVA 3GAFA 3W4JA 4B7XA 1QV7A 2CF5A 5JCXA 3JQ8B 3EC7A 3IUPA 3LF1A 2E6UX 2J3JA 1MFPA 1DC3A 2YJZA 3JSAA 5ENDA 1P45A 2NADA 3PIIA 2IYOA 1EQ2A 4YAEA 4ALJA 1GADO 4YAIA 3RIHA 4QT0A 1I2ZA 3FN4A 3H65A 2AHRA 1QV6A 1S6YA 4PLWA 3EVNA 2PZMA 2OUIA 4PCVA 4FJ0A 5ENVA 4OXYA 3NUGA 2GZ2A 1Z6ZA 4L0QA 4WK6A 4JCOA 4KWHA 2NU7A 1NAHA 1U1IA 4YJGB 2EGHA 1R4MA 2NNLD 3U62A 4XYLA 3OF2A 5KVVA 2YV1A 1V35A 1EE9A 3GGGA 3ZWXA 4XGKA 2VNSA 5A02A 4J7XA 1A4UA 3K8ZA 3PZBA 3DBRB 1C0IA 1NR1A 4F3YA 1S46A 3JQ6A 2WPGA 3ZHBA 1X0XA 5EN4A 5C37A 2X86A 2IDZA 4Q3NA 1DDOA 1P0CA 1C1XA 2DBZA 5EQDA 1CWUA 1H2HA 2I9PA 3QWBA 4CLRB 4A27A 4QQRA 1B8UA 5HS4A 2EJWA 1E6WA 5KJ1A 4PIVA 3K73O 2D1YA 1SOVA 1BVUA 1DC5A 1IZ9A 4Q3AA 3OJFA 4FOSA 4MDHA 4IQ0A 4R01A 5TJ9A 2AE1A 2DC1A 2HCTA 3AY3A 3EY4A 3QWFA 2B35A 1YL7A 4CMGA 1DLJA 4GVXA 1NPYA 3BAZA 3V1YA 2C0CA 4XB1A 5L4SA 4DMLA 4YJFB 3WS7A 1PR9A 5TT0A 5BSEA 3TL2A 2X5OA 4L74A 1YXMA 1A7AA 1VL6A 2V6FA 4P38A 5CG2A 1XEAA 2WE7A 4UUNA 1HDOA 1ZXBA 3QJ5A 5KTKA 3GG9A 3BTVA 2HLPA 4I08A 4EUHA 4FFLA 2HK9A 1ZMTA 2PK3A 3TN7A 4FGWA 1GQQA 4MIOA 1ONOA 1QXSA 3KSZO 4IDCA 1P1KA 3X2FA 3FSRA 1D4FA 4OO3A 1K6IA 1X14A 4J90A 4ZRNA 3RAJA 4C7KA 1XELA 2QG4A 3H9EO 3H6KA 1Y7TA 3BMNB 3BHJA 3JQ9A 4RORA 4BO9A 1PQWA 4GWGA 2RAFA 4N18A 1UDAA 3QY9A 2VNAA 3ULKA 3ZHYA 3UCQA 2EGGA 4GVLA 5JY1A 1ISHA 4XQCA 4F46A 2OHXA 1KVTA 4BNJA 1J5PA 3AUSA 4GKBA 2A4KA 4QO8A 1E6EA 2PFGA 3ICCA 4IZHA 5AVOA 3I4FA 3PWKA 4OIMA 1JWBB 2VCYA 1L1FA 5CDTA 2W90A 3MWDB 2HJRA 3UN1A 4GMGA 2IZ0A 2YQ5A 4EI2A 5ICSA 3D1LA 5IXYA 1H0KA 1ZK4A 1P31A 5A3VA 2BF7A 1YDEA 2XPCA 1I5RA 1ZIDA 1OFGA 3IAHA 3ANNA 3JQAA 1I8TA 3JQFA 1W8DA 3GEMA 5J23A 4QX6A 1ZZEA 4EZBA 1AUPA 1YE3A 4JXKA 1DB3A 4LGVA 3Q9NA 1CEQA 1KERA 3HDHA 4PLHA 5EIOA 6LDHA 3AK4A 3WGHA 1O5IA 4PLCA 3QE3A 1BW9A 3DL2A 4Y6RA 1QG6A 1WW8A 3D4OA 3BIOA 3AOEC 5AQ1A 1HDXA 2B5VA 4J49A 1B26A 3ZV5A 3HG7A 4CLXA 5KJFA 3TNLA 3I1JA 1MG0A 1UDBA 1YBVA 4EJMA 1PZHA 1PU2A 5KIAA 5IZCA 2ZTLA 1X13A 5IZ4A 3CZMA 4NR0A 5DULA 4TWRA 3H5AA 3O03A 1PGOA 4M8SA 1SMKA 2XXJA 4XIJA 5A9TA 2DUWA 3PLRA 1YBMA 3ZDFA 2A9FA 5ER6A 5A9SB 3OIFA 9LDTA 1M67A 1P3DA 3I83A 2PA3A 2EKQA 4B3IA 3NJ4A 2MAPA 2HQ1A 1RJWA 3RC2A 2NSDA 5DP2A 3MJ4A 3IP1A 3ITKA 2WWRA 4K9DA 2JCVA 2VWGA 4YQZA 2YHIB 2GASA 1HEUA 1VRWA 5JY6A 2I6TA 3AJRA 2AG5A 3DEYX 4X54A 5KJCA 4FPXA 2GZ1A 4YPOA 5JDCA 1A9ZA 3IJPA 4YVFA 1MVYA 5EL0A 3WXBA 2VHYA 2AQKA 1LBEA 3S55A 7ADHA 3WWYA 1ML3A 1IHYA 2H9IA 3U4CA 2FZEA 4E5NA 1GR0A 2NVUA 1WDLA 1PJ3A 2Y1OA 3FF4A 3NRCA 1R0KA 3K30A 3VTZA 4DIFA 3OEYA 3OH8A 1HE4A 1DJQA 3DFUA 3L6EA 4EITA 2QRKA 5JAIA 3L0DA 3CINA 4M54A 3HDJA 3BMOA 3N58A 4XDZA 2NACA 3LLVA 4PN3A 3VKVA 1NVGA 1F0YA 1H6AA 4Z6KA 2QQ5A 4B4VA 5ILOA 4XYMA 3H7AA 4TKLA 2NVWA 2VWPA 4PZDA 3PFFA 3WX0A 1ZVMA 3R0IA 4L4XA 3LC1O 4R3NA 4UEKA 5BSHA 1N92A 4QUKA 3V5NA 1M75A 4YRAA 2VYVA 1GZ4A 4FLQA 2AEMA 3RJ5A 3PDUA 3AOEA 3RUFA 5JW6A 4WLVA 4XEHA 3PP8A 1KEWA 3IKTA 3RU9A 5AYVA 2P2SA 1M6HA 5CPFA 2X8LA 2POQX 1L7DA 4GWKA 1UXHA 4BKRA 3VVBA 3GVIA 2VOEA 3KM0A 4BNHA 3B20A 3G79A 3JQFC 4XQEA 4QTZA 4RF2A 4JLWA 3ZU5A 4II2A 4RL6A 2XOXA 1H2BA 4MVJG 1MC5A 5F1PA 1FK8A 2HAEA 1I3KA 2I99A 1DIGA 2BI8A 4WEQA 1PS9A 3LK7A 3QP9A 4B4OA 2O4UX 3DZBA 4NJMA 3WGIA 2NV6A 3GHHA 4LCJA 1H94A 3CPSA 4R41A 5BSGA 3GGPA 3M6IA 1N2SA 4HV4A 3A9WA 3OM9A 4GLOA 4H3VA 5U1PA 3W6ZA 4AJ1A 1SOWA 3ABIA 4BNVA 2VUSA 3GNTA 4Y9DA 1W4ZA 3FNEA 1N5DA 4BO7A 4XR9A 2DFDA 2WSBA 1EDOA 2X1HA 4RDHA 4GAEA 3KYDA 3O8QA 4NHEA 3WSWA 1Q7GA 4Z0PA 2BLLA 1N1EA 3D3WB 3FWNA 4H7PA 4EW6A 4YRBA 3IL2A 1BXGA 2HKIA 2G5CA 5IDWA 1EBUA 2JAHA 1AXEA 2X4GA 3F4BA 4O6VA 3PFWO 2AQHA 2O4CA 4CMEC 4ILKA 1DAOA 4Y98A 4E2YA 1Y8RB 2O3SA 4R9RA 2Y99A 3EZYA 1Q0QA 3DR3A 4J7UA 4AYSA 4JROA 2Y1GA 5IF3A 4UVHA 5TLSA 3R6DA 1GL3A 2X5KO 4ALKA 2HMVA 3EMKA 1R37A 2C59A 3H2ZA 4WPGA 3TL3A 4IPTA 3SBOA 4FR5A 2JCYA 1PQUA 4FFOA 4R5HA 4RVUA 1YQXA 1K3TA 4RQTA 1VKNA 1YH3A 2HSDA 4ROSA 4N5MA 3PYXA 4ND5A 2WYWA 1PWZA 1SCUA 3Q2IA 4CMHA 1U3VA 4CUJA 2YHUA 3WMXA 5G0WA 2NTNA 5ILGA 1NNUA 3VTFA 4E6PA 2ZIZA 1LDEA 3SJUA 4E0BA 4DVJA 5AOVA 3KVOA 5U4QA 4OXKA 1UXGA 3ROMA 4A2CA 4RDIA 3VPHA 1M2WA 3ZCXA 1VL0A 2FRDA 4MOWA 4OYRA 2DFVA 3D5TA 3DAFA 4YTEA 2CVZA 5LC1A 3JD1A 3ZWVA 1QORA 2VHVA 1U2GA 3WBFA 4GL4A 1O94A 3RBVA 3Q1LA 1BHSA 5LCXA 5G0UA 2V6MA 5G0TA 1GFSA 2G17A 4CLDA 3U0BA 2EKPA 5JDIC 1U7HA 3ETEA 3HUDA 4GGPA 4GMFA 3OQBA 2P91A 3BMOB 4BO1A 3OA0A 5L7WA 1X7GA 1MA0A 1WVGA 1BW9B 3EZLA 3OFSA 3EUWA 4J4BA 2EV9A 3DMTC 4JJGA 4FFRA 3VPSA 3U9LA 2FHSA 3DC2A 1IZ0A 3QSGA 4EJ0A 3UVEA 2PH3A 1T2EA 3JQAB 4NJMB 4LSMA 1E5QA 3H5RA 3WFIA 3WICA 1ZUD1 3MCVA 5BSFA 3ZV3A 1MW0A 2PZLA 2I76A 3JYPA 1WZEA 4ZICA 2G82A 1HDRA 4B3JA 3UOGA 1JKJA 4DA9A 4QEDA 1JQBA 1GZ3A 1UXJA 2VZ9A 4R5MA 5GMOA 3B70A 2GZ3A 4E5YA 2ILTA 4P4LA 3D0OA 4E33A 2QYTA 2AMFA 2PTGA 3ANMA 3H2SA 1WPQA 4BV9A 4GX1A 2JCXA 1E92A 2BKAA 2RIRA 4WASA 4L76A 2V6GA 1W6UA 2X7HA 1KVUA 2W2LD 2RHCA 3BMNA 1EFLA 3WGGA 1GAEO 2AW5A 2Q3EA 1CETA 2OO5A 1VPDA 3GA0A 1GEGA 4NK4A 3LT0A 3L4BA 1P1IA 3WNVA 3ZU4A 2C20A 5COQA 2W2KB 1BGVA 1BVRA 1ZSYA 4H15A 4L73A 5IFLA 4PGFA 3MTGA 1GV1A 5HTOA 1KY5A 1B8PA 1BG6A 3B1FA 2GF2A 1E7MA 4OHUA 4KZPA 1JW9B 4A10A 4NIMA 4AJHA 4BNLA 4NMHA 2BRUA 1ADCA 2E4AA 2ZB7A 4HADA 3JD2A 3IC5A 3RWBA 2PKQP 2Q1WA 4J91A 3FNFA 1DFIA 4YEDA 3OJLA 4PRKA 3T4XA 1HYEA 1QYDA 4OH1A 1O6ZA 1HYHA 1LC3A 5C7OO 1MFZA 2DVMA 1FDUA 4CM8B 5JXWA 1PQPA 1AE1A 1MGOA 1F8FA 2FY8A 1WDMA 2HUNA 3ZWCA 3P2OA 2Y68A 4XD2A 4CMBA 2B4QA 5EINA 2O3UA 3SC6A 1MW3A 1DHRA 1NYTA 3TRIA 1I10A 3KTDA 2DTDA 5I9MA 2IEBA 4MIYA 4FLOA 3EHEA 4R54A 1K6XA 5T8KC 1DIRA 5DN9A 2ZB4A 1Z7EA 2ZJ1A 4MP8A 2V65A 1N7HA 2UV8A 4CXFA 3INTA 4NJOA 4WLFA 4Z3KA 2TMGA 4XGNA 3B1KA 2PGJA 2W8ZA 3H4VA 1E3IA 4M89A 4NNJA 1ADFA 1UP6A 3QVTA 1NBOA 3M2TA 3PJFA 4HKTA 1GU7A 4GSLA 4BKQA 4I5DA 3E18A 5GZ3A 1GUYA 1BDBA 3B1JA 2BFOA 4IY1A 1TB4A 2G76A 2NQTA 1ZK0A 2FPGA 1YBAA 5DP1A 5K6AA 1E7RA 3UW3A 3AOGA 2W98A 2PNFA 1H5QA 4WE3A 4B8WA
chains in the Genus database with same CATH superfamily
2ZBGA 3FUEA 1CUUA 1FPMA 2BD0A 2O1SA 3I39X 4MRMB 5ITWA 1WSDA 3CNEA 3HCBA 2L18A 1TM3E 3DDOA 1BX1A 3HCRA 2PWYA 4FZRA 4C43A 4D79A 5AW0A 1O4WA 2C3YA 2JD2A 4R98A 3X1JA 3EPKA 2B1JA 1U0EA 1RDFA 2YV5A 4EG8A 4X44A 3ZGNA 3QHAA 6ABPA 3B7PA 5CVVA 2DQ6A 1MC4A 1RR6A 1ZI9A 2I03A 2HGSA 2I67A 1MQSA 3PRYA 4ATNA 2GMWA 2CMDA 2LNDA 4CKXA 4QBIA 4X3CA 9ABPA 4OIFA 1Y5NA 4GVPA 1PS8A 2D1SA 2QVCA 1Y8RA 1ENZA 4KLNA 4YRZA 1XGKA 3L7AA 3TVYA 1XYGA 4E3WA 3AHHA 2AG8A 2FN3A 3DTVB 3KB2A 3L01A 4RHUA 3BZWA 1EM8B 1XLTA 2M98A 3YASA 4I1UA 1N32B 1ECGA 2HU2A 2RK3A 3CXBA 1NJFA 3N2ZB 4KIJA 4IAOA 4WCFB 4KPUB 2F43A 4QHPA 1R0YA 2YWFA 4L7QA 2FZ5A 1STOA 2PMCA 4HFJA 2W5UA 1L0BA 5HKOA 2NYAA 2HA2A 3C3DA 3CWZA 3WB0A 4KUGA 3TSZA 3UMRA 1QQAA 4FHZA 3T7IA 2A67A 3AFOA 4L8VA 1EVEA 1AF4A 1RHKA 2IZ1A 3UK6A 4COOA 5BVGB 3BWMA 3W2IA 2H5LA 5DHAA 3PVCA 1GZDA 1W34A 2YR0A 1HKUA 2Z3WA 4XA8A 5DXFA 1E62A 1MZVA 1DO8A 2Z9CA 5K9ZA 2ZRBA 3EZ2A 4C08A 3VNVA 2QAGC 2XPZA 3MJCA 3MZ0A 5JSUA 5HF9A 2VDWB 2B3TA 5B55A 5IZCC 2CXOA 4ZN6A 3I42A 3BMQB 4L0CA 3RLFA 3CKMA 2CYCA 4HXFB 4F4CA 1O9BA 2QF7A 1RWNA 3H11A 4XOIA 2PL3A 3B7SA 2QZJA 4YRLA 3SJCA 2QL5A 3UICA 3ZTYA 5CFLA 8LDHA 2ENWA 1RKXA 1FQJA 2YW2A 3ESCA 3GH3A 3GPDG 4BP1A 3Q44A 3QUSA 4JQOA 3R0XA 1OBVA 5IASA 3WYEA 2ZQYA 1E3LA 4QBTA 1JIIA 2QROA 3PPXA 1PS0A 1HTBA 4WCFA 3SR4A 3A2NA 3NTRA 4JU9A 3RIMA 1WKBA 3NCTA 3PR3A 4M6WB 1HL3A 1ZU4A 2P5YA 3UQYS 1LPAB 1RWQA 3TX6A 4RZHA 4HQ6A 3UCXA 4ZJPA 4E03A 1EK2A 4R1OA 1KP2A 5C5EA 4KQXA 2O7VA 4KXVA 2C5AA 2QTRA 1V43A 2GD1O 1QRDA 1JJVA 2DGDA 2WTXA 3E8XA 4QUGA 1Z9BA 5CLQA 1LDYA 2ZVQX 1BWRA 1HQYE 1XRSB 3C97A 3WLEA 3QVKA 3M81A 5FPKA 3O5AA 4ZRMA 4R1SA 4BO5A 1IHPA 1T5LA 4Q6BA 3VU0A 3IP6A 5HXAA 3U4IA 1BFUA 3NEPX 4XIGS 5K0GA 3WVNA 4MP3A 1NP3A 4OJMX 3MCTA 4XARA 1JR3E 2H29A 3AR8A 3GOQA 4JR1A 4XRGA 3GLGB 2NT3A 1CQIB 1NHGA 2Q1SA 4WGGA 3R09A 2R8OA 2DLNA 3I52A 2BFDB 3RYTC 3O74A 2TMKA 4YIKA 2IYWA 2OESA 3OBBA 3TRDA 1H2XA 4CLOB 4Y2JA 4NMMA 5AI9A 4JT9A 1QBKC 1UFKA 2IY9A 3VO9A 3VC7A 3WAJA 3RFTA 3TRFA 2J07A 4A2WA 3BUSA 4I14A 1VLLA 2ID9A 2YN4A 3S5UA 5B1EA 2F7SA 1RMTA 3M9XA 4H7IA 2QRQA 2Y1WA 2D0IA 4U7GA 3KTFA 5CW1A 5IABA 1PLJA 5AIBA 4FQ8A 4IMJB 1XU4A 1OZAA 3D6AA 2IOHA 3FF1A 4W1QA 4K5LA 4BZXA 1RHRA 5HZGA 3T9BA 1AGRA 2XKJE 2YJ4A 2J1LA 4MKZA 4GX2A 3KOZA 4KP7A 4E1VA 3VR3D 3KYCA 3ZWNA 4EI9A 2Q6KA 2N0SA 1KS9A 3BD6A 3HKEB 2WAXA 3QMVA 4EHFA 1EVKA 1ZD3A 5EXXA 3RRZA 3DFFA 1QHEA 3MJEA 4X6XA 2PX8A 4Z86A 3FA2A 1EVIA 4JLSA 5EIBD 2QD1A 1NV9A 4BNKA 4TYPA 3FZGA 3F6YA 4ETWA 1GFZA 3CLTC 1G5FA 1N2EA 3L7CA 3V1UA 5B7NA 5ITZA 1IHOA 3ZHXA 5JMTA 1C0PA 3DDSA 3F3YA 4BLUA 1UAAA 5J4YA 1IUNA 1GO2A 2X58A 2HA6A 3T94A 4O4JA 2D7DA 4MPJA 2G77B 2GRAA 3OLXA 4HK4A 1YUMA 4DHWA 5HS6A 3T38A 3SHWA 3IJ5A 1MH9A 1YZVA 3SMQA 2IGBA 4X20B 3ONEA 4R3UC 1GL6A 2AKYA 2ZBRA 2WYIA 2ZE5A 2F62A 2W0MA 2X14A 4PVCA 1YVEI 2EBUA 1PJRA 4FCWA 1WKVA 2HD4A 5FDFA 3CNLA 4UBJA 1JR4A 1ZEMA 3L6CA 2PUJA 3VA7A 2HHJA 3WWDA 4Y67A 1QFMA 1SVKA 4FZVA 1BS1A 1L7RA 1Z8DA 3WGYA 2F59A 5HNHA 4WNIA 4UTOA 1RZUA 4FFSA 4QBKA 1LEHA 1NPTO 1OXUA 4JX8A 4XN4A 3WLSA 4DSZA 2ZT7A 4Q9DA 1TUBA 1WB6A 4DHEA 1XUOA 1ZSVA 3MSCA 2FWJA 3QNUA 5J2UF 1XAGA 4LSGA 4G07A 2J4DA 3GD7A 3H9GA 4OQXA 3BHIA 1X70A 3FAZA 4ZVRA 3RSHA 3L3BA 3N70A 2HRBA 3NHJA 2FRDC 2VJAA 2I3BA 4HAWA 2Q1YA 1WXEA 3B9PA 2X22A 2XIQA 5T3YA 1AX9A 3T34A 2CJPA 3BB4A 3C45A 1ZS2A 1T43A 4TTTS 5K1ZA 4AO6A 2LR0A 1RXIA 4MKIA 5JYEA 4C7VA 4J4HA 2BFDA 4W1PA 4Z9FA 4OTZA 5CW2A 2FQQA 4DYVA 4D0RA 1MIHA 1CULC 4YRTA 4CTKA 4ER0A 3V33A 1APBA 1MX5A 3M0EA 2OE2A 2RH5A 2QN8A 3LCMA 3L5OA 3NIDB 3QV1A 3R9XA 2GJAA 3FDJA 4P3PA 2YXBA 3M9LA 4ZOLF 3N6XA 2NO4A 3QPCA 3MTIA 4KWTA 3CZEA 1KYWA 3OWXA 4B6RA 2DHRA 1EXMA 1LZLA 3NKFA 2X15A 3P0JA 4Y3UA 4CV2A 5C80A 1G20E 1T9CA 3PQ5A 4LQCA 4M87A 3II6X 5DCLA 5FTJA 3JWJA 3FFTA 4TVOA 5LZ9A 3BB1A 3USCS 5EQFA 1F8XA 2HO5A 1YIDA 3LYHA 3SXUB 4R7TA 5IJXA 1XROA 4LBZA 2WJJA 1UL1X 3OT1A 1B3RA 3E6AA 2A9PA 4D3XA 1HH4A 4LRTB 5LMUB 3AXTA 3X43A 4MP6A 3DGFC 2FFQA 4HWSA 5JLJA 4BX3A 4WXRA 2G28A 5DT9A 1NM5A 2RHHA 4R51A 5FRDA 4AZWA 1YL5A 3AILA 5IDQA 1JPVA 1GOTA 1KAHA 1GRCA 1UBUS 2OP0A 5IC5A 3EIOA 4EG5A 1JFVA 4GYWA 3TTSA 1MB0A 2P1DA 3R3YA 4U7HA 5EMKA 1V45E 3WK4A 1P4RA 3MELA 1F2DA 5ALKA 1JA9A 3DVAB 5EUBA 1NMYA 3L4JA 2AZ4A 2AGVA 3LRXA 4O4HA 2G40A 2JS7A 4NLLA 4ZEVA 3JTEA 2I6FA 1NVDA 3FMVA 4P3XA 4MW6A 4CHGA 2GCEA 4B3XA 4II7A 5KYYB 1MJHA 3MCUA 3SY8A 1AB5A 4X5OA 3KJFA 5CH5A 1FRQA 4Y6QA 5JE8A 4M8LA 5LZ8A 3SDSA 4ZYVA 5KNLA 3GARA 3Q15C 3ZWAA 3KPVA 4FYVA 4Q34A 3MPOA 5SZIA 1FS4A 2XRMA 4CG2A 4EJ6A 2Z2XA 4QULA 3DBHA 3K92A 2VAVA 3ZZ0A 1EIWA 5DASA 4JJ7A 2N47A 2L42A 2VJOA 1JAXA 3KV1A 1QRUA 2HXGA 4LV8B 2H54A 5EXEA 2I7XA 4XWTA 4DG5A 1SO8A 3MRXA 1SQ6A 5IW8A 4BAUA 5B5SA 2QVLA 4NEGA 4AS3A 2XKKA 2GPBA 3LGXA 2POCA 2PH7A 4I1RA 3HXLA 1C9YA 2PIDA 3DEIA 4H1WA 4DV7B 2DERA 5JAPA 2QAIA 1Z2NX 4XN9A 1JJFA 1WF3A 4KGDA 1Y6ZA 2C99A 3JWPA 4OP1A 5HIMA 4DY6A 4YGYA 4D82A 4RY2A 2CCKA 2J3DA 1X7ZA 221PA 4P4TA 2WPNA 3Q6IA 1E3DA 1SK9A 1TTQB 2BKVA 4GPAA 4KDEA 2WFMA 2ZWVA 4M98A 3TOVA 4EG4A 5ITZB 4R5XA 1E7YA 3H99A 2IU0A 1XTQA 4AZ3B 3VR1A 1L1QA 1K6JA 1PK9A 4YMUA 3UJ6A 5CT6A 2ZI7A 2BZSA 2CHGA 3GPBA 2F9MA 3P4YA 5AMXA 2OG2A 4MGHA 2XCSB 4X94A 4PY2A 1Q0HA 4B8ZA 4F4FA 5KX5B 2HLHA 4WV3A 3AVVA 3KUDA 1T9DA 4JP1A 3EZXA 1KY2A 1IXKA 1JIKA 2C8JA 2CEKA 3FSEA 4GBGA 5AKHA 3UGJA 1G59A 1CUGA 4BQOA 3WWEA 2WSLA 3GEIA 4BNMA 4MW2A 4JYAB 3FBGA 4DSTA 4B48A 3KR1A 1T8PA 5EJ8A 5KKNB 4JASB 2GCGA 1M54A 3OM0A 4CEJB 3EULA 3OCXA 4NFYA 3RASA 1ODFA 3FCXA 4Y1RA 2CJFA 5EKUA 4GPZA 3RJ9A 3A06A 5A6SA 4TXHA 1S89A 2WPDD 3L9XA 3C16C 5EI5A 1F9EA 2B1RA 4YRQA 1Q1QA 4Q0MA 1H3NA 1QK5A 3AVQA 2NO0A 2YXLA 5FB3A 2Q49A 1Q1BA 5ELLA 3UA4A 2IHTA 1ZICA 4W1RA 3LHDA 3WWZA 4AP6A 2HOQA 2NZJA 1I4WA 3C3PA 3DNMA 4HI0E 5LJLA 2VBCA 4Y1GA 2WLSA 1ABFA 4IIJB 5J4VA 1L4GA 1XVTA 2D5AA 3CVOA 1YT5A 4UBKA 3SBDA 4CMIB 3H0EA 2WHPB 2C5LA 1RJDA 4GEGA 1GDHA 1DTEA 3TQCA 1M7GA 3VU8A 3ED1A 4YRMA 1DBVO 3LZCA 2KBFA 4RVCA 2OHFA 1PP4A 1UZAA 4CKCA 1GNPA 4PG6A 5ALMA 3H4IA 4A2QA 1JI0A 1WNFA 3ONDA 2QM8A 3K31A 4LYHA 4RXUA 5BR7A 5CYOA 5FFFA 2AMLA 2ZJYA 2ON6A 3PHJA 3ZW7A 3TR6A 1QG0A 3G1WA 5TGTA 4TYNA 5TC4A 1MT0A 3OQIA 4IQ4A 3LC2O 1L5SA 1QPBA 3CZLA 1H2EA 1OFHA 5TGZA 4CUZA 4NCHA 2GPSA 2OHVA 3GRFA 1U65A 2IP2A 3W04A 5AVWA 4DQDA 2XVZA 2Z4SA 1P9RA 1WMAA 3HJHA 4I4IA 2XW6A 3PEYA 1AQUA 1V7QA 1G7RA 1W4AA 3DOFA 4NYMR 3WLNA 3IPLA 3TB4A 4H7FA 3CLSC 5K2MA 2PLAA 3CC8A 4Q21A 4AG3A 1K8QA 5B57C 3QGMA 1TCVA 3LP6A 5F2KA 5B37A 5IJ0B 1EX7A 5KJEA 2QNIA 5A3JA 1C7ZA 1XP5A 3RRYA 4MS4B 3WMWA 4YT2A 2BE7A 3WIEA 4DLZA 2XCTB 4WUVA 2OVFA 1QK3A 2WF7A 5IDXA 4OX9B 2O14A 3STWA 3UGKA 1F2TB 2Z0MA 3GAAA 3EQ2A 5HLTA 3LXXA 3MGCA 4LV5B 1VKHA 3LPCA 3DE7X 2FPWA 3PXXA 4F4UA 3RVDA 4MUIA 3H0KA 3GH1A 3OZDA 5LMCA 4NKRA 3B85A 3RIGA 4C7OA 1HQDA 1PSDA 2CZGA 3WGQA 5FLKA 3SHOA 3F5SA 4AMUA 3I1IA 3T8VA 4B76A 8ABPA 4HWGA 5KWEA 1JQ3A 1N8NA 2PZJA 2QZPA 4IJWA 3TD9A 4PX9A 1ZBDA 5J5CA 4ED9A 5DHUA 2IYFA 1N9GA 1TUIA 1KVRA 4P34A 1EEHA 3L1KA 1QYIA 3RDPA 4R1TA 4C88A 3ZWPA 2MSCB 1XA4A 1CERA 1Z6XA 2VRNA 4GM4A 1PJZA 1Y37A 4TS1A 1ULHA 4UCFA 2ASVA 3QWIA 4LE2A 4YFYA 1ODSA 2PS1A 5IYZA 2O07A 2QL7A 5GY7A 4PM4A 1KC1A 3MPUA 2JARA 5LBTA 1ZONA 3F2VA 2FZKA 3T5PA 3VKFA 1X3SA 3MWDA 2RBGA 4TQUS 3R7BA 3RF6A 1W4RA 2DM6A 1D09A 4YRSA 5L9AA 1Y3IA 4ZOLA 2IF0A 4ZAWA 2M6KA 4B9AA 2O2JA 3M82A 2PHZA 3QVWA 2JGAA 4B33A 4CM4A 3IQEA 4AF8A 3EA0A 1KFBB 3DXFA 5D84A 4X84A 2QW1A 4QPNA 1Y89A 1KGSA 3WBBA 3L8YA 4F2HA 4JI6B 5IBQA 1L3CA 1ZNZA 4A0GA 4HAVA 2BIFA 2W37A 1K7XB 2H65A 2Q8QA 3CF4G 4ND7A 1WW2A 1PF7E 2I2XB 4Q9KA 3SJ7A 4B2YA 4P1ZA 3DAOA 3FOAA 1P1BA 1A9XB 3COVA 1JFRA 4N0QA 1RXEA 3CUEF 2P4HX 2V7UA 1NMSA 2ZRDA 1KYXA 5I8PA 4HF7A 4QJIA 3KXDA 5TF0A 4BHTA 1Z08A 1IWBB 1QS0A 4G6ZA 3B7GA 4RHYA 2R5NA 2Z5LA 4WFIA 3W8RA 4IZOA 4FYWA 1I5OA 1WCYA 3HW2A 4B5LA 2UVPB 4N1AA 1LDBA 5G3YA 4NPAA 4WD3A 2WNIA 1A2KC 4RS4A 3L8HA 4F3NA 1UXKA 3EYWA 2KW5A 3HZZA 4KQ1A 3RSOA 1IEWA 1X1AA 1JKIA 2RGYA 1SVLA 2DWCA 1OT5A 3QV2A 4FU0A 4S0ZA 3GC6A 4UVDA 3ZQKA 1OTYA 2Y2VA 4BLTA 3IOMA 3QQPA 2PUFA 2PKYX 2ST1A 3FR7A 2V6IA 2WFAA 5EIHA 2RGGA 1G41A 2OXEA 5KHLB 2R47A 2ZYHA 1PDVA 3VH1A 1C50A 4F04A 2PX2A 3JRXA 2R48A 1E8MA 2X6TA 5K4AA 1C7FA 3MT9A 4BTVA 4EQZA 3SQXA 1FP4A 1GJRA 3EG5A 3FLMA 3LDFA 4JBXA 4LQ4A 5ALTA 2AR0A 2A5JA 1KAGA 3MIIA 3UB3A 5C8XA 4HGQA 1GT91 2FI1A 2IUEA 3QUCA 4HFRA 1Z25A 4WN9A 3ZBQA 3EUFA 2VT2A 3SZOA 1TK3A 4NI5A 1WEKA 3MTQA 4G0MA 2LW7A 1DEXA 4FS3A 3BGVA 4IIVA 4RIFA 4INJA 1HDZA 3WOHA 3GBSA 3FU6A 4G5HA 1Q7RA 4QDTA 4EYGA 4QGFA 3RG8A 3DKPA 4Z9XA 3PJEA 1ECBA 4EQ6B 1LPNA 1QS0B 3V00A 1E79A 3ND9A 2X7JA 1CUVA 3TIVA 1SCAA 2Z5GA 4IDGA 4IIUA 1CRPA 2AR7A 3PQDA 4US0R 3N6RA 3ST7A 3MUNA 3LQFA 1UIRA 5AI5A 3E9DA 1SFRA 1MO4A 2OFOA 4A0RA 4BFVA 2C5SA 2RONA 4UTPA 5C3UA 3SZGA 5FF9A 3AEYA 3TWOA 2BF4A 1ORRA 1R9GA 1XU9A 2BCEA 3I53A 2A78A 3L82B 3LV8A 1YZKA 3GLKA 3COZA 3JX9A 2WRZA 3PSAA 4JB2A 4NAVA 4YQYA 2CLIB 3P1JA 4QPZA 1QK4A 1FP1D 3A6GA 3F5MA 1U7OA 4XIFA 1L1RA 1TNDA 1JU3A 1U0GA 3GJXC 4FKZA 1P0FA 5KZMB 4ZEXA 5JAUA 3AH8A 3SZRA 4QU5A 3SFTA 3FUJA 1XU7A 2EDCA 1HR0B 4JBHA 3SS7X 1W5FA 5CEEA 6GPBA 1LNQA 4DLXA 2MINB 3GL9A 1SC3A 4RY8A 5ADVA 4I1IA 2PZFA 4OLJA 1XDSA 3N5KA 2BMVA 1I2BA 2CXUA 3ASVA 1S7CA 3M6MD 1EFTA 1KPHA 2OM6A 2VNJA 3CT6A 4JN6B 4REQB 5I3CA 2Y1EA 1KEUA 4Y7DA 4B3HA 1G5TA 2N9UA 2FPOA 1MX1A 2FR1A 4BEWA 3FPLA 4INPA 4K1XA 1M8FA 2HEIA 2J59A 2X8AA 1VPWA 1WAMA 3NTQA 2GXAA 4W9NA 4GC9A 1XLVA 2Z1NA 3GZ4A 2UZ3A 3M5PA 3PUKA 1M34E 4IGFA 2BEUB 1JECA 3CLVA 1ZZGA 2A86A 3P9SA 4XLTA 3EXHB 2XF8A 4KK3A 2OAEA 3NKVA 5KKCA 2JJ1A 3EIEA 1BWSA 5IJAA 1IXRC 4CM6A 3HP4A 3G9UA 3TH5A 3S2FA 4DV5B 2FEMA 2HF9A 4WY8A 2B1QA 3RVMA 1FYEA 1JDJA 1O8CA 3MJRA 4H1VA 3CX7A 3GA5A 4BBAA 5KDOA 2IX3A 2GRUA 5IUJC 1U2TA 1Y81A 4MGIR 1VJTA 4K81B 3VVMA 1CK4A 2EATA 2OL4A 3G3EA 3RS0A 1GAQA 3GRPA 3A2KA 1ONNA 3J7AC 3MK31 5DBIA 2RBEA 4G0XA 3DDNA 4DKXA 1LPSA 1PX2A 4DPKA 2FUCA 5BY2A 4E5MA 4EVRA 1ZC3A 2IYZA 4Z7NB 1DVRA 2BISA 2C92A 3ZD9A 2YNMA 3A2MA 3JYOA 3T7TA 3ABZA 3H8SA 3T9AA 1DEHA 2BJHA 3V4LA 4D3YA 4NBTA 4WWHA 1WZCA 2IDJA 1DXOA 2IEZA 2J0QA 1KR5A 2GZDA 5AVRA 1N1MA 2WT4A 3NH6A 2CWDA 4P53A 5DW3A 2XCQA 5FUWA 1DBIA 4ZC8A 3TJRA 4CF3A 4BRSA 5AXCA 1RCUA 3O3MB 4CHTA 1PL6A 5K4GA 2HU5A 2UYYA 3PNOA 4GBMA 5KVQA 3E2IA 3TQTA 3UOAB 2WIGA 3BF8A 3C4VA 4YJGA 1DOHA 1EGQA 2P2DA 4X92A 4HRAA 3WGTA 3PD1A 2NUAA 5FI1B 4XVCA 3FUCA 2J9RA 4OXNA 3WYFA 2QQEA 1TYZA 1IFXA 1XTSA 3Q43A 2D06A 3C8HA 3P7MA 1O58A 1UBMS 1YR8A 4RGVA 1Y1KE 4G0YA 4PC2A 3HFJA 5TQ0B 3KAKA 4DM7A 3D64A 4GG1A 1VL2A 2HV9A 4ZZ0A 2GCNA 4WBNB 1U28A 3VR4A 1DLIA 2W6MA 4P4SA 1ICEA 3AY6A 5E2IA 3FDXA 5EP1A 4JI3B 4CKEA 1QBGA 2AF3C 3GWGA 3UW1A 1FW8A 4XD7D 1F6DA 4I8IA 1H05A 3QITA 5JRJA 4L6IA 1BDMA 1P73A 5IMSA 1E5VA 3L6BA 4RZ2A 2YY5A 4LBYA 3RUDA 3AL0C 2GTPA 2YVKA 4G5SA 3RG2A 3V2GA 2RHJA 4BB0A 4CQMB 1HYBA 4ZT2A 4DIUA 1R3UA 1DHTA 2JRCA 4H3SA 4FILA 2VUTA 1C1HA 2SECE 2A0WA 1QUEA 1PT7A 4JYBA 1WSAA 4X41A 3M3DA 3V6MA 4AK9A 1KGDA 4ASUD 2I4OA 1ID8A 3GUYA 5L95A 3HHPA 5LZ4A 4W5QA 3H5LA 4PCAA 3ZU3A 1P39A 1LW7A 4EUEA 2E5WA 2ZPUA 3FM9A 1C9DB 3L79A 2HK6A 1BN6A 4E88A 3N8NA 4O3MA 3MT8A 2R7MA 3ESAA 3KWLA 3OF5A 5LZ2A 4KQWA 1WSBA 1PZFA 2IXTA 4N49A 3DBVO 1ZRSA 2AD5A 3ZE8A 5CLJA 4MVJM 3HRIA 4QHSA 4KE7A 2KS6A 2GARA 4Q1EA 2NZUG 4LJYA 4C5BA 4CLHA 2C3OA 2GWHA 1HT1E 2BEKA 1NM5C 3PUZA 1DUIA 4BO3A 1JNYA 3BTUA 4D81A 1HRKA 3OLZA 4U2EA 2NNWB 4ND6A 3UIEA 3VZDA 3KQOA 4AWBA 4DDHA 4ZV4A 1DWPA 1WZ2A 3OPMA 3VH4A 3OIDA 2OA0A 1KVSA 2VSFA 2HUPA 4IXNA 1N33B 1J7KA 1T5BA 1N5MA 4UZSA 2PV0A 3UJ7A 4TRRA 1VCHA 1DX9A 1IBRA 2G0NA 3M4YA 2AUNA 3WDLA 2O2GA 1DJLA 3B5IA 3U7JA 5T64A 1I30A 1RFGE 1SAYA 3NDIA 3WMFA 2XRFA 1PTJC 4LTDA 4M1EA 4A0FA 2VDVE 3KVVA 4QATA 2Q5LA 5KU1A 2XWBF 1XRPA 2JJ1D 3GMSA 2QRPA 1XL0A 4AUKA 2NZWA 3GRYA 1WL8A 2UYGA 1RBQA 5DU2A 3CQ9A 4BO0A 5MGBA 5J2TB 1JAIA 1GAWA 1XA0A 1Z5VA 2NOAA 4MUJA 5TQVA 3VX3A 2XEDA 1J4AA 3CBQA 4IIXA 3TTTA 2UZ4A 3E70C 1ESCA 1RRKA 2PL9A 4U02A 5CIYA 4J16A 2Q8PA 2PVPA 3C7DB 3VHXB 4GOXA 3SYRA 3H8VA 1U2PA 3ZDEA 1I32A 1IY0A 4C87A 4DMGA 1E6LA 4HS4A 1E2NA 4HR7A 4FT2A 4C0LA 1F60A 3L8CA 4CCSA 2JKVA 4EQ6A 1X7ZB 5CK5A 3PXGA 3EZ7A 3PC6A 3QKSA 2H1OA 2JLWA 2IVZA 1H22A 1V8BA 5FULA 2IPXA 2XUPA 4IGIA 2A35A 2OGSA 4P32A 4GQAA 2R84A 3EFBA 1LFAA 1N2JA 3JU3A 4HAYA 3QWHA 5J47A 1U0JA 2P68A 2PXXA 2HJSA 2XUKA 2FFLA 2BMWA 1YASA 3W5AA 1WU7A 3BGSA 4G1MB 3DT9A 3I9MA 3ON5A 4D9MA 1L9XA 1L4YA 3DZIA 5AD1A 3RSCA 1UMDB 1IBSA 4IZIA 2C4KA 2R6DA 3EB9A 3OECA 2FWNA 3VKGA 4KOAA 4H3HB 1KEKA 3SGLA 4DLRA 1UZUA 3W77A 4C6TA 4YLEA 4CIVA 2WF5A 1PYOA 3FWKA 1VLJA 3G2IA 4IIJF 4K8OA 3W9YA 1ECPA 2I6SA 2I3AA 4V39A 5HGJA 4Z8YA 1G9XA 1O95A 2OCKA 4GU5A 4L75A 3U3KA 1SKQA 4EPYA 4RYLA 1TEHA 3A1CA 2B2CA 4BMVA 4DADA 3LWDA 3CS3A 4AR9A 1ZAKA 5AW3A 3EPLA 3VOTA 3WRYA 3LQYA 4IQ8A 4DM4A 1AKQA 4GS5A 4I0WB 2I5PO 5DMXA 4CMIA 4K40A 5D85A 1JDZA 3UAZA 5HHTA 3TZCA 1YSCA 4QXOA 3THXA 4IVPA 1OIWA 1SWWA 1T36B 2YJ3A 1V16A 3A10A 1NF3A 3CKLA 4WDRA 1BVHA 2PD6A 2P0AA 3BTSA 1UT8A 2AI1A 1KVQA 1E5TA 1G4AE 3D7KA 3DXXA 4FDAA 5HIJA 2VAWA 3OEEA 1SQGA 3C98A 4LOHA 4UHCA 1RI5A 2YASA 4MW1A 3CUYA 4MI6A 4TX1A 3TLGB 4CM9D 3L1VA 5CBPA 1J0AA 1E60A 1A9OA 3GVPA 3IAAA 1WA5A 2HIHA 3T9FA 4BJ5A 1RAEA 2P9YA 4EFDA 3EQ9A 1R8YA 5BMVB 1X94A 2Q45A 3GQVA 3OOWA 1Q6ZA 3LUCA 1QYWA 2CNWD 2QQ0A 3A8TA 2EIHA 1O95D 4L85A 4X71A 4MJ7A 2G9VA 4M49A 2FVYA 3P9RA 3GFFA 4JOQA 3QE9Y 3P52A 4MW4A 1UAYA 4J3BA 1E0JA 3MJTA 3I1YA 2NUTA 5L51A 1U8EA 1U5AA 1Q20A 1WVMA 2GZAA 4O02B 3AHCA 2QJWA 3BQ9A 2GBLC 2IEGA 4QU8A 2V0GA 4O2RA 4G5OA 4NCBA 2MT9A 1E0AA 5IVPA 1QZUA 5FEMA 5IH7A 2YZMA 1KBOA 2ATVA 2VRCD 2TS1A 1HSOA 5A3SA 4QLBA 1IAQA 1OWLA 1Z7YA 3DV0A 4UOQA 3QLUC 3MIZA 2O2SA 3BSWA 5CIQA 3E9YA 2OMKA 3ZWYA 2Z2ZA 3WJAA 3TLZA 5AHKA 4EI8A 3FIJA 4WBXC 1RIIA 4LX0A 1QR6A 1T3SA 2XNJA 3OLYA 9ATCA 7GPBA 3ZVMA 1C41A 1OOEA 5K3EA 5ISMA 4BVLA 4WOCA 1TZBA 1R5JA 2HDHA 1UMDA 4QUIA 1VG9B 2OHHA 3RGGA 3PFKA 3JS5A 3O75A 1Z6QA 2YZKA 4WERA 4DJTA 1GITA 1A72A 3B34A 3F2IA 4B4UA 1R7RA 1VL8A 2BFWA 3AR7A 4OLFA 1BC5A 5F7ZA 4OHRA 4C2TA 4OUDB 4ND8A 3BJIC 1D1QA 5ER9A 1SEPA 3HVHA 3S68A 1XX6A 5JCJD 3W9UA 4EHAA 2PZKA 3OTWA 1Z8NA 2BGMA 2I2AA 2WF8A 5AH0A 3UGTA 1KI4A 3FGPA 2EX4A 2BCGY 4R8LA 4EEZA 3GXOA 5CA0A 4XX0A 3KT6A 1QTQA 3EVCA 3W1EA 4MH0R 4Y6LA 3ZWWA 3SLGA 2J41A 4PLFA 1UK9A 4F12A 5D87A 2EWWA 4IDFA 1HSZA 1HE5A 1R6UA 1R64A 3GB9A 3JXEA 3HMQA 3NT4A 4LXQA 4FWTA 4TTRA 5J2TA 1W2WB 1QO7A 2PIAA 1RU3A 1Z07A 3R23A 4O2AB 1TD9A 1YV9A 3DMPA 4IEFB 1KOLA 3UJAA 1RZRD 3NHAA 3F6BX 3AEUB 3DVQX 4Z3OA 3SYMA 2VUUA 1X9GA 3P9ZA 4ZJYA 5EJ5A 3PNKA 1JHZA 1M2FA 1L7EA 4MUGA 4N6NA 3IQFA 2O8BB 3GGDA 1YF3A 7AT1A 2BW0A 1DT3A 5HWSA 4KQCA 2C57A 2PUGA 2CUKA 4X64B 2GVZC 1M1XB 1W8IA 5CFMA 5CX1A 3F4KA 1L5OA 3VI4B 5G1NA 4MCJA 2JFZA 1E8NA 3A9RA 1P1HA 4Z7QB 2ALJA 4XTRA 1QIFA 1SUCA 2BEVA 2I0FA 4ZTUB 5E8JA 4HLQB 1LF0A 1LA2A 2YFHA 3ROEA 1YU6A 4ZK2A 1K5HA 4HLDA 1XMJA 3BE5A 2VT3A 2FMFA 4XX0B 5T6BA 3GMDA 2CYBA 5CNIA 1JYEA 1H2FA 1KI6A 3PGJA 2FLWA 2GJSA 2UU9B 5B1HA 1J56A 3ELDA 4U3JA 1U2ZA 1QRRA 4CL0A 3P0FA 1Z73A 4QTXA 5BQXA 2R4TA 3L40A 1TKAA 1YB1A 4QUOA 4JNDA 1LLQA 3BIWA 3ZLBA 2H85A 1MO3A 2KYRA 5U9CA 1YA6A 1FQOA 1HI9A 1PKXA 4TSFA 4FTWA 5DLYA 3JQ9C 2VXBA 3MWLA 5JI3E 3I8SA 3KXLA 3EIWA 2PZGA 3CEMA 4YY3B 3ZGLA 1I1OA 5HW0A 4KQ2A 5CNKA 1QTNA 1U3WA 5JWHA 3UHJA 2VQFB 1IDN1 5EZ6B 1ZGHA 2JIMA 3QHPA 4D25A 4KIGA 4TZKA 2C78A 3SYNA 1RADA 4P08A 2XWQA 4L57A 1N1GA 1E2MA 4H17A 4LCEA 5TQ2B 1EK0A 5BMVF 1MJGM 3TGLA 4MR7A 1Q3HA 3RYFA 1WMEA 3RHTA 2XYHA 4OA5A 3D8UA 4Q24A 4RV4A 3W4KA 1R6XA 1JQ5A 2MSDB 3JCZA 5M34A 3A4MA 4K2HA 2HQBA 1XCBA 2OILA 3R7NA 3PKZA 5C8YA 4DLNA 3I9NA 1JN0A 3OX2A 1JL3A 4M1KA 4YUYA 4KQKA 1CIPA 4I66A 5JG7A 5LOVA 3PJRA 1ISJA 4MCAA 2UYCA 1RYDA 3GLFE 2NU8A 1M34A 2EW2A 1M2KA 4BJHB 1BOOA 3AP1A 4UHDA 4ZQBA 1RYMA 2TSYB 4F86A 2AJCA 3SF0A 1YRLA 3OICA 3FROA 4RGQA 1ADJA 1AKMA 3G59A 4NMLA 4Q4HA 3FOCA 2C00A 3GZTB 3M1IA 3V2UA 4L72A 2DKOA 2V5AA 3BILA 4B87A 1FUKA 1Y9ZA 3E0XA 4FVTA 4LJ6A 4UU1A 2N1MA 3HK2A 3G5AA 3K5PA 4EVIA 5K2OA 1C1XB 2JAPA 3WAKA 1W5AA 1EXWA 1NBEA 2GEFA 1KXJA 2X6QA 4R9VA 3ASYA 4K26A 4CLRA 3BFVA 4BJ1A 5KYWB 2WQ7A 4LPKA 4XCXA 1MRZA 4JR0A 2P2LA 5CXXA 5TQ2A 3NBYC 3IYLW 3EG9A 1B7GO 1QAMA 3DFIA 3EZ6A 3GGCA 3DPUA 3M4ZA 3MINA 3ZXIA 1UEXC 4XJTA 2RDMA 1P81A 3F47A 4DJJA 2HREA 3PEEA 4EHIA 1XMPA 2J33A 4GSKA 4Y9UA 2EQBA 1PE0A 1SN7A 2FG5A 3UQZA 6REQB 3PF8A 3A1SA 3IP5A 3AG6A 3OT4A 5AK4A 3TF5A 1HDGO 1KJIA 1S2IA 1S4QA 5TVKA 4L15A 2VAPA 3W1WA 1IXSB 4ROTA 1OX5A 4BUCA 1T5TA 1LK5A 4FW8A 4NE7A 4JVNA 1S3GA 1RC1A 4AJ1A 1HZJA 1JU9A 2C7BA 4WZZA 3ICWA 3JPWA 3ZNOA 3BTOA 5A4KA 3TXXA 2QVXX 4BKPA 1YQWA 1IPHA 4WKGA 1WQ4A 4NZMA 2ZYAA 3I28A 2MAOA 1PEDA 3GG2A 2OBLA 1Z0FA 4OQYA 3UFXA 2J9GA 1DZ3A 3PICA 5IT9A 1AQ6A 1VB5A 3AFGA 3T7RA 1F2VA 2X2FA 1IIRA 1K3FA 1JSZA 1QLJA 2YDYA 4PLGA 4Q7EA 3SU8A 5BUZA 3UPTA 1I01A 3LHIA 3TD6A 2PY6A 2ZM5A 1SB9A 2PKWA 2QTBA 3C5HA 3PG5A 1AG9A 4LJ7A 3BSYA 5DYIA 2XDYA 3SC4A 3WTBA 4OHCA 3C3EA 1WXXA 5EKSA 1K4KA 2B25A 1W4LA 3DO5A 4Y0NA 5LVAA 1OTXA 4YLYA 4G0QA 2F3SA 1YACA 3LWBA 2QOEA 1QYVA 3GFBA 1AQJA 3FUDA 4Z1MD 5FI5A 5JZMA 5DNCA 2JEZA 3KZ1E 2DH5A 3REQA 4HX9A 1XNGA 5DGTA 1NF8A 5MFZA 5B3KA 1HT0A 4FFMA 1UKAA 2PU7A 4UZEA 4G25A 4KUEA 3RNOA 2JHGA 5EUMA 3WDSA 4YCLA 1X9IA 1XQYA 3FVQA 4I9FA 5K0EA 2AOTA 1EK5A 4YJHB 3VPDA 1NXQA 4Q37A 2XJ9A 2Y0DA 1EG2A 3LRPA 4NDZA 1ZW1A 2PXAA 4LFBB 4QQNA 4XUDA 4DIMA 3P0RA 3W7AA 1W9MA 1J06A 5C46F 1PHRA 1T3ZA 4G26A 4RHEA 1HT3A 2JH3A 2OZEA 3ZY2A 3AP3A 3DOOA 4MR9A 2CVQA 3SKXA 2O1WA 3RU2A 4FOPA 1UODA 3C2QA 4OGWA 3LF2A 4URZR 1F17A 1P3Y1 5HFJA 3SD7A 4NICA 1DCKA 4ITVA 1SXIA 1M1YB 2M6SA 4MUAA 3PUYA 4O4IB 1Z29A 4CCYA 2Q1UA 1YRAA 4WJLA 1DAGA 3TD2A 3AR6A 1I3CA 1WXQA 1LSJA 2BOVA 2P4QA 5EWLB 2AC7A 5AW9A 1I6LA 2QLTA 4AO8A 2R8ZA 2HO4A 2Q2QA 4EBBA 4KJZA 3PC8C 4G63A 1U81A 3RVNA 1WIWA 1E0DA 3WXMA 6NULA 1W5BA 3O7WA 4P3NA 1U2GC 1MW2A 1QDLB 3CT4A 1UXIA 4KZKA 4JJ4A 3RYIA 2O8CA 1Z16A 4D3ZA 2CVFA 3WIBA 3UT5B 2WW8A 4DR4B 2RJNA 1OTHA 3NKLA 4HEQA 1MA3A 3B9QA 3NYWA 1QWOA 1R9NA 3X2SA 5EJ7A 2DFLA 4MK4A 1PJ2A 4YJHA 5FNVA 1NUSA 3PDIA 3RK0A 3TZKA 3VV3A 1F3OA 1W6RA 4YBZA 1Z2AA 5J2TF 4N12A 4CMJA 5LOVF 1NP7A 2OWEA 1HX7A 1NONA 2FOXA 3E15A 3NC1C 3JQBA 2I3ZA 4FK8A 1RZ3A 3OFVA 4FFWA 4N01A 1YB7A 4LC1A 3PFNA 4K87A 2F1KA 1BXRA 2P9BA 1U2DC 2P35A 2QHXA 3OAAD 1GTL1 3SX0A 2P2NA 4EATA 2A0XA 2V03A 2X76A 3ACBA 4IHKA 3RRMA 5L7TA 2ZIWB 3L4SO 1MPTA 4G0OA 4OI4A 4BV8A 5K01A 4U1RA 3LW7A 1HURA 1KO5A 3PGA1 1ZR4A 1O54A 2NIPA 1E99A 2Y6VA 4IV8A 3ENKA 4Z9YA 4PQRA 2HRZA 1IN4A 1SXHA 1I7QB 2R87A 5GGYA 3CM0A 1PTJA 2IEIA 3U80A 4RTOA 1TLTA 5EKDA 2GLUA 2VTKA 4EBFA 5KYWA 1SZJG 2Q5CA 2R7KA 3ME5A 4NH4A 2I33A 3GP3A 5JAHA 4O3FA 5DXAA 5ALVA 4K2AA 4ZVSA 1I3MA 1UM9A 3DWIA 1YQTA 1VYTA 3SAJA 1DS6A 3OJ0A 1SR8A 4GRDA 4NQRA 2GF0A 2FNAA 1XB2A 2QZSA 1WMBA 1OJ7A 3ISJA 4HJXA 4HSEA 2PKQO 3KOXA 1CQJB 4WNAB 1G4HA 1PGPA 3R8CA 2HJGA 5HG0A 4KDRA 4EYSA 1P2BA 2DJ5A 2I4NA 5BWNA 2ZYVX 1U3TA 4G86A 3J80A 1YBFA 4B3GA 2C5EA 2YMQA 1EM6A 1NWCA 4LNHA 4ND4A 2YYZA 3C24A 4RWZA 5GJCA 1P4JA 1LLFA 2BTOA 3K2EA 2R68A 3G2KA 1XCPA 2HC9A 2VQ3A 1LI7A 2CV0A 4B73A 1E9FA 4YJ3B 5LMZA 4D9NA 2H2IA