1R0KA

Crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
386
structure length
380
Chain Sequence
SQPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIADPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTVALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPFRTTSLAEMATVTPERAVQGAKISIDSATMMNKGLELIEAFHLFQIPLEKFEILVHPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAPDYERFPALTLAMESIKSGGARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPATPSSLEDVFAIDNEARIQAAALMESLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from Zymomonas mobilis at 1.9-A resolution.
pubmed doi rcsb
source organism Zymomonas mobilis
total genus 126
structure length 380
sequence length 386
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2003-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1r0kA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1r0kA01
3FNFA 3RUHA 5JY6A 4KP7A 1JWBB 4W7HA 5JDIC 3CKYA 3VPHA 3JQ8B 5AVOA 4D3FA 2FRDA 4YAJA 1DIRA 3L6DA 3BYZA 3E6AA 1BMDA 3JD2A 4WCFC 1FDVA 3DBRA 2WM3A 3ASUA 2YZ7A 5G0SA 3RUDA 4OIMA 4GKBA 1MA0A 1E3IA 3UHAA 4B7XA 3HSKA 4RVDA 1AUPA 3OMLA 1B0AA 4HNGA 4QQRA 3ZWWA 2EKPA 3N58A 5KKAA 5ER9A 2J3HA 2YV2A 4Q39A 5I8ZA 2VT2A 4Q3NA 5CPFA 3BXXA 4A10A 4HY3A 1TXGA 2BKAA 1E7WA 3PQEA 1NVMB 1E6UA 3DMTA 3MZ0A 1F14A 3I6QA 3VPSA 4E31A 2AQIA 4BNVA 3COSA 4O5OA 4CR6A 4L73A 2JD0A 3BMCA 1LLQA 4XKJA 3TQHA 1OR7A 4JBHA 4ZQGA 3RC2A 2BGKA 1QORA 4CM3A 3AFMA 4BNKA 4LGVA 3H65A 4NBUA 2GRAA 1K3TA 4XGNA 3ZWBA 3EYWA 3NT5A 1XGKA 1F12A 3JYOA 4JJGA 2WYWA 4CMEC 3L4BC 3E1KA 3H9QA 3QVSA 2WE7A 2EW2A 4MVJP 2G1UA 5ENVA 4K28A 1KEUA 2WYUA 1K0UA 3PHHA 3PJFA 5B4UA 4W99A 4YJGB 1C1DA 3GNTA 1OFGA 1YQDA 2PKQP 3EC7A 4F46A 2QYSA 1YO6A 2WD7A 2O7GA 3WGGA 4JBGA 4KMSA 1JVBA 3OJEA 5GZ6A 5LDGA 4MKZA 4RORA 2W90A 3PK0A 4YBZA 5TT1A 1DLIA 4NHEA 3GDFA 4BKOA 1PZFA 2RBEA 3D5TA 4AJLA 1ORRA 3ZWPA 1DB3A 3OEWA 3EGOA 1J0XO 1SO8A 3VAZA 2HUNA 3ZN2A 1N7HA 1LEHA 4DVJA 2HRBA 3WTCA 2DTEA 4MKXA 5TSDA 4PLPA 2QRLA 5H83A 4WE3A 1XU9A 2JD1A 1Z74A 2GZ1A 2OO5A 3OJOA 4BNFA 1ZJYA 4XYEA 4CLEA 4M55A 3CZGA 4MIOA 1HTBA 1ID1A 4ZA2A 3GAZA 3H5AA 4QFCA 4YAGA 3M1LA 4FR5A 2X86A 1O95A 3QWHA 4GX2A 3ROMA 3PYLA 1IPEA 3H2SA 1XA0A 1B3BA 1ZS2A 4JLWA 1X14A 3IOYA 3TNLA 5IXSA 4Z3KA 4MVJH 3OQ6A 3NYWA 1P1IA 4Y6RA 1D4FA 3RCBA 1LDGA 4OYRA 1RYDA 3VDQA 2Q1TA 4FFOA 3KZVA 2C07A 1Z73A 4AVYA 3FPCA 5L95A 4CUJA 3VZQA 3AI3A 3BTOA 3QIVA 3WWYA 2E82A 2X0IA 1P44A 2H5LA 1KY4A 3WXBA 4YEDA 4Z0PA 5F3RA 3HN7A 2GR9A 4FCCA 4IDFA 1YOVB 3PGXA 1IOLA 4CMCA 3ZWYA 1MB4A 2G82A 5AXCA 2PWZA 2NM0A 3GZNB 5T8KC 5FEUA 4LW8A 4P38A 1KVQA 3HFSA 1WNTA 1U7TA 2XF8A 3G1TA 3JQAB 1EK5A 5ITWA 1PZHA 3VVBA 1HZJA 5THQA 3DOCA 5F1OA 4W9NC 1OI7A 3MJTA 4ZVVA 4DYVA 3Q2KA 5IZ4A 3IKTA 4NFHA 1J5PA 1NQAO 2VWHA 4Y67A 4JGBA 1D1TA 2OFPA 1YQXA 2EKQA 3TZKA 3D5QA 3FI9A 1RP3A 3RU9A 2HQ1A 3A14A 5EMHA 3PLRA 4AJ2A 3O26A 1Y7TA 3AY7A 1TT5A 3F9IA 3C8MA 3BMOB 4CMIA 1QMGA 4DPMA 3L4SO 2B35A 2D3TA 5DULA 4II3A 3DBHA 1EEHA 1LSOA 1ZZEA 4J7UA 3KETA 3VKVA 2C2YA 1WLYA 2NACA 1IPFA 4HADA 4INAA 1I2BA 3BTUA 5TJ9A 1GUYA 5EIOA 3T4EA 2DU8A 1R0SA 3D3WB 1YVEI 1RJWA 4NIMA 3NJ8A 3PGJA 3ZWCA 1HF3A 2PY6A 3Q9NA 2O48X 1LDNA 1R4MA 2X0RA 4CM7A 4HXYA 1QYCA 3WYEA 4WLEA 1HSOA 2QW8A 3AFNA 1MW2A 3ZNPA 4XR4A 2C7GA 5HWSA 3ZHBA 1VRWA 1O0SA 1DFHA 1VPDA 3DHNA 4BO8A 4YT2A 2WDZA 4YRBA 3N74A 2YHUA 2DBVO 3NV9A 3PI7A 1NX6A 1YQGA 5AOVA 3FPLA 2RH4A 3PJDA 3HADA 5KIAA 1FF9A 3PJGA 3FWNA 3DMTC 3K2BA 2Q46A 1AGNA 3GEGA 4R4JA 3B70A 5C5IA 2A35A 2FZWA 4MVJF 4PZDA 2I6TA 3RJ5A 1U3TA 3M6IA 4NR0A 4WGGA 2HJRA 5G4KA 3HE3A 3PRJA 3CZMA 1H6AA 1PX0A 1Q7CA 4R9RA 1QYWA 3V2GA 1AN9A 3VPFA 3ZW9A 1WDKA 1UH5A 1P77A 2AG5A 2VWGA 3CMCO 3I52A 1HE2A 4W4TA 3H6KA 4XB2A 4F6LA 2AQHA 4HX5A 2VHXA 4NBWA 5T5QA 3EZLA 1W73A 2DT5A 4RPGA 4I5FA 2I3GA 1CJCA 2GN4A 2UVDA 1O89A 2CY0A 4J9VA 4CQMB 3L6OO 2W2LA 3ROPA 3T4XA 2IYPA 4QECA 1UAYA 2P5YA 4M1QA 3DXFA 4DL9A 3GT0A 1UXGA 4JN6B 1XG5A 4DTIA 1EVZA 1M76A 3OICA 1PQUA 5THKA 2ZJ0A 3ZWXA 3KB6A 3ZWMA 2ZB4A 1JKFA 4RPHA 3ZNOA 4J90A 1GCUA 3UXYA 1AXEA 1ZSVA 3I9OA 3O03A 4NQZA 3EW7A 1LQTA 1DLJA 4HBGA 4YWJA 2IRWA 1HZZA 2J5QA 4DA9A 4NK4A 3EK2A 5L7YA 2NUAA 1I3KA 1PL7A 2YV3A 5F1PA 2CF5A 3GAFA 3V5NA 3W8FA 2X5JO 4B4VA 3UAGA 3OJFA 1WPQA 3A9WA 3WOHA 3KYDA 4J2HA 4WCDA 4E32A 1EMDA 2A94A 4MVJI 2VYNA 2WSBA 4DIBA 3DR3A 1PJ2A 3S2GA 3WBFA 1WW8A 4CM4B 2ZYAA 2C54A 1OZAA 2GN9A 5AQ1A 3JYPA 4ZQBA 1EUZA 1QKIA 2RH8A 3C7DB 3PIIA 1MG0A 4J1SA 2R6JA 3IP1A 3GFBA 2OGUA 4IQ0A 5JS6A 4NU6A 1LSJA 3ZU3A 1PS8A 4AYSA 3QY9A 2BFMA 1WDLA 3ONFA 4ZICA 1P1RA 4Z9YA 1R66A 3RKRA 1PJSA 1GEEA 2POQX 1DFGA 2Q1WA 4CM9D 5C7IO 4OKNA 3KYCA 1OC4A 2P91A 4BO1A 3CMMA 5T6BA 2JCYA 1M67A 3OA0A 4BNGA 1GPDG 2IE0A 2V6BA 1JWAB 1I5RA 4I08A 3E8XA 2FSSA 2G17A 5DCUA 4PG5A 2P9CA 1LRLA 3NGXA 4CMBA 3ETGA 1YBMA 3E9MA 1P33A 1QYXA 2B4QA 3ITDA 3K8ZA 4U5QA 5JNLA 2VUSA 3ANMA 3INRA 5EQDA 3VC7A 4YT8A 3ST7A 3U4HA 2X5OA 1F0YA 3QVTA 4DMMA 3GGPA 2Q3EA 3K30A 1NAIA 3RUCA 3LK7A 2EXXA 4XIYA 4HFJA 5CEFA 4R1TA 4IDEA 4QO8A 2A4KA 3JQAD 3P2YA 1NPTO 3QA9A 4BO4A 5BT9A 3ONEA 4C7JA 4E0BA 2Q45A 5IDYA 2E37A 5JFOA 1K6XA 1U7HA 2UUPA 1A27A 5C7OO 2X9VA 3S2FA 1CIVA 4WKGA 4EGFA 2VT3A 4PZEA 3LC2O 5KJ1A 2HCTA 4L0QA 2YQ5A 4E3ZA 1Y5RA 4IDBA 4KTVE 4IJUA 2EP7A 4NFYA 1PL8A 2YV1A 3JV7A 3PXXA 5DT9A 5AYVA 3KHUA 2CDAA 3T7EA 2ET6A 1C0LA 2DVMA 5JAZA 1P45A 1B7GO 4ONEA 5L7WA 2GF2A 4FDAA 4BKQA 3AUAA 1G6KA 1G5AA 3WTBA 3D7LA 2GGSA 1BXGA 2Y1OA 2B5WA 2VCYA 4GSLA 4FC6A 3SJUA 1W0CA 1X1EA 2PZLA 5G0VA 1X0VA 5BNFA 5DDIP 4DBZA 1ZBQA 3LC7O 1PU2A 1KEWA 2HO5A 3OIDA 3NRCA 4TKLA 4I8XA 3BZUA 3HHPA 2OP1A 4D46A 2OHXA 3CE6A 4PLFA 2NVUA 3VDRA 2Y05A 1E3SA 3HZZA 1QLJA 3TZ6A 4XGIA 3RUIA 4TROA 3JYLA 1A5ZA 5T57A 4H7PA 3H2ZA 3PQFA 4JIGA 1UR5A 4PVDA 1DIGA 4NJMB 1QP8A 3B1KA 2W98A 2YW9A 4HFRA 2O7SA 2J3IA 1SEPA 1ZK0A 4FS3A 3WSVA 1U9JA 4DYDA 1I3NA 5A5FA 2Z95A 3GPDG 3HDQA 5I9LA 4FN4A 1T25A 3V1UA 3WGOA 1BTOA 1XCBA 3S2EA 5IN5A 4HNHA 2BGLA 2NWQA 1RM3A 4XZ3A 4YDRA 5L51A 2TMDA 3TZCA 4G65A 4AJ4A 2J5RA 6LDHA 5COAA 4B8ZA 2B4TO 2P9EA 1GYQA 3LT2A 2I9PA 2EKLA 3CH6A 2NVBA 1ZXLA 4B3JA 4R5HA 2ZYDA 5F5NA 4BQRA 2WWRA 1MUUA 1ZEMA 3H5RA 5HRUA 3IKVA 5KVCA 1ISHA 1GADO 1M66A 1VM6A 3CTMA 2GYYA 2BD0A 3SLGA 4YT4A 1DFIA 2BELA 2VUTA 3UICA 3ZWVA 4CQMD 3PFWO 4OXYA 4WCFB 4E5KA 1TI7A 3VH1A 1U2GA 4K9DA 1PZEA 3JD3A 5CDYA 2CVQA 4HFMA 2YFQA 1YB4A 3A1NA 4LK3A 1SC6A 1GFSA 4D43A 1LQUA 1BDMA 5TS3A 4BMNA 1PQWA 4R9SA 1PJCA 1NP3A 1JU9A 3AUSA 4G2NA 5JAIA 2FR8A 2P4HX 4W6ZA 4DC1A 3P19A 4LVUA 1X13A 2B0JA 4BL5A 1YDWA 4FLRA 3V2UA 4EEZA 5KVSA 2VNSA 1B14A 1X1TA 5B1YA 2NQ8A 4BHTA 3GC6A 3JSAA 3LLVA 2QYTA 1PGQA 2G0TA 3BMQB 4OM8A 1HXHA 4A03A 1ZIDA 2I99A 4R01A 2ZB3A 3QW2A 2IZ0A 4GX0A 3HDHA 1YDEA 4BNHA 1JLLA 3I1JA 2G76A 4P8RA 9LDTA 2O4UX 1Q7GA 1R4NB 3DFUA 4Y6PA 4YCAA 3KEQA 2FR0A 3DONA 1C0PA 3E03A 3H9UA 4J16A 5U9CA 1EK6A 2LDXA 3OJ0A 1A9YA 3ZHZA 2QRKA 3BAZA 3QJ5A 2Q49A 5G0WA 2CNBA 5MGBA 1ENPA 4N7RA 2PK3A 1HE4A 5TRTA 4ZQEA 4GH5A 3FBGA 4E6PA 3SBOA 4DPLA 4ALMA 3LQFA 2RHRA 1U8FO 4PN3A 1PL6A 1PWXA 3FN4A 3MJVA 2IZZA 3WMXA 1IYZA 4WNIA 1IULA 3DZFA 4WLNA 5T64A 1XHLA 1XU7A 2OXIA 3ZGYA 3FBTA 3OM9A 3DB2A 4MKRA 4PG4A 5EQFA 5ICMA 1BW9B 4ALLA 2PZJA 1DEHA 3NAQA 4BNLA 2I65A 4FW8A 4EJ0A 3I9LA 2O2YA 3WFIA 3FWZA 4N18A 1NNUA 3G0OA 1J6UA 4MINA 5DNAA 3GN2A 4QTZA 4TZTA 2AW5A 2BRUA 4BKRA 5A9SB 1T2EA 2PKRA 1K6IA 4BQPA 4KUHA 1OC2A 3AU8A 3D4NA 1NVTA 2JD2A 4YR9A 2J5KA 1I36A 1KYQA 2RHCA 2UUOA 3JYNA 4FD3A 1G0NA 4XYBA 3AUTA 1I01A 4J49A 4ZGWA 4RF4A 4IMPA 4PLCA 2PGLA 3WLEA 2DC1A 3UN1A 1ENYA 4E33A 4U0KA 3NT2A 1E3WA 1ULSA 4JJIA 1BVUA 4CLOA 1Y8QB 2DUWA 1NQTA 2D8AA 4PLVA 1U28A 1QV6A 4Y6SA 5JC1A 1DIBA 1U3UA 4LCJA 3BTVA 2PGDA 1A4UA 3ANLA 3GOHA 3PWZA 3TJRA 1UP4A 3GZ4A 4WOKA 3GNQA 1Y9EA 3HQ4O 3KBOA 5JDCA 5CEEA 3WYCA 1ZSNA 1HL3A 2ZIZA 4Q3DA 4XCVA 2HMTA 3KM0A 5F5LA 3TFQA 3GGOA 4MOWA 4LSWA 3DBLA 4MVJM 3UKOA 3JYQA 1DHTA 5JCJD 2HSDA 3I9JA 1E7QA 4IXWA 4OO3A 1XELA 3ZV3A 3FCOA 5G0TA 2NU9A 3WWZA 4RF5A 1I24A 1B2LA 1MP0A 4XYMA 4JBIA 4BB6A 3ZNNA 8ADHA 4IDAA 1F06A 4Q9NA 4WEQA 1E0DA 1N9GB 3D1LA 1GQYA 3S8MA 3OECA 2P5UA 4R16A 4GLLA 1Z82A 4CLXA 1X7GA 4EJ6A 4EJMA 1B8VA 2FP4A 1SEVA 3ZU2A 2R2GA 4GX1A 3ZU5A 5IFLA 3VVCA 3X2FA 1IZ9A 5ER6A 1KIFA 3RFVA 3JQ7B 5IG2A 1PTJA 1YGYA 3A4VA 4CUKA 4EZBA 5AXAA 1HE5A 1SMKA 1FDTA 5BSEA 1P31A 4HKTA 4XGKA 2F00A 4BNUA 3WNQA 3GEDA 3TL3A 3OIGA 5GZ3A 4CM8A 3KSZO 4K6FA 4O1MA 2PFGA 1WZEA 4M54A 4YTEA 4PRKA 4BO0A 1YBVA 2HAEA 3IDSA 2BH9A 4FJ0A 1IHXA 3KTDA 4YQZA 5CEJA 4K26A 2JAHA 3DBRB 3BA1A 2RIRA 4NQWA 1YL5A 4J91A 5DBFA 1ZKMA 3D3EA 1ZJZA 5L45A 1XEAA 4YQYA 2ZB7A 1FDSA 4CMGA 2ZB8A 1P1KA 3IUPA 2Y68A 3IMFA 1VI2A 4AFNA 4CR7A 4E2XA 1PJ4A 2B4RO 3K92A 5DOZA 3UW3A 3VOSA 1PGOA 1HLDA 1DC5A 2ZK7A 4F3YA 3SC4A 2HLPA 3JQBC 1E5LA 1O8CA 4LN1A 2JFFA 1ZK4A 2Y0DA 1GL3A 4GVLA 3BMCB 1LDEA 5A04A 2O3UA 3RKUA 4CM6A 3WB9A 2FY8A 5IZCA 4J4TA 4IXTA 3R3JA 3KV3O 4IDCA 4JQCA 1E3EA 1CERA 1T4DA 3HG7A 3ON5A 4MIEA 2GLXA 3A06A 3PZRA 1ZK2A 3VTFA 3WS7A 3C1TA 4S1VA 1YL6A 1NR1A 1C1DB 4GI2A 1SB8A 2B69A 3MTJA 5F1KA 4QEDA 4E13A 1EFLA 3H3FA 4OSPA 3OH8A 1E92A 3PTZA 5K0ZA 2PA3A 2D1YA 5BSFA 1LXCA 4JNKA 5ILGA 3O4RA 5C37A 1LLUA 2VRCD 4RPLA 5JSFA 5FYDA 2BMAA 4L75A 1WXDA 2X4GA 4JCOA 1GZ6A 1VE9A 1E77A 3VHRA 1GTMA 3UGKA 3OFSA 3U4IA 4NK5A 1ZO8A 5EL0A 2DBRA 1WZIA 4OGWA 4YJFA 4BGUA 1OMOA 3K6JA 5KJCA 3LT1A 4FOOA 4XDZA 3MTGA 5AXDA 3VPGA 4BO3A 5CP8A 3GGGA 3AOEA 2OOSA 2VOJA 5JW6A 3AY3A 4Z3DA 5L53A 3CZEA 1PJTA 1S46A 2GD1O 4CLHA 3R0IA 1N7GA 3M2PA 1ZNQO 1L1FA 2B5VA 4IM7A 1BVRA 2B83A 4YB8A 5EERA 5HS6A 3GFGA 1DHRA 2QIOA 4CXFA 3JD4A 3RD5A 3K5PA 3TDKA 3W4IA 4FJ1A 4TVBA 1ZK3A 1T2AA 3PQDA 1UZNA 2V6GA 5ES3A 2HKIA 1MV8A 1GV1A 1P1HA 1XIVA 2OBYA 3QHAA 1MW1A 3C24A 4RO0A 1T26A 2XPCA 1BDBA 3U5TA 1GUFA 4AJ1A 3QQPA 5KNLA 5I9MA 2YHIA 4DPKA 1P3DA 3RWBA 1Q0HA 2YYYA 1PGPA 5JDCC 3SVTA 3HN2A 3JQAA 2GN6A 4M89A 5JLAA 4TSKA 3O38A 3ICPA 1NYTA 1KC1A 3H3JA 2ZCUA 4W7IA 2XAAA 2VHZA 4P4GA 3BMNB 3MCVA 2PTGA 1WMBA 4MVJA 2VTDA 2CF6A 4WLUA 5DCYA 3E5RA 2QQ5A 2C20A 1VKOA 5KJEA 4CV1A 3AU9A 4IJVA 1YRLA 1Y8RA 2DKNA 1YL7A 4DC0A 4IDDA 3L77A 2P2SA 1HDOA 2RCYA 3ONDA 4I9UA 3ZV4A 3Q1LA 1SCUA 2X0NA 5TC4A 2VRBA 3DOJA 4BNNA 2AQ8A 3GHHA 1CQIA 4NFSA 1TT5B 3VH2A 1W6UA 3GA0A 3UCXA 4R5MA 1ZK1A 3DZIA 4CMIB 4EUHA 3DOOA 4UVIA 3DMYA 4G81A 1UJMA 3H5NA 4OQYA 3DBHB 1XKQA 2GASA 2PLAA 4FPXA 2PD4A 2O3RA 1V3TA 3UVEA 2IYOA 1VLLA 3TPCA 3OQBA 4DQXA 4R1SA 5JE8A 2W2KA 4RZIA 2X9NA 4I5EA 3EVTA 1TEHA 4PLZA 4DREA 1DIHA 4NNJA 3EAGA 3MJEA 5G4LA 3U49A 2HMWA 1C14A 1QRRA 5DZSA 1FDUA 2HMSA 5IDWA 1N2SA 3WQQA 4J0EA 4RZHA 4FIZA 4GAEA 3LLSA 1H6BA 5I7FA 1XWFA 1MW3A 3JCZA 4B4OA 4BGEA 1P1JA 2MAOA 1E7YA 1T2CA 3K2EA 1F8GA 3DBVO 4B3HA 1Y81A 4UUNA 4DGSA 1YE3A 2JHFA 3OETA 4CV2A 4DXHA 1U5AA 5CFZA 3PZBA 4AICA 1LTHR 1BXKA 1K89A 4UAGA 3LSYA 5G4KB 4EW6A 4GSKA 1JKIA 3W8EA 3RUFA 3V2HA 4IS3A 2C5AA 2DTXA 4RV9A 5K9ZA 2FOIA 1IUKA 3WG9A 5IZCC 4YYZA 4CL8A 4L8VA 1JA9A 2H63A 1NVGA 4KQXA 3MJSA 2BFOA 3FRJA 4DQUA 1ISJA 4H16A 2EP5A 2QRJA 1LSUA 4YRAA 4J1TA 3CIFA 3LF1A 4UULA 1ZW1A 3PDUA 3TFOA 1R16A 1Q0LA 3BHMA 3HJAA 1I0ZA 1P1FA 3DWFA 2NVWA 1T4BA 1UP7A 2TMGA 1KVUA 2DTDA 3U4DA 1MG5A 3EDMA 4B4UA 3FR8A 4CMKA 3W8DA 3IC5A 2W8ZA 1W4ZA 2GUGA 2P68A 3MOIA 2XOXA 3WIDA 1LDYA 1R12A 4RGBA 4I9HA 4BO9A 4L9RA 3DFZA 4UREA 4CLRA 4UUOA 1LJ8A 3S2IA 3GG9A 1GDHA 4IBOA 1ADCA 5TF4A 3GY0A 5A03A 3DTTA 2CDCA 3HB5X 4AG3A 1ONPA 3SLKA 1HDXA 4CODB 2PD3A 2DM6A 4D0SA 2WJPA 1PIWA 1PR9A 4QSMA 1RPNA 1B8PA 3KYDB 4YJHA 5FI3A 5BSHA 5TGDA 4DLLA 1HDGO 2Q4EA 4UVGA 3AOEC 4XRRA 2IZ1A 4RVSA 1QLHA 2GCGA 4BNZA 2OL4A 4D44A 4BGVA 1ZCJA 3OHSX 2EWMA 4RLSA 1D1SA 4L4SA 3PHJA 4PRLA 5DN9A 1PEDA 3NTOA 3AM4A 2C2XA 4UUPA 2O2SA 1LC3A 2DBQA 3GDOA 3ZZNA 1NQ5A 4I1IA 4PLYA 3CINA 4RDIA 3GR6A 4GLOA 2NNLD 3O8QB 1VL0A 4W82A 1GU7A 4E30A 4PCVA 2FR1A 2AE1A 3KYCB 3QWFA 3VZPA 1CWUA 1RWBA 1PJLA 1ML3A 5A3JA 3PDJA 3PJEA 1FK8A 1LX6A 3OIFA 3IUSA 4RQUA 5KVVA 2YDXA 3G79A 1NXQA 3L9XA 5JMWA 5EPOA 3CSDA 2FPGA 1LDMA 3ULKA 1M2WA 3B6ZA 2PNFA 3PVZA 1VKNA 2WEKA 3G49A 4CQLA 4DBVO 5KJFA 1SB9A 3E5MA 3WGHA 1YB1A 1JQBA 4OAQA 4XR9A 7MDHA 2AA3A 2NU6A 3GHYA 4EEXA 3HB4X 4WUVA 5TJHA 1U2DA 2X1HA 3C85A 1HETA 4FOSA 2HMUA 5EINA 3E18A 1X7DA 2ZCVA 4OHUA 1Y5MA 5HM8A 1P0CA 1V3VA 4UVDA 2CZCA 4KDFA 3WX0A 4IDGA 3EHEA 3CUKA 3GN1A 5GZ1A 4WOJA 1YB5A 4NPCA 3TWOA 2XXBA 4CV3A 4ZQFA 4WLOA 4RVFA 5JYEA 1U3VA 2QG4A 4IQ8A 2BF7A 1CQJA 4HP8A 3F3SA 3FHLA 1IE3A 1H93A 2GO1A 5DBIA 4UEKA 5JCJA 4CM5A 4J4HA 1EQ2A 4J7XA 4BB5A 1NR7A 2BFAA 1NQOA 1DRVA 4ITUA 3UCEA 5IXYA 4IJWA 1BXGB 3NDJA 3IIEA 2X7HA 2Y99A 2X8LA 1WVGA 2H9IA 1GPJA 2C82A 1GUZA 4R68A 4ND2A 4UEOA 1I3MA 4A5OA 4RPKA 4HUJA 3ENKA 4Z9XA 3VKUA 2NLOA 4GKVA 4BNXA 3M1AA 3BTSA 4ND3A 4Z0HO 5A02A 1AXGA 1NM5A 2EG9A 2NVUB 1HDRA 3CZLA 4D41A 2X58A 2SCUA 4Y98A 5GMOA 4EUFA 3DAFA 3MJCA 2Q2WA 3F1LA 3RUAA 3Q6IA 4TRRA 1C0IA 3DL2A 3JQ9A 4ALIA 4BUCA 3JQGA 3GNSA 4J9UE 3ZDFA 3PYXA 4LMRA 4BV8A 2EJWA 1KERA 3VPXA 2PH5A 4QT0A 1E7SA 4M8SA 2C5EA 4GX5A 5G0UA 1N1GA 5I9NA 1X0XA 5DF1A 3LC1O 1MFZA 3F4LA 3JQ6A 1I33A 4O63O 4YAIA 3DEYX 2AQKA 4B7CA 4L74A 1UDCA 3ADOA 5I7EA 4XYLA 1JGIA 4FLSA 2WTBA 1IB6A 2O3JA 4OMUA 2H6EA 3GRPA 1BHSA 3L6EA 3C1AA 4FFMA 3V1YA 3F6YA 4CJXA 2V6FA 5TIIA 2CVZA 4Q3AA 3IAHA 4IUYA 3HWRA 3ETEA 1BSVA 1AE1A 3I5MA 4KWIA 4C7KA 1FDWA 3SEFA 1LBEA 4XQCA 2D4AA 2J6IA 3LT4A 4IIVA 1MC5A 1DBVO 2W2LD 4B8WA 4FFRA 1HT0A 4YAEA 4FLQA 3OSUA 4HFNA 4XB1A 1U5CA 3S55A 3HDYA 2UV8A 3ZHYA 5LC1A 2EW8A 2J8ZA 2PD6A 4F45A 5CDGA 2C0CA 2D5CA 2R00A 4YACA 3AUUA 3ABIA 2Y1FA 5B4VA 2BFPA 1IZ0A 4J1QA 2YY7A 3AY6A 3IS3A 2BGMA 2HMVA 3I9NA 3SX2A 1M6HA 5CG1A 5CAEA 3QV1A 1YJQA 3AWDA 4MP3A 3KOUA 1ZXBA 1PQPA 2XXJA 1H2BA 1A7KA 4M49A 3LZ6A 2FMUA 3QWBA 1EVYA 1R4NA 3RBXA 3PHLA 8LDHA 1DSSG 2GZ3A 3G17A 3AK4A 4NH4A 2X0JA 4ZRNA 2DLDA 2VRCA 3VTZA 1PZGA 1UZLA 4XD2A 4Y8VA 1B15A 4ALNA 3B1JA 3AI2A 3ZI0A 4U8GA 2Q4BA 4ZQHA 1ISMA 3H9EO 4FFLA 1DAOA 2JHGA 3FTNA 1EE2A 1HDCA 2DPHA 3AW9A 1I8TA 1OAAA 1AHHA 1T24A 1ZUD1 4FGWA 4MIYA 2IEBA 3E9QA 1YBAA 4O6VA 1YWGO 1BW9A 4RVGA 1WMAA 3TRIA 4IJKA 2FPPA 4R3WA 5JPIA 4DMLA 4L4XA 4PZCA 1EBFA 1V6AA 1CYDA 2VWQA 1DDOA 4QX6A 1LDBA 3NTRA 4XJTA 1O94A 1U1IA 1ZMOA 2BI8A 2AMFA 1PR3A 4XWYA 4O59O 4J4BA 1G0OA 2VOEA 1I32A 2A92A 3ROQA 3C3XA 1V3UA 1MW0A 1OOEA 4NG5A 5BR7A 3RROA 3ZV5A 7ADHA 4P4LA 1S6YA 1KOLA 1H0KA 1J49A 1C3VA 2CSUA 2ZKLA 1NPYA 3ORFA 5L7TA 5EN4A 1C1XA 4URFA 2VWPA 1DPGA 4EDFA 3GUYA 4L4RA 5JYDA 1E3WB 3IJPA 3OBBA 4EITA 4FFNA 1LSSA 1ISFA 2IODA 3DHEA 4CLOB 1SOWA 1QR6A 2QHXA 1DC3A 2VHWA 3KSUA 4BMVA 1CDOA 1ZVMA 1CETA 4OXNA 3RAJA 2ZTUA 4AJKA 2NTVA 4J3FA 1VC2A 4WNCA 1SOVA 3FNEA 4U7WA 1HDZA 1ZEJA 3W6ZA 5U4QA 1P74A 4OKIA 3GPIA 1GQ2A 1LNQA 3L07A 1XYGA 1VL8A 4DWVA 3LF2A 4ROSA 3DBLB 3OQ1A 1UAGA 3HDJA 4MVJG 4A73A 4BO2A 5GY7A 6ADHA 3ZH2A 1E6WA 3QP9A 3L9WA 1JVSA 1K6JA 3X2EA 1UXIA 2I66A 1Z7EA 5KCZA 3HFGA 1DC6A 1KVTA 2FWMX 1R6DA 4ND1A 3JQ9C 4K6CA 4JK3A 4B7UA 5JY1A 3WJAA 1IY8A 2Q2VA 4JJFA 1PJQA 3JQ8A 3AI1A 1T1SA 4RF2A 4IZHA 4WEOA 3JD0A 3JQFA 3R6DA 1U8XX 2GNAA 1GV0A 2HRZA 4RF3A 4BVAA 2Y0CA 1GY8A 1ULUA 4RPJA 3MEQA 4FGSA 3RI3A 1QXSA 4GWGA 1B16A 4NU5A 3GMDA 3LT0A 1Q2XA 2Z1NA 4E5NA 5I7SA 4D79A 3PHIA 5HTOA 1V0JA 4ILKA 4J7CA 1YXMA 1B8UA 4NMHA 3D4OA 4R1NA 3NT4A 2PZMA 4D7AA 1R15A 3RC9A 4LRSB 4LMPA 3TOZA 4OH1A 4CM8B 4B4WA 5A1TA 3DC2A 3NX4A 1FJHA 2BI7A 4BNYA 4YT5A 2UYYA 3TOXA 1ADFA 3FD8A 3N7UA 2NADA 1TT7A 2X5KO 3NDRA 1HE3A 5L4SA 1QG6A 2JFGA 3RC1A 1BGVA 3INGA 2VNAA 4DLBA 4E5PA 4A2CA 4C4OA 1UDBA 2P4QA 3W4KA 3RJ9A 1HYGA 4EUEA 2EHDA 1DO8A 1VJTA 5CG2A 3UCFA 1ADGA 2R00C 1XDWA 3WFJA 1MLDA 4AJEA 3GVCA 1EDZA 2FN7A 2CVOA 1TVEA 1RYEA 4UVHA 4IS2A 4BMSA 5K6AA 3NDIA 1NHWA 3KSDO 3ZHXA 2AE2A 4YJGA 2I76A 4NBVA 3NGLA 2I3AA 1LRJA 1U4OA 3ROKA 4QUKA 4TRNA 3CZRA 1U4SA 4D42A 4J1NA 3QVOA 3TZHA 5T67A 3H8VA 1GZ3A 1LI4A 4YXFA 3UUWA 2DUUA 2MAPA 2NU8A 1JG9A 2Y1CA 1LLCA 2V6MA 2WD7B 5HS4A 1SAYA 1G1AA 1N5DA 2JFHA 4WLVA 4J2OA 4KOAA 1VJ1A 4ID9A 4G5HA 4U6SA 1TA4A 1XQ1A 3I6IA 1N8KA 2V7PA 5ADHA 1Q1NA 4NDNE 2JL1A 3WQSB 4JP3A 3MOGA 3WICA 5FWNA 1SNYA 3U0BA 3GRKA 3KEOA 1LLDA 4XRGA 5I8WA 2Y0EA 3EMKA 1MC4A 1GZ4A 3VH4A 2JCXA 4FB5A 4KUGA 4OOEA 2VQ3A 1V8BA 1H94A 2DFVA 4PIVA 4RLHA 4UUMA 1YONA 3GH3A 3I9KA 3UOGA 1Z6ZA 4D3SA 4R1UA 4NZ9A 4QFDA 4WECA 3WLFA 2ZQZA 1LA2A 4IGFA 4I5DA 4CM9A 5TX7A 3ASVA 1C0KA 1E1LA 4Z6KA 1ONOA 1EBUA 1HYEA 1Z75A 4AJNA 5BNTA 1HEUA 2D0IA 3ANNA 1Q7BA 2P9GA 1ZFNA 4MP8A 1KY5A 4PFJA 4AJHA 1B26A 4YJFB 4YJDA 3WJ7A 4E5MA 1MXFA 1VJ0A 4GMFA 2DBZA 5B4TA 4E12A 3DZJA 1VSUA 1ADBA 2J3JA 2OBNA 5F21A 2O23A 4BO6A 4CMJA 4ALJA 1H6DA 1YOVA 3B20A 3I9MA 5IDQA 4P4NA 3TL2A 2PKQO 3AOGA 4PG8A 2VN8A 1K2WA 3UF0A 3U09A 4L76A 2BLLA 3H9JA 3KYBA 4PLGA 4TKMA 1NTOA 3GZNA 3ICCA 3NEPX 1YKFA 4R3NA 1HLPA 4RDHA 3VZRA 4BS9A 2GERA 3FF4A 4E4YA 1WDMA 1TB4A 3PWSA 2WMDA 1JW9B 4GL4A 4N54A 2YQ4A 2PR2A 1Y1PA 2GSDA 4ZD6A 3UH1A 4E2ZA 3RBZA 2YHIB 4R51A 4S3MA 2VYVD 4Q3BA 3SJ7A 4OXKA 1KEVA 1PSDA 5FF9A 2O3SA 4CV0A 1A72A 3BMNA 1H5QA 4YRDA 4DRYA 4FSHA 5ITVA 4Z0TA 2X6TA 3W1VA 4AJJA 1DRWA 1PS9A 4DIFA 3AM5A 4N5LA 4KZPA 2AEFA 1XR3A 2YFHA 1EVJA 3QWAA 4OJNA 4AJPA 5JC8A 2JKVA 4OOFA 1L7EA 3BMOA 4CM1A 1YH3A 4FJ2A 2B36A 2NV6A 3U62A 4NJOA 5BNIA 1ENOA 3G1UA 1E3JA 1Z7BA 3KLPX 4J6FA 4Q3EA 5KWEA 1E7MA 1X7HA 4XDYA 4RL6A 3UERA 1KBZA 2NQTA 2PH3A 4FQ8A 1JN0A 1Y8RB 3Q3CA 2Q99A 2E49A 3D3WA 1ONNA 3E82A 3JQFC 4MO2A 2DAPA 3WQRA 5CDSA 4XX0A 5MDHA 4J0FA 1UXHA 1B3RA 2OZPA 4JROA 2C59A 9LDBA 3DZKA 1H3LA 5CPBA 1HSZA 3GEMA 2GN8A 1BRMA 5TT0A 3VZSA 2JCVA 1R4MB 3FNHA 1RM0A 4PLTA 5B37A 1R37A 2E6UX 1HWYA 3IP3A 2YUTA 5A3VA 5COBA 2VHVA 3KXDA 1DIAA 3V1TC 1EQUA 2W2KB 2ILTA 2GZ2A 1UXKA 5BSGA 1NFQA 4ALKA 3ETDA 3M2TA 5I7VA 1F17A 1ISIA 4ZN6A 3WBBA 2HJSA 3JTMA 3K96A 4XQ9A 3WIEA 3CPSA 2EF1A 3ZW8A 2CMDA 4PG7A 3ZWNA 4HV4A 2EGGA 1GEGA 2PV7A 4IQGA 4FBGA 4RCVA 5JXWA 1BG6A 3NKLA 3PEFA 1U3WA 4IY1A 5K6AC 3ZNQA 3GUCA 3C7CB 1WWKA 1EDOA 1L7DA 4CQMA 5A9TA 4PGFA 3QWIA 3P7MA 2Y1GA 5EJ2A 1J4AA 3QVXA 3U4CA 3OJLA 2EGHA 3GQVA 3WNVA 4ND5A 2AHRA 1MGOA 4LUPA 1JKJA 1A4IA 1JDJA 1R0KA 1KVSA 1NFFA 2EJVA 5L4NA 4OL9A 3CXRA 4YPOA 3O9ZA 1I2ZA 2OORA 1FMCA 1T2FA 1TLTA 1GR0A 2GDZA 4FC7A 4TMFA 1GYRA 4II2A 4ZU3A 3RU7A 1O9BA 1SPXA 2VTEA 5FFFA 4OSOA 1QSGA 1M6WA 4XQGA 1SBYA 5IAAA 4TWRA 1KETA 2E48A 3RBVA 3L0DA 1EUCA 3QSGA 2UDPA 1Z45A 2I5PO 2OP0A 3LDHA 5IJZA 2C29D 1NHGA 3HUDA 1E1MA 4CM4A 3TN7A 4M86A 3WGYA 4E5YA 3WSWA 2DFDA 3GK3A 4WK6A 4CLRB 4CMAA 2F1KA 3D4PA 4PG6A 3RVDA 4BNMA 1WAMA 2Q1UA 3MWEB 1I30A 1ZMTA 4RVHA 4UEJA 3RUEA 2AG8A 3HNPA 2ZATA 4OQZA 3TF5A 3NUGA 1N92A 1ZSYA 3ZWOA 1MFPA 1DAPA 3R1IA 3WYBA 1A7AA 4YJHB 3OP4A 2NTNA 4A27A 4TRJA 1UUFA 1GAEO 4RVUA 4CUZA 1O5IA 3GLQA 1T2DA 4BO7A 1EUDA 4JX8A 4A0SA 1GQQA 1YJ8A 1H2HA 3F4BA 3RASA 2VZ0A 4BNWA 2E4AA 1F8FA 5JMPA 2Y67A 3FR7A 1E5QA 3GVIA 3O8QA 5HA5A 3RIHA 3S1LA 4E2YA 1E7RA 1CRWG 4K1LA 1SZJG 4LRTB 4N5MA 2ZTMA 3FSRA 3SXPA 5TNXA 3MWDB 1P0FA 4CMHA 1ZH8A 4GGOA 3H7AA 3RFTA 1W8DA 2PZKA 2O4CA 1E3LA 5IN4A 3QE3A 3RC7A 4ZHSA 1UZMA 4BOYA 4QO7A 4BNTA 2WD8A 2X22A 4E2WA 2ZYGA 3FNGA 3PP8A 4GGPA 4WPGA 4KWHA 4PLHA 2IEDA 4BIIA 3RSHA 3DDNA 4IIUA 1YS4A 4TRMA 3LVFO 3SC6A 1EFKA 2Y1DA 3LYLA 4D3DA 1DXYA 2EEZA 3GVHA 4P22A 4X54A 3WGIA 4DUPA 2C7VA 5J23A 4CQLB 3MJ4A 5JO9A 5KOIA 3JQCA 4LISA 3DZGA 2HK9A 1A71A 2Y66A 3DAGA 1AHIA 2HU2A 3IL2A 4IINA 3JD1A 5L4LA 1NPDA 4XIJA 1KEPA 1Y6JA 5EESA 2D59A 1ISGA 4MVJD 5KTKA 2WE8A 2NSDA 1H9AA 3OA2A 4GMGA 3BIOA 1PGJA 4CLDA 1JTVA 4Q3CA 1D8AA 4U0JA 4ZJUA 4BGIA 4D45A 4KTTE 3U9LA 2H1SA 3WMWA 1DRUA 4BO5A 2B37A 2FSVA 3PLNA 1WP4A 1LRKA 1VL6A 3G3EA 3UEQA 2EIHA 4MPDA 4BKPA 5JAMA 4XQEA 2YJZA 4NJMA 3I3OA 3EZYA 4KQWA 3WR5A 1KVRA 3IQDB 3F5QA 2ZTLA 3ZCXA 3I4CA 5C7LO 1QYDA 3DQPA 5ILOA 3DHYA 3AJRA 1P9LA 3RFXA 4A7PA 4FLOA 1I10A 2HDHA 1EVIA 4IZIA 3CEAA 2IXAA 4BNJA 4KDEA 3F47A 4J43A 3PYMA 3W4JA 4XEHA 3ZWAA 2WPGA 1HDYA 2HK8A 3EVNA 4CL3A 1GCOA 3QLJA 3JQEA 5KVQA 5KKCA 5CDTA 4Z9FA 4DLAA 3NJ4A 1DOHA 1K5HA 1BWSA 4MP6A 4MVJE 1Q0QA 4BV9A 3ADPA 2DPGA 3ZU4A 4D0RA 4GWKA 3H4VA 3JQGB 5KJ6A 1H6CA 5JBIA 5U1PA 2Z1MA 5JDIA 3KO8A 2O3TA 3Q0EA 5LDHA 2D5AA 2QZ9A 1XLTA 3STHA 2Y93A 3P5SA 1CEQA 5A06A 2PGJA 4CR8A 3DO5A 4GQAA 4WCFA 1E1NA 5A5EA 3W6UA 4EBFA 5DOVA 1QYVA 3E9NA 4ND4A 5B12A 1CF2O 1JAXA 1HRDA 4YA6A 3V8BA 1IHYA 4YVFA 2Q50A 2EERA 2FHSA 3D64A 2NTJA 4NI5A 4GVXA 2Z5LA 4XYGA 4LSMA 3JQDA 3K9QO 4H3VA 1GD1O 1XQ6A 4RJTA 3F5SA 2HK7A 4GPD1 3ZV6A 4JP2A 3K73O 2AXQA 1SC5A 4R41A 3K31A 2G5CA 4DIOA 2ZJ1A 5H81A 3BMQA 2O7QA 5G2OA 3VH3A 5A4DA 3IJRA 3JQBA 3U3XA 3DZHA 1QV7A 4CMEA 3L4BA 3CZKA 2JAPA 3I23A 3C7AA 4B79A 3QRWA 4KUEA 5CHEA 2QX7A 4NBRA 4YAKA 3BHJA 1LC0A 3T7CA 2CFCA 5L9AA 4JXKA 4NBTA 2VYND 2VZ8A 3D0OA 3E48A 4GBJA 4DQVA 1V35A 3C1OA 1D7OA 1PJ3A 2BHLA 3WGZA 4U6QA 3DZBA 4TZKA 2X9GA 3QVWA 1RM5A 5FI5A 4CPDA 3KRTA 5ENDA 5TQVA 1IL0A 1NFRA 4EI2A 2O3QA 1DJNA 4Y9DA 5C3MA 4MDHA 1E1KA 1LU9A 4RQTA 4HWKA 4A26A 1O6ZA 5L40A 4AL4A 1X15A 3EUWA 4R69A 3TSCA 1BXZA 5DCWA 3WGQA 3Q9UA 1V9LA 4LVCA 5DP1A 1RKXA 2EV9A 2UAGA 2VHYA 1UXJA 2J3KA 1PWZA 4FFPA 5IF3A 1R0LA 1UP6A 3WGTA 3GG2A 3OF2A 3TZQA 1D3AA 5LCXA 2W4QA 5COQA 5A9SA 1Y9AA 4XA8A 4E21A 5AXBA 4TVOA 1S7CA 2GPTA 4PVCA 1I3LA 3FTPA 3PPIA 2LDBA 5A05A 1PGNA 1N1EA 3KVOA 1JAYA 1FXSA 3KLMX 1NWCA 1EZ4A 1M75A 3OEYA 3F1KA 1RM4A 5H82A 3H9GA 1UDAA 2NU7A 2YDYA 1VSVA 1Y8QA 2RAFA 5TLSA 1NASA 3GMSA 4XJSA 3KUXA 4MJLA 1MXHA 1NBOA 4QXMA 1PS0A 3GF4A 4IPTA 5L3ZA 1H9BA 2O50A 1E6EA 2CUKA 4O0LA 2IXBA 2Q2QA 3DAPA 1A9ZA 1I2CA 3INTA 3DTYA 4ESOA 3LU1A 2ZTVA 4BKUA 2IDZA 1C1XB 2VYVA 1DJQA 2V65A 3PIDA 2Q1SA 2VUUA 4M87A 3WDSA 1HKUA 2D2IA 3BHIA 3GVXA 2WYVA 1NWHA 1ARZA 1NAHA 1DC4A 3NTQA 3PHGA 5T8KA 4R54A 3GDGA 5DP2A 3UCQA 2AEMA 2ZQYA 4WASA 2A9FA 4EYEA 3T0YA 3GVPA 4WJZA 5IDXA 1ENZA 3ENNA 1KS9A 3A28A 3ITKA 4W9NA 4B3IA 2OMEA 1MX3A 1EE9A 2FZEA 1PJBA 2DQ4A 4AJOA 2I67A 1N9GA 1KC3A 2VZ9A 2OUIA 4I9NA 3Q2IA 2AEJA 3PWKA 4IGEA 2Y1EA 5HBRA 5JO0A 3RQSA 4TQGA 1OBFO 4ZRMA 5A9RA 3P2OA 4LCEA 2CDBA 1T1RA 2FPIA 4PLWA 2JJYA 3EY4A 2CD9A 3F46A 5BQFA 4BNIA 1MVYA 1HYHA 3B1FA 3AM3A 5ICSA 4H15A 5DBGA 5JAQA 5CDUA 3JQ7A 1XSEA 1GYPA 2X23A 3I83A 4N5NA 4UVEA 3UFXA 2QZZA 4AJIA 1LUAA 5JCXA 3Q11A 4IMRA 4F6CA 3I4FA 4WLFA 3R3SA 4I5GA 3PFFA
chains in the Genus database with same CATH superfamily
4PZ9A 3RUHA 1CZUA 2J1LA 4W7HA 3J81A 2Z4RA 5DV9A 3R5JA 2WINI 4K5QA 4AWAA 2W5UA 2E4UA 1RHJA 1CB0A 2E4ZA 2YHAA 2ZR8A 4MZDA 4YAJA 3V8QA 3VMFA 3L6DA 4L78A 3EX7C 1TTTA 1BMDA 3DGFC 1KRXA 5AI5A 3WQHA 4WCFC 3DBRA 1L3IA 1QH9A 2R5WA 2RC6A 1Y3AA 1OB2A 2QQFA 3KB1A 1G42A 2HPTA 3F7TA 1FS4A 5CFRA 4L5JA 3BGWA 1GNVA 3HYCA 1JG2A 1JGTA 1B0AA 3VZCA 1WU8A 1QCYA 1T4CB 2WJIA 1XCJA 1XOIA 3PXBA 5ALUA 3WLLA 4H0NA 3H16A 3JZDA 5HJEA 2GZRA 2J41A 2VT2A 3LECA 2OHJA 4B76A 2PYZA 3BORA 4HDKB 1XPOA 3DMTA 4LOJA 3MZ0A 2BE7A 3B12A 4E31A 3W9YA 3QFRA 2AQIA 3KSBC 4BNVA 2JFNA 2FCAA 4HAVA 1PZXA 4X1OA 4CR6A 2IDKA 3P96A 2DQKA 2Q9BA 4D5EA 3T1TA 2OFXA 1V8ZA 2ZE8A 4XKJA 3TQHA 3FYTA 4JBHA 3RC2A 2ZKIA 1DGQA 4JSTA 2NO5A 5DLLA 4CM3A 1R8JA 1U0JA 1XMVA 1P7PA 3AFMA 3AO0B 4GI7A 2I8LA 2IYNA 1JXQA 1K3TA 1KAQA 4XIIA 1A04A 4N47A 3ZWBA 5HF9A 4QZVA 1G20A 1F12A 1KFKB 1XGKA 2WYWA 2ZSJA 3BQNB 3L4BC 3E1KA 4QOGA 3R9XB 4LDNA 1ES9A 5K0NA 1JMYA 1Z17A 1WF3A 3KHSA 1D1PA 4U7PB 5CB6A 2FJUA 3FA2A 5K3AA 4Y9RA 1NR5A 5B55A 3CUSA 5ECGC 5HDQA 1OFGA 1S2IA 4W8OA 2OYSA 3TD2A 2QYSA 5TXGA 5DNEA 2WD7A 1KHHA 3WGGA 4HPJB 4QUDA 3RWOA 3M34A 1FXWF 4AMBA 4BB0A 4Y9UA 1XRPA 3GJTA 5FBVB 4KPYA 1K7FB 4MS3B 3PGLA 5SZJA 4YBZA 4XAQA 1FUIA 5TT1A 2AZTA 3AVOA 3TG2A 3K6SB 3MM4A 4BKOA 2BMDA 4QJ5A 4R0MA 1VYVA 3C4JA 4AO6A 3D1VA 2G6TA 3O75A 3EGOA 3P9QA 4HDOB 3TD9A 2WNSA 2XRFA 4CT0A 4LHSA 3ZN2A 1SOMA 3NBQA 4DC9A 1Z8DA 5KMGB 3RR2A 4YP9A 3LUGA 2PUSA 3DTVB 5JAHA 2CLCX 2IF2A 4AN1A 4XN2A 4JT8A 1Z74A 3ORYA 2XBLA 3PD0A 4MQ4A 5FLEX 1JIQA 1ZJYA 4EY8A 4PBRA 3UMCA 2LW7A 1UMCA 5ALKA 3C5WP 1SKYB 4BZPA 3UAXA 4BXOB 1KI1A 1QFSA 3AF0A 3DWIA 3MCAA 4KI0A 1ID1A 1O94C 4FE3A 2UU9B 3H5AA 4I1SA 2ZWOA 4YAGA 5HE8A 1GL6A 1VFNA 4M8KA 4PS1A 3M1LA 1W75A 1XRSB 2X86A 5C5CA 1RWNA 1ULAA 2H0AA 2VEOA 4JQSA 3U4GA 1IPEA 3G8CA 2GOYA 1F7UA 4JLWA 3OPYA 2NSJA 5TMPA 4UCQA 5IXSA 4GE3A 4MVJH 1DT3A 2C61A 1UPAA 1KQPA 1L4GA 4G0YA 1EFVA 5SZKB 1TUEA 1OKKA 4FYYA 3RCBA 4OMFG 3QF4A 1BWQA 5B1IA 4UTPA 1TMGE 4FI3C 4MHSA 3TOSA 1RYDA 3E70C 4H7FA 2RG1A 2WKSA 3H2KA 4HWTA 3VDQA 4JKIA 1QIJA 1GAQA 1G5QA 2C07A 2OVFA 4QBTA 3FPCA 1K27A 3GGDA 3PQ2A 3T9CA 4AVYA 5L95A 1X2EA 2MSNA 2ZUDA 3WWYA 1MDFA 3ESQA 2O2IA 5AVVA 4OHKA 1RXCA 4R5VA 5IKXA 1KY4A 3H7IA 3WXBA 4Z0PA 4O2BA 1G17A 1LNZA 1NXWA 2A9OA 2HF2A 3INNA 2X6RA 4KPGA 1F6DA 3PGXA 1QONA 4R2HA 5DX8A 1SD1A 1GPKA 1JSRA 1OTXA 5ESWA 1NG1A 5AXCA 2PWZA 5IASA 4LW8A 2PT9A 4P38A 1WNTA 2MWMA 3GFQA 4G25A 2WT8A 1EK5A 2XT0A 2LGJA 2WI8A 3JR3A 4BJ3A 4O4JF 4IKPA 1IY1A 1GPBA 1V95A 4C89A 1SXHA 3DOCA 3ABRB 3FUCA 4B84A 4DA7A 1U8EA 1G66A 1Z9BA 4I4LA 4Q03A 4RHUA 1XHFA 5CX4A 4ZVVA 3TRKA 4DYVA 3RVOA 1NQAO 2X0KA 1D1TA 2H1HA 4RQAA 1CFZA 3U40A 2G1PA 2R8ZA 1F6WA 4MQEA 3COWA 4ADSG 3GDWA 1SXJA 3A14A 2IEYA 3G9UA 4H6XA 4RE5A 3PLRA 2BEVA 3UBMA 4AJ2A 4BVEA 2A0UA 1Y1SA 2FEKA 1CYEA 2C3YA 4OX9Y 1NBAA 1WUTA 3DOUA 3KJGA 2ZR7A 3C8MA 1MIHA 1OE0A 3Q3HA 2DQSA 3BE6A 1SBTA 3QJGA 5C8XA 4V0ME 2B35A 2ZI5A 1VA4A 3LGXA 4II3A 4XO4A 3O5AA 1EEHA 1LSOA 4FT2A 4J7UA 1DCTA 5J40A 1RCTE 2AL7A 3VKVA 4X41A 2EJCA 2YVKA 1G5TA 3U3OA 3GIDA 3KVVA 3HCAA 5EIOA 1A76A 3H1BA 4ZMSA 4NIMA 3NJ8A 4B44A 4EVQA 3ZWCA 3HRKA 5FWYA 1E20A 4XX0B 2CE7A 2ZRGA 3QPVA 1NUQA 2MIIA 3SY8A 5KYUB 1HH4A 2X0RA 4CM7A 4YO8A 3TX2A 4XLTA 3AH8A 4WLEA 3RK1A 3WYEA 3OFJA 3ZNPA 4XR4A 3V8RA 4EH1A 4V0RA 3ZHBA 2BH2A 1VPDA 2H4WA 3DHNA 4B6OA 2WDZA 2ONCA 1B2RA 3N74A 4LYFA 1EWYA 1U0LA 2ZUSA 3MRVA 1YQGA 5AOVA 1Y4DE 5K8JB 1XL1A 1JH9A 1T9AA 3HADA 3AYXB 4IHJA 3DMTC 3TH5A 1AGNA 2FYTA 3GEGA 5HF8A 3A1WA 1H5NA 2IEGA 2ZUWA 4HEA6 2AB0A 1L5MA 1UJCA 3FB4A 4MVJF 4M1MA 4PZDA 4UZSA 1I7PA 1ZNXA 3BWYA 4IIEA 1AB5A 2HJRA 2K6GA 4TYYA 4EI7A 4FCTA 2BOVA 4JIMA 1PX0A 1SVUA 5TPWB 5IJWA 3KR9A 2BKXA 2QG9A 1UH5A 4F6LA 3BH6A 2X1MA 4NBWA 3CR8A 3QKWA 4UEQA 2AOTA 4JL6A 4PAGA 1NN5A 3KLNA 3P9NA 3OKFA 5GONB 1OFIA 2KBFA 3NG1A 1LNSA 1MKYA 4GYYA 1YB2A 2C31A 2CY0A 2FFQA 3F8TA 2FE1A 3H5TA 4Q4DA 3IDQA 3ROPA 4EHJA 1ECFA 4E1AA 5F2OA 3E3LA 4ID3A 5KNCH 1UAYA 2WHQA 2V59A 2P5YA 2VT7A 4LXXA 3T3MB 3U7QA 2Z98A 4DL9A 3MUOA 2YZKA 4DCCA 1NW9B 2RBKA 1FSPA 2RHDA 1FC0A 3OIWA 2FHPA 3OICA 4XX1A 1PQUA 5THKA 3V1MA 5D87A 5EG5A 3ZE2B 3ZWXA 4L57A 3ZWMA 1JQJC 4KIFA 4RPHA 5IMBA 3Q44A 1N34B 1J97A 1RPTA 1GAWA 1ZSVA 3O03A 4IG4A 1Z4LA 1JB1A 3NIDB 4JLVA 3FCEA 1KJQA 4HBGA 2BGIA 4YWJA 1O0CA 3FUVA 2DOKA 3PHCA 4NK4A 3AWIA 3M4NA 2QJ1A 1LB1B 1PL7A 1IBSA 3M83A 2G8LA 3TSAA 3OQMA 2WU0A 1BXRB 1KMHA 1T3GA 2CF5A 2DR3A 1Q3KA 3KAQA 2HHHB 4I6JA 5M3BA 1RCUA 3QYFA 4LFAB 2XKKA 1YJAA 3A9WA 5TV2A 4J3JA 5TQ2A 2XJ9A 3LRPA 2Q3CA 1EMDA 4MVJI 3MD0A 5IC6A 3RUIA 4XGRA 3ZIAA 2R60A 3EEYA 1M83A 3HZOA 1NGSA 1XMPA 4KYTA 4MV8A 4Y2UA 5G1OA 7MHTA 3OAAA 4GEKA 4RVNA 4CM4B 1PHPA 1G8AA 2C54A 3JYPA 1WQ4A 1EUZA 4M7WA 3SIWA 2R6JA 2XD9A 1KEEB 2VSNA 1X1BA 4IQ0A 4RY9A 5JS6A 2XSZA 2F8TA 3L7CA 4NU6A 3A9RA 1PX2A 5C32A 4GDMA 3OX1A 1HRKA 4AYSA 2FEOA 3QY9A 4O8ZA 3RT1A 3X1JA 3TUZC 1P1RA 3RSZA 5LQUA 2FXVA 3H86A 4E5VA 2EFGA 3RKRA 1IG0A 1PJSA 2HDNB 3G59A 3U37A 3C70A 2SKDA 4OHVA 4QU9A 1ILEA 3L8YA 4OKNA 3I09A 5HMLA 2P91A 4U63A 1RC8A 2ZIWB 4FHGA 3EGDA 4ZXFA 1UMKA 4JI3B 4JHXA 4D5GA 4I66A 5K8CA 3KZXA 1TLLA 1IXSB 3C0KA 4BNGA 1MVOA 1DUIA 2LIPA 2FU5C 3LPMA 4MGHA 4M1KA 2J3QA 1YFLA 3UZUA 2FSSA 3UPTA 2G17A 3KQVA 1Q7TA 2JEOA 3M5DA 4H1HA 5DX1A 4GPTA 4HX9A 4K9LA 1H22A 3BC1A 3ETGA 5K3OA 3U4MA 5HOQA 2XAUA 5DOVA 3U81A 5JNLA 2BSXA 2VUSA 4UDOA 2O1EA 3RK4A 2AF4C 4TV9A 5AJHA 3QVTA 4DMMA 3KKOA 3RIYA 3X1DA 2QVBA 1O9HA 3GGPA 3K30A 3LUPA 1BS1A 1C30B 2OHVA 4WZAE 2WJ4A 4XIYA 1EM8B 4HFJA 2W58A 5CEFA 1QVVA 1SKYE 1U7DA 2JFOA 3FWHA 1JHYA 4MR7B 4Q66C 2ATVA 2A4KA 3K0KA 4JDPA 4YRLA 4I4TA 4YPVA 2LBPA 1KFEB 1NPTO 1QG2A 3QA9A 2UUCB 4BO4A 1L8QA 3VAYA 1RVV1 3JX9A 4M7PA 2I54A 3EVZA 1NVDA 1K6XA 5A4IS 1U7HA 2HF8A 1A27A 1SXJC 4MYHA 2LIVA 4R1MA 2FW1A 1P5RA 1Q6YA 1IWBB 1GHTA 1KP9A 3LC2O 4PBSA 2HCTA 5KJ1A 2QXUA 2YQ5A 3HPQA 2C2OA 1Y5RA 1ZM7A 3A4MA 3L7DA 1KO7A 4IDBA 3T35A 4HGNA 4E3ZA 4TTRA 1V6CA 1KORA 2EP7A 2KM1A 4NFYA 1PL8A 3ZVNA 1Y4AE 3EIWA 5FTWA 4CF7A 2QZJA 4ES6A 1CF4A 3O8RA 2PKYX 3GH1A 4P0PB 1AQUA 2DVMA 5JAZA 3AZOA 2IYWA 1OT5A 5K8TA 2E5WA 1G6KA 2B9VA 5JJBA 4RM2A 1G5AA 3ND5A 2A0WA 1DIOB 1KAHA 2X19A 2Y1OA 3JZIA 4QOIA 4TL6A 5ALTA 5FD8A 1SC3A 3ZKWA 3ZCPA 4K8RB 3ZHSA 4GSLA 1NDUA 1MX1A 1C3JA 4FFBA 3SJUA 2QE7A 1W0CA 2N47A 1X1EA 3B2XA 3IEKA 1TJ5A 3QG5A 4XH9B 3VR4H 1W8IA 4DBZA 1ZBQA 4RUKA 2WHPA 4E5SA 1KEWA 3GNLA 4TMYA 1WO8A 2PSFA 1S2NA 4KDCA 5ALGA 4DLTA 4ENTA 1ZAKA 4X92A 4DT1A 3VDRA 4KXMA 3LCCA 1QE0A 1Z5UA 3I8XA 1QLJA 2ACWA 2AKYA 2MSEB 5FL7A 421PA 1P72A 1VJCA 3BVPA 4TROA 4DRXB 4C20A 1RWOA 1X1RA 4B87A 5C0OE 2DFLA 3PQFA 5TVGA 3ZS8A 3MCWA 4PVDA 2JCBA 1WXFA 3HA7A 2W98A 4KJXA 4HFRA 1HFJA 2O7SA 3WKBA 1ZK0A 4C2TA 4N9WA 5LMZA 3Q85A 1U9JA 3LO5A 1PEKE 1I3NA 4KGVA 4D57A 1HL7A 2RGDA 4DQKA 3N3BC 3P27A 3GPDG 5I9LA 1EP3B 1IY0A 4FN4A 1DP4A 2X2FA 3U16A 4D74A 2I3DA 4PZ0A 3HCCA 3HLYA 1XCBA 1Z2OX 2D1QA 3U48A 4Q9IA 1E2FA 2NWQA 3GRVA 4XZ3A 1ZRHA 3RRZA 3T9BA 2E7ZA 3IBGA 3TZCA 2XCIA 4WNYA 4YP1A 5FQOA 4B83A 3GP5A 3SZMA 1BN6A 2F3SA 3ZXXA 3L4EA 1TK2A 4YXWA 4I1RA 1GYQA 1P1CA 3LT2A 4WBNB 3BGSA 5J47A 2OESA 3LFTA 5C80A 4BVBA 4BLWA 2EKLA 2IIVA 4H2DA 3FH7A 2YXBA 4Q9DA 1JFVA 4BV2A 5LP6F 1O03A 2PZAA 2FVYA 5EXTA 3K15A 3FGNA 1OH5A 2IPNA 1S2DA 3IKVA 5KVCA 3Q6NA 1M66A 4V2UA 4AUMA 1ESDA 4L2IA 5HQ3A 3EVAA 2BELA 2VUTA 3A27A 5T4EA 3WOVA 5KU7A 1U1GA 3L1UA 2I4LA 1ZISA 1RYFA 2Y76A 1P19A 5CDYA 2W6IA 3A2MA 2QT9A 3O47A 1ORWA 4KK3A 3KC2A 2YFQA 1YB4A 4HVTA 3NALA 4LK3A 3SHQA 1ZVVA 3LH5A 1SC6A 3TGWA 1DU4A 4CNBA 2QV7A 4MVCA 3RS0A 3EEQA 3Q8MA 4EFDA 1LQUA 2IH2A 5K7SA 2BBSA 2C5GA 3DUFA 1PQWA 5HSGA 1NNEA 1PJCA 4F7WA 3AUSA 1ZUIA 2W6CX 4FWTA 5ES4B 4W6ZA 3JQRA 4DC1A 3FUDA 3GJ4A 4ZQTA 1DT5A 1DVRA 1FTNA 2FW6A 1REQB 2PRKA 4FLRA 4KE9A 2O0KA 2GFHA 2HUPA 4BYGA 4E70A 3GT4A 1LBTA 2QROA 3V7NA 1CUGA 3TK1A 3ZR4B 4LDPA 4OHYA 3O3CA 3V97A 4AG6A 1H1DA 1YK0A 1QFYA 2NV2B 3GC6A 3JSAA 4OI1A 3IIMA 1YVRA 5A1JA 1EHYA 3PEYA 2IGBA 1B1CA 3B38A 3BBLA 1OLSB 3QEKA 4A03A 3GPCA 4J07A 4KL8S 5B7GA 3QMMA 3AF6A 2ZRPA 3SMVA 1ODIA 4RIEA 1E4OA 1CPYA 4FLEA 2FDCA 4RADA 2IXEA 5CXUA 1R4NB 3DFUA 2ADFA 3IUEA 4KMRA 2JLZA 4GXNA 2FR0A 1G8GA 4LCBA 5SYMA 3ZK7A 4ESVA 4WXEA 4KR6A 1L4NA 1EK6A 3EF1A 4LZOA 5B2FA 4K46A 5AHRA 3ZHZA 2FG5A 3UK7A 1G7CA 5KNCD 2Q6OA 3KU1A 3SEAA 5E1OA 1ENPA 1RPZA 4D9MA 1HE4A 2I4MA 2AN1A 1OFUA 4GH5A 1O54A 4MQ6A 4F5WA 3O2SB 3OE4A 4QTXA 1AU9A 2Y27A 3ZHRA 5FULA 4ALMA 5EGNA 1C9NA 3ELYA 4B5LA 3OFVA 4EG5A 4YI5A 4ZYYA 5GJVC 4UTVA 3E0QA 2XUKA 5ILQA 3C3WA 3BZWA 1WBDA 1IYZA 4WNIA 1IULA 3OM9A 4NOMA 5EQFA 2LR0A 4E14A 1TM5E 4L7QA 2B92A 1BW9B 2V6IA 3ID6C 1AZSC 3ZBTA 1YA6A 1RYHA 3NAQA 5IVPA 4FOLA 4Q7LA 3L8MA 5GV8A 5MN5A 2O2YA 3NORA 1JHVA 3THRA 3K9FC 5I4BA 1NNUA 4IOMA 1WB9A 1PNOA 1WOYA 1U5BB 1KXJA 3RHSA 3GN2A 4TZTA 3AVTA 4FB4A 3PENA 2AW5A 2IY7A 4S1WA 3WMFA 5EQJB 1DKOA 2HJ9A 4IDPA 1T2EA 1PJ8A 1S8OA 2PKRA 4DCOA 1OC2A 3UWMA 3AU8A 4KYVA 4CIYA 4DILA 1Q84A 1I36A 4O08A 4V0MA 5HGJA 4XYBA 3HM2A 5FPPA 1F8UA 1I01A 1Z4OA 1UDWA 4J49A 2HQOA 1SRRA 2XDAA 4RF4A 3FVRA 5AI6A 3TX6A 2VTBA 5AH0A 4BASA 3IAAA 1VRVA 4PGAA 3FZQA 4AS2A 2GZAA 2Q41A 1Q16A 1PFKA 2JIRA 5BYJA 1EG2A 1QH1A 3ESRA 1OFTA 3T99A 1AF7A 3FKJA 1USKA 1SZPA 1Q11A 2AUTA 1ULSA 1M0WA 2H0RA 3FVVA 3JWHA 4JJIA 4LWPA 5FA6A 5HCUA 2OHFA 3EHDA 1KZ9A 2ACEA 4U2GA 4BP8A 2L69A 2D8AA 4TM8A 1OCEA 4HQLA 4HG2A 4UTOA 3S3TA 1D6SA 4HMQA 5BQPA 4Y6SA 1DIBA 1SVWA 1U3UA 3NWBA 4FSDA 1O5TA 1GNSA 4LCJA 5BVHA 3N2NA 1XCOA 5GM2A 5EI5A 2QVWA 2IV3A 2IWRA 1XA4A 1EZ1A 1WR8A 1P39A 5IYZF 3NHKA 4RXMA 5DM1A 3HQ4O 1TEXA 5JDCA 5CEEA 4HH0A 5ULLA 5CIWA 1GSOA 1ZSNA 2GBFA 4Q3DA 1CHDA 4Q9LA 1YZNA 2DJ5A 5F5LA 4LSWA 1E9RA 3DBLA 2R1VA 2NUPB 3JYQA 3H8WA 5F7JA 3PNQA 1H0RA 3H9CA 4M0EA 5DI9A 4OO3A 1SY7A 4PPYA 1WBJB 4O33A 4RK1A 3ZV3A 1V1MB 1JHRA 4LKRA 4O4HF 4R1QA 4K5LA 3MTAA 1AQLA 4B81A 1GGHA 1NLUA 1I24A 4JEIA 5CDFA 4DMUB 4XYMA 4PC3A 2DETA 4JBIA 4REQA 4C4ZA 4F2HA 3MQ2A 4YMTA 1ZLXA 4C9BA 1RP7A 5BRNA 1F06A 3NHSA 4Q9NA 2AXPA 5DTRA 4PONA 1K4MA 1N9GB 4XCXA 2CWWA 3D1LA 1XMQB 1GQYA 4MX8A 3S8MA 3OECA 3WGJA 2P5UA 4DUZB 1KL7A 3VR3D 1PVDA 2F1IA 2PQ6A 5DYWA 1X7GA 2WWTA 3O2NA 4X7MA 1STOA 5FTLA 1NVKA 1SEVA 4MITA 3DCYA 4JDUA 1XE3A 1P5JA 3M6XA 3RARA 1BMTA 1CR6A 1SHUX 3VVCA 4QLBA 1OI4A 1KIFA 2Q3FA 2MR5A 3HZHA 2WWXA 5EAIA 3AYZB 4ZQIA 2H3EA 3VU3A 2YIDA 4BMDA 3JQ7B 1XEXA 1JEJA 4Y6GB 4AZTA 4TVSA 2GPJA 2ZETA 5ECWA 3UO8B 4IZOA 3VOTA 4BPRA 4CUKA 2RIPA 2Q5EA 3EMVA 1SMKA 1CK4A 3CNHA 4JCCA 5BSEA 4XGKA 2F00A 5BWLA 3V33A 4C04A 1RAHA 3WHLA 1NONA 2CXPA 2V4ZA 4UARA 4M7OA 3TL3A 2N0SA 5B64A 4TT3D 4A1OA 2E4XA 2PFGA 3AC0A 1I80A 5TQJA 3W9UA 1WF6A 3EAFA 4FYWA 4DSTA 2YJ5A 3IDSA 5KOJA 2AWOA 3M4ZA 1P7CA 1ZWKA 4Y0AA 5HKOA 3VSEA 4NWIA 5CEJA 2CMKA 1TAQA 2F59A 2JAHA 3JS5A 2WTAA 2BKVA 1RAGA 3GJ7A 2XT6A 1D2EA 2QW1A 5DBFA 3TXYA 3BJIC 1CUXA 1ZJZA 4Y2SA 5L45A 2LRHA 2IPMA 5CGQB 5JU6A 5HG0A 3IUPA 4RZXA 1CRZA 4AFNA 3GUZA 2AG6A 2VDWB 2XVMA 2B4RO 3F6BX 3BWEA 3UW3A 4P4UA 1SUCA 1UJ4A 2B61A 3PPXA 5HQTA 1HLDA 1P29A 1ZLYA 1NUAA 1J7KA 3DLPX 3SC4A 2HLPA 4C4XA 3LPCA 3GJSA 4CHGA 1JLRA 4ED9A 3DTNA 2HHJA 2Y0DA 1E60A 1MB0A 1T36B 3DGEC 1YC5A 4NYMQ 1BJRE 2R87A 5CITA 3SGLA 3TLCA 5EIEA 2Z6VA 4BRUA 1WVMA 5AFSA 3LVRE 2G9QA 5A04A 3DW1X 5AVZA 1FB5A 3WB9A 1BAPA 3E84A 5ITZA 4NCNA 5JAUA 4P7FA 3EDOA 3A6GA 3HL4A 1CERA 1U0FA 3ROFA 3QXCA 3TZLA 3LUCA 3D7NA 1QVAA 2JB9A 3D0QA 5AUNB 2WF5A 4OJTA 4WAUA 3VTFA 1GCGA 3Q6MA 4S1VA 3WIUA 3O74A 3PBKA 1NR1A 1C1DB 4P08A 2B69A 2JCGA 3MTJA 4TMZA 5E7MA 3VOBA 5F23A 1NG9A 4NICA 1EFLA 1BDHA 1M34E 3KQMA 3H3FA 4GSYA 1G3UA 2B21A 1E92A 2V7EA 2XA2A 1P5HA 3ZBPA 1H4TA 3SKVA 1YCFA 2PA3A 2W6OA 5HUJA 4TTVA 1LXCA 1V45E 3FCSB 1JF8A 1XZGA 3O4RA 3R3UA 2C2MA 4RPLA 1XJQA 3KE9A 3ABZA 5BWMA 4WZAA 2WFLA 3HL0A 4L6CA 3DYBA 2IHUA 2X4GA 4YRIA 5FDFA 5KX5F 2W2OA 4H0CA 3JAMA 4BXOA 1TRKA 5L3SB 3A3PA 3A32A 5CNIA 3OZTA 1CVLA 2GKGA 1X7WB 4XSGA 1RBZA 1RI5A 1IY9A 1IJKA 4JLSA 4KMOA 4NK5A 2Q3HA 1WZIA 4YJFA 5FOUA 3IX7A 4BGUA 3H2HA 4ZVLA 5KJCA 4QBIA 5AW7A 3KQSA 5AXDA 2AJ8A 4ZV9A 1B43A 1IATA 1TUIA 2IYFA 3X43A 5JUWA 1L6IA 1WU7A 3AOEA 4H0FA 3ZKAA 5JW6A 3ZBQA 2PJDA 1S46A 1CY4A 3NFRA 4CEHB 1NZFA 3U26A 5B58T 3G02A 3G8BA 4KREA 1FNBA 2J0UB 2JIPA 4M76B 1L4UA 4ZRDA 1O94D 1PR5A 2JJ2D 1L1FA 1Z0IA 3DKVA 1QHNA 1DHRA 2IKQA 1GOTA 4ZO9A 3RTBA 3LGSA 3COVA 3M49A 2K7ZA 4FJ1A 4TVBA 1RFLA 1A9SA 3KVRA 1UZNA 3F78A 1Z3CA 1K8ZB 5ES3A 1AIPA 5CBPB 1DJLA 3EH1A 1MV8A 1IN5A 3QYJA 4XNDA 3QHAA 2O2JA 2BM0A 3MK31 3QBDA 2QM0A 2D5IA 1T26A 3ICQB 1WB6A 5JZOA 2P1DA 1GUFA 2YMMA 4AJ1A 1KR5A 5I9MA 2YHIA 3U3MA 4C43A 3GLGB 3HBJA 2YYYA 1P3JA 2OAEA 4D26A 1AZWA 3CHQA 1GFWA 3H5WA 2BFEA 2VP0A 3QXHA 1U8ZA 5JDCC 3SVTA 1DX6A 2C95A 2GN6A 1WL8A 3D6TB 1M0SA 4CFSA 3C87A 3OWOA 1IK4A 3SX0A 4EKNB 4YWHA 3QE0A 5KYWA 2OOKA 4BUZA 3PB3A 1HGXA 2W71A 3JATA 1Y4UA 5DYNA 2ZUVA 1Z37A 1OBVA 2BR3A 2JC3A 2Q62A 4F8JA 4GM0A 3NBMA 2JV7A 1W49A 1XNGA 2RKWA 4UUQA 5DHTA 1Y8AA 3RVRA 5A6SA 3C41J 1ULTA 4WLUA 4AM8A 1DX4A 3E5RA 3N6RA 3LY5A 4IRXA 1F3LA 1VKOA 3K4HA 3AU9A 3EGCA 3L93A 3UG7A 4LOLA 1EESA 1NVVQ 5I9IA 1M5RA 1AF4A 1Z0ZA 3W2FA 4DC0A 4GBGA 3GJ8A 5J43A 1ZONA 2PX6A 4H59A 1M8FA 2WYHA 2YOGA 2AI2A 1BFKA 2J9FB 3DT9A 3Q1LA 5C7YA 5ICCA 1A1VA 1XYVA 3ROZA 3D6JA 2WF7A 1PLKA 1PJRA 2AQ8A 2C84A 3A11A 3DOJA 4P83A 4Q1CA 3QE4A 2QQEA 1Z0SA 1Q15A 4JZKA 4JU8A 4NFSA 4L5IA 2PO7A 1TT5B 1U7WA 3LBAA 3VH2A 1W6UA 3GA0A 4GPEA 3DZIA 1UIRA 4PSVA 1UMBB 1BRTA 2WVAA 3DOOA 3DMYA 3LDAA 3PGKA 1UJMA 2HXSA 4G81A 3G23A 4PSAA 3ZDXB 1XKQA 2B8TA 1V5FA 1JECA 1FA9A 1VLLA 1E9FA 2JAUA 2R96A 5J2UF 4GPIB 4UTRA 3T5BA 4HXEB 4B7AA 7ABPA 4G8JA 4RZIA 3W5CA 2X9NA 2RI0A 3EVTA 1TEHA 4PLZA 1CJKC 2OQIA 1JEAA 4GUAA 3K1YA 2NXEA 1GTVA 3FUEA 2BW0A 1H9CA 2K4MA 3G82C 5GGYA 3U49A 5C9ZA 1I3OA 1EH5A 3LG2A 1SCIA 1FFXB 2GA9A 2HMWA 4PNEA 4ZAVA 3FGZA 5IDWA 3JAWA 4ZYVA 1VHLA 2ACVA 3LLSA 1RZVA 5J2TA 1RLIA 1MW3A 4NRDA 1Z5VA 3ZJ4A 3QYPA 4B6FA 1T2CA 3K2EA 3S8EA 1BCRB 1F8GA 1ORHA 2EZ9A 4J0QA 2EQBA 4JUFA 3H05A 4B45A 2C9YA 2VQEB 3NMUF 2Q4DA 3UXEA 3L79A 1QYRA 4ANFA 4QE3A 2X0DA 1CJBA 1X9GA 1YE3A 2JHFA 2ZJOA 5K3SA 3LW8A 2XVXA 4B2LA 2ZYIA 1B74A 1Q74A 3H1AA 5J4VA 1T5SA 4HATA 1W29A 1WDTA 2C5BA 4EGSA 2QBYB 3B5EA 2VH5R 3BRWA 1BXKA 2ZZKA 1U8AA 1K89A 1URPA 2MYPA 3OTWA 5G4KB 3VNRA 4R8RA 2W4IA 4GSKA 2JA1A 3W8EA 3ZPXA 3V2HA 1BNCA 1SKAA 4LC0A 2C5AA 4CU5A 1M1YE 2ZYRA 2IHNA 4DIEA 4H7EA 2X76A 3I28A 3EF0A 4YYZA 5T7BA 4N5IX 1JQAA 4CL8A 4HRXA 4L8VA 4D4IA 3CLRC 3PTAA 2KE5A 2NW6A 3ICEA 3FRJA 2GWHA 4AWBA 1ISJA 2IYRA 5EIFA 3MTEA 3CIFA 3LF1A 3NBUA 3WLHA 3GLFB 2Z6AA 3PDUA 4IW3B 1CD5A 2HO4A 1CY6A 4OL0A 4HGRA 3UFBA 2EHJA 3ESAA 3HJAA 1JU4A 1Y48E 4MA5A 4ARAA 3NATA 3T34A 1SG9A 1D9XA 4JB3A 1UAAA 1SIUA 1UP7A 4NOJA 4M8LA 3LL7A 4YUVA 1NMYA 1E1RA 1NN1A 2JS7A 1UZAA 2C2BA 3DO8A 3LWBA 3KVYA 3V8EA 4PE5B 4PSDA 1Q1EA 5IANA 4HWGA 2BJVA 1NJ8A 3T1HB 2AWNA 4GRIA 4RIIA 4CMKA 1YCGA 1EWTA 1ZN2A 2P68A 1XAGA 3MPOA 4UM5A 4KQCA 4ZCIA 1RWQA 1JQLB 3L6RA 1R12A 3JAKA 3K70C 1OWNA 4RGBA 5GAJA 1LJ8A 1LW6E 1L5VA 3MUEA 3OCJA 4RGVA 4Z7NB 5BQ3A 5JJKA 1ADCA 2G63A 1SULA 4R40A 3GY0A 4XN4A 3DDWA 4L07A 4DWOA 1G8SA 1HDXA 2AOXA 1Y1RA 2L19A 3IT2A 4G4JA 4D0SA 3DMRA 1DWUA 3CYFA 1PR9A 4O2AA 4QSMA 3CQ9A 2PSEA 3KYDB 2OB2A 4YJHA 5B3AA 4A6XA 4N0QA 5JWOA 2XB8A 4W1RA 1KEEA 1TM4E 1R7RA 3AOEC 3OIUA 2PWBA 4XRRA 3PT5A 5IJAA 5E4JA 1L7MA 2IZ1A 1ECGA 4RVSA 2XYQA 2PX4A 2JIQA 4D44A 4KVZA 3RTEA 4DLPA 5C34B 1DG1G 3H5IA 4E09A 2R6GA 1D1SA 1C9MA 1WUIS 4L4SA 1PYGA 3PHJA 3F7NA 5DN9A 1PEDA 3ZZMA 1EUDB 1USWA 3CSUA 4QNRA 2WIDA 2HSWA 1VBMA 3EQ7A 3MIZA 4RGYA 3ZDCA 3CINA 2WU3A 2NNLD 1QRDA 1GRVA 1XHEA 2CW5A 2HNAA 2XBUA 4GC5A 4JLBA 4ZO7A 3LS2A 3G9XA 1N57A 5DN6A 3VO8A 1RYZA 3HA5A 5LN1A 2O8NA 1TK9A 1OKKD 4PCVA 4BFVA 4EY4A 5DM70 2AE1A 3KYCB 5LQSA 2XQGA 1CWUA 2D54A 4AUEA 4ZI2A 1ML3A 1RLTA 3IBCA 5A3JA 3P4XA 4S24A 1JAIA 1G21E 2QE6A 3PDJA 4TVKA 4UFOA 1JEYA 4G0XA 1PE0A 2VG8A 4HB2A 3UGQA 3U6KA 3NP7A 5EYPA 3U5ZB 1NXOA 3BD8A 2YWGA 1NXQA 3H1PA 3FH5A 2C4KA 3ZE1B 4OHZA 3ZDAA 1RHRA 5BV2P 1YC2A 1TM3E 5F7XA 3B6ZA 1KJZA 2PNFA 2MOKA 2QN1A 3VPBA 2WEKA 1I9CA 2B98A 1RNLA 4QYWA 5KJFA 3L43A 5EVJA 3BJMA 1KF0A 2P2LA 4RZ3A 5FR1A 2O2EA 1VHDA 4XR9A 7MDHA 3GHYA 3KR0A 1B0ZA 3FLAA 2X1HA 821PA 4YROA 1T6NA 4S2UA 2B9EA 2HMUA 5EINA 3QX7A 1MDBA 1X7DA 1VE3A 2ZCVA 4LUCA 4QOFA 1KK0A 5HM8A 2J0EA 5EWMB 1NJSA 4UVDA 4MROA 3NYQA 3WX0A 4XCQA 3A1FA 2FLWA 1EHIA 2CUZA 4IDGA 4QAQA 5KDLA 3CUKA 1TC1A 3GN1A 2J0SA 1II9A 1UC8A 3G13A 3OQJA 2BM9A 1X1CA 5LZ7A 4BQIA 1IN1A 4QBFA 1N2BA 1X9IA 4C0HA 5E6UB 2ZJBA 2YOFA 3OCZA 3AIIA 4LMBA 1VSBA 4Q4JA 4Z4HA 3ZK8A 5JI2E 5JYEA 5DIFA 1SXJD 4JJAA 4PC2A 1AKMA 3QUSA 3F3SA 1RRKA 3LY8A 4LE0A 2GRUA 4X1KA 4YRRA 5BRJA 4CEJA 1XMIA 1LS6A 4PYKA 3SC2A 1MABB 4V0LA 1H93A 1MV5A 5DBIA 2VO1A 3RREA 1PD0A 2I33A 3KXIA 4J7XA 4BB5A 2F9LA 2XA1A 3VI3B 2BFAA 3A6LA 1DRVA 1TO1E 3UCEA 4H1WA 2O59A 1G3IA 1BXGB 2ONKA 2GCOB 2XA9A 4RA9B 4OXRA 1C80A 2IQ5A 2Y99A 3GX1A 3F8WA 4HS9A 2OFFA 3GLGE 2H9IA 2QENA 2X7JA 2C82A 5DWQA 1EUYA 2FOLA 3BCUA 4UEOA 1G6Q1 1I3MA 2ZSUA 3E3OA 2XMZA 4MDFA 1FX0B 1WY7A 2GJSA 2FUNB 2GCNA 3ENKA 4GKVA 2QD4A 4HUJA 5DNDA 3WNDA 1JWLA 2JDIA 1LH0A 4Z0HO 2CFTA 1X7ZB 5A3SA 5A02A 3TSZA 4G5SA 2EG9A 4RANA 1HDRA 1RKVA 1XZCA 3KTOA 3W6OA 3UT5A 1GLGA 4Y98A 4PX2A 3IBTA 4FYXA 3DAFA 2ZLBA 3MTQA 5CK5A 5IHPA 3A6PC 2Q2WA 4CI0B 4TRRA 4BMXA 3C43A 4US1R 4OKSA 1VE7A 4BUCA 3JQGA 3GNSA 1OUMA 1I14A 1TZ2A 3ECSA 4LSZA 4UTZA 4LF7B 1UWLA 1GCAA 1ODFA 3A7DA 4L1KA 3I12A 4LXYA 4EWLA 2HR1A 4DDWA 4PQEA 3IXMA 3V4FA 3FHJA 5CVCA 4HPWA 2IW3A 2ZEJA 2D00A 5G0UA 1N1GA 3FLBA 2QMOA 2Z1DA 4TTTS 2XB6A 3DDHA 2OA0A 2MT9A 5FUWA 1M34A 2AQKA 3OEED 1QP0A 3KOXA 2XZPA 4YMVA 1JGIA 3ESXA 1KDVA 3WK7A 1ZHFA 1IB6A 2O3JA 1CNMA 1VKJA 2PQ0A 3USES 3D2CA 3OLWA 1JZQA 2IU6A 2JIDA 3L6EA 3V1YA 2HPOA 4FFMA 3F6YA 4ECEA 1KH3A 1G3RA 3ZHOA 1YHYA 2Q2NA 3C6BA 4LY6A 4ZREA 4JJZA 2PXAA 5DGDA 4EY6A 4YONB 3UGTA 3MINB 2D4AA 1YDGA 2VNJA 5K3CA 2DKFA 4GC9A 3KZKA 3K20A 1IXYA 2F43A 5CT8A 2AYZA 2WJ3A 2QPOA 4BLOA 4YAEA 3AF3A 1AKWA 1D0IA 3OSUA 4XB1A 1U5CA 3ZLUA 4DCNA 4MJ7A 3BXZA 1P81A 2CUNA 3HDYA 1P9WA 3MJFA 5LC1A 2EW8A 2J8ZA 4RENA 4AU1A 5CDGA 3OCVA 4CYMA 2R00A 4WZZA 4YACA 3ABIA 2I78A 1I6KA 2E5LB 4FCVA 5CX1A 5B4VA 4WCVA 2P6MA 2O07A 4G07A 1KI6A 2YY7A 1U4NA 2WU4A 3AY6A 3OZRA 1ZCBA 4QJIA 5JNUA 1DWPA 3IS3A 3UAYA 2BGMA 2HMVA 3SX2A 4UQLA 2C5ZA 3AEYA 2VHEA 2BEUA 5JYBA 1WUHS 3QV1A 2N46A 4C5BA 1Z0KA 2CXQA 4AUKA 3NBYC 1S4MA 4ZVQA 1BGXT 1NKVA 1H65A 1PQPA 2FLKA 1XZFA 3LZ6A 4M49A 4GXQA 1D2RA 1AZLA 3DO6A 1K8QA 3HGQA 3HH8A 1R4NA 3I2KA 1E96A 2W2TA 2EBFX 2HXGA 2VJQA 3WISA 1DSSG 3R74A 2AK2A 3P97A 2GZ3A 2BGNA 4AX4A 2R59A 4ZRNA 1UC9A 2JI6A 4BP3A 3VTZA 4DNQA 4EJSA 1PZGA 1CX9B 3OAAD 4G0MA 2BHNA 4NQRA 4F2DA 3MGGA 1TYCA 3ZI0A 2HIMA 3K0HA 2WAXA 4ZQHA 3GLFE 4FFLA 3THYA 1DAOA 4GXTA 2PMKA 4MR8A 1C2TA 3ZG6A 3U7GA 1EE2A 4HEA1 3ZV7A 3AW9A 2HJHA 3E7XA 2XSZD 4TKVB 3QKRB 4ZDIA 1OAAA 1DQSA 1NMSA 1PR4A 1IOVA 3AJDA 1ZUD1 3VR6A 4FGWA 2NO0A 1UFOA 2IEBA 3TGPA 5LD2C 4I6GA 5K3FB 1KRHA 1PK8A 3VR2A 1BW9A 1JDSA 2EBWA 2DMRA 2PGXA 4RVGA 2DUJA 3TRIA 2M6KA 3R9KA 2O20A 4FE4A 4C0JA 5JPIA 2E2WA 3DKKA 1PNTA 4Q4HB 1EBFA 1QG4A 4M22A 1VMKA 1V6AA 3QTLA 5ALPA 2AJBA 4N8EA</