1R0KA

Crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
386
structure length
380
Chain Sequence
SQPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIADPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTVALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPFRTTSLAEMATVTPERAVQGAKISIDSATMMNKGLELIEAFHLFQIPLEKFEILVHPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAPDYERFPALTLAMESIKSGGARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPATPSSLEDVFAIDNEARIQAAALMESLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title Crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from Zymomonas mobilis at 1.9-A resolution.
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Oxidoreductase
total genus 126
structure length 380
sequence length 386
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2003-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 1r0kA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1r0kA01
1S7CA 4FR5A 1GDHA 2BKAA 1HXHA 1NPTO 3DEYX 4XQGA 3WICA 1RP3A 5TQVA 4XCVA 3G49A 5AYVA 1IPFA 1DC4A 1YWGO 3I4FA 1YB1A 3T7EA 3SEFA 4BGUA 2C2XA 4M1QA 1I3NA 1CEQA 1YL6A 5U1PA 2DM6A 1SC6A 1GUYA 3ZV4A 1F12A 3CXRA 3H5RA 1LJ8A 3WNQA 1MXHA 4NMHA 1AHHA 1R0SA 3KV3O 4KMSA 1IHXA 2JHGA 4BO8A 3I9MA 1DIAA 4LUPA 1O95A 4GMGA 4CMJA 5L7WA 1P1JA 3RJ9A 1EVIA 4RJTA 2IXBA 4H15A 1YOVA 1X1TA 3DHEA 2QG4A 3ANNA 2VTEA 2Y1FA 3GFGA 4QO7A 3CINA 1ZVMA 3W6ZA 1GPDG 2QQ5A 3TL3A 1KC3A 4HUJA 1QORA 3ZHZA 1X7GA 4NI5A 4J7UA 3PP8A 4MVJA 3HADA 3DHYA 3PRJA 3PJFA 4FBGA 1UUFA 4QECA 5IDYA 4DA9A 3TJRA 3CZGA 2PV7A 1SAYA 4XYLA 2V6FA 2IZZA 3DBLA 3HHPA 3K31A 4BO4A 5CEJA 3W4IA 3UCQA 2UUOA 3NTQA 3AOEC 1MG5A 1NQTA 1H0KA 1NTOA 4N5NA 3U0BA 3JQ9C 3LVFO 2FZWA 4RV9A 4FPXA 1ZJYA 4KP7A 3OEYA 4GX1A 3RUEA 3GN1A 2IRWA 3EDMA 3DOCA 2BMAA 2HRZA 3P19A 4MIEA 2GZ3A 3QJ5A 4ZD6A 1E7WA 1HTBA 1LDBA 1I2BA 4NPCA 3OJ0A 4L8VA 4M55A 4NBUA 4HFRA 3TDKA 4J3FA 1C0IA 4TRNA 3E9NA 2GN6A 3G0OA 3K73O 2JFHA 3NAQA 3QQPA 3ZU5A 4A26A 3WGOA 4G65A 4BS9A 3UXYA 3VVBA 1J5PA 1L1FA 1EE2A 5A4DA 3MZ0A 2CVQA 2ZKLA 4A10A 1E77A 2YYYA 2X5OA 1B2LA 3KEQA 4WECA 5TX7A 1NWHA 3JQAD 3U4IA 1VJTA 3WMWA 1EK6A 1OZAA 3I3OA 3PJEA 4DXHA 1Y6JA 3IIEA 2X23A 4XYBA 2I5PO 5CHEA 5KIAA 4FFNA 3EHEA 4CLDA 3OQ1A 1PJLA 4CQLB 4CUKA 4LVCA 3PXXA 4DQVA 3DR3A 3FTNA 4MIYA 4R54A 4AVYA 4URFA 1K6IA 3H9GA 3UHAA 4JJFA 4AJNA 3VKUA 4FCCA 3MTGA 1UXIA 1TT5A 3ZV5A 1FF9A 2G5CA 5JS6A 1VI2A 3WDSA 1VRWA 2VHZA 4IY1A 4QQRA 1K89A 1UZNA 1V35A 2UV8A 4J4TA 3DL2A 5AOVA 3AOGA 1E6WA 4EUFA 3G79A 3SJ7A 3K2BA 1X0XA 5BQFA 1MUUA 3OBBA 3WB9A 1NWCA 1PS0A 3JQEA 4MKZA 5AXBA 4B79A 4IJUA 2FN7A 1YGYA 5C7OO 4BNNA 2DC1A 1JW9B 2O7QA 3H9QA 1LQTA 2GN8A 4HFNA 4IGEA 4EUHA 2DTXA 3WLEA 4GVXA 3QVSA 4GVLA 3WGIA 1XCBA 1I10A 3DC2A 3JQBA 4OXNA 3JYNA 5FEUA 3GAFA 2G82A 3GGOA 3N7UA 3ZWAA 4Q3BA 3LU1A 1JTVA 4YCAA 3SC4A 4BKOA 1IL0A 1U1IA 4W7HA 4PLFA 4YAJA 1I0ZA 4DPKA 2QZ9A 4MP6A 4E13A 2WE7A 1T2FA 3LT0A 4PVCA 4NBWA 1YKFA 2VHVA 3OJLA 5A3VA 4EJ6A 2VWGA 2W8ZA 3KYBA 3ZDFA 3CH6A 3L6DA 5CP8A 1Y5MA 1PSDA 1YXMA 3RC2A 2ZCUA 2JJYA 1YONA 4EGFA 4CMIB 5JW6A 4U6SA 3OICA 2DLDA 1HLDA 2FOIA 1BVUA 2FR1A 1N92A 4FGWA 1PJ3A 1DC6A 4BB5A 1GU7A 5C7LO 3LC1O 5B12A 2UAGA 5DOVA 1I5RA 3CE6A 3OM9A 5TIIA 5EMHA 4BOYA 3DZGA 2NLOA 2EF1A 3F4BA 3O8QB 2NVUB 1NHWA 3OQBA 4WCDA 3C1AA 4GX0A 5I8ZA 1DFHA 4Y8VA 2QYSA 3H9UA 4KQXA 1SEPA 1T24A 3B70A 1G0OA 4BMNA 1CF2O 2GLXA 1P0FA 2VNSA 3NDRA 3L77A 1PU2A 3ZU3A 1LRLA 1XG5A 2QIOA 1VE9A 2D5AA 1A9ZA 4DGSA 1HKUA 2OO5A 2V6GA 4ND1A 4B4VA 3W8EA 3DZIA 2WWRA 3U49A 2DBVO 2WJPA 5CG2A 3KB6A 4MP8A 3TZQA 4W99A 4Q3NA 3LZ6A 1K5HA 2AE2A 4KUEA 3PHIA 3ZW8A 4HFMA 4DMMA 5A3JA 3RU9A 1JU9A 1QRRA 3QHAA 1GYPA 4TKMA 1O0SA 1KETA 3C7AA 4FC6A 1XWFA 3QA9A 2H5LA 3P2OA 2FSVA 1OAAA 4D0RA 4N54A 3CPSA 4K28A 4WE3A 4E31A 2YFHA 1GAEO 4DQUA 3GN2A 3K92A 3V2UA 4E2ZA 4BHTA 2Q1SA 2FY8A 2Y1OA 3ONDA 1I36A 3DQPA 3RQSA 4RPHA 1H6BA 1FMCA 4CQMD 4BKQA 1JKIA 4XIJA 1D4FA 4RPJA 5F5LA 5JAMA 3D1LA 1K3TA 1TT7A 3M2PA 1B8UA 4BNMA 3OA2A 4KWIA 1H94A 2QW8A 5MDHA 3GPDG 2GR9A 3RIHA 1RWBA 3BHIA 4KOAA 1UAYA 1VL6A 3QLJA 3DDNA 1XHLA 5HA5A 4H7PA 1SBYA 3DMTC 4U0KA 1W8DA 3R3JA 4RDHA 2X58A 4YJHB 3GEMA 3HSKA 3JCZA 2R00A 3OA0A 9LDBA 5CDSA 2O3SA 3F46A 2GYYA 3H9JA 4CJXA 1E1KA 5IXSA 5JE8A 4J90A 4PLYA 1N7HA 3ZV3A 4UEOA 4NQZA 2DUUA 1UZMA 2NADA 4IJVA 4BNXA 2CDCA 2O3QA 4J4BA 4S3MA 5A9TA 3STHA 1Z7BA 4L75A 4W82A 4HKTA 3DB2A 1NYTA 3HN2A 4ZGWA 2VZ9A 3IJPA 3I52A 2CUKA 4R68A 1EBUA 3JYOA 1ARZA 1DXYA 2YY7A 2BFPA 4CR7A 4XYGA 1KERA 2J5KA 3B1JA 4WLVA 4R5HA 3WSVA 1U2GA 1X0VA 4TRMA 4ZJUA 3PI7A 4XZ3A 2RAFA 3H65A 5KNLA 1ZH8A 5A9SB 5GMOA 3SC6A 5A5FA 2EKPA 3NYWA 2NM0A 1FDWA 1BSVA 2BFAA 3UKOA 1Z82A 4ALLA 3M6IA 3WBBA 4LGVA 2B4RO 3F1KA 4B4WA 4CODB 3ZI0A 1R12A 2J5RA 3EZLA 2FR0A 2QHXA 3QVOA 4CR8A 5HBRA 4PZCA 4XQEA 5CAEA 3C24A 1Q7CA 3A06A 1F8GA 5BSHA 5KOIA 5C7IO 5HS6A 3VOSA 3UN1A 5THQA 4PLVA 1JVBA 2VOEA 4BVAA 4FIZA 4J2OA 4D46A 5ILGA 2CVZA 2HU2A 2P4HX 3JQAA 4MKXA 1DJNA 2AEJA 1DDOA 5EINA 4A7PA 3BMOA 1SOWA 4B3IA 5K6AA 1NHGA 1J4AA 5F21A 4GX2A 4GWGA 1OC4A 4N18A 5KJEA 4YAGA 1E6EA 4D41A 1UZLA 4KDFA 1K2WA 4BNGA 3E6AA 3QV1A 1HE2A 1ZKMA 4F46A 3C8MA 5ICSA 4BQRA 1C1DA 1RYDA 1P31A 2VQ3A 3FPCA 4J9UE 3E18A 4WOJA 1QKIA 4CLOB 2Q50A 1EFLA 3DBLB 2OZPA 1ISJA 2WM3A 1H6CA 4MVJG 3SLGA 2C54A 2FPPA 7MDHA 1O94A 4FFLA 4XGIA 3ZWOA 1RM0A 2EERA 4YPOA 2GO1A 3FD8A 4FW8A 4YJGB 5T8KA 5THKA 3U9LA 3H3JA 4OAQA 1DFGA 2IZ1A 3FNEA 4NG5A 4ID9A 4LK3A 4XGKA 3RJ5A 1EK5A 3HDHA 1DIHA 5FYDA 4CLHA 1N5DA 1HSZA 5AXCA 4BNLA 1P1IA 4HBGA 2GRAA 1KBZA 1Z7EA 4NJMA 4GAEA 3OFSA 2ILTA 5KCZA 3WQQA 4UVEA 4A27A 1AHIA 1RJWA 3BMQB 4YQZA 3JSAA 1O9BA 1T4DA 3GR6A 5B4UA 1LXCA 1ZZEA 4F6CA 2EW8A 4UUPA 2EGGA 3AUTA 3Q0EA 2VNAA 2YW9A 4QTZA 2BHLA 3AY3A 3QY9A 3LLVA 2ZQZA 4UUNA 1Z74A 2NACA 2CMDA 1XIVA 3DHNA 2Y67A 1U3VA 3H9EO 1O5IA 3C1TA 3DZHA 4YT5A 5DNAA 3RD5A 4UAGA 8LDHA 1SNYA 4ND4A 3LSYA 4J1SA 1AN9A 3OJFA 2E6UX 1E92A 1LDMA 4GGOA 4ILKA 1QYCA 3OMLA 3N74A 2VZ0A 1ML3A 4J91A 2P91A 5EQFA 3BYZA 3WOHA 4X54A 5IZCA 1HE3A 2DTEA 3G1TA 3JQ7B 5IJZA 3T0YA 2EW2A 4CM4A 3GRKA 2JKVA 3WFIA 5U4QA 2B36A 1VKOA 4FFRA 3GRPA 2BF7A 4RVDA 3RFVA 2CDAA 3LC7O 1D3AA 1E6UA 1ZCJA 2W2KB 3UFXA 4BO7A 4KTTE 3PIIA 4AJOA 4U5QA 1ONNA 1CIVA 4IM7A 4IQ0A 3C3XA 1P74A 2D59A 4XRRA 2JFFA 1ADBA 2SCUA 3IAHA 5T6BA 5ER9A 4ZQFA 4J1NA 2V6BA 1B3RA 4L4XA 4YJFB 2AEMA 1JGIA 2FMUA 2UVDA 3JQ6A 3OQ6A 5ILOA 4ZHSA 4L73A 1U7TA 5H81A 1C0PA 4FJ0A 1UXGA 1JA9A 2F1KA 4AJ4A 4WNIA 3LT4A 2X8LA 4K26A 4GQAA 3T4EA 1PR3A 1RYEA 3NGXA 4JXKA 1YB5A 3B1FA 4CMAA 1KEVA 1R4MA 2NVBA 1NFRA 3GHHA 5ER6A 3I9OA 4LMRA 4ZRNA 4CMEC 4FN4A 4JCOA 3VH3A 1D1SA 4D43A 4G5HA 4OSPA 2IYPA 2GZ2A 3IP1A 4J6FA 4A5OA 4CM8A 3PFFA 1YS4A 3GVXA 4ZA2A 1LNQA 2P5UA 1LDGA 3GNSA 2B4TO 3NKLA 4OOEA 3ROMA 5I7VA 4W9NA 2O3JA 1PGOA 1J49A 1KEWA 3G1UA 5J23A 3VKVA 3NJ4A 4ZQGA 3PWKA 4CQMA 3QWIA 2CF6A 4E6PA 3RUHA 1UP4A 1NAHA 3WGYA 4OHUA 4RLSA 1ZEJA 2A94A 3ZNNA 3LLSA 1XA0A 3AUUA 3RSHA 3I5MA 5JMWA 5A04A 4OQYA 5TNXA 3GC6A 1E3LA 1U9JA 3WWZA 4AICA 2EXXA 4YBZA 2GDZA 5TF4A 4AL4A 3SBOA 3VZQA 4DPLA 5ADHA 3DOOA 3RROA 4WLEA 1WPQA 1NQOA 1PL6A 2VT2A 1G1AA 1U7HA 1ZBQA 1SB9A 2P9GA 1FDTA 3MTJA 5IAAA 4GBJA 2BH9A 4WPGA 3U3XA 5EPOA 1KYQA 4TSKA 2E4AA 2OP1A 1A71A 2YJZA 1LLCA 1X1EA 2XOXA 1PQUA 4XGNA 4CLRB 2O3TA 5F1OA 5JCXA 4WUVA 2BRUA 1MGOA 1PZGA 2C0CA 3ZWVA 1MA0A 1N2SA 1MFZA 2DQ4A 3U4DA 2XPCA 3GY0A 1E3IA 5ITWA 2HMUA 4BNWA 5G0WA 1E1MA 3AY7A 1C0LA 2W2LD 4M54A 5L51A 4P4LA 4Q3EA 5CPFA 3KZVA 1QYVA 2CNBA 3D3WA 2P9EA 4BNVA 4CUJA 4K6FA 4Z9XA 2GZ1A 2NUAA 3IUPA 2HLPA 4DVJA 3TOZA 3NJ8A 2Z5LA 4RPLA 2WTBA 4WNCA 5ENVA 3AJRA 3TZHA 1PJTA 1NBOA 3IS3A 5JYEA 5JO0A 1HDGO 4Q3DA 4FFPA 5G2OA 1M6HA 3F9IA 4NBRA 1EUDA 3PHGA 4JJGA 3DZJA 3PLRA 3JYLA 3VH1A 1GFSA 2UDPA 3KYDA 2GN9A 4IDCA 4P22A 1LU9A 3RASA 3RU7A 3UH1A 3W4JA 5GZ3A 4OYRA 1Y8RA 3WYCA 1ZUD1 3VPSA 3EVTA 3HB5X 1G0NA 2WYUA 3CIFA 2P2SA 3GDFA 1U4OA 2EG9A 1QLHA 4P4NA 4R9RA 1YQGA 3TFOA 3DMYA 5GZ1A 3GFBA 3DZBA 4Y67A 1OOEA 4PLHA 1T26A 5T5QA 1NP3A 3B6ZA 3Q1LA 1FDUA 4R1UA 3BMCA 5EJ2A 4NK5A 1JKFA 4I08A 4CLEA 3CTMA 3DBRB 1ZO8A 1LTHR 1VL0A 4Y6SA 4HXYA 4ZQEA 4HY3A 4FDAA 3ITDA 1WDKA 3I9KA 3DTYA 1PGQA 5DOZA 3DWFA 2CFCA 2YDXA 5CFZA 1A7AA 4FLRA 1LC3A 4MPDA 4ZRMA 2NSDA 2QRJA 4CMKA 1MXFA 4CM9D 4FJ1A 4D3FA 4ONEA 4PG7A 1EUCA 2XF8A 1HLPA 2HJRA 2YDYA 2ZB3A 3V2HA 1A5ZA 3IMFA 4UVHA 1IZ0A 3RI3A 4BGEA 1R16A 1M76A 3HDJA 4BNIA 4IZHA 4YRDA 1PWXA 3PYXA 3OF2A 4PLWA 5BNTA 1R0LA 4J49A 5EERA 1FJHA 1E3SA 3HB4X 5EL0A 3UW3A 1DHRA 3E48A 1ZEMA 2X22A 2VOJA 5JY6A 4FS3A 1E7MA 5JDCA 1LLDA 1DFIA 3GOHA 1RM4A 4BNTA 1T4BA 2RH8A 2VTDA 4RQUA 1GQQA 4TVBA 3JQAB 1V3VA 1MC4A 4EJMA 1BW9A 1TEHA 4NNJA 2PZMA 1ONPA 4GMFA 4OL9A 5DBIA 2J3HA 2H1SA 3E9MA 4CMBA 4D44A 1RPNA 4FJ2A 3FN4A 2AXQA 2ZYDA 3C7CB 3INGA 1D7OA 4RF3A 1DAPA 3RC9A 3GG9A 3D64A 4I5FA 3JQCA 3TQHA 2PFGA 3IUSA 2PA3A 1VJ0A 1E3WB 3WGQA 1QYXA 1YH3A 4L9RA 3O38A 4L4SA 4L0QA 3ICCA 1Y9AA 3JQFA 3I9LA 1DB3A 3EK2A 3ZZNA 4WJZA 2Q1UA 4UREA 5CDUA 2E48A 1N7GA 4GX5A 1UDBA 5BR7A 2DTDA 2YHIA 3RUAA 1O6ZA 2ZYGA 3ZWXA 2YV2A 1H5QA 4XB1A 3UICA 1XQ1A 2JAHA 4NBTA 3ZWPA 2QRLA 4TZKA 3GK3A 4HX5A 4MO2A 4TQGA 4AJKA 5JC1A 3KO8A 1TA4A 2B4QA 5CPBA 1I3LA 4DC1A 1UXHA 3GZNA 4P8RA 4NFSA 2R6JA 5FI3A 3RUCA 1K6JA 3VC7A 1E3JA 4UUOA 1IUKA 4FGSA 1Y9EA 4II2A 3PIDA 1RM3A 3ZHXA 4R69A 3NTRA 4NU5A 5TJHA 1EDOA 1LUAA 4OM8A 4WEOA 4AYSA 4E12A 4B7XA 4YT8A 3UCXA 1KVRA 4I8XA 3Q9UA 3QRWA 1QXSA 5TS3A 1ADFA 4ND5A 5GZ6A 3TZKA 1Y8QB 2I67A 1GQ2A 3WFJA 1LBEA 3KYCA 4RQTA 4CM3A 2Q1TA 3TRIA 2O23A 3U4HA 3NRCA 3WIEA 4B3HA 2HCTA 4GSKA 4QX6A 1DOHA 2AE1A 4YT4A 5B1YA 4L76A 4OH1A 1UXJA 2VRCD 3P7MA 3E82A 1VKNA 2H9IA 3EC7A 3GEGA 3UF0A 1YRLA 4UVDA 1A4IA 2WD7B 1J0XO 9LDTA 1VSVA 2DKNA 4MVJM 1LSJA 1XU7A 2PNFA 1VC2A 1GUFA 4DMLA 2AQ8A 4CM1A 4NHEA 3GEDA 4R1TA 3EGOA 4E3ZA 3AI1A 3I4CA 3L4SO 4I1IA 5ITVA 4GH5A 4MVJE 1VJ1A 1WW8A 4WGGA 1ZS2A 1ADGA 4BUCA 4J7XA 2WDZA 4PLGA 2HRBA 2Y0CA 4CM6A 1A72A 2HO5A 4XA8A 5K9ZA 3ZWMA 1V3TA 1Q0LA 1GEGA 1K0UA 4WCFA 1A4UA 4FC7A 3AFNA 4O59O 3RC7A 3VPXA 4BB6A 5IDWA 5IN5A 1CJCA 1D8AA 2VYND 2GUGA 5KVCA 1IPEA 1C1XB 2Y99A 4J43A 3UCFA 4I5DA 1KOLA 4C7JA 4ZICA 4ALMA 1N9GB 1W73A 1GV1A 3WIDA 4Y6RA 5EIOA 2X5KO 1XGKA 1I2CA 4HV4A 3CZMA 1DHTA 1X15A 3KOUA 3R0IA 4N7RA 1MLDA 2W2LA 3ICPA 3PQEA 3DBVO 4KQWA 2JCVA 1CQJA 1ZNQO 4RPKA 4BO6A 1YQXA 2Q3EA 3R3SA 4D7AA 4R41A 2RBEA 2B0JA 3KTDA 4ZVVA 5A5EA 5B4TA 4JP2A 4LSWA 3BAZA 3F4LA 3LK7A 4BO2A 1P1HA 5DCWA 3QWBA 2D4AA 3HNPA 3WYEA 3L9WA 4EEZA 4JN6B 1W4ZA 1OBFO 1HWYA 3E5MA 3JQBC 2HMWA 2I66A 2QRKA 5AVOA 3ITKA 3OSUA 4O0LA 2O2YA 2Q2WA 3Q11A 4NFHA 3MJEA 1GZ4A 2RCYA 3VZPA 3A9WA 5F1PA 1WZIA 1AXEA 1Y5RA 3ENNA 4QEDA 1DIRA 4FLSA 2C20A 2WE8A 3WGTA 2DT5A 3WS7A 3S2FA 5KJ6A 1QG6A 4MOWA 4P4GA 2C5AA 2Z1NA 1ZSYA 4IBOA 4R3WA 3UAGA 3NX4A 3UOGA 5BSGA 2GASA 1DJQA 2IDZA 1MW2A 4NU6A 4RVUA 4JJIA 3ZN2A 4DC0A 5JBIA 4MJLA 1U3UA 1R37A 2O7GA 3BA1A 3JD1A 4YA6A 3L6EA 3QVTA 5BNIA 2O4UX 2BI7A 3BHMA 1ULUA 4DTIA 3A14A 3EYWA 5A9RA 1Y81A 1NXQA 3JQ8A 1R15A 1IHYA 4UEKA 1V6AA 2ZK7A 4OXYA 3IKTA 1E0DA 3PPIA 1BMDA 2NU7A 2EJVA 4D3DA 1ADCA 4CV2A 3HQ4O 3A28A 5HWSA 3FNFA 4MKRA 4PLCA 3VAZA 4LMPA 4AJIA 1BHSA 4XDYA 3D3WB 4K1LA 3AI3A 1E7QA 4L74A 1MW1A 2PR2A 3JD2A 4IJKA 2Z95A 3BMNB 3DOJA 3LYLA 1ZJZA 4CM9A 4CMCA 5L95A 1C14A 5A05A 1ZSNA 1U8XX 5KVSA 2VN8A 4BNUA 1H6DA 2OOSA 4UVIA 1NPYA 2IEBA 1TB4A 2PKRA 3D0OA 3U09A 3GDGA 1A7KA 1V0JA 5CDGA 4RL6A 5KVQA 4J0FA 3RBXA 4DBVO 3VHRA 2POQX 2Y66A 3TN7A 1PJQA 4DBZA 5JCJD 1T2CA 3LC2O 1V8BA 3GT0A 2IYOA 4TWRA 3RWBA 1Y8RB 3WR5A 4AG3A 4D0SA 1PZHA 3FI9A 1DRVA 3PHJA 1PGJA 5DDIP 4O1MA 1EBFA 2Y0EA 1EQ2A 2BFMA 2I3AA 3FNHA 4YAEA 4PZEA 4BNKA 1MG0A 4XEHA 3QVXA 2A35A 2J6IA 5G4LA 2ZTMA 3NTOA 2VUTA 3ULKA 1Q1NA 2PTGA 1F06A 3W6UA 3VZRA 3ZWYA 5T64A 5DCYA 4LN1A 5C37A 1LDYA 4RCVA 1PX0A 4XB2A 1AGNA 3ANLA 2NU6A 3H6KA 4Z0TA 3OHSX 5COQA 3WBFA 3UERA 1TLTA 2OBNA 1LRJA 3RUIA 3IKVA 4RGBA 1SZJG 2XXBA 2CZCA 5TLSA 1QYWA 2R00C 2Y1DA 4BMSA 5IXYA 3PLNA 1HZJA 5ES3A 3FWNA 1GL3A 1JKJA 1YDEA 4IQ8A 3NDIA 2C07A 3E5RA 3HWRA 2YV1A 1Z6ZA 1FK8A 2JAPA 4RPGA 4HNGA 3K2EA 4AJPA 3K8ZA 1YOVB 1ZK1A 3GVCA 3DONA 3AI2A 1BWSA 2NQ8A 4XJTA 2D5CA 5H82A 3ABIA 1WWKA 4TZTA 1HEUA 3ENKA 2NTVA 4KDEA 4RVHA 3WGHA 2JL1A 3A1NA 3DO5A 2NU9A 2VZ8A 3K30A 4YRBA 2ZB4A 2ZATA 3MJSA 3HZZA 3QVWA 4QSMA 1N1GA 4CV3A 2YUTA 4E33A 3AU9A 3JTMA 4U6QA 4IINA 3U62A 1U8FO 2ZIZA 1OI7A 5JSFA 3UVEA 3I6QA 3JYPA 3PDJA 1MVYA 3NT2A 5TGDA 3PK0A 1NQAO 4DREA 1QV7A 3P5SA 4XWYA 1JWAB 2PGJA 1ID1A 1SCUA 4G2NA 1GPJA 4PN3A 3KSDO 3MJCA 2ZTVA 1U2DA 4Q9NA 4R3NA 1GCOA 4PGFA 4UEJA 2XXJA 1MW3A 3EY4A 4MIOA 1PEDA 4TVOA 2Q99A 1NQ5A 2VRCA 1PWZA 4AJ2A 1X7DA 3BIOA 4PLTA 1PJSA 1P44A 1WDMA 5DBGA 2C7GA 3ZCXA 4YYZA 4YJDA 1H93A 3MWDB 5L45A 1NASA 4BV9A 3RAJA 4PLPA 5JPIA 4W4TA 5DF1A 2AW5A 1TVEA 2BGMA 3GGGA 1DIGA 5JLAA 2X0NA 1DEHA 5K6AC 3N58A 1SMKA 5IN4A 4J9VA 3L9XA 5CDYA 3BXXA 2PD3A 1EMDA 1V3UA 3HUDA 4RZHA 1KS9A 3WTCA 3O03A 4TRJA 2PZKA 1GEEA 5JDIA 3H7AA 3WQRA 3FR7A 3RCBA 1ISMA 5BT9A 3RUDA 1RM5A 2YQ4A 2B5WA 3L4BA 3OJOA 1W0CA 4ITUA 3ZHBA 3W4KA 2VYNA 2DBRA 4E2WA 1JN0A 2B5VA 1LI4A 1YO6A 4CQLA 5KKCA 2MAPA 1AE1A 2W90A 3IQDB 1ISHA 5T8KC 3S55A 5K0ZA 2DFVA 4IJWA 2I9PA 1DSSG 1LA2A 5T67A 4EW6A 3GF4A 1VLLA 5COAA 2X0JA 3V1TC 4I5GA 4MVJF 3GMSA 4C4OA 1Q7BA 1IYZA 4RLHA 1TT5B 5JAQA 3GGPA 3TSCA 5JY1A 1HDXA 3KYCB 1P3DA 5TT0A 1UP7A 4E5NA 1OC2A 1BTOA 1P1FA 1Z73A 4OOFA 1PS8A 1H6AA 4BIIA 3T7CA 3GZ4A 3IDSA 4XDZA 4F45A 2G1UA 1X14A 4OO3A 4LISA 2UYYA 5DN9A 4BKRA 3I23A 5G0VA 3LT2A 4UVGA 2W98A 2ZB7A 5KWEA 3ANMA 3PWZA 3IP3A 4BGIA 1NPDA 3ZW9A 4CL8A 1L7DA 4Q39A 2CSUA 4FLQA 1JAYA 1KC1A 1M67A 3ETEA 1PZEA 1F17A 3FWZA 3S2GA 4YXFA 2UUPA 4LW8A 1P1RA 1IULA 4JBHA 2IE0A 4NBVA 5IZCC 1MX3A 3MJTA 4MVJH 3WWYA 1FDSA 3Q9NA 5DP1A 2NU8A 1CERA 2WYWA 1BDMA 2DBZA 1BVRA 3MCVA 4DQXA 3C85A 1BGVA 3WLFA 2OORA 4J1TA 4IS2A 4CMIA 5JFOA 1SEVA 1LLQA 3DZKA 1CDOA 2Q2VA 4R1NA 1YBMA 3RVDA 1GZ3A 3JQDA 6LDHA 1ZXLA 1NAIA 1BXGA 3DFZA 4AJEA 1LQUA 2H6EA 3TOXA 4BNFA 1P77A 3D5TA 2OGUA 2PD4A 4EITA 1PL7A 3AM3A 5IDQA 3FHLA 3ZH2A 2A92A 4CLXA 2NVUA 3M1LA 4J16A 4K9DA 4GWKA 1XQ6A 2PGDA 1I30A 5G0UA 4E5YA 2C2YA 3QP9A 4PZDA 3FF4A 2HK7A 5CEFA 4BKPA 3O9ZA 4PVDA 1HZZA 3CEAA 3OJEA 5DT9A 4AFNA 4IDFA 4PLZA 1HL3A 2Y68A 4D79A 2F00A 4RO0A 3WX0A 5DP2A 5L3ZA 3MWEB 1EZ4A 1P0CA 4XYMA 3RBZA 3QE3A 1E3EA 2D2IA 3O26A 1T2EA 1NVTA 1J6UA 4M49A 3TNLA 3V1UA 4LSMA 3ZWWA 1GTMA 5C3MA 5JCJA 1YE3A 1YDWA 2VWPA 4B7CA 5L4LA 2O3RA 2EKLA 5I7EA 1H9BA 4QT0A 2HMVA 2GERA 4B8WA 2ZB8A 4NIMA 4OGWA 4H16A 4W9NC 5JYDA 1Q0HA 1HDCA 3WSWA 2W4QA 2WSBA 3Q2IA 5I7SA 3HJAA 1PTJA 2FR8A 1R66A 1LSUA 2ZJ0A 1HDYA 3TPCA 1O89A 2FP4A 4Y6PA 3OETA 4BNHA 1SOVA 5F1KA 2NWQA 2GGSA 3ZNOA 4O6VA 4RDIA 2D8AA 4Z9YA 4AJ1A 4M8SA 3RFXA 1JWBB 4R4JA 4IXWA 1ZK2A 4G81A 4GKBA 1FDVA 1Y1PA 3PQFA 4EBFA 4RORA 3BTUA 2E37A 3JQ8B 1C0KA 1P33A 2ZJ1A 4E21A 3GQVA 4MDHA 4NJOA 3EVNA 3KSUA 1A9YA 1U5AA 5EESA 3TL2A 3V8BA 2CF5A 1Z45A 2Y0DA 5C5IA 1BXZA 2GCGA 4YJHA 3ZWNA 8ADHA 4EZBA 3PGXA 4INAA 1DRUA 4XR4A 2J3IA 1HYGA 1KVTA 3ONEA 4BO3A 1KVUA 4KZPA 2PZJA 4XYEA 4IDBA 4BKUA 1GR0A 1P45A 1UH5A 4PFJA 4WASA 2OP0A 3BZUA 4KUHA 1GCUA 2O7SA 2WYVA 5EN4A 1GV0A 2X86A 4R51A 1WNTA 1EVJA 2EV9A 3AK4A 3W1VA 3OIDA 1DBVO 1LSOA 3KHUA 4RVFA 4IMRA 4YDRA 4JX8A 3OP4A 1NFQA 3QSGA 2AEFA 4DLBA 1PQPA 1WAMA 5L40A 1GQYA 4WLFA 5A9SA 4IUYA 4BNJA 2GPTA 1F0YA 4NQWA 1I2ZA 3BTOA 3AOEA 3NV9A 4A03A 2RHCA 7ADHA 4GLLA 3F5QA 3JQ9A 2O3UA 4YAKA 4YR9A 5FWNA 3F5SA 2X7HA 1HYEA 3OECA 4R5MA 4AJHA 5BNFA 1DLIA 4DPMA 4PG6A 3UGKA 4BNZA 5A06A 1IZ9A 4ROSA 2OUIA 4XIYA 4HNHA 1QSGA 2IXAA 1ZK3A 5FFFA 5TJ9A 2O50A 3ST7A 4GKVA 1YJ8A 3AWDA 3KRTA 4H3VA 5JMPA 1IB6A 2IZ0A 3BMOB 1EQUA 5I9NA 2DFDA 3DAFA 3ZWBA 3RBVA 3WTBA 3KETA 2JHFA 1VPDA 3GLQA 2YZ7A 1I32A 4QFCA 4YWJA 1NR1A 1NR7A 2PK3A 4PG5A 4DUPA 5JC8A 5G4KA 4DIBA 4TRRA 1BRMA 4JGBA 1B8VA 3PDUA 4CLOA 1C1DB 2HJSA 2QYTA 5L7TA 3UUWA 2J5QA 1ZFNA 3FNGA 1GYQA 1W6UA 2WEKA 1F14A 1NFFA 3KUXA 2VYVD 3Q6IA 1KEUA 1YL5A 1BG6A 2Y05A 3L07A 3AFMA 3C1OA 4YJGA 3V5NA 2YHUA 1IE3A 4P38A 2BGKA 1ULSA 3GMDA 1OMOA 4PG4A 4PIVA 4Z0PA 1JAXA 3TF5A 1XR3A 4XR9A 2P5YA 2TMDA 1YBVA 4N5LA 2FHSA 1QMGA 2WD8A 4NJMB 1Q7GA 1YJQA 2P4QA 3BMQA 5JDCC 4PRLA 1E5QA 2I65A 2AMFA 4E5PA 2JCYA 4BO5A 4Z3KA 4F6LA 3PVZA 4KTVE 5KTKA 4Z6KA 1KVSA 1N8KA 1CRWG 4HWKA 4JNKA 2J3JA 2HK9A 3PGJA 1ORRA 4GPD1 3U4CA 2O48X 3ZGYA 4E0BA 3DAPA 3D5QA 4Y98A 4D42A 3H5NA 4CM5A 4YTEA 2X0RA 2WMDA 4BV8A 1DC3A 5CG1A 4L4RA 5JO9A 1VM6A 1I8TA 1UJMA 2OBYA 3FPLA 1QV6A 4YVFA 4GI2A 2PZLA 4R9SA 4M89A 1YB4A 3QWHA 1SO8A 3JQFC 3VDRA 5L9AA 1B16A 5I9LA 4IXTA 1JDJA 1E7SA 2AG8A 3VZSA 3JQ7A 4PRKA 3GH3A 2Y1CA 4JIGA 3EW7A 4NR0A 5G0SA 4CM4B 3TFQA 4LRTB 3WGZA 3Q3CA 4XJSA 3ROQA 1PR9A 1T1SA 4FB5A 5LDHA 2RH4A 1HDOA 5A1TA 4ZQBA 3AY6A 4OMUA 4R16A 3KLPX 2X0IA 1EE9A 1I01A 1ENZA 4ALNA 2W2KA 1FXSA 2D1YA 3QWFA 4J4HA 1SB8A 3AW9A 3S2IA 5DBFA 2FPIA 3WJ7A 1R4NA 3DBHA 4GGPA 4I9HA 3MEQA 1JG9A 5HS4A 3IJRA 4CV0A 5TC4A 2TMGA 4YJFA 5JXWA 3CZEA 3PEFA 2C82A 4E2YA 4EYEA 4A73A 1KY4A 3B1KA 3AM5A 1XYGA 3KM0A 3L6OO 3HFGA 3PZBA 1GD1O 3ADOA 2ZTUA 1OR7A 1QLJA 3DTTA 3GG2A 4YB8A 4DIFA 3KLMX 1R4MB 3HN7A 4IPTA 1E1LA 3IOYA 3DAGA 3W8DA 1JLLA 4Q3CA 2GF2A 4NFYA 1UAGA 1GY8A 4AJLA 2VWQA 1EVYA 1XKQA 1PZFA 2V65A 5JNLA 2CY0A 3S8MA 5IDXA 1EEHA 2PD6A 4CM8B 1Q0QA 2FRDA 3GNQA 4DLLA 3OIGA 4NK4A 4TMFA 4EI2A 5G0TA 4IZIA 3DXFA 3L0DA 5BSEA 3ROKA 4OIMA 4IDAA 1QR6A 4BQPA 4CQMB 1BXGB 4E32A 4S1VA 3QIVA 1DLJA 2EP7A 2Z1MA 1VL8A 1M6WA 3TZCA 5L4NA 4KWHA 1SPXA 1JVSA 3H2SA 4IGFA 4JP3A 1H2HA 4WEQA 1EUZA 3VPFA 1WLYA 2I3GA 4M87A 1ENPA 2A9FA 3E03A 1Z75A 4WCFC 3KSZO 4CXFA 1PQWA 3CSDA 3AUSA 3UCEA 3X2FA 3ZNPA 3MOGA 4B4OA 4XQCA 3NT4A 3RUFA 1S46A 1UP6A 2I6TA 2G17A 1PGPA 2NTNA 3HG7A 3SJUA 1N1EA 4JLWA 3I83A 3LF2A 3TWOA 1NVMB 4WLUA 4ESOA 3IC5A 4OKIA 4IDEA 3DMTA 3CUKA 4UUMA 3PFWO 4CLRA 2R2GA 2NV6A 4PCVA 2E49A 3JD4A 2QZZA 1QP8A 3I1JA 1QYDA 4J7CA 1H9AA 1EDZA 1G6KA 2CVOA 3GVPA 4BO9A 4J2HA 3ETDA 3HFSA 1E7RA 4XRGA 1AUPA 2JD2A 2C7VA 2VUSA 2V6MA 2ZTLA 1HE4A 3I9NA 3RKUA 5DCUA 2GSDA 4BO1A 1KEPA 2PKQP 2X1HA 2Q2QA 2Q1WA 3NT5A 2BI8A 3VH4A 5HRUA 2PH5A 1LC0A 1I3KA 1KIFA 1LDNA 1U5CA 3GVHA 3INRA 4QO8A 4D45A 3WYBA 2J8ZA 1U28A 4E2XA 3GPIA 4EEXA 3VPHA 3ADPA 3KXDA 4J1QA 3GVIA 4E30A 3TZ6A 5JAZA 2RIRA 1NM5A 3WG9A 1GYRA 3H8VA 2HSDA 2EGHA 1NNUA 3PHHA 4FSHA 2EEZA 3UEQA 1I3MA 1WXDA 2GNAA 3H4VA 4O5OA 5IZ4A 4QFDA 2MAOA 3KYDB 5LDGA 1PGNA 1XSEA 4FQ8A 3D4PA 1T25A 2Y1EA 1JQBA 2EJWA 5AXAA 4CMHA 4CL3A 3JQGA 2HKIA 2JD1A 3FRJA 2HUNA 4J0EA 4ZN6A 3SXPA 2X9NA 4R01A 5FI5A 4UULA 2C29D 3R1IA 4WKGA 5KJFA 6ADHA 2FSSA 1M75A 1T2AA 3SVTA 1AXGA 4IQGA 2G0TA 5I9MA 1ISIA 1Y7TA 2DAPA 2B83A 3BMCB 1PJCA 4HFJA 4I5EA 2G76A 3DBRA 2DPHA 4WLNA 3VTFA 4B7UA 2VUUA 3E1KA 4HP8A 4RVGA 4IDDA 3ORFA 2OHXA 4MVJI 3BHJA 4YT2A 2A4KA 3MJ4A 1NVGA 3GNTA 3JD0A 5KKAA 1ONOA 2VHWA 3D7LA 2VYVA 3D4OA 4QUKA 3IL2A 5L4SA 4BNYA 4XKJA 4YAIA 2YFQA 4Z3DA 4WK6A 3FCOA 5ENDA 1E5LA 1DO8A 5TSDA 1V9LA 1I33A 4R1SA 3KEOA 2PY6A 3VDQA 3LQFA 1LSSA 3AU8A 3VPGA 5L53A 4M86A 1PL8A 2GD1O 1XDWA 1XLTA 3K6JA 4ND3A 1HRDA 2EKQA 3F1LA 4OQZA 5KJ1A 2V7PA 3SX2A 1TXGA 1LRKA 5AXDA 1B14A 5EQDA 1LX6A 3INTA 2Y1GA 2RHRA 2H63A 2BFOA 4HADA 4Y9DA 5U9CA 2PWZA 5I7FA 1YQDA 4QXMA 2FZEA 4RZIA 2FWMX 2J3KA 3AM4A 4OXKA 3E9QA 1T2DA 3PZRA 3QW2A 2OL4A 3S1LA 1UR5A 3AUAA 1U3TA 2HQ1A 3F3SA 1BW9B 3EZYA 3FR8A 2AQHA 4GL4A 1ZMTA 2BD0A 3WQSB 5DZSA 3MJVA 1DRWA 1GADO 1B15A 1ZK4A 3OIFA 3OH8A 5F3RA 5LCXA 3P2YA 3ON5A 2X9GA 4D3SA 1HYHA 1MP0A 1DIBA 3BTVA 3PWSA 4CR6A 3NGLA 5G4KB 3FSRA 3MOIA 4Q3AA 4OKNA 1E3WA 1PIWA 4ZQHA 1SC5A 3NEPX 3COSA 4EDFA 5ICMA 1EFKA 1U3WA 1D1TA 2VT3A 2YQ5A 3A4VA 3PJGA 5COBA 1BDBA 1HETA 2OXIA 2ZYAA 2IEDA 5JAIA 2OFPA 1E7YA 1B26A 5FF9A 2DUWA 4IIVA 4LVUA 2YHIB 4ALIA 1HF3A 2C59A 4YEDA 1R6DA 5CDTA 1DAOA 5MGBA 3V1YA 5KJCA 1LEHA 1P9LA 1PJ4A 2X6TA 3NUGA 1WMAA 3GZNB 1LDEA 1T1RA 2JCXA 1ZW1A 3CZRA 3M1AA 3C7DB 4CMGA 3FBGA 2WPGA 2Q49A 1KY5A 4N5MA 2ZQYA 3FBTA 4MVJD 2NTJA 4OSOA 5KVVA 1PS9A 2FPGA 5A03A 2AHRA 3H5AA 4CM7A 1BXKA 3CMCO 1MB4A 4JROA 4CPDA 4DLAA 2EWMA 5IFLA 5F5NA 1CYDA 1WVGA 1B0AA 2I99A 1G5AA 4XD2A 1L7EA 2QX7A 5TT1A 4YRAA 4W7IA 1X7HA 1Y8QA 1ENYA 4RF4A 1O8CA 2GN4A 3PTZA 3VVCA 4E4YA 3EUWA 3GAZA 4IIUA 4OJNA 4CMEA 2CDBA 3FTPA 4GLOA 2P68A 1CWUA 1OFGA 1M2WA 1WMBA 4B4UA 3V2GA 2AQKA 4FOOA 4LCEA 3R6DA 4I9UA 4YQYA 1WDLA 2NNLD 1UXKA 1ZXBA 2VHYA 3O4RA 4DWVA 2JD0A 2BLLA 1HSOA 4DIOA 4MP3A 2WD7A 3ONFA 3ZHYA 2LDXA 1IY8A 3GUYA 5JDIC 5CEEA 5H83A 3ETGA 4MVJP 4JK3A 4U8GA 3HDQA 3L4BC 2BELA 3G3EA 2P9CA 2BGLA 1WZEA 1ZIDA 1K6XA 2ZCVA 5HM8A 3D3EA 4DRYA 4RVSA 2HMTA 3ZU2A 2AQIA 3ASUA 1R4NB 3DBHB 3W8FA 1GUZA 2HK8A 4EUEA 1S6YA 3GHYA 1KVQA 1ISGA 2EP5A 2E82A 2VWHA 3CKYA 3ROPA 4WCFB 5HTOA 5B4VA 1C1XA 4GSLA 3X2EA 3KBOA 4JBGA 2DPGA 3RC1A 4FFOA 4E5MA 1ZK0A 3M2TA 4O63O 1N9GA 3GDOA 4W6ZA 3JV7A 2YV3A 4DL9A 2B35A 1X13A 1YVEI 3K96A 4BGVA 2O2SA 3DFUA 4TROA 1GZ6A 1A27A 2CD9A 3KVOA 4F3YA 1E1NA 2AA3A 2HMSA 3O8QA 4KUGA 2DBQA 3Q2KA 3EMKA 5DULA 4MINA 2NQTA 3SLKA 3T4XA 4BL5A 4A2CA 3HE3A 2ET6A 1TI7A 3GUCA 4FLOA 1HDZA 1EVZA 1WP4A 2C5EA 3JYQA 1RKXA 2DU8A 1PJ2A 5LC1A 3WJAA 4BO0A 3LF1A 3K9QO 3PYLA 1ZSVA 2PKQO 4E5KA 5IG2A 1YBAA 5A02A 4ZU3A 5B37A 4A0SA 3PHLA 4Z0HO 3HDYA 3S2EA 1DC5A 2Q45A 3E8XA 3PYMA 4LRSB 2Q4EA 3I9JA 2Y93A 2PH3A 1U4SA 3H2ZA 2B69A 4IS3A 1XELA 1PJBA 1H2BA 1CQIA 2IODA 2D0IA 3F6YA 4I9NA 4B3JA 5AQ1A 2VCYA 2AG5A 1MFPA 3ZWCA 2OMEA 3LDHA 3RKRA 4CV1A 3VH2A 4BMVA 3OEWA 1IOLA 2HDHA 2VHXA 4YACA 1H3LA 1HT0A 2DVMA 3U5TA 2B37A 4ALJA 2VRBA 1B8PA 3BTSA 4WLOA 4FD3A 3JD3A 3D4NA 4ND2A 3WNVA 4AJJA 4DYDA 3PQDA 2O4CA 1NX6A 2EHDA 4PG8A 3G17A 1MV8A 4II3A 1B7GO 2EIHA 3NDJA 3WXBA 3CZKA 1LLUA 2LDBA 3K5PA 4TKLA 1B3BA 3ZU4A 3B20A 3I6IA 3QWAA 5I8WA 1R0KA 4CUZA 3F47A 4FFMA 1ENOA 2PGLA 5TRTA 4IMPA 2X9VA 4LCJA 3BMNA 1I24A 1YL7A 2Q46A 4U0JA 5T57A 1HE5A 2XAAA 2X4GA 4IDGA 4NZ9A 2I76A 2X5JO 3ZNQA 4NH4A 1XEAA 1Q2XA 1MW0A 2NVWA 5IF3A 2HAEA 4K6CA 3WGGA 1XU9A 2PLAA 5GY7A 3VTZA 4NDNE 3CZLA 4XQ9A 1ZMOA 1C3VA 3GA0A 4Z9FA 3ASVA 4U7WA 3PJDA 4JQCA 1MC5A 1UDCA 1P1KA 3ZV6A 3CMMA 2JFGA 4DYVA 4C7KA 4JBIA 4RF5A 4FOSA 4XX0A 5BSFA 1M66A 2Q4BA 4WOKA 4B8ZA 3JQGB 1CETA 3H3FA 4ALKA 1ISFA 1DPGA 4RF2A 3WMXA 4EJ0A 1VSUA 3EAGA 1UDAA 1HDRA 3LT1A 3RFTA 1F8FA 2D3TA 5L7YA 3DZFA
chains in the Genus database with same CATH superfamily
3NASA 2VRWA 4FR5A 1TUBA 3V4ZA 3FLMA 1Y5NA 1CJTC 1G291 1NPTO 4XQGA 4KYTA 3H84A 5LP6C 5TQVA 1DKNA 1T9GS 2ZYSA 5A3RA 1YWGO 5K4AA 2OXFA 5JXJA 3BD9A 4KFSA 4BGUA 4DLKA 2YOFA 1ORDA 2C2XA 2I2AA 4RZ2A 5D51S 1NW7A 4AZ3B 5BURA 3ZVNA 4AKHA 5BN4B 5FTMA 3LIIA 3RF7A 3H1TA 1FYVA 1JFFA 5U1PA 1XPJA 5JYBA 4YC7A 4JSRA 1SC6A 3TG8A 1GUYA 3ZV4A 3N05A 1F12A 5JARA 5GIOE 4KX5A 1LJ8A 1SG6A 5FULA 1F7UA 1UMBA 3S7TA 4YJ2B 4TWBA 4W5HA 4M9XA 3X1JA 3FFTA 2AH5A 1G6HA 3V6MA 4BO8A 4LUPA 1O95A 4CMJA 5L7WA 5K0SA 3NKFA 3RJ9A 1G5FA 2XQKA 1LH0A 3OPXA 4HLQB 1RLJA 4WFKA 1YOVA 2WBLC 2QG4A 3KKPA 5K0GA 2GRJA 3IQZA 1WU8A 2R8BA 3ABSB 4REQA 1QIEA 1E2BA 2W37A 3N5KA 3A6HA 4JP1A 7ABPA 3GFGA 4FEAA 3ABRB 3CINA 4OSEA 1ZH2A 1JUDA 4QO7A 3ROFA 2RGUA 3TK1A 3TL3A 2I33A 5KCZA 1U7XA 2CLMB 2O8DA 2C99A 1QORA 3L6RA 5EZ6B 4PXYA 4RPIA 2EWWA 4I2VA 3HADA 3DHYA 1VLVA 4FBGA 3DM5A 4DA9A 4TVSA 3Q7EA 1RZUA 4XE5A 3DEJA 4B5LA 5BV1A 4RYDA 4UOEA 5K2MA 5KINB 3DMFA 5FJJA 2PUJA 1U2EA 1P4RA 3ZE9A 4BO4A 2IDJA 2DCMA 2HF2A 3GU3A 2XWPA 3W4IA 2WPDA 2VRNA 5DEOA 4YP5A 1Z3CA 3DEIA 5A7GA 3Q3JB 4Z7OB 3SC3A 3U5ZB 4N5NA 2O8VA 1SC3A 3LVFO 3K6RA 1VB3A 4EJFA 1ZJYA 4KP7A 5T3UA 5CA1A 3RUEA 2DKOA 4X6XA 5LYJF 4KZKA 1OXVA 2F8LA 1ECGA 2H7VA 2QJFA 3EDMA 3OESA 2XTZA 1T5TA 4A6XA 1HTBA 5ALSA 3GFRA 1JMKC 2XKBA 1PZNA 1DMSA 4NBUA 4QAQA 3L8YA 4OKSA 5KQSA 2PUFA 5REQB 5H3LA 1C0IA 1FPMA 3QHPA 3K73O 3VHXB 1T5BA 3OUTA 1YK1A 3UJ3X 1K4KA 3ZU5A 1N34B 3UXYA 4P6VF 3O73A 3CUSA 4FDMA 3PC7A 2O06A 5AR1A 3URMA 3IR5A 1EE2A 2ODWA 4B3GA 4KPUA 1DIOB 2QTHA 4ZFNA 4DYHA 5A4DA 1N0UA 2ZKLA 4MCIA 2YYYA 2D5LA 2WP8J 1N6LA 2IA5A 4JWTA 4R8KA 1QFZA 1ZD3A 4L0DA 3VHQA 1W46A 5BN3A 2JLCA 1GP2A 3JQAD 3O3CA 1FS6A 2CUTA 3EBPA 3U4IA 3WMWA 2BHRA 4HTAA 4JZYA 5EXDA 1RFLA 1YQEA 2CXHA 4R40A 5BY2A 3IIEA 4PSKA 4BTLA 3OTHA 3L8FA 2BMWA 4XYBA 2I5PO 4OVKA 5CHEA 3ZPXA 2WMOB 2Z2IA 3KJNA 4FFNA 4YMUA 5ARBA 4CLDA 1HOXA 2WINI 3R77A 1MC1A 1YZQA 2FX3A 2WNIA 4FDLA 2NUPB 4I50A 3PXXA 4NYJR 2X6QA 4CUKA 3ELWA 1J9ZA 2QA5A 3L18A 3PNPA 4MIYA 2QN6A 4URFA 1LJUA 1K6IA 4F2PA 1PJ8A 3IOEA 4XWTA 5KYWB 2R8XA 1X8KA 4JT4A 3K9WA 3R7LA 3DMHA 4F85A 1YR9A 2ONKA 5HDQA 1HGXA 2ORED 4NKRA 3EGWA 1RQPA 3OPYI 3DNFA 2MYUA 1FRNA 3WZLA 1JEAA 2Q5EA 3WDSA 2IWHA 4DIUA 3CH5A 1VRWA 4Z8YA 4IY1A 5LA6F 2HIMA 3CW9A 5LWQA 5EJEA 4E94A 3IJ5A 2UV8A 3AUYA 2ZS9A 2O05A 5AOVA 4DA4A 4LQCA 3G79A 4Q3KA 1JYSA 4KMRA 3VNUA 4PC2A 5HXAA 1PN3A 3F2IA 2MCFA 1P3Y1 1JIVA 1QH8B 3BQNB 3WB9A 2GHRA 4ZYLA 3RUPA 2EBHX 3K9GA 4ZW8A 2ZUTA 2SKCA 5JOQA 1XUOA 2DC1A 3SZOA 4P5EA 4MLZA 4I8IA 3ADDA 3WLSA 3FKJA 3T0FA 5EJ8A 4GVXA 2CMHA 2XGGA 5KVAA 3WGIA 2GNOA 3OURA 2K2QB 4IQFA 2JBAA 3DC2A 3JQBA 1T9AA 4E88A 2CSXA 5ICFA 3AV0B 2AMYA 3N7UA 3O7WA 3ZWAA 1A5AB 4ZREA 2IQIA 2VSYA 4L7QA 2PSSA 1KXJA 2GH1A 1N8TA 2IYQA 2JGMA 3HU5A 1X39A 4YCAA 1E1YA 1JV2B 5H9WA 1X9IA 3IVMA 1YR1A 3NHWA 4ZYTA 4A4DA 2FLWA 3I01A 5L3SB 3V42A 3BIXA 4CXMA 2XAUA 4FCAA 1YKFA 3FDIA 1Z39A 4RMJA 3KUUA 3LO8A 4TTTS 2NU8B 3H87A 2AG6A 2QRGA 1KPIA 4FR0A 4L4UA 2FCRA 1Y5MA 2C2KA 2JH3A 1YXMA 2BEWA 3IJEB 3VC3A 4AG5A 2IKSA 5KNDD 2JK0A 3B3JA 3VKFA 4JT9A 2MSKA 4Q6WA 1NSFA 3OICA 2DLDA 3NM6B 3WKCA 1QDEA 1QIGA 3D0RA 1F2DA 3DLHA 1MJGA 1DC6A 4LJ4A 1G5HA 2HNBA 5C7LO 3B78A 4OI2A 3O83A 4EFNA 2W8BA 3CEJA 1K6MA 1OX4A 5CX1A 5A5GA 3DMPA 1TEVA 3PC6A 3EISA 5CURA 5KHOC 1II8A 1PD1A 4NPHA 5EMHA 3F49S 1KHTA 1P6QA 3HR4A 4L6CA 5JLJA 3E1GA 1NHWA 3QU9A 5J2TF 3TE6A 3P9PA 2WWYA 2C5LA 3OQBA 4OQEA 4BJ3A 4LI3X 2ZETA 3H9UA 4JC4A 5KOJA 3B70A 4U2GA 5KDLA 1E9RA 4OGLA 2IWRA 2XA1A 1WUTA 2D0DA 1SXJA 4F4HA 1JH9A 3GA5A 4JLBA 1P0FA 2VNSA 3L77A 1PU2A 3I0ZA 1E0JA 2JJ2A 1AHPA 2RGEA 4UUBA 2D5AA 4MV8A 1A9ZA 4DGSA 1KQGA 1HKUA 2V6GA 3W8EA 5FLYA 3NTVA 3A4LA 4ZVVA 4LFCB 2M32A 1HORA 2ATVA 3KB6A 1I6KA 3TZQA 2IHUA 1MJFA 4DNPA 4J3BA 3LWBA 1K5HA 3TTWA 2Y1WA 4ARCA 2RGAA 1NT2A 4EPYA 4NZMA 4GVPA 5JZMA 1VYVA 2ZG6A 1WU7A 4TKMA 1E32A 3OQPA 3U9SA 3VSBA 1O0SA 4GYWA 1KETA 1D4AA 3QPDA 3LW8A 3C7AA 4YMGA 1FE8A 1C3XA 1XWFA 2M98A 3CO0S 3H2KA 2R47A 3MD0A 3P2OA 2FSVA 3QA9A 3FH0A 4F5DA 4PPQA 3Q1KA 1M2VA 4N54A 2Q9CA 3HBNA 4P0PB 1ECJA 4WE3A 4E31A 1C3OA 2ZBQA 4N0EA 2HWKA 2HA7A 2C58A 1HS6A 3P4YA 2IQ5A 4Z86A 1SVNA 5ALKA 4BHTA 2FDCA 4OAPA 2WTNA 4TWAA 1UDRA 1R74A 2CXXA 4DR5B 4ZV7A 1NVDA 1H6BA 2WVAA 4CQMD 4CG1A 4KN8A 4DOMA 2CYBA 3KZKA 1NSTA 2P65A 1CZOA 3M2PA 5FV4A 2V96A 1Q74A 3OA2A 4P3KA 1MZPA 1WXXA 1CB0A 4MA4A 1E5XA 1NI4B 1RWBA 4IKOA 3BHIA 2C2GA 1JHPA 4XJXA 4YRTA 4KQEA 1UAYA 3IDAA 4TLAA 3B8EA 3QENA 2PT5A 2G6BA 3DDNA 3K0AA 4BVHA 1ZGAA 3M6UA 3O82A 5KTYA 4KI0A 3R3JA 4YJHB 4QZVA 4FW9A 4EHJA 3HSKA 3REFA 4QPCA 4QVKA 3QELB 2XUQA 9LDBA 3PXUA 1TF2A 4F5YA 2GYYA 3AG5A 1F2UA 1Z2CA 2AFIE 3ILHA 1WG8A 3MBKA 3KV1A 3MGCA 5JE8A 2F3UA 2XCOA 1FFYA 1W0KD 1N7HA 1U8EA 3E2MA 1Z68A 4O33A 2VTVA 2EZTA 3T9BA 2C84A 4H7IA 3R2JA 1G7RA 4BNXA 4ZX5A 4EAAA 2KBFA 2O3QA 5A9TA 4Z53A 1XVUA 2I0FA 1A8SA 1HK7A 1RE1A 2OV4A 4OPMA 1UOQA 2C0PA 2WF5A 5J5CA 2BFCA 2AZDA 1G17A 1P39A 2PXAA 4MQEB 2BE9A 4GC5A 2HH9A 1JQAA 1K75A 2HSGA 3I52A 4D0GA 2B5OA 2CUKA 2JLBA 4Q3OA 5CYPA 1IBCA 4MV0A 5D5QA 4KO1S 3WGNA 1ZRNA 5EEHA 5DXFA 1E9EA 1YR6A 2WZQA 3H2JA 5CLLA 4P33A 2J5KA 3B1JA 3PFKA 1U2GA 5BVHA 2H06A 3H7IA 3PI7A 3A6EA 5KNLA 1ZH8A 3U7EB 2K5UA 6AT1A 1XRJA 1VIDA 4PXAA 5GMOA 2PMEA 3SC6A 1D1PA 1K7EB 1OSNA 1WMFA 1LPBB 2M2IA 3BFJA 3M3HA 4IOLA 4LMBA 2WC1A 1J0AA 1H23A 4MKFA 1SXIA 2H8KA 5FLEX 3PXGA 3U9TA 3ZGLA 1PV4A 1BSVA 2YJ5A 3D43A 2BFAA 4LZOA 1H9CA 1C1YA 1Z82A 3KKKA 5FX2A 1QP0A 4TN5A 4FVTA 1YZ3A 4B4WA 3MWGA 1R12A 2J5RA 2CGEA 4X71A 4Z4IA 1NOKA 2FR0A 1SXJE 1E60A 2QHXA 3B12A 1JLKA 4UTXA 3RWOA 3T5GA 5HBRA 4PZCA 2FWAA 4HQ0A 3C24A 2WAXA 1F8GA 5KOIA 1DAHA 2HPZA 3BWYA 3UJBA 4G0NA 1WHSB 5KSPA 1EX7A 3UN1A 4CKEA 3NORA 3HY6A 2VOEA 3H13A 5LP1A 4BP1A 4BVAA 2NYAA 3UWOA 1Z0DA 4PPYA 5IH3A 3UWSA 4D46A 1IXYA 1X9HA 2HPVA 4IJQA 4ZVPA 1QG4A 1XD2A 1FFEA 2D74A 3JRWA 1I1NA 3JQAA 4IHKA 1AS0A 1NMEA 2O7NA 5AKGA 5ERXA 2AEJA 2PV0A 1KMHA 2WAAA 4A7PA 3BMOA 4B3IA 3DVLA 1DBQA 1NHGA 2W42A 4UOQA 4UTZA 3DP9A 4N18A 5TEWA 2HV9A 3ECSA 5D1NA 2GCNA 2OCAA 5IU6A 4D41A 4DV4B 1VJCA 4H6XA 1G18A 1C7ZA 1PHPA 2OC9A 1VGVA 1K2WA 1UBCA 2CBXA 2WFLA 2QOEA 1FZQA 3R5XA 4JY7A 3E6AA 2R70A 4L08A 3V1NA 3KQUA 4LY0A 1ZKMA 3N9IA 3GIWA 5K0CA 1NYLA 2AT1A 3EMBA 4GUAA 4TM7A 5ICSA 1NC1A 2VQ3A 4M8IA 4G25A 4E4TA 2Q4TA 1XZCA 2Q50A 3HU2A 5LB2A 1W49A 4DCOA 3GD5A 4MVJG 4GM1A 5CIYA 1TO6A 1U7OA 3UOAB 1NUPA 3HZRA 1TM5E 2CEAA 1FY2A 2FPPA 2O14A 4JUIA 4PYJA 2BGTA 4DEVA 4D80A 1BOOA 4OB8A 4YPOA 1XLTC 3GYGA 3OOSA 5THKA 3UUEA 2OYRA 2JGLA 1Y63A 2R96A 4QPEA 1S2MA 3FNEA 3OTQA 5JH7A 2VF8A 3L7JA 1DIHA 2CL5A 1EWYA 3E9ZA 1HSZA 1NBAA 4FXPA 4JB0A 4QL3A 4UHKA 4BNLA 4HBGA 2YASA 3EYAA 1UK9A 2ZW9A 1E9BA 4UVEA 2HBZA 1PT8A 4LBZA 5DXAA 5KKCA 1L5VA 5AENA 1RJWA 4XWGA 4YQZA 1QE0A 3CRZA 2JLZA 1H4QA 1ZZEA 2VDMB 1FLVA 3AI7A 3Q87B 2FFQA 4TKZA 3H8SA 5E4YA 4WY5A 3WGKA 4PC6A 2YINC 3K0KA 1S8NA 4P86A 3MXOA 2NACA 3ML1A 1Z5PA 3HYNA 2WB2A 3FHOA 2P6UA 1P2SA 2Y67A 3FNIA 3VNRA 4YT5A 3ZKWA 1AM4D 3VNQA 2FFRA 1P81A 2WNHA 5I4IA 3EH1A 4H1VA 3TQSA 4ND4A 2GCOA 1T0BA 3OJFA 3V4PB 4RTOA 1E92A 2P9JA 5SY9A 4ILKA 3RVJA 4KXUA 4KC0A 5DYFA 3OMLA 1LPSA 1Z0KA 4CQNA 4JNCA 2VZ0A 1FTSA 3R6WA 5KNDA 1G5QA 3KSRA 3WRXA 1KRWA 4E5VA 1W25A 2M9MA 4X54A 3X1MA 2X1LA 2ZSUA 1U8TA 4LJ9A 1FQWA 4Y0NA 2DTEA 2WY2D 3J81k 2FZVA 4HWPA 1IVNA 4CM4A 3OD5A 4RY9A 1SCAA 5YASA 2RB5A 4HDKA 5U4QA 4YUAA 2EZ4A 4AP6A 3QBJA 5FOWA 3P2EA 2P9ZA 4UDOA 1VI6A 3LC7O 1JLHA 1BCSB 1CT9A 4L8WB 4V2IA 3FVRA 2AC7A 1GZVA 1ZCJA 5FPPA 5TGTA 4US2R 3UFXA 3QLTA 2C2BA 3U2QA 2XGSA 3CEHA 4GR4A 2CN1A 5AW0A 3IH5A 5GVSA 4U5QA 5JNWA 1YRQA 4IM7A 4IQ0A 3JATA 4XVCA 1MO6A 2I2DA 3C3XA 4PGHA 4XRRA 2NW6A 2I4IA 4IX1A 2XNJA 3CCFA 3UENA 2QB5A 3W9BA 1BGXT 2VT7A 5E9AA 1NI5A 1QV9A 1YE5A 3ZHCA 4C0HA 2V6BA 1B3RA 3BSSA 3WL7A 5CA0B 1JFSA 3F67A 1LY1A 3JQ6A 2BMJA 5ILOA 3U80A 4ZHSA 5JAOA 5H81A 1ZVKA 1UOEA 5GINE 1C0PA 4FJ0A 5FDFA 1UXGA 1JA9A 3BDIA 5LPNA 4MV7A 1YMQA 2BT4A 4K26A 1IU9A 4ZO9A 4AKSA 4GQAA 4DIKA 1QTQA 2O5CA 1PR3A 4EVRA 2G40A 2HOQA 2VTBA 4CMAA 1KEVA 1JNXX 1GRNA 3IT2A 2TSYB 4QT4A 2RHJA 2QP3A 2JIQA 3I9OA 2OCYC 3K6SB 4LMRA 3BXOA 4US1R 3DZCA 1E1QD 4JCOA 4G5HA 1S4QA 1V3QE 3R8FA 1UBFA 3DE7X 2FKNA 4O4IF 1AKNA 3KKEA 4MV5A 5E0OA 3U13A 3D6FA 2XDWA 4BY9E 1MIOB 5J2UB 4A5OA 1JXQA 1AKTA 3AB8A 2AL7A 3ESBA 5D00A 1I3CA 1LNQA 2IZOA 1RR6A 4FYMA 1E9SA 3KQYA 4GRIA 4TLLB 3UB4A 4ACBA 3GNSA 2B4TO 3ROMA 4O2AA 5I7VA 4B3TB 2P9QA 5EUMA 2O3JA 1R8YA 3C5WP 3NHKA 4B09A 4YCSA 1J49A 1KEWA 5AI8A 5J23A 3VKVA 3GT4A 4ZQGA 5AWFC 3BFVA 4BX2A 1THGA 3OBIA 2CF6A 2X19A 2OXTA 4CQMA 4DCPA 1UP4A 1NAHA 4XFJA 2HLDD 3WGYA 3WWDA 3KTAA 2XLBA 4KAXA 1L5YA 2FSHA 1U9IC 4KSYA 3AUUA 5HKLA 2IHTA 3A3NA 3V9PA 1WPGA 2GJ8A 3E9YA 3RS0A 5LBUA 3GC6A 1U9JA 5JS1A 3OKAA 1JEQA 3SYKA 2WAMA 3B89A 4TSFD 4AICA 2EXXA 4AL4A 2GDZA 4DPLA 5C46F 2VC2B 3P0EA 3VZQA 4EO9A 1YQQA 2QV7A 5ADHA 3JVIA 2J5XA 3O7MA 2R86A 4GNRA 1ZYUA 3ZH9B 4HC4A 1QZTA 3AUFA 4BJ6A 4QM7A 1TK9A 1D9ZA 1DQPA 2PKWA 4NAVA 1KH2A 1W0KA 1H8HD 2NZVG 3NLLA 3E3OA 3P9XA 3ILXA 1QAMA 2PWPA 4TSKA 1NW4A 2D13A 4E5SA 2FMIA 1XJCA 4L50A 1QYRA 3E7FA 2QZJA 1PUIA 3O8CA 1YBHA 4Y1GA 2NXNA 4CLRB 1PQUA 3LUFA 1ADJA 3JPYA 1FBNA 4K2AA 4FWIB 5H16A 5IX8A 2XDYA 1SU4A 4TUYA 2HXYA 3VZCA 2G07A 4QICA 3I72A 3EXG1 3FM9A 3QMWA 4EPTA 4WUVA 2E4UA 2AF3C 4ES6A 1MFZA 5G41A 4Q4HB 5C8ZA 2XPCA 4DLTA 5B57C 4JI4B 3IAM1 1E3IA 5DLEA 4DTCA 2Y77A 3AY7A 4NV1A 5L51A 4Q3EA 2QM3A 2BI4A 5F73A 5AKHA 5CPFA 1HEYA 1QYVA 2CNBA 2JZNA 4L07A 4BNVA 4UQLA 5HKAA 1FNBA 2F8TA 5EHQA 4EW2A 2ZRFA 5E6UA 2GZ1A 3CRVA 2NV2B 2PMCA 1ZD4A 4DVJA 3NJ8A 2YCLA 2Z5LA 4RPLA 4RY8A 5KKNB 1DNPA 1UBMS 1TW3A 1P18A 3KELA 4F6RB 4NPAA 1T2UA 5JO0A 4AO6A 5IAGA 5J9FA 4QOFA 2V7EA 4PHCA 2O20A 3UM9A 5AVWA 2R68A 4NBRA 3PHGA 1N7JA 1UMKA 4UEWA 3DZJA 1H2YA 4H1UA 3HUEA 3U40A 3PX7A 2I1QA 1AKRA 1Q21A 1YHZA 1FMJA 2EAUA 3KYDA 1FLNA 4IXMA 3SQMA 3RU7A 1G3RA 3UH1A 1LNSA 4M1EA 4ARFA 3VR3D 3W4JA 2FJUA 2QUAA 2QNBA 3CXUA 3GRUA 4EL5A 1MENA 4DV6B 3JARB 3UK6A 1G0NA 1R6VA 5KQPA 2R5FA 3NNNA 2NTEA 1XNQB 1ZIYA 1I7PA 3DMYA 3LQ1A 3CX7A 5DI3A 4UMEA 4Y67A 2VQDA 3TUZC 2D6FA 4D3YA 2IUFA 3WIVA 5EG5A 1T26A 3L7BA 3F8WA 3Q1LA 1KJZA 1LPMA 4BX8A 3GPBA 2ZSEA 3E15A 4G9GA 4ZAXA 1Z37A 4KO2S 4Q4CA 2CFTA 4MMXB 3W5DA 1ZPDA 2C8LA 1J2RA 1JKFA 4HDRB 3CTMA 4RY0A 5AICA 5ALDA 3VV3A 4K9SA 4X20B 4F4UA 4KHPB 1ZO8A 1VRVA 3RNOA 3QVJA 2ZJ5A 4HVCA 1VL0A 5JSYA 3BCUA 4HXYA 4CN9A 1ZGBA 3R5FA 4KE6A 1XEXB 1SK9A 3I0NA 1DAMA 3O8BA 1E0AA 1XDDA 4QGAA 4GOMD 4OBBA 1LW6E 1E62A 1VPWA 3PXAA 2ZYTX 2YDXA 4IEEA 4LOKA 4ETWA 4QU0A 2F43B 3NH6A 1T5SA 2YWXA 1BWQA 3JRNA 1AUXA 4L1KA 4WWHA 1LC3A 1V1RB 2VHQA 2IE8A 5EFZA 4CMKA 4HWOA 4CM9D 4EUKA 4XO4A 3WDMA 2Q3MA 2X8JA 2RK3A 3A1VA 1UPUA 3O91A 3KNZA 3CF2A 1BKYA 3ZI4A 4AYXA 1TEZA 1EUCA 1HLPA 2V6JA 3I5UA 4AY3A 2ZB3A 3SVZA 2RHDA 3C3JA 2JANA 1XXHE 4YUZA 2BFWA 4BGEA 4YFYA 1R16A 1M76A 5EIXA 3GXOA 1PWXA 2G1KA 4C07A 2PL9A 5BNTA 4V0RA 1JBEA 1NULA 5EERA 1JHVA 1FJHA 2CXQA 2V4ZA 3SSMA 1DHRA 3GLHB 3HCBA 4JR2A 4NCBA 3ZKAA 1GU0A 1ZEMA 4P7BA 4C3VA 2P67A 3K32A 4I4CA 4FS3A 4WNAA 5JDCA 1KU6A 4ZW3A 2W6ZA 1ABFA 3EX7C 2JPDA 2UUCB 3CW2A 4XTCS 4BNTA 3R3VA 4RQUA 5J5AA 2W6OA 2FPUA 1L7RA 1WKBA 1ZONA 3AJAA 1BW9A 3OIUA 3AFOA 4MB2A 4JD5A 2JVIA 4CMBA 5G1PA 3DB1A 3EMVA 3OX4A 1NU6A 1ISPA 1FP7A 1KO1A 4Z7NB 2KSQA 4HL6A 3INGA 3NHUA 1ZU4A 4UDYX 4LQ4A 1WZCA 4XM2A 4JT2A 3D64A 2DHCA 3IUSA 1VJ0A 1E3WB 1LZKA 1YH3A 5B36A 3GWZA 5E1DA 3TIGA 1O95C 1KO7A 2BUBA 2JLYA 1Y9AA 3JQFA 2WIBA 4PFSA 5KNCH 2JGKA 1QE5A 1A7JA 3EK2A 4RM2A 2GVNA 2Q21A 4IHJB 4RQAA 3U3JA 4OHBA 2FGKA 4K05A 3HYTA 1ZNXA 1M2EA 3B3BA 3S5JA 2DTDA 1IOVA 1BS9A 1MB0A 4M9ZA 3U7GA 2YV2A 2ZGVA 3G0BA 3K70C 4MZXA 1SBTA 5EA2A 2ZE6A 4HZUA 2I4RA 1NGSA 3GK3A 1IEVA 3IIKA 4HX5A 3CUWA 4MO2A 4TQGA 2B4QA 1PLLA 3MS4A 3VJLA 1WKCA 3N2YA 4P8RA 3QH4A 1SH7A 1MQAA 1QRAA 3B13B 4NFSA 4X85A 4ZT5A 4RD2A 3TZEA 4AWBA 1M33A 1V5EA 1MJHA 4PX9A 1L1EA 5FNVF 4MWBA 1K6JA 4KEAA 2QLJA 1VDZA 1E3JA 2Z58A 1IUKA 4M1ZA 4KFCA 1Z88A 4CEJB 2R4UA 4IGIA 3AH8A 4Z8XA 3WGJA 3U31A 3HVKA 2QTCA 2C9OA 5CFQA 4A82A 3NTRA 4LYAA 4E12A 1E1QA 1YB2A 2H1FA 1BWPA 4IDQA 4O4JB 4ZOEA 1C4OA 4LG1A 1KVRA 2VDUE 4I8XA 2QYOA 3KT0A 3QRWA 3EGDA 4I6EA 4QREA 5DIZA 3C6ZA 3L4KA 3DDCA 3MBOA 2BFDB 1P5ZB 4QFMA 4BMZA 4KSCA 3LBHA 4FLEA 5KREA 2XMQA 2QUIA 3JZFA 2REOA 5GZ6A 3TZKA 5BUSA 4O4LF 2I67A 1GQ2A 3FZGA 3SHWA 3TVDA 1LBEA 2GWHA 4XOIA 2GEDA 1M0WA 3MCTA 2Q1TA 3TRIA 2O23A 3U4HA 4C76A 2G83A 4RY2A 3CISA 5I51A 2MT9A 4GSKA 4QX6A 3L7YA 1SVLA 1SCKA 1DOHA 4JLAA 4DVGA 5ERYA 4GZMA 3LUCA 1IJFA 1C2YA 1CS0A 4OH1A 1SKMA 1UXJA 2HLDA 4K9MA 2Q5LA 1EK1A 2CWWA 1XL1A 4D9IA 2GCPA 2O8NA 2VP4A 4G4GA 1HYQA 4DAOA 2IYRA 4L2IB 4UVDA 2WD7B 3N07A 2A5GA 3QU7A 2VHEA 3ADKA 9LDTA 1P1BA 1XU7A 4D9GA 1RRPA 4Q9JA 1Q0PA 1NSYA 2QG9A 4TSFA 3UAWA 5TF0A 5DTIA 3VTAA 5AVZA 1WUJS 2AQ8A 1YUMA 821PA 1CIJA 3HO6A 1FNDA 4LOAA 5FOSA 2VBIA 4UMDA 3MPOA 3I4CA 3S2ZA 1V25A 1VYTA 4AZ0B 2GLUA 3W90A 4GH5A 1VZ2A 4MVJE 1OILA 5AD1A 2BBOA 3AESA 4TQ9A 1JSCA 4NBNA 4ZOLB 2BZSA 2BJWA 4BQEA 1I7DA 3IXQA 1H8HA 4UBLA 1PZMA 2HRBA 2Y0CA 4Q16A 4EI2A 4HLUA 2GSWA 2HO5A 4CM6A 4YRZA 3CZ5A 5CB4A 5K9ZA 2HR1A 4Q18A 3GLFA 2AN3A 2RGXA 1A4UA 1EZZA 2IEZA 3IUNA 3AFNA 3PNYA 4TTIA 4WCFA 5IDWA 1JQ5A 1ONSA 1V8ZA 1W29A 4YV0A 3EDQA 4B32A 1F3LA 3LX4A 1D8AA 2VYND 2JCGA 1IPEA 3CZPA 5LQDA 2FN3A 1T9HA 1RMTA 4IIFA 2GVDC 4RA6A 1KOLA 4ZEWA 4EHFA 5CYFA 5C52B 1JX6A 1PDVA 3PPVA 1RAAA 4G4JA 3Q43A 1YTLA 1GV1A 4IIDA 3HWX1 3AJEA 2AN4A 4Y6RA 4R6XA 1I2CA 4D4MA 5HNFA 1S3FA 3EVAA 1A2BA 1K8YB 1DHTA 3R0IA 1IDOA 2WUGA 1ZVVA 3ICPA 3DBVO 2R1VB 1IWPB 3L0IB 1PYOA 1ZM7A 4HNQA 4D7AA 1C0EA 1QHEA 4JI7B 3OCYA 5DH9A 3KTDA 2KS6A 3EXFB 2XCSB 3BAZA 4F4JA 2Q28A 1OBOA 2JRCA 2P3OA 4C14A 1V6CA 5KTPA 1AZLA 3ZCTA 3IPRA 3K3PA 1MRSA 1X7YB 3QWBA 4ZARA 4QVIA 3L9WA 4XCQA 1CG6A 3STVA 3ZGVA 1Q57A 5AW4A 4D99A 4EHKA 3JQBC 3E5MA 4F9EA 1FP2A 5JPDA 1QIDA 2REBA 2ZXFA 4NYIR 3STXA 2A3RA 3W1EA 2QRKA 3MWEA 4BX3A 5AVOA 1FMTA 4MDEA 2O0HA 3OSUA 1VHJA 2YIJA 3IAFA 1C7QA 4NFHA 1G8FA 2IP1A 1BMTA 4MUHA 4MW6A 1ZD9A 1AZTA 4RAQA 2GEFA 1DCFA 1ZJJA 3WIBA 1M74A 1Y5RA 3ENNA 3F8TA 2YMLA 4QEDA 3VR3A 1O4VA 2WU1A 3DHVA 4G01B 4CCYB 4WNYA 1FVXA 3EC1A 1UJ5A 1MOSA 4U7PB 3WGTA 1JALA 5ALJA 4BX9A 2V3CC 4MUAA 1S4MA 5DGHA 2QSZA 3K1ZA 3BB3A 3VXKA 4C7BA 1F8YA 2P2YA 4ITVA 1ZSYA 1YJXA 1T3SA 1GGFA 4OREX 3RVPA 3UAGA 4BFTA 1UANA 2YJNA 2IDZA 2QRPA 1Z63A 5B1DA 1RU3A 2L82A 2PPVA 4DC0A 2ZYHA 3BA1A 4NOLA 3ZLVA 4ZXPA 1HH4A 2DHQA 3QVTA 3MMNA 3L0YA 5BNIA 1Y6RA 1ELOA 2BI7A 3LOPA 5HCNA 4DTIA 3EYWA 1Y81A 1LTKA 1NXQA 3QKSA 1W36C 2V4MA 2DETA 1K97A 3I04M 3H2HA 4UEKA 1H1TA 3GJ7A 4OXYA 3IKTA 3PPIA 2JC3A 1BMDA 2V9PA 1AGXA 4UCFA 4D3DA 1P4AA 2I4LA 4HQKA 3NEAA 4P7FA 4MHOA 1SXJC 3E7DA 4TV9B 1S1CA 2BHNA 3P0RA 3VHLB 3RTAA 5ECGC 4HOYA 3WLHA 5HWSA 5AW9A 3ZQUA 4JLKA 1VGRA 4XDYA 5FOTA 1XLVA 4F8JA 4K1LA 3KT3A 3E22A 3AI3A 3MCUA 1AQJA 4CM9A 3BMNB 2OCGA 3MGBA 1K7FB 1ZJZA 4KKVA 4OHYA 4XVHA 2FPOA 5IJWA 1C14A 1QS0B 1JI3A 1AKVA 1VHLA 1U8XX 2V6IA 3JXEA 3QUCA 5FBRB 4BNUA 2OOSA 4ESHA 2FZ4A 4HEJA 4M53A 3L1HA 5JD6A 4EQZA 2PZFA 4WD3A 4AAYA 2RI6A 1M5UA 1TB4A 2EFDB 1BXRB 2QXUA 1JQJC 3SQWA 1V0JA 4AKIA 3D8BA 1ZM2A 2BIFA 1X7XB 3A3KA 4X1OA 4UFPA 3PNOA 4CCSA 2C7OA 5DNEA 4MKHA 4Q01A 5B64A 4J0FA 5ALZA 3QKWA 4DBVO 3FHCB 5BOVA 2NNWB 3BILA 4QXAA 4YNBA 3JASB 4GMXA 5LD2C 3H1FA 2FSVC 2GOYA 1N3LA 3HZHA 2Y66A 3TN7A 3U6BA 4ZTZB 5KYKA 1QPZA 3GT0A 3WR5A 1XFAA 2NXEA 1PZHA 3DE4X 1VJDA 1WD7A 1RHRA 3GX1A 1VBMA 4EI9A 4F3KA 3BA6A 2Y0EA 4D9FA 3I6YA 3IQFA 3MFQA 4MV4A 3MGGA 1Q0SA 1QIKA 5EZYF 2JLUA 4YAEA 4BNKA 1FA9A 1LLFA 4QTUB 2OCKA 1ZOOA 4I55B 1TMYA 2A59A 4OA5A 4LXXA 5G4LA 2QPLA 2C8VA 1N5RA 1UBTS 1Q1NA 1XMPA 4NJEB 3RSQA 3UFBA 2XUDA 3VZRA 3HK2A 1C41A 2AFVA 1BDJA 2IOHA 4ML3A 5A3QA 5EP4A 3ANLA 1P8JA 2IUTA 3H6KA 4DNFA 5ALEA 3GLIA 2Q7XA 3ZHTA 1XQXA 1Q1AA 3DWGA 3RUIA 4RWEA 2I87A 1BN6A 2GQ0A 1FLDA 4M1TA 1GDDA 1TM7E 3L4EA 3P97A 5FBLB 1RXVA 3O2JA 1SA0A 4TS9A 3TLXA 3H5VA 1OXKB 3PUYA 4YWHA 1CCWA 1Y4DE 1FBTA 3A3PA 3FCXA 4PGGA 5E1OA 1G7TA 4FFDA 4N49A 2QMHA 3E81A 4BMSA 4HNRA 1KI4A 1J8VA 4P35A 2Z4TA 4YV7A 2I7DA 3F0TA 3PLNA 5ES3A 3H0EA 3BORA 4P36A 3FWNA 4DMCA 2JFNA 2EBUA 1T9KA 1JKJA 1YDEA 4QBHA 4WACA 3MMPA 1W44A 3E5RA 3FDZB 1E99A 1Z6ZA 2X76A 2J0VA 2XA2A 1RBZA 5LOVB 2GTQA 3L7AA 1B6TA 3T5CA 4JBLA 2HT1A 2A30A 3ZIDA 2EC5A 2OO7A 4IV8A 2QE7D 2BM0A 4Q4AB 2NQ8A 5FUYA 2EKZA 1ZN7A 3EGVA 4MTCA 5H82A 3ABIA 3QSYA 1D03A 1O96A 1HEUA 3ENKA 1ZRHA 5J58A 1L4MA 3A1NA 3DO5A 1JJVA 2ZB4A 1PO7A 1R3DA 2ZATA 2CJWB 3QVWA 1EWQA 1U2GC 2PSDA 4U6QA 3SM3A 2Z6AA 2FEPA 2HYDA 1XQVA 3SIPA 1X1QA 2VQ6A 3OFKA 2R6AA 4PZZA 5FOUA 3T1QA 1U1CA 4HQRA 1PZXA 3I39X 3KUDA 4UNSA 1H19A 4L2LA 2DP4E 1E58A 1ID1A 2EVWX 4G2NA 4X3PA 3BJMA 4O02B 4MV3A 4EPVA 3IQXA 4C0KA 1D0VA 1ZY2A 3MGKA 3FROA 2VQEB 4WVLA 2RBGA 1R5JA 4LUCA 4HNUA 2XXJA 1LJLA 3EEIA 3HVIA 3R5TA 4AJ2A 3L4JA 4E6EA 3B6KA 3LNCA 3OT4A 2P2DA 1PJSA 2QRMA 2Q3CA 1GN9A 1P44A 2WWTA 4GOLD 4P9NA 4PLTA 4DT1A 2YRWA 3RHTA 1G59A 1RWPA 4EG8A 3AIIA 3CLSC 3PE4A 4G41A 4YJDA 1JPJA 2JGDA 4MRRA 4BV9A 4N41A 1H5NA 5DF1A 4BTEA 3HXTA 2HCFA 3GGGA 3EULA 1QAQA 3DCIA 4A8JB 4QOHA 3TSAA 3G02A 3T35A 3N58A 2W00A 2Q1XA 4OV6B 5D7NA 5HIIA 2C57A 2HEGA 2D7JA 1S7GA 4RZHA 1EUYA 5JJLA 3WTCA 3O03A 1UBHS 1M6EX 2H16A 4TRJA 1TL7C 1K7YA 2B9VA 4XDHA 4AX8A 3D8UA 4R6WA 1XU4A 5BT9A 3T12A 3B2QA 3TKAA 4UNRA 1RM5A 2YQ4A 4YX9A 1NW8A 2YWCA 5FL7D 3ANYB 3CGGA 3U4QA 5EJ5A 5GADl 1R4AA 3ICWA 4O4HB 3ZHBA 3RVBA 3HXKA 2VYNA 3W4KA 4XUDA 3NHYA 4YCCA 4G4IA 5BW4A 2B5VA 1YO6A 4ZODA 1OB5A 4CQLA 4XN9A 5AIAA 2OWDA 2MAPA 2L18A 4PS0A 3QI2A 1B6GA 1LVGA 2G08A 1AE1A 2O2EA 2ZSBA 3QFRA 5E1MA 5DSTA 2ZVQX 3P9YA 5HCIA 4M1WA 4QGGA 4IJWA 3RE1A 1CHNA 1DSSG 1LA2A 2DFLA 4LXGA 5ED0A 2CHEA 1VLLA 3AVQA 5CH5A 4Y9SA 2X0JA 5COAA 3B82A 4MVJF 4CGZA 2H1LA 4B81A 4DSZA 3CZAA 2R1UA 3CSSA 4J29A 2ODAA 3HI6A 4RLHA 3VR4D 3WDLA 5I6DA 5JY1A 3EGXB 1IXZA 1NNSA 3LECA 1P3DA 4PAWA 2OG1A 4TS3A 3SJCA 2DLNA 2O8DB 2OHVA 1OC2A 4H31A 2JKZA 4ZQTA 1A82A 1HRKA 1PS8A 4V38A 5EXTA 2WHYA 4LXHA 1H6AA 1WKVA 2BGRA 4XDZA 3I45A 1RPZA 3IHLA 1K6EA 2G1UA 4INPA 4ARZA 2UYYA 1L6IA 2WHQA 3P9QA 2A33A 1S2GA 4OFWA 2W98A 4L5IA 2O07A 2XJ9A 1M6VA 2FJ0A 2HIAA 5AM0A 1TUIA 5BOSB 5KWEA 3ANMA 2LP4Y 3IIJA 1I1OA 2DG2A 3B3GA 1V43A 3IP3A 4RH0A 3TQFA 4EVQA 4YV1A 1MHTA 3ZW9A 4G0OA 4B40A 4Q39A 5CX4A 3N59A 2B4KA 4AW9A 2AD5A 1KC1A 1M67A 1RXIA 2IHZA 2HCBA 5FJIA 1I4OA 2GBIA 3LGAA 3QY0A 1IIRA 1XFDA 4X44A 4G8BA 2BUAA 4QYTA 1GPUA 4IWNA 2QPOA 3WRXC 3C39A 3ZY4A 4ZW5A 2RI0A 1JP7A 1O5TA 1ZRMA 1CRZA 1KMMA 2I2XB 2XUJA 5TS2A 3SFZA 4W5QA 5TE9A 4WZAA 3FWPA 3P9RA 1J8MF 2WU8A 4PYMA 1IN8A 1OIXA 5DP1A 5FPQA 3PC8A 3AVVA 1BDMA 4HDAA 1RJFA 1XHEA 2COUA 3C85A 1BGVA 3FLAA 3A37A 3IPAA 2RC5A 4I4NA 4J1TA 1P7WA 4W1SA 3JAKA 4IS2A 4TZ0A 2CYCA 5K1ZA 6LDHA 4K03A 3TUIC 1GZ3A 5J1SB 1ZHOA 2PR7A 4XOUA 2OUKA 3DFZA 3IAS1 2HDNB 1LQUA 3TOXA 4BNFA 4CEIA 3HGTA 2PFKA 3R0QA 2CBZA 4EITA 3DF9A 1COWD 1P62B 5LKRA 4Q34A 4LZZA 5ALIA 5CFRA 1R5NA 4PNEA 4GWKA 1XQ6A 3RK1A 3WL3A 2P77A 2M1ZA 2QN1A 3CHRA 2FHPA 4COKA 4OP2A 4F96A 2E0IA 2JIRA 3AEYA 3PFCA 4FUQA 4BP9A 3A10A 5FADA 3ADBA 4PZDA 3H05A 1IJBA 1TO1E 4JLVA 5CTJA 3QYPA 5E9QA 2FLVA 1YGPA