1R0XA

Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
281
structure length
264
Chain Sequence
TGIIMENVTAFWEEGFGELLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 90
structure length 264
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r0xA00
4M1TA 4ZV4A 4Q1BA 3GLIE 3QXHA 1DELA 1PLJA 4B33A 4EJSB 1KO7A 3S1AA 1ESMA 1E2GA 2I3BA 3ZZ0A 4EAQA 3AKYA 4TLAA 3P26A 1OLOA 1E2NA 2C2HA 1ZM7A 2LKCA 2WOOA 2P67A 1H8EA 3I8XA 4FCTA 4RVCA 5E95A 5BYKA 4BLRA 3DPUA 2L0XA 1ZM2A 3FKSD 4RD3A 3PIRA 4MA4A 2D3WA 2C99A 2MMGA 1R0YA 2ZS9A 1R2QA 2ERYA 1K5GA 1TEVA 1W44A 1Z0FA 4PANA 5B57C 5HZKA 5IT5A 1SZPA 1UEIA 4RSGA 2GJSA 1RYFA 1MV5A 2R8RA 1IN7A 4TL7A 4OQMA 3TLXA 3LBNA 4RFSA 4GL2A 1U94A 2GTPA 2QAGA 1CJTC 1E2DA 4Q48A 1E2KA 4YMVA 4X8HA 3G82C 1QHNA 3MAAC 3D3QA 3AM1A 3UWOA 1NRJB 3GLGE 3GLFA 1KHTA 4GZLA 1E4VA 1YZQA 1K6MA 1P60A 3CLVA 2B21A 4PPFA 2DHRA 3ICQB 2YOGA 2XJ4A 4EFMA 4Q7LA 3T15A 1NVWQ 2O5VA 3CH4B 2OLKA 4NCHA 5LD2C 3ONWA 4IDHA 4DCTA 2WICA 3DHWC 3C14C 1X6VA 5TARA 5CITA 2QUZA 4N1AA 5SZIA 4HDCA 2ZI6A 3CPEA 4QBIA 1D8TA 3LFUA 4C0JA 1NMYA 3A4LA 3EAQA 4XVRA 4IFBA 1VCMA 1VHLA 2G1JA 1GSIA 3C15C 4AYWA 2Q3FA 1KK3A 5FTJA 2VSXA 2IYLD 4HUQA 1XTRA 1H65A 4C0BA 1OH8A 4LC0A 1NVXQ 2GETA 1ZCAA 4JVNA 1LF0A 2NQ2C 5CYPA 1Z83A 1P7CA 3VU9A 3IO3A 5FH9A 3W6NA 3QEJA 1SKQA 2QGNA 5DYIA 4IOMA 2HLDA 3K0SA 4LV8B 2V1UA 3ZD7A 2KI5A 4MKIA 2FNAA 4I99A 2ZITA 3AP1A 4JKIA 1HA3A 1JI0A 5DO9A 4A82A 4C0AC 3EPKA 2WJIA 1G3IA 1SVMA 1WRBA 2XB2A 3U4QA 4IRUB 2DFNA 2NOAA 2AKYA 3H84A 4LJ4A 4C0SA 1DTSA 1XXHA 4ERNA 4MGZR 1TQDA 1G9XA 1S1CA 3TSZA 5HR5A 3GFPA 4KODA 1VTKA 4JLPA 5H68A 3B7GA 1UEJA 1EFRA 3ZJYA 3WMFA 4FMCB 4DIDA 4DLUA 3RC8A 4D25A 1W5TA 2IBMA 4FMDB 3RS4A 1CRPA 2C8VA 4PC7A 1Z0DA 4YMUA 2IYTA 4G5SA 3KB1A 1P6XA 1KY3A 4PAQA 2ZETA 3ZVMA 3QI2A 2CVFA 1E94E 2D7CA 2AK3A 2ECKA 3VAAA 4M9QA 2JDID 5EXXA 3U2QA 4YLGA 3K0CC 4D4MA 4F4IA 1O3YA 3THXB 3FMIA 4DDUA 1ZD1A 1KNQA 1G8FA 3L43A 2KE5A 5DSZA 2GEDA 2E1RA 1LW7A 3L8YA 2IXGA 1M2OB 4HATA 4LBYA 3Q9LA 4RD4A 4Z1MA 4LCBA 4L9WA 1KI3A 3RDPA 3N2EA 3Q5EA 1CF4A 5FTMA 2G1KA 1G1MA 1ZU5A 3AP3A 3T34A 4V0KA 2VPPA 1TADA 1GNRA 3RNLA 4NE2A 1NN1A 1JB1A 3NBYC 4MGYR 2O8DA 2O8DB 4DLTA 5GJVC 2HT6A 1ZM4A 3VQTA 2HXYA 3CF0A 3QVVA 4D0LB 2IYWA 4HAWA 2ZQ5A 1MO5A 2VP5A 5K8IA 2ZRJA 3MSXA 2HCBA 4HZUA 2V8OA 3W5IA 4OHZA 3TH5A 1GDDA 4Q4AB 1GAJA 4Q4AA 4KFSA 4CEJB 5FTNA 2NGRA 4EPXA 3AVOA 4KFRA 3I62A 4IW3B 2GXQA 5KTYA 2QM8A 2HYIC 2Q9CA 4XSGA 4A8JC 2B8WA 3I1FA 4V0NA 3EPJA 2WPDD 1GVNB 1GTVA 2JJ1A 1WDTA 3B9QA 4FMBB 5TDHA 1XD9A 2GEVA 1AQUA 3LLUA 5FTKA 4E03A 2FG5A 3PCRB 1RKBA 1U99A 3H86A 1XPRA 1II8A 4D81A 2IF2A 5JWHA 4FXPA 3HYTA 3KKOA 4NYMR 2EU8A 2OE2A 2Q3HA 5F2EA 3VMFA 3RHFA 3BE4A 3I4LA 2UZ3A 3A1WA 3PFIA 3KJGA 2ZANA 4DSOA 2A3RA 4QGFA 3R9IA 2ZSAA 1OIXA 2OHFA 4NBSA 4C4PA 2IWRA 3F8TA 3TSWA 1AK2A 1ANKA 3X1ZA 1CP2A 4FMCF 4X8OA 4RKEA 4WXRA 3L0PA 1KI9A 3UANA 3K0FA 5SZHB 1OIWA 5KSYA 1Y3AA 2ZRPA 5E7JA 3B9PA 2QRNA 1G41A 1VG9B 1G6OA 2IYSA 2FSHA 2JASA 2W2VA 1Q12A 4P4SA 5JHHB 2IHYA 1Z3IX 3TW4A 4H9GA 3AVXA 1DEKA 1WE2A 2GAAA 3CWQA 4HZUB 5A5GA 3PR1A 4JLBA 3FTQA 1CJKC 1H8ED 5FOTA 2WWHA 4TLEA 3RANA 2XSZA 5CM9C 1XTIA 3BH0A 4OQFA 4C2UA 2AFHE 3GPLA 4ACAA 2WSSA 3FDIA 4ZPXA 3FKSA 4RD6A 2PLRA 4LYHA 2HJGA 3K53A 4HLUA 1FQJA 1R0ZA 3V4FA 1G7RA 3CNOA 3NVAA 4DLVA 2IS4A 2VP4A 1ZAKA 1UKVY 1ZCBA 121PA 4IOKA 4DEYA 1NL3A 4Q4LA 1XPOA 1OKKA 2WBLC 4Z8XA 3LAWA 4TSFD 4DDTA 1UKZA 1VECA 1CR0A 4U00A 3RS3A 3KQUA 2GCNA 5BN5A 1RRCA 3AH8A 2IEYA 4C2TA 2RGNC 1GL7A 2XNSA 1GILA 1S96A 3A37A 4KHZA 4OI4A 521PA 3BH7A 4URZR 1XXHB 2ZJAA 5B58C 3B1XA 3NH9A 3PUWA 4LV5B 3SNHA 1G291 3GJ3A 2DCUA 4B6EA 4M2LA 1GZSA 3UWKA 3IIKA 4I81A 4C0QC 1HYQA 4AI6A 1AKEA 5J4LA 4C3ZA 4LYFA 1FZQA 3ND9A 4TT3D 2GDJA 3A4MA 4YC7A 4D4LA 3EW9A 3ZIAA 2OO7A 2CNWD 4JLKA 2AR7A 2VSOA 1NVVR 2GVDC 4FD2A 1U81A 1W2HA 1E4YA 3AUXA 2RHDA 5DNYB 2H17A 1A82A 1G7TA 3AB3A 3CR8A 5J5CA 1H8HD 2EFCB 2XXAA 1QVRA 4LSGA 3I3SR 1FTSA 4LHZA 2W6JA 4Q1CA 2Z4RA 5FPSA 4PZZA 4NPHA 1GKYA 2QORA 4JIMA 4UNNA 4DSNA 2B7CA 1COWD 1QBKC 4XTCS 3KTAB 5C46F 4BLPA 1R7RA 4LV6A 2QAJA 3A1VA 1M1YE 4WW0A 3FHOA 2R9VA 2ZRDA 1TAGA 1NG1A 1RZ3A 4A0GA 1G6HA 5CB8A 3WNCA 3C8UA 1U0HC 1T3HA 3B5JA 2XITA 1DARA 3BD9A 3TGPA 1EFRD 1P2UA 2R6GA 3KJIA 2PEZA 1E0AA 1XJ0A 2RGDA 2ZR9A 1RVDA 1NG9A 4RZ3A 5E7MA 2GCPA 5AUNB 2J1LA 2QENA 3B1VA 5GJWC 4D0NA 4PC1A 1XJCA 1G3UA 2ORVA 2UVQA 2G9NA 3RAPR 5JZVA 4TLDA 2CBZA 4OK3A 2VF8A 2X8AA 3O8CA 4DSTA 1R5BA 1T5LA 1JXMA 1P2TA 5GVSA 3QF4A 5E7IA 2YINC 3VR6A 2YWFA 3SJAA 1XNJA 3WNBA 3AVPA 4Z51A 4TYQA 5JJKA 1CEEA 2HDNB 5FBVB 4YQFA 3KXKA 3L0IB 5LB4A 2P5SA 4D4JA 2QNRA 2QSYA 3OEED 3VTKA 2ATXA 1DG3A 1I4TD 4CT5A 1XF9A 1OHHA 1GP2A 4C0HA 1N6PA 1XZQA 1CJUC 3AF1A 1YHNA 2O8FB 4D6PA 1E9DA 2CHQA 2FU5C 2ZSFA 4B76A 5EP3A 1HQCA 4Z8YA 2NZ8A 3VFDA 2NPFA 3K09C 1NF3A 5IHPA 5K8LA 3MRSA 3EZ7A 1RRPA 1ZP6A 4KJZA 4RFSB 4B3GA 1ODFA 3MWYW 1B0UA 2Q21A 4TMWA 1J8MF 1D9ZA 1HY3A 3QVUA 5AJXA 1OV4A 2OXRA 3EIHA 2VLIA 4OJQA 4TWZA 4FW9A 4G5QA 4LK2A 3BRWD 1VDZA 1DE0A 2OLJA 1E9SA 1KGDA 4HB4A 3PEYA 4JL6A 2ZU0C 4JVMA 2ZRKA 2ZJZA 2N42A 4LYJA 2WPDA 3W6OA 4A0FA 2FSGA 3LBHA 3MWLA 2CL7X 2AXNA 5BQ5A 4DVGA 2P65A 5AJVB 2ZRLA 4ZIRA 5DI9A 2PCLA 1D9XA 4IVQA 3GEIA 4QNMA 3GCGA 3Q72A 2IEZA 3ZGXA 1ZIOA 1OB5A 5DGXA 4AKGA 4RCZA 4U5XA 5TVKA 1U90A 3NDPA 3T1OA 1E2FA 4EPYA 4N0DA 4M9SA 1IJEA 2G88A 2I4IA 4NYIQ 2EFHB 3GJ5A 1OIVA 3UATA 1FMLA 2B6HA 3HPQA 2OG2A 3THYB 2EWWA 1P61B 2GESA 3K0EA 2NO9A 4KCGA 2UKDA 2VP6A 3LXXA 1Z0KA 2QPAA 2O8CB 3U61B 1IY2A 3G5UA 2QI9C 1NI3A 5KSPA 2QE7D 3Q85A 2PEYA 2WKPA 4HLDA 2C5LA 4B3FX 3M4YA 4MRVA 3GFOA 3THXA 4IXNA 1G20E 3DMDA 2G83A 3M0EA 4B71A 1KK0A 5LBIA 3T5DA 2FA9A 1EX7A 5KOYA 5CIWA 2ANBA 4JLVA 1RE0A 2F1RA 2IT1A 1QRAA 1XBTA 3K9LA 1T4GA 3RRYA 2LCFA 3TR5A 4B44A 5CB6A 4MYHA 1XD8A 4ITRC 5DLQC 5J47A 1FUKA 2F3RA 2WWGA 5EXSA 2IUSA 4C0LA 2AKAB 1LY1A 1IQPA 4DKXA 3D8BA 1ZNZA 4ZCLA 3SC3A 3LY5A 1W36D 1FOEB 2J3EA 4QFMA 1UBCA 3IQXA 4PO9A 2ZS8A 3LRPA 5FPTA 1U0JA 2OM2A 2VQSA 1OKKD 5JS8A 1DBSA 1NLFA 1KO1A 4TSFA 4QBFA 2VTKA 1XZPA 5F9HA 1EFTA 1Z8FA 3VNUA 4LDJA 1TX4B 2RGBA 1NBME 3ZZTA 4D4KA 3T61A 1GIAA 1QDEA 1VHTA 4B35A 1NLYA 4CGZA 5DN6A 3ZVNA 5GVRA 5L3SB 2KJQA 1NY6A 4QM7A 3GLHE 1E3MA 4Y0AA 1F2UA 5JWOA 3SN6A 2HF9A 4Q1EA 5H8WA 3ICEA 3MWKA 1HV8A 5D3QA 5JWRA 4M53A 2OESA 2FE4A 3B82A 3KKMA 3NBZC 4XSHA 2OBLA 2QAGB 2RH5A 3PUXA 3VKGA 1VYVA 1OFTA 4B3XA 2ZJ8A 1N6KA 4JSTA 2YC4C 1M8PA 3TSOA 3MJHA 1ETUA 2QEQA 4W5WA 2O0KA 2H57A 1Q1BA 1N0WA 3GLIB 3AP2A 1QG2A 5LB2A 1CKEA 1W0KD 1P9RA 1JEEA 2FZ4A 2NO0A 2Q6TA 2VHUA 1VPLA 5ANRB 1XFAA 4PFSA 2ZAMA 1IY1A 1OXTA 2CNWA 3WRXC 4PQYA 1MOZA 2GEUA 2JLQA 4DLXA 3DZDA 1Q0UA 3DZ8A 4Q4HB 1QHHB 1TUIA 3NIBA 4B75A 4B73A 1RJ9A 3HU1A 4OI0A 1SVKA 4BFTA 3LV8A 1Q44A 2KSQA 3AVWA 4NCIA 4ZDJA 2W6JD 3W8RA 3KXIA 5EP2A 1NBMA 2FMXA 1LF5A 2ZRHA 1N6IA 1E2EA 3JZMA 1S3SA 1ZVQA 2W0SA 3CR7A 4LJ6A 2KBFA 5TV2A 2ZRMA 4TL6A 2Q0HA 3SS8A 1N5KA 2QT1A 1AS2A 2QG6A 5DH9A 4HLQB 4NMMA 4HB0A 4KSBA 4TYWA 2XNDD 2RMKA 1OPXA 3LQRA 3WY9A 4URYR 5FBQB 4Q21A 3V9PA 2VL7A 2WIBA 1CBUA 1UM8A 3CH5A 1U9IA 4BEJA 2XOKA 2QPOA 2ZYTX 4LYAA 4GOJA 4PR0A 2OT3B 2WHXA 5E3HA 4DCUA 5C4MA 2KWIA 3AVUA 1E79D 2FPLA 3PVSA 3LDAA 4KLNA 5AWFC 4JS0A 3NTUA 3SR0A 3KXLA 2IS2A 4A2QA 3O47A 3DKPA 4F93B 2IUTA 4Q03A 3AGPA 4BQSA 5CM8B 3NH6A 1JJ7A 2QP4A 1BYIA 4CF7A 1E96A 4URXR 1AGPA 2A5GA 1IOZA 1Z0IA 4M21A 1W7AA 4XIGS 2HCJB 1UF9A 3QKRB 4EQ6A 4ZIRB 3I5XA 3OEEA 3VKWA 1N6HA 2J9RA 2A5JA 2VP9A 2ZI5A 1RIFA 3MG9A 3QPUA 1S3GA 2QL6A 1ZD8A 4WBSA 4EPWA 5FUVA 4CIDA 4LWZA 1G4AE 4EPRA 1KAOA 1NJGA 1JAIA 4W7SA 4OQLA 1KNXA 1CULC 1DG1G 4QOSA 4FN5A 4A8JB 2F43B 2VSFA 4MKFA 2QQ0A 2ATVA 3FFBA 1DAHA 1KJZA 4ZKDA 2KB0A 2Z83A 3QXXA 4JLDA 4PAOA 5BWMA 1NIJA 1G5PA 2VO1A 5IRCD 5GADl 3HPRA 3LNCA 1YR9A 1F6BA 4HDQB 3BERA 2VBCA 4LHWA 4OK5A 4DLWA 4UNPA 1L7VC 4R2IA 3DDCA 1FMJA 2YWHA 4I1VA 2V9PA 2WM9B 4Q7KA 3J81k 3KUDA 5FBWB 1MT0A 5FFMA 4IEEA 2NG1A 1BKDR 3BWDD 3QPVA 4HAVA 3RVBA 1XTKA 3CM0A 2C96A 5KNDA 1XEXB 1OB2A 2OAP1 2P2LA 1KI8A 2CL6X 1JR3E 3WRYC 3I5YA 1DAEA 4CYMA 4TTQA 3L0OA 1GOTA 3TIFA 4GRAA 1Z29A 1LS1A 4B2IA 1PUIA 2QMHA 3BFVA 2PL3A 1AM4D 2RAPA 3VR1A 1A1VA 1ZUHA 2WJYA 1SVIA 5C4GB 2Z43A 2C9OA 2EFEB 1RFLA 5J4HA 2XXAB 5EP4A 1G3QA 4M4SA 4DCVA 4Q7MB 3AF4A 4MKGA 3SI7A 3V4RA 1XU4A 4UNRA 4PTLA 1KAGA 4FIDA 4Q18A 3EZ9A 4US0R 4DDVA 3KQLA 4RJLA 2HUPA 4UNQA 3Q7PA 3N70A 2JIZA 2H1LA 2EYQA 3PUZA 1IN6A 1P3JA 2IYYA 4NP6A 4U02A 2NMVA 3SOPA 1A2BA 3KDSE 3QXCA 5DYGA 3ZVRA 4Q9IA 1ZINA 1SKYE 4YMTA 2EYUA 2JGNA 4RY2A 1SVWA 4QG7A 2PJZA 3EC1A 4YXWA 1ZUIA 2QMOA 4ARZA 4JLNA 2BCJQ 3R9WA 3C41J 1KDTA 4M1OA 4KSCA 1XEFA 2RCNA 3MJRA 3FKQA 5JJLA 3IHWA 4PX9A 4X8LA 2IK8A 2KBEA 2Q3MA 2R62A 1MO4A 2WJVA 4FMDF 1LV7A 3EIEA 4NYJR 4GZMA 1XDBA 1Q1EA 5HCNA 1N6LA 4BRUA 1S8FA 1EFCA 5DN6D 3THYA 3OFNA 4EFLA 2FSIA 3BB3A 3REGA 4Q4JB 4MRPA 1NY5A 3FYHA 1AZSC 2XTNA 3QSYA 2IX3A 1ZU4A 1UADA 3MGCA 3IBYA 2X77A 4B6FA 5AUQA 1J8YF 1OH5A 1ZRHA 3JZAA 4IOLA 1IHUA 2QTVB 2QM7A 2R44A 4FI3C 5D3MB 3IKJA 1G16A 4WZ6A 3U3OA 3A4NA 4BRWA 3ADCA 1OF1A 2BDTA 2JATA 2OFWA 4PZLA 1M6NA 1FUUA 1ZM9A 3Q7QA 3TKLA 4AKEA 2AWNA 3BJIC 1BYUA 3THWA 4LZZA 1R8SA 1VCIA 5DHFA 3ZS9A 4XD7A 2AL7A 2REOA 2VHQA 4JYCA 3IGFA 3GLFE 1TMKA 4MQBA 2PX0A 1IBRA 1XTJA 1BH2A 1CJVC 3NBFA 4RD2A 5JCPA 2IYQA 3PEWA 1WBBA 2R6AA 3ZZUA 3C4JA 3SBEA 4CZ2A 5JMTA 2QTHA 1KSHA 1TF5A 1D5CA 4GMDA 5CLLA 3SYKA 3TK1A 3WYFA 2J0UB 2NO6A 4ILEA 4Q00A 3W90A 2FX3A 2G0NA 3AUYA 1BO6A 4RD1A 1XCGB 1JAHA 4EKDA 5J4KA 4BZXA 4QGGA 1JPJA 1NVUQ 3GEHA 3SYNA 2ZI9A 3DM9B 3NBXX 4DRZA 1DADA 4GMXA 5AJYA 4DUGA 4A6PA 1IXSB 1IONA 3UXMA 3FMPB 3K0CA 2J7PA 1GWNA 1D2EA 1XB2A 2FF7A 3KKNA 4WXPA 3RS5A 1XTQA 3T1VA 4QBHA 2J87A 1E2HA 1R10A 2RGCA 1N3BA 3ZVLA 1ZYUA 1J7KA 4V03A 5IK2D 4KBFA 3TW8B 3C7KA 1SGWA 3PENA 4HI0E 1HT1E 1WMSA 3VR5A 3MMPA 3I8SA 1T8UA 2XOKD 2A78A 3QPWA 3U3RA 1ZUNB 4PC2A 2GILA 2JLUA 2YNMA 3BAFA 3HWSA 4EJSC 1KDRA 1YR6A 3SDZA 3SQWA 4IXMA 2ZYVX 1E79A 4E5UA 3TRFA 3GLIA 2CJWB 1ONBA 2AXPA 1C1YA 1G18A 4M1MA 4B2LA 4DHEA 2CHVA 2E9SA 5EUQB 3FE2A 5JSZB 4Q1DA 2R2AA 4V0OA 4IDOA 4Z54A 3U44A 2IS1A 1II0A 4UJ5A 3SQXA 2YYZA 3GD7A 4R98A 4TL9A 1VG0B 2BKUA 4P4TA 421PA 3GJ6A 3KZ1E 4P4UA 4GT1A 1GRQA 1TEXA 5L3SA 1TTTA 2IUUA 1E2JA 1Y63A 2XX3A 1ZBDA 1BMFD 4ZDIA 2WJJA 4LJ9A 1SXJA 4JSYA 3FMOB 3HJNA 1P2VA 5TXGA 1CTQA 4TYPA 2VIIA 4V0MA 1FX0B 4IDQA 1FX0A 3BIFA 2CCJA 1SVLA 2ASEA 2IYRA 3JVVA 5FOXA 1VYUA 2A30A 2ZYUX 3RS2A 3SFZA 4BLTA 1UDXA 1W0JA 2JLXA 3TBKA 1YZLA 4URUR 3UK6A 3BORA 2WWFA 5KUTA 2J59A 3B85A 1M7HA 1RPZA 2JAQA 3EX7C 3D6TB 4MRSA 2GRJA 3L8ZA 4TQ9A 1AA9A 2ZVPX 3HR7A 4XWAA 2FJUA 3P27A 5KPDA 3U7EB 2AK2A 2ZE5A 2H16A 2JJ2D 3QE0A 3CNNA 4MUBA 1NN3A 1E1QA 3QKTA 1SHKA 1VCOA 2JCSA 3TMKA 3WYAA 2P3SA 1Q20A 4RZUA 3PUYA 2PZGA 2C95A 3E70C 1XMVA 2ZRNA 4LJ5A 2C98A 4JBXA 3TQCA 1E32A 3EA0A 1NIPA 2GZAA 4ZCMA 4EFNA 4QM6A 1XD2B 1TNDA 2OBNA 4L15A 2BEKA 2CLSA 1GRNA 3H1TA 4J0QA 5CK4A 4DZZA 3I32A 1P9NA 2HLDD 3THOA 1GNPA 2VP2A 1GL9B 1KK1A 4LJ8A 4OQNA 1IN5A 1Z6GA 1TU3A 3T12A 1T8TA 1N0UA 4JT2A 5ELXA 5KSZA 2IXEA 3VR4A 4DEXA 4K8OA 1EWRA 1KZ7B 1E1RD 1V43A 3QG5A 1ZW6A 1DAIA 5K8UA 2GXSA 3QKSB 3ETLA 2C77A 1US8B 3RLFA 1EX6A 2JIZD 4EUNA 4C9BA 2XAUA 5E4FA 2BIFA 2WTUA 1SXJE 2ZUDA 2D4HA 2GHIA 3UIEA 4AG5A 1NLZA 2W2XA 3KJHA 5J4VA 3R20A 5CYOA 4D0GA 2W6IA 1NKTA 3M6AA 4YXWD 4QBGB 4DXAA 5HZHA 4MYTA 1J70A 2RGXA 2JLWA 1CXZA 2WMOB 4TMZA 1QHIA 1KSFX 3EARA 4KYUA 5CDFA 1LS6A 2WJGA 3KFXA 5HE9A 4D2IA 4HB3A 5FR1A 3RRNA 1A7JA 2WWWA 3IILA 1T3SA 2H18A 2DR3A 1I2DA 3NHAA 5K8TA 3A1TA 2OEPA 3H2YA 4Z1MD 3P1JA 4G5GA 3DOEA 4HDOB 1E9CA 3PEVA 3SBDA 1EESA 4QL3A 1FQKA 2F9MA 3AF2A 4HYYA 3RRZA 1D2NA 1I4LD 1M34E 1E9FA 4M22A 2ZRGA 1HTWA 4ZI3A 3QY0A 4TZ6A 4Q66C 2CJWA 3REFA 3EPLA 4QNRA 2XTZA 1DAKA 3AGQA 4R71A 2F1HA 4NL4H 3W6PA 2PZEA 5A0FA 1KI1A 3KB2A 3QG1A 4GI7A 2FEOA 5L3VA 3L0SA 1X8LA 2OCPA 4G01B 2BHRA 2WIAA 5B2ZA 1JPNA 4UJ3A 1OSNA 4Q47A 3KQNA 1XCMA 1A4RA 3C5CA 4AY2A 3UG7A 2R6FA 2OAQ1 4NZYA 1E2MA 4PQFA 2FDCA 1MO3A 3D7MA 2YJTD 4XD7D 1U8YA 4PPQA 2HF8A 2QA5A 1F5NA 1M7BA 4NCJA 1W47A 4OYHA 4A1FA 3DEFA 2JJ1D 4DIEA 1QZXA 4LJAA 5EE0A 4DLRA 1GM5A 5FBRB 4NHOA 4B3CA 4BE7B 3K8YA 1KJYA 1Z0AA 1ZC3A 1T5IA 1UPTA 2BOVA 4LPSA 4B3BA 2F7SA 2BCGY 1IAQA 1EFHA 4C7OA 2IYVA 2RKOA 1FL9A 3QF4B 4CDGA 4I1UA 1SXJB 5HKKA 3BGWA 4DWJA 2FPMA 3LW7A 1HEIA 1S9DA 2JLYA 4ZDWA 4GOKA 3TVTA 2PCJA 3KTAA 2QMUA 3I92A 2MSEB 1T91A 2XGJA 3KL4A 1OXVA 1HH4A 2C9CA 4GBMA 2OZEA 4OKSA 4DT1B 5KHOC 3NEJA 1DPFA 3GJXC 3OHMA 4W9MC 2QPTA 2GZDA 5JI2E 2F43A 2ZE8A 4ASUA 3FOZA 5DIFA 3ADDA 1NNEA 5EZ6B 1VYTA 1IJFA 3HU2A 1U8AA 2A5YB 1KZGB 5EXTA 3LQQA 2VF7A 4P0TA 2PT5A 1XMIA 2JLSA 4NH0A 3SJBA 3MD0A 2WWYA 2H5EA 1EG7A 1Z07A 1C9KA 3EASA 5JHGB 1WF3A 3THWB 2YV5A 3BS4A 4Q4HA 4LGMA 1TL7C 3WMGA 621PA 3AVTA 2ZREA 4R9UC 3U7GA 2HYDA 4DB2A 2C03A 1R5NA 4UXIA 1UFQA 3AKDA 3FMFA 1PVOA 5EZ5A 3QXJA 1NP6A 1II8B 4KAXA 3FPAA 3HU3A 4LBWA 5KDDA 4KITB 1Z28A 2ZVQX 1KI4A 2IS6A 2FGJA 1ZD9A 1FFHA 4LHYA 1W49A 1W4BA 5JRZA 2J46A 3HP1A 2FFHA 4E22A 3RYTC 2GAOA 2XJ9A 2GCOA 2MSCB 5AR1A 4MDFA 5TMPA 2F9LA 1Z5ZA 1JBKA 1JXOA 2ORWA 2XZLA 4TZ0A 2DY1A 1Q57A 2O8EB 3CIOA 1E69A 2ZRIA 3OIYA 2QSZA 1CJMA 2NO7A 3BFXA 3KKQA 4LJYA 4BLSA 2EW1A 1J2JA 3CKLA 5BXQC 3ZLJA 4AURA 1M74A 3S1AB 2BM0A 5FPYA 3RS0A 1IY0A 3RWMB 1YR8A 3HDTA 4POAA 1JQLB 5EE9A 3ZD6A 2IL1A 2X19A 3LVQE 2JJ2A 3EZFA 4AYTA 4OHVA 3WXMA 3DVLA 3SJCA 3VX4A 1QHXA 2I1QA 2H92A 4M1YA 4FWTA 4WIAA 1QHSA 1QHGA 4DDWA 1KIMA 1HURA 5FBLB 4CEIA 4IHQA 1OH7A 2FEMA 4RD0A 2O8BB 5F9FA 2CCKA 2R6CA 2JLZA 3CZPA 3BXZA 4AC9A 3EC2A 4JZKA 3UKDA 1Z0JA 2F1JA 5FUXA 3R7WB 3UPUA 1W5SA 4I1SA 1YR7A 4Q9LA 3IHLA 5C2JB 2QBYA 4LBVA 4MITA 3TE6A 4BECA 4KXFB 1Q1QA 1DAFA 4LBZA 4X8MA 2GWHA 2XTMA 3LW8A 2TMKA 5LPNA 1BOFA 3U7HB 1COWA 1GG2A 5JS7A 2GKSA 1P2SA 2QQEA 4XWKA 4N0EA 3F0TA 1E1RA 3N2IA 3IIMA 3WHLA 4KU4A 3X1WA 4OHXA 2O8CA 4R7ZA 4NTZA 1VIYA 1RW4A 4QJ3A 4GPTA 2NTYC 1OFHA 2GVZC 2WMNB 1G7CA 3U6KA 3QJYA 3ZH9B 2V1XA 2OCBA 4ON9A 3CRVA 5BYJA 3K0AA 4LRWA 4RZ2A 2VEDA 3GEEA 1AN0A 2N46A 5JECA 2W6ID 1YE8A 3K1JA 2ZRFA 1NMZA 2DYKA 3BOSA 1YZNA 1KI6A 3EZ2A 1ZMXA 2NIPA 1CRQA 4JJKA 4EPVA 4BASA 5JBQA 1K8RA 2ZIAA 1Z6YA 4QC2A 1RRGA 4DCNA 2QU8A 2PJRA 3CO5A 4I1OA 2ODWA 1FP7A 4A2WA 1G7SA 3ND8A 5GJCA 5C1BA 3QOFA 4O3MA 3KKPA 4WVFA 5JFGA 1B23P 4RFVA 4A2PA 3OIUA 3WBJA 3CWZA 1GNQA 3AEZA 4A4DA 2RHMA 4PC3A 4Q5IA 3CBQA 1VMAA 4QKQA 2YKGA 1ELOA 3EG5A 3NEYA 2OUKA 3OEHD 4R2HA 2X2FA 2G77B 2NO1A 4EDHA 3E1SA 3QUSA 4P32A 4ABYA 2O8FA 4NDZA 4TMKA 1W1WA 1E2QA 3OAAA 4B74A 1KSJA 4B34A 1S0UA 1T9HA 1L4YA 4IFEA 3VX3A 2RGAA 1VCNA 4DLYA 2AHOA 2QBYB 2FSFA 3SHWA 1NJFA 3MCAA 2WJHA 2AD5A 3CZQA 2BVNA 3NKVA 2BC9A 4PQRA 2JLRA 2ZSBA 3K9GA 3AKCA 1OW3B 3UMSA 5EJEA 4A15A 3JVUA 5DISB 4C30A 3DKVA 1PUJA 3LX8A 1AS3A 1D6JA 1GFIA 1TQ6A 2IYUA 3DOFA 4G3XA 1YZKA 2A7QA 4DT1A 4D26A 2ZROA 3PQCA 3IDQA 1AKYA 4JKYA 1XWIA 2GJKA 2WAYA 3K70C 2BMEA 1SXJC 4URVR 4Q19A 3UG6A 1N6RA 1JQJC 1W4CA 1ZIPA 2PZFA 1Z2CA 1XD2A 1P5ZB 4M8NE 5BW8A 1KDOA 4B43A 1NMXA 3UMRA 2QP3A 3B8HA 3IIJA 4LJ7A 2A9KA 4ESVA 4F4JA 2ANCA 3WP0A 5FR2A 4PO8A 5G53C 5G41A 1LNZA 4YONB 2PH1A 1CR4A 4I4LA 4Q1AA 5GJBA 2PBRA 3ZQ6A 4QGAA 1RYHA 4MYUA 2ODNA 5B64A 1XMJA 2ZS7A 2D7DA 1DAMA 1TU4A 2SHKA 4GSYA 1MR3F 2O0HA 1S4QA 3QBTA 4Q9HA 3CF6R 4JLJA 221PA 2OV2A 4MRRA 3ADBA 3P4YA 5KU1A 1U0LA 2V7QA 3QENA 1PV4A 4BPBA 2CXXA 4LPKA 2FFBA 2OXCA 2G0TA 2P6RA 1FTNA 4YDSA 3LA6A 2FGKA 4LY6A 1GUAA 4LX0A 5SZKB 3G0HA 4L16A 4UXHA 4A36A 4NONA 4PC6A 4PPGA 2QP9X 4PSAA 5IDVA 4ZO4A 1SQ5A 2NPIA 3GQBA 4L5BA 5EQTA 3R7WA 1WP9A 3WMEA 2H7VA 1KKLA 3NXSA 4P33A 1E98A 4ZI2A 4Q9JA 3LH5A 3LO5A 3FB4A 4HAZA 2FOLA 1S1MA 4QRHA 2ZUCA 2BWJA 3PITA 1EGAA 3V00A 1E0JA 1UDWA 4OJKA 4KO8A 3KX2A 3F3YA 4BFSA 4BFYA 3KUCA 2UZIR 2IC5A 2R6DA 4PHFA 2BJVA 4KYIB 4LHVA 1KO8A 2HV8A 2ZAOA 2ZJ5A 4OI1A 3SE0A 1J99A 2J0QA 2VA8A 4GDFA 4TTPA 3GLGA 2JLVA 2ZE6A 1W4RA 3HR8A 2C9YA 3F5FA 3NC1C 2XZPA 3U3MA 2ZRCA 4UQOA 2GK6A 3ECCA 1II9A 2ZSEA 1ZM3A 2I1VB 1YKSA 2QZ4A 1U8ZA 4HB2A 5FUWA 2P6UA 3BK7A 1HT2E 3TQFA 2PMDA 2BJWA 4XJXA 2DB3A 3RSOA 2IXFA 2XSZD 5DI3A 4JYBA 3QBVA 2HT1A 1O87A 1G17A 1GKIA 2EVWX 1W0KA 2WSSD 3X1DA 1G5RA 1JR3A 5CLQA 1OYYA 4E07A 1IXRC 3ASYA 1DAGA 1E9RA 5G3ZA 5UKDA 4B3DA 2LKDA 1X3SA 1GRRA 1P9WA 4WAUA 5HPYB 1AIPA 3BBPA 3TR0A 5EP1A 2A5DA 1QF9A 1T6NA 2ORIA 4OK6A 1OH6A 2WSMA 1PLKA 1WXQA 4V0LA 4PHHA 1SULA 5CIQA 1S9HA 2WV9A 1Z08A 2YWEA 3PUVA 4A6XA 3CPJB 1P62B 5CDFE 2PLFA 2ERXA 2IHBA 1NBMD 2BM1A 5JCZA 3B1ZA 5FI0B 2Q9BA 5JEDA 4DC9A 4O25A 3RS7A 4QHSA 6Q21A 4KI0A 1KI2A 5EE5B 2J0VA 4BGDA 4FCWA 4DCSA 1OXXK 3BC1A 3A1UA 3TAHA 3CB4A 2BBSA 3QEOA 1E2LA 2D06A 3ADKA 4DBLC 1X1RA 1TF7A 3QKSA 4OQXA 4TT3A 1Q1ZA 3TUJC 5FTLA 2BEJA 2X2EA 1X1SA 3K09A 4AG6A 3GMTA 3SYLA 5FPKA 3ZIAD 1KMHB 4PPNA 1E2PA 4Q02A 1VKJA 1KO4A 1SHZA 3VKHA 1P72A 1YZGA 3K9NA 4K81B 2V3CC 4HUTA 1RC8A 4KVAA 4TQUS 3E2IA 5JI3E 1ZNYA 5DI3B 2ZJOA 1I4DD 2EFGA 1UKYA 1N2CE 4KV9A 4MKHA 5EUMA 4AYXA 1H8HA 3AKEA 4ZCIA 2C78A 4CEIB 5AUPB 2DFKB 4PHGA 3DL0A 3OIVA 2Z6VA 2GF0A 4O2LA 2ZXUA 3W3ZB 2GZHA 4YMWA 2ZI4A 3GJ4A 3OEHA 2GXUA 4BFZA 2Z5FA 4CEJA 1G4UR 4NCKA 3P20A 721PA 4OBEA 3GLGB 1BIFA 4PAMA 1NN5A 3OAAD 1P4SA 4O0MA 5EXPA 4BFVA 4EJSA 1Q21A 2XZOA 1CR1A 2DFTA 2DWOA 1TQ4A 4KFUA 4BEBA 2BV3A 4V02A 2QRZA 3B1WA 4NCNA 1Z22A 3VNVA 2W58A 2OCAA 4ZDKA 1EFUA 3GJ7A 4JBWA 5FL7A 2OFOA 3U6BA 4M1WA 1C4OA 1E9AA 4XVQA 3A58B 2WVJA 2ZEJA 1QHYA 1N25A 4XOIA 4BFWA 2V54A 4CVNA 5L3QA 4P31A 3Q5DA 4UNSA 3CX7A 4US1R 3Q3JB 1W48A 1AGRA 3A36A 3LBIA 5BN4A 1U98A 4BFUA 2PX3A 3BFKA 1KI7A 2GNOA 3RWOA 3B13B 2OFXA 1Z47A 2ZJYA 4BZPA 3IPXA 3GP8A 3MLEA 4DLSA 3SFVA 4EPTA 2W00A 1KDPA 1OHHD 1A2KC 2VP0A 1E9EA 2ZU6A 3TAUA 5B30A 3GLHA 3AF0A 2ZRBA 4GFDA 1T3LA 4LHXA 1SVSA 4MRNA 4A0RA 5EE1A 4A0HA 4EIWA 1AJEA 4M1SA 3QXSA 1WCV1 3EIQA 2GCOB 1E99A 2DWPA 3K0AB 2QAGC 3M1IA 2V7QD 2IW3A 1W46A 1XJQA 2A5FA 3CRW1 1M7GA 1S2MA 4RZXA 4KLZA 2JEOA 4W5HA 2N1BA 1GL6A 2IF0A 4TMXA 4CW7A 4F91B 1E2IA 3T06B 3U7FB 3FGNA 2FH5B 1OYWA 2HXSA 4JLOA 4TMVA 1T0HB 3B1YA 3QIAA 2FZLA 2X1VA 4PHTA 4U7DA 1X8JA 5L3RA 3OIWA 1YZTA 1ESNA 2CEAA 4QJ4A 3BB4A 4MDEA 2J0UA 2CDNA 4A9AA 3CNLA 1D2MA 2P6NA 1VIAA 3EA5A 3ASZA 1CLUA 4BLOA 1Z6AA 3B6EA 2JJ8A 2XB4A 3ZQJA 1AZTA 2CL0X 4A92A 2REXB 5F98A 2QGZA 1V5WA 1RRFA 3UMFA 2WKQA 4Y0VA 4JMPA 4TN1A 1J90A 2O8BA 1G19A 3K9HA 2ODBA 1LFDB 1KJWA 5JLJA 3WYGA 2G6BA 4DLZA 1HE8B 1HUQA 1LB1B 1YRBA 2C04A 3CRMA 3WHKA 2GBLA 2B8TA 4OI2A 8OHMA 4CEHB 4DB4A 2V6JA 2A2ZA 1FW6A 5KSOA 1P73A 2CK3D 4BZQA 1EXMA 3KQHA 1N5IA 2P0EA 3W5JA 3IEUA 3SEAA 4LC1A 1JNYA 3CX6A 1KOFA 5TY0A 1CR2A 1XTSA 3GFTA 2QE7A 1UBGA 4JVSB 4Q1FA 1F2TA 3B78A 3QNUA 1E0KA 5KNBA 3CPHA 3T5GA 2MSDB 3EZ6A 4OHYA 4TL8A 4M9ZA 2PMKA 2LWIA 2Z4SA 2DBYA 5D3MA 5FOSA 4B32A 5AUOB 5LD2B 4JL5A 4D80A 4II7A 4GOXA 2V55B 4IDPA 5HE8A 3LLMA 2AFIE 3H4MA 2ODEA 2VH5R 1JR3D 5FOUA 1K5DA 3C5HA 2REBA 1TQ2A 4PXAA 1XPUA 1G64A 4NYMQ 5FI1B 3KFVA 2RGGA 2ZTSA 4IDNA 3PJRA 2CCGA 1BS1A 1Z6TA 1OXSC 2GK7A 1XX6A 1JALA 2P5TB 1MH1A 1KMHA 5EE3A 5J4YA 1UAAA 1N5JA 2VYFA 2J5XA 4ARZB 3LX5A 4NU0A 4RKFA 4A8JA 2ZJBA 3E5HA 3IUYA 3K70B 4S2EA 1DO0A 2D62A 3CUEF 4O2RA 4W5JA 5FOWA 3BH6A 3OF5A 3MUFA 1KO5A 2J41A 2V4ZA 2WOJA 3A1SA 1JEDA 3LD9A 2ZUBA 2WWXA 3OE7A 4DUGD 2ZE7A 1NSTA 2O0JA 5CK5A 4B2PA 2D2FA 1Z2AA 2BMJA 4V0ME 4JBYA 1UJ2A 2J7PD 4QHTA 3W9YA 5L8VA 2J7KA 3PEUA 5FOVA 1XP8A 4NYJQ 1XEWY 4TLCA 3CX8A 4KBGA 4BFXA 3FWYA 5IK2A 3CW2A 4KFTA 4HEJA 3U5ZB 2O52A 4H1UA 1W4AA 4Q9KA 2EFDB 3I61A 3U3JA 4G5OA 3TNFA 1F2TB 1PLLA 3O8DA 1F3OA 1G8YA 1VG8A 4F7WA 4BUJA 2ONKA 4DJTA 2RGNA 3ZDQA 2Q9AA 5AJWA 4YMSA 3AVQA 1QVAA 3EWAA 3WBKA 4D82A 2QTFA 4GNKA 4B48A 1W36B 5JSZA 5L3QB 3U44B 1MO6A 1YJ5A 4NYIR 2AD1A 1PJRA 5F3WB 4FWIB 1G5TA 1U2RA 1WQ1R 3PV0A 3SZRA 4BLQA 821PA 3L82B 5AJZA 2E87A 3T1TA 1YU9A 2WWIA 3VHXA 1KTVA 1ZC4A 2J0SA 3AQ4A 4XVUA 3B2EA 3AVVA 1KI6B 4MGKR 5JRJA 1WA5A 5DE3A 2GJAA 2F55A 2IA5A 1KYIA 4URWR 1BMFA 3U3KA 4HZIA 1G8HA 1IN4A 1SXJD 4M0LA 2AN9A 2ONJA 4P4SB 3LVRE 2QY9A 1MABA 5KO2A 5DHAA 2RB4A 1CIPA 3EXAA 1XXHE 1FPMA 2XNDA 2YC2C 3NC0C 1G3MA 2G3YA 4F38A 5LDDC 3W8NA 2ZM5A 4H1VA 1W0JD 5KPJA 1KSGA 3R8CA 4M9XA 5FL7D 3KQKA 3DM5A 3TJZA 3L2OB 3TVDA 2R65A 2O8EA 1KKMA 1NSFA 1N0VC 2WZQA 1Z63A 1R8QA 4XWOA 1MRSA 1XEWX 2CLDX 5M04A 2AWOA 2DFLA 1NVVQ 3KJEA 3FVQA 5FPHA 1DOAA 3TUIC 1XRJA 4GP7A 3R9XA 2YOFA 3RABA 2H8KA 4WZAE 3K70D 2FPKA 4MH0R 2GJ9A 3VR2A 1EWQA 1E1QD 4BWYA 1TF2A 4B47A 1OT3A 3CONA 1Q3HA 4LOAA 3VU9B 4HLUC 1VG1A 1G3RA 2V6IA 3W3AA 5G40A 4LUCA 3SU8A 2BMFA 5IF9A 2FV8A 1LTQA 1I2MA 4LI0A 2ZRAA 4WZBE 4IJMA 1OJLA 4M1KA 4YDHB 1R6BX 3EWSA 5CJ2A 1MRNA 5JJIA 2CE2X 3LXRA 1OE0A 3U4QB 3GJ8A 3AF3A 3MFYA 1X8KA 2XEXA 5HTKA 2NZJA 4MGIR 3CRRA 1Q3TA 2CLCX 1OFIA 5H1YA 1JR6A 4L8GA 3IPYA 2CVHA 1GITA 2B92A 4AKIA 1E6CA 2DPXA 1CU1A 1F48A 1US8A 4MYCA 3IO5A 4OHWA 2D74A 2ZPTX 1Q22A 2EQBA 5G3YA 2VRWA 4PSVA 4CRWB 4AK9A 3AV0B 1XMSA 3IQWA 1DO2A 4QHYA 1G21E 1Z6XA 1T0JB 2HJVA 2WKRA 4F4CA 4AD8A 1U9IC 3R8FA 5KNCA 3NWJA 2W2TA 2GA8A 1HQYE 4P3YA 1FNMA 1L8QA 3I72A 1RJ9B 1P75A 3A6PC 1X86B 2ZSDA 3PG5A 4GP6A 1QHHA 1TUEA 4L9SA 4IKEA 1AS0A 2F1IA 2FN4A 4CEHA 4F92B 5KYKA 2OSBA 2FFAA 3B60A 3RRMA 1GKUB 2FFQA 4AIIA 4Q4JA 4TQAA 1EK0A 2CK3A 4G0NA 2BKEA 2F6RA 4PSKA 3GLHB 3RC3A 1G8GA 1R4AA 3VHLB 1YVDA 2QN6A 2OILA 1KK2A 4NKRA 2ZR0A 4HAXA 3A8TA 3I73A 1SKYB 5J40A 3QQ5A 4HAYA 3QKUA 4JL8A 5HCIA 2MMCA 3H0KA 3HYRA 1F2UB 1YRAA 4OL0A 4Q7JB 4QJ5A 4ZKEA 3WP1B 4MUAA 2DWQA 3FHCB 4AKHA 4RCYA 4FINA 1JECA 3TUZC 3AVYA 2GJ8A 4JVLA 2OCYC 1L2TA 3NG1A 2F3TA 4DSUA 2ZI7A 4UKDA 2Y8EA 4HLCA 4JLAA 5A4JA 3LWNA 3FFAA 4C0KA 2JA1A 3X2SA 4XH9B 5FUYA 2GF9A 2JDIA 5FL3A 1R0XA 1YZUA 3D31A 2D2EA 4FCVA 1A5TA 1ZNWA 2QROA 3OESA 4KVGA 2IYXA 1KMQA 4WA7A 4HSEA 2VHCA 2IYZA 4Q01A 1NN0A 3CRQA 1UBFA 4ESHA 2YZ2A 4K46A 3NDBB 1SVOA 3GJ0A 1AQYA 1L4UA 2CE7A 1R5OA 2AX4A 2WAXA 1Z06A 1KY2A 3T35A 3DMNA 4TTRA 3OFND 5P21A 2QT0A 3C16C 1ZJ6A 2W0MA 5KDOA 4ACBA 1N6OA 2J45A 2PT7A 3OE7D 4G5RA 2FWRA 3O8BA 4JJZA 1PZNA 1TPZA 5HKKD 3IEVA 1XCPA 3K0FB 1E0SA 2BMDA 1UBEA 2OBMA 1IN8A 1MABB 1OFUX 3NHBA 2ZYWX 1FP6A 4L4UA 2YOHA 1IXZA 4AWXA 1IM2A 3U60B 1N5LA 4IOJA 1WBDA 1CS4C 3GLFB 2GBLC 4IEIA 4CT4B 1DS6A 2EWVA 2K5UA 4N3NA 3FHTA 3Q8XB 1LVGA 2RGEA 5TB5A 4PO1A 4QXAA 4US2R 1QG4A 3W34A 1YQTA 4S35A 4ASUD 3X1YA 2YWGA 2BBWA 2CHGA 4UXJA 4HAUA 3OZXA 1DVRA 2VHJA 5AK0A 1NKSA 4G1UC 2B7BA 4PZYA 1WB9A 2GXAA 4JLMA 2ZR7A 1N6NA 3VR3A 3EPHA 2IWHA 3P4XA 3DO6A 2YVUA 5JEEA 1XEXA 1G8PA 1ZNXA 4HUQB 1W2GA 3IBGA 2BBOA 3WNDA 3RSLA 3ZYCA 1E9BA 2CMKA 1OXUA 2Z0MA 2ZI3A 4WOPA 4IVRA 3SJZA 2BBTA 3T1QA 3QKRA 4EQ6B 1JJVA 1FNNA 2W83A 1F60A 4TLBA 4TMTA 2ZJ2A 5C18A 5SZJA 1UKEA 2HEIA 4QGHA 2YHSA 3MWJA 3CF2A 3ZS8A 4C7OB 5CJPA 2QMEA 3P32A 1R0WA 4TYNA 4TYYA 1MKYA 4XTRA 3PXGA 3QF7A 1HE1C 5KDLA 3SHFA 4JT4A 3BB1A 5H70A 3X1XA 3O8RA 1W36C 5BN3A 4IVPA 3N5CA 4E09A 2VHTA
chains in the Genus database with same CATH superfamily
3TD2A 3UB3A 5EWLB 5TE9A 1GGKA 1DELA 1PLJA 4H3VA 1J49A 3S1AA 5G4KA 1E2GA 5SICE 1ZH8A 3NHFA 3OZVA 3TTVA 5HIMA 3PWTA 3OCWA 1J5EB 1OLOA 1EA7A 2WOOA 2QVBA 3GJTA 4Y6PA 5AQ1A 2P67A 2HK9A 4TMYA 3TDKA 3UJ8A 5BUCA 2ZBFA 4KO3S 2IKSA 3I8XA 3Q40A 4RVCA 3PQ3A 2C31A 5CVVA 4JI1B 3MYYA 1CUEA 4NZPA 2VHVA 1RADA 1TCBA 2WWRA 3OM9A 3DE5X 2HBYA 3OTIA 4MMXB 3D02A 4MA4A 1N75A 1SY7A 4UHKA 5J40A 2AG0A 1C9MA 2Q7OE 1W44A 4RLSA 1SA0B 4MQFB 4AZ0A 4F4UA 5KNCH 1F1JA 5A03A 1XZCA 3NUZA 2JLBA 3KEGA 1RWBA 4Y7CA 2GJSA 4L4RA 4YQEA 1ZXXA 1IN7A 1GNSA 4TL7A 3PNLA 4YECA 3I9FA 4ZREA 2FI1A 4B7AA 1EB9A 1KIFA 1ZRMA 4QOFA 5E7QA 4ZQFA 4AY5A 2VPQA 1RBZA 1DLJA 4Q16A 1C7FA 3VPSA 3N7TA 1EDDA 3EVAA 1U11A 3RIYA 4YMVA 2JIRA 1AV7A 4YIHA 1E5VA 1YXMA 3E9QA 1AK1A 1FTGA 3I53A 3MINA 4GZLA 4W5QA 1E4VA 4UQPA 3HY3A 5DTEA 1U2GC 4U9IS 2WM2A 3MJSA 3RYIB 1L4NA 2DHRA 1YASA 3ETNA 4K1LA 1GA4A 5AK4A 2RJ3A 2ZKIA 3BD6A 3MJCA 5LLDA 4RTRA 2RHWA 5MN5A 4EFMA 2GRUA 4UM9B 2OR3A 4F3CA 3CH4B 2OLKA 1CC1S 3JRXA 3ZXXA 3F5DA 2I7TA 1V7PC 4MR8A 4MUJA 4Q93A 1A9XA 1BH6A 2J5QA 4BNYA 1MA0A 4Q3NA 4ZJZA 3DHWC 1X6VA 4B8YA 1FS5A 1KPIA 2QUZA 4N1AA 2V65A 3A27A 5HQ3A 5SZIA 4HAOA 2QR3A 4HDCA 3LU1A 1CUDA 3LFUA 4ARBA 3TNLA 3UEOA 5IVHA 3MUEA 4I50F 4E13A 1NMYA 4IFBA 2W6CX 1RC1A 3R1IA 2G1JA 4NECA 1GSIA 5JE8A 4AYWA 2HFJA 2ZW9A 2VSXA 4HUQA 1XTRA 1H65A 2C0CA 3HO6A 3E03A 2QXTA 4M89A 3OPNA 2GETA 1ZCAA 2Z6AA 1CVLA 2YJZA 1E3QA 1PCXA 2Z4TA 3B1KA 4D4IA 2AC4A 4TRMA 3IQEA 4N5MA 3VU9A 5AXDA 1SK9A 2DH6A 1Y7HA 2OPHA 2P5UA 5IASA 3H9EO 2QGNA 5DYIA 4IOMA 4YUVA 3K0SA 3ZD7A 4FHCA 2FNAA 3EOBI 2ZITA 5T41A 4JKIA 3UUWA 4B7XA 1IZYA 2REQA 5LWHA 2VH1A 5T67A 4RC9A 1YGYA 4WK4B 4A82A 3EEQA 3QTLA 4RKQA 1WRBA 2XB2A 4KWEA 5DW3A 1MGPA 1C29B 1CPYA 4IRUB 2DFNA 4DSAA 4UPEA 3H84A 1CEYA 3DAYA 1DTSA 1XXHA 4OYYA 5K3DA 4I1PA 1HMPA 1JFVA 2JH3A 1F8FA 1O03A 1S1CA 3A3OA 3KTOA 1EP2B 4JVOA 2NWQA 1Q0PA 1NI4B 2O7VA 4HDMA 4JLPA 3R5FA 3KR2A 1UEJA 2BP7A 3MVEA 1E3WB 2PAFA 4J0EA 3WK8A 1QLHA 3WMFA 2HA6A 2R8BA 5C7LO 1JBEA 3C8ZA 4D25A 4CI9A 4CLXA 4E6PA 1T8PA 1NYQA 3PVCA 3MB5A 1VIDA 4FKMA 1CRPA 4YMUA 5F7ZA 4BDSA 1P6XA 2OTCA 2OUIA 4P5DA 4AF6A 3ZVMA 5ALSA 4ZEWA 1OYVA 2AK3A 1U0SY 4CKBA 2O7SA 3KHSA 5JS6A 5KEIA 1CB7A 3U2QA 4GZ3A 4YLGA 1J8QA 2A1IA 1DP4A 3NM6B 1JZQA 2LGJA 3AJ9A 5JIBA 1JBQA 5DSZA 5DBHX 5K45A 2GEDA 4GYJA 5BMVA 3CKKA 1R0RE 4GUAA 4YAOA 4OMCA 1E4OA 3HXPA 4HATA 3GFVA 4EA9A 2JVKA 4F2HA 1JPUA 1I7LA 2EP5A 1PFGA 2O7RA 3N2EA 2RE8A 1K98A 5EZYA 3K9WA 3PIIA 1VL8A 3T34A 4WLUA 2VPPA 1SCJA 1I24A 2HBZA 2N0SA 1JB1A 2WF9A 4H7JA 2PSDA 2C83A 2DOKA 4W8HA 4X0EA 1I3MA 5CT8A 1ADBA 2HT6A 4C0WA 3DVAB 3VQTA 2ACWA 4ZI7B 4ZYYA 4QXQA 3U56A 2BI4A 3BMNA 2FWIA 4HAWA 4CF5A 3MT9A 4PQEA 4O4JA 1F4PA 1KJ8A 1NBOA 4TN5A 2XRMA 1QFSA 4HEHA 4IY1A 3ABZA 4EYSA 2CF6A 4X1OA 1H2AS 3EMKA 4KIJA 3GJSA 3R44A 4Q4AB 3VJRA 3WNZA 2WWVD 1FTQA 2UUAB 4KXYA 2V5VA 5JD3A 3LZ6A 2GXQA 3LQYA 2RBKA 4P3NA 4WBNF 4CFYA 3L7OA 4TT8A 3BYZA 3STYA 1C9EA 5SYNA 2AMFA 3A6HA 3CSDA 3DHVA 3UHJA 3I5MA 2Q5EA 2HB6A 1JG3A 1USVA 4D02A 4RH3A 4FMBB 4X85A 5TDHA 1MRZA 1ZDMA 5H0IA 4XM0A 1CUYA 2JIMA 2FG5A 4G5YA 2GF2A 1RKBA 5GONF 4BKUA 2R5FA 4BP1A 2OCXA 1II8A 5AW3A 1LSSA 2IF2A 3NVDA 1M2VB 3R6WA 3HYTA 4FXPA 4U7FA 5JWHA 1CUJA 2OE2A 2YY7A 2Q3HA 5CDYA 5FULA 4JBIA 1EDBA 3A1WA 3ONDA 1RM0A 3KJGA 2VXYA 4O2BF 4GOOD 1ZGAA 4L6AA 5IZCC 1UQUA 4B6PA 1KMMA 5TQ2B 1OX4B 3R9IA 5EJFA 3FJ1A 2JH9A 2OHFA 5JXWA 4XI9A 4P3KA 5DF1A 4MICA 2ZCVA 3RJ9A 2IUYA 2ONYA 1LLQA 3NP7A 2AEEA 2VOJA 4ONEA 3E7PA 2VH2A 4KO1S 5TGTA 4FMCF 3FPBA 1HT3A 4NNPA 3ORQA 1KI9A 4NY1A 4WXRA 5SZHB 1ACLA 4BPRA 4F06A 1EU1A 3HLTA 1QC5A 4JJ8A 1CQWA 1FRFS 5E1BA 1NQXA 2Z3WA 2A0YA 3B9PA 3B52X 3AJDA 3QWFA 2DR2A 1VG9B 2W2VA 4LFBB 2RHCA 1Q12A 5DM4A 1VSTA 1W8DA 5LCXA 1YMVA 1EK6A 1JU4A 1E59A 1Z3IX 3C6MA 1SXHA 1QANA 2X14A 4YO7A 4YJHA 3D5TA 4H9GA 4X84A 1DEKA 4WOCA 1WE2A 5KTSA 1TC1A 3Q6MA 1IZ8A 4CM9A 2O06A 5A5GA 5I7OA 3OWXA 3PR1A 3RSQA 1XQ6A 1XQ9A 3EVDA 1CJKC 4PYOA 4TRRA 1OX5A 3KB6A 3VC3A 2A57A 1BDBA 3BH0A 4Y0NA 2AFHE 2PQMA 4WK6A 5BSTA 4OHRA 3K9QO 1QIKA 4LYHA 3STWA 2H5JA 2QU7A 3K53A 1DC6A 4HX5A 3MTAA 4KN9S 1BG6A 1R0ZA 3OEYA 5CPFA 3IEPA 2HRQA 3V4FA 1G7RA 5JASA 4PX5A 5CCBA 4Z7OB 4H59A 1RPTA 3CN7A 1LSJA 4GICA 3FYUB 4JQOA 2YYAA 4AG3A 1NL3A 1QOQB 2NZUG 2ZAGA 10MHA 4EKYA 1XPOA 4B9AA 4TSFD 2JGRA 4YMHA 1OWMA 2W6OA 4AZVA 1GPAA 3T7JA 5BOSA 5JSHA 4B1FA 4ZVMA 1KVUA 1UBUS 2O19A 3USZA 4OYRA 3UAGA 1H2BA 2VWPA 2Y4OA 1A5AB 1GILA 4CWAA 1YIAA 3A37A 4KHZA 3CVXA 4OI4A 1K2VN 521PA 4INJA 3SVLA 4B8ZA 5ENVA 1OA0A 2ZJAA 4N40A 1CUUA 3UW1A 4PYLA 2YV2A 3I2HA 4XFKA 5DCUA 1HNZB 1XRRA 3TPFA 1HNNA 2DCUA 1GAQA 3UWKA 2XRYA 1MO2A 2QLJA 1NI4A 1AKEA 1RHJA 1YOVA 1EBBA 3ABSB 4RVHA 3VH4A 1Y1LA 1YDGA 3PNOA 1NR7A 3TQIA 1JIVA 3HFRA 1D4OA 3P2IA 4IFTA 3DLTA 4D4LA 3AY0A 3ELBA 1KEKA 3ZIAA 5B58T 3O4GA 3DZCA 3JRNA 1B74A 2GZRA 4E5SA 2VSOA 3KLBA 1NVVR 5E9AA 3V8VA 3D2LA 1M2VA 3N0WA 4NX2A 3GJQA 5AK3A 5JCJA 3W05A 3I2YX 3AUXA 4FGUA 1JFSA 1A82A 3AB3A 3LC1O 4F8JA 1QH9A 2XMPA 3CO0S 5J5CA 2EFCB 4BKRA 1W5AA 4QOGA 3WAKA 3SLRA 3N53A 1FTSA 4R01A 4N9QA 4Q1CA 2Z4RA 5FPSA 1FK8A 2FJ0A 2UXBB 4JIMA 3TRIA 4KE8A 5CM2Z 3UAWA 3K05A 3OX1A 1DKMA 1HZJA 2ZWPA 1GYPA 1DUVG 1FPQA 3ME5A 4LY9A 1HE3A 3GHHA 1DSSG 4BNUA 1NC3A 2QAJA 1FNSA 1M1YE 3H42B 3Q8LA 3FHOA 4RIIA 4PTYA 2DHCA 5JZSA 3WNCA 1NAHA 3C8UA 3GMSA 1U0HC 2Z08A 4Y1RB 1YBMA 3AI2A 1TKCA 2XITA 3QX7A 4X20B 1AF7A 1XP5A 2VCHA 4OMUA 4BNDB 3KK0A 3TGPA 5LL6P 2PEZA 1QIGA 2PSEA 3BMNB 4E21A 5BSKA 4Z0TA 1RVDA 3HWWA 3MHPA 5KWIA 2JKYA 4KQJA 5DJ5A 5E7MA 3ZNQA 2R4QA 2FDXA 4J2OA 2R68A 2GM3A 2CVOA 4X6XA 4LYGA 5B55A 4FGKA 2OVBA 2ZDQA 2OXEA 1K68A 1G3UA 2ORVA 1LA2A 4PC1A 4YAFA 4D0NA 2ZBVA 2RK3A 3UT5A 4JLUA 5JZVA 4TLDA 3E9DA 4CBVA 4ZWNA 4C7BA 3ZJVA 2QX9A 4TSKA 2G71A 5GVSA 1U8UA 1NQAO 2YINC 3LUDA 2YWFA 1AUVA 3NRBA 3Q0TA 4J9UE 2G67A 4MV7A 5LBUA 3SJAA 3ZHXA 4F4HA 5BNWA 3AVPA 4YJDA 2C2GA 4QOIA 2BRUA 3GW8A 4FX5A 4NS1A 1FRVA 1GKKA 5A4FS 3H8VA 1PD1A 3GA5A 1OGJA 3MHTA 4YRMA 2VTDA 1EM8B 3HUEA 4UHBA 1ATIA 4UHEA 5T57A 3T5TA 2FUCA 2HJHA 1A96A 1Q6ZA 1TECE 1XV5A 2FPIB 1UZUA 2VZLA 2FZEA 1X74A 1S01A 2X42A 2ATXA 2VP3A 1DEHA 3ICOA 4M88A 1Y6QA 5KTMA 1OHHA 2AOUB 1GP2A 1LZKA 3QPBA 1CJUC 1C1DA 3NHZA 4UMFA 2O8FB 4LGVA 1WB4A 4YR7A 2FU5C 4B76A 5AW0A 4OFBA 3N7UA 2VDWB 1K8ZB 2W2QA 2ZYDA 4HFMA 1J4AA 2X2OA 2NPFA 1NF3A 4M83A 4G56A 1KAEA 4L0DA 5DKFA 4EYKA 5K8LA 1MNAA 4JJ4A 4U2FA 4CKEB 1EVLA 1R4MA 1RRPA 2QDXA 2HMAA 2AZMA 2QVZX 3IKLA 4LOHA 1B0UA 3KG2A 4GRDA 3VI3B 1T13A 4F46A 1NVDA 1D9ZA 2C5SA 4AJKA 2FQ1A 1OV4A 2D5IA 2QLNA 4FYVA 3OP4A 2PUCA 1VIMA 5ECDA 5B7GA 3TF5A 4I3FA 4J1TC 5I7VA 4MK4A 1DE0A 4RENA 1E9SA 4AO8A 3RSGA 5AO9A 2V7GA 2W8BB 4HB4A 1MENA 2ST1A 3G3EA 3ZBTA 2PN1A 3ZE8A 4W6ZA 4JXXA 3PJDA 2Y1WA 2HO5A 1H1TA 3W5CA 1CD5A 2CL7X 4S1OA 5I6DA 2HC9A 4KX3A 2P65A 5AJVB 2ZRLA 3SJUA 2GN4A 2ODPA 3LS2A 4HGNA 4LE2A 4ZIRA 1D9XA 3ET4A 3GCGA 4QTYA 1LX7A 1K6IA 1A5BB 4XGKA 5I5GA 3ZGXA 4XGRA 4YNBA 3WO1A 1ZIOA 1QKKA 3WGZA 4RKRA 3RS9A 2G4CA 2WYWA 1Y6JA 2V45A 2C3UA 3IT1A 4RCZA 4B7CA 2OM6A 1RLMA 3LDHA 3AERB 5HUHA 1R1DA 4EPYA 2G88A 4L73A 3QFFA 3RUCA 3FTEA 1ND6A 4BDTA 4GZ5A 1M1UA 4LDRA 3OY2A 1P61B 1ZLYA 4LF6B 1E8NA 4JGGA 4RA9B 3LVBA 1WXXA 2CFCA 1HI9A 2Y27A 4ZVTA 7ADHA 4DUZB 5KC8A 2UKDA 3LXXA 1Z0KA 1CHNA 3U61B 3DL2A 1RBMA 3OWHA 2XDQA 1TVEA 4OMDA 2ORYA 2QI9C 4A0QA 1MB3A 1I0IA 2UDPA 3Q85A 5H4GA 2PEYA 3TLMA 3KT8A 1OV6A 5IDQA 3SSOA 3PQ2A 2N1MA 1PKEA 2AN3A 3M6IA 1UK8A 2G83A 1MLDA 2GX6A 2RAFA 1E66A 3CH7A 3DMDA 4HQOA 3K3PA 1K8XB 2FA9A 5KOYA 2EWMA 2RGWA 3LPCA 5CB6A 4TMFA 3RRYA 4CLOB 1YS9A 3N2NA 2HU8A 5DLQC 5J47A 4UTRA 1FUKA 2F3RA 3CFYA 4X3CA 1THZA 1ULZA 4YJ3B 1AVTA 5AOCA 5IKOA 4A23A 2O23A 1V1MB 3HB4X 5GGYA 1OD6A 3WL6A 5DN9A 1BEUB 2X5KO 3PDIA 1W36D 2CV0A 2WMYA 4MWZA 3DT6A 3ID6C 5D5HA 5HHTA 3LT1A 3IQXA 4J75A 1LK0A 1TEZA 1PNRA 2OM2A 3E9YA 2OSVA 1DBSA 4TSFA 1KO1A 3B2QA 2YL2A 2RCYA 3D6JA 3OOHA 4XSVA 1CWUA 1XAJA 1XZPA 1SQ0A 2OV8A 3A4YA 1EFTA 3BRQA 5F9HA 3ZZTA 2VJBA 2R60A 2PT6A 3DV0B 2E4WA 3Q87B 5KYUA 4WCFC 5DN6A 5F5XA 1RQPA 2VNIA 1ZMOA 3UT6A 3GLHE 2Z6QA 4XIFA 5IXYA 4ZT7A 3ICEA 1HL7A 1I1OA 4OXRA 5L40A 2ISSD 2JIQA 3DBLB 3MWKA 5D3QA 3O8QA 5D85A 3KKMA 2Z3VA 4MAFA 3IOYA 3OP1A 4WKGA 5K0NA 2VWHA 3V42A 1VYVA 4E5VA 2Q6VA 2BCEA 1A76A 3AZOA 4X64B 4B3XA 5KWVA 3Q0IA 3O90A 4FGZA 1SUSA 1OLUA 3MJHA 3QWAA 4D5EA 1AN9A 1IEQA 4MV4A 3RVNA 3ANTA 3ZU5A 2KLHA 4N8DA 2VDMB 3GLIB 2O2ZA 1CVRA 4FC6A 3Q7RA 1W0KD 3MIZA 1E2BA 2QRUA 5A9SB 4QT4A 1MQ8B 3ONEA 3O8LA 1DC8A 2NSDA 4RIGA 5ANRB 5J2UA 2XKKA 3C3YA 1OXMA 4HBGA 3H7IA 1IY1A 3DUFB 1ZOSA 2GEBA 1QQ6A 2VNKA 1MORA 3BA1A 3IODA 5DEOA 2VUSA 3BZUA 1DX6A 5CXXA 2CNWA 5AW5A 2WTBA 4PQYA 3R7SA 3V7FA 3VDQA 3DZDA 1V3VA 3C85A 4RHEA 3DZ8A 2HK7A 1U3GA 1Z7GA 2NM0A 3HDGA 1WMFA 2YICA 4OV6B 4Q4HB 3SXUB 4EJ0A 1ESCA 3VDMA 4IUYA 1UXJA 3KYDA 4KYTA 3NV9A 3UJCA 3PDHA 3PX2A 5LWQA 4NFSA 2XADA 4F04A 3LV8A 4B2YA 2VBGA 4NCIA 1R8YA 4UBIA 4O4HB 1T5OA 4H15A 2Y1LA 2UUOA 5CVDA 4J2HA 1NBMA 5DULA 4ND6A 3WXBA 1N6IA 4FFWA 4R41A 3Q88A 1ID8A 3OMWA 2ZSKA 3JZMA 2H9IA 3PXDA 5TV2A 3ZGZA 1DIOB 2ZVJA 2PU5A 4CKZA 1ULUA 2E21A 3G79A 5I8PA 1Y6FA 3QVJA 5ILOA 2GCIA 2TYSB 1MW9X 1OZHA 1Z25A 2LDBA 3M3DA 1BMTA 4HLQB 4P86A 1QWSA 2J5BA 2BPOA 3AFGA 3IULA 3OCYA 3HRIA 2Y99A 4KSBA 5CA1B 4O4IF 1D2GA 4FC7A 2H1OA 1QS0A 4YBZA 4GBGA 4K9QA 2DHEA 3LQRA 1GZHB 2JZNA 3IEKA 5FBQB 5K2MA 1W85B 1UODA 2DKFA 2P1DA 2VL7A 1Q7CA 8GPBA 1CBUA 1UM8A 1QAQA 3CH5A 3ENKA 4FYPA 2EG5A 1ORTA 2XOKA 4UM8B 3ZWKA 4KIUA 4G0WA 2IP4A 1CJCA 2JHGA 4S3MA 4GOJA 3M5PA 2WHXA 3MOGA 2LIPA 4MR8B 4B09A 1E79D 2JLCA 2C88A 1J9GA 5CG2A 1TYDE 2RGRA 3R5XA 2IZ0A 5JDCC 5TIIA 1RQNA 4U2BA 3E84A 1CUFA 4JJGA 5FLKA 3OU6A 2IS2A 5C34B 3O47A 3DKPA 4F93B 3OUTA 4Q03A 3E8MA 2D8AA 5FHRA 2K2WA 5CM8B 5F7JA 3AHEA 3P9SA 4OU5A 3M9XA 4UPVA 1BYIA 4LVNA 2XYHA 3WGKA 1KA9H 1RWNA 5TF0A 4M21A 1TLFA 2Q4DA 3LWDA 3L46A 1UF9A 3WOVA 3H4TA 1H0KA 2C1ZA 4NU8X 4ZIRB 4GPD1 3I5XA 2H31A 4J7UA 2KM1A 1UIRA 3M5DA 5ESRA 3V9AA 3VVMA 1UZMA 2ZI5A 1RIFA 3MG9A 2A9PA 4JASB 1UBOS 3W5DA 1G0NA 2AYYA 2QL6A 5IDWA 2O1SA 4YJFA 1ZD8A 3ZW8A 4EENA 1MJGM 1SQFA 3WFZA 4EM6A 4BFLA 2B8JA 3BQ9A 4R40A 1V25A 4L0CA 4CIDA 3FDZB 4LWZA 1G4AE 1G5IA 3O82A 1TGYA 5LU8A 3B7WA 3QLJA 4D9BA 4RA9A 3PQ7A 4RJ2A 1SBQA 4YJ2B 3GCZA 1EK2A 3AM3A 4CMEC 3H13A 1P44A 2YYYA 2VSFA 4F5ZA 1TKRA 2Y0CA 1R4ZA 1WD5A 2PKQO 4JQYA 4IBOA 1HQKA 4KACA 5TMDA 5ADHA 3ILVA 5LXTA 2KB0A 2Z83A 1IB6A 5EZSA 1KEZA 4I6JA 2Z04A 4O2BB 4QICA 5GADl 5FNVF 5B5SA 1YR9A 1DKOA 1EQAA 2G8NA 3BERA 4HDQB 1MJNA 4UNPA 1L7VC 1YCGA 2J9FA 5CFZA 1RLJA 5IFLA 2J0EA 4XE5A 4D9KA 5DBOA 3SEFA 5K8JB 1JT2A 3O7MA 4QYMA 2ATCA 4I3HA 2GB4A 4BB0A 4B31A 1BMDA 2BEVA 3SZGA 5TLSA 1WY7A 4U2KA 5JZ9A 4BIMA 3BWDD 4ZU1X 4WV3A 1AMOA 2FWPA 2NW6A 3I9OA 2EBHX 3RT7A 1MHPA 4D9HA 1JR3E 1Z0UA 2X0IA 3L6EA 4XUDA 2H1RA 3U7QB 3WRYC 3L0OA 1GAEO 1Z29A 2CNKA 4B2IA 4LJKA 3KR9A 1AM4D 4ZI7A 2RAPA 3VR1A 2QTNA 3NHYA 4MQMA 4NBUA 2WJYA 1OTHA 3B8EA 3ORSA 5J5AA 4AIRA 2VTBB 2M6SA 4HYEA 3DLPX 2IIVA 3H1GA 1EFAA 2Q3CA 3C7AA 4LWPA 4EW3A 1E3LA 4M4SA 4Q7MB 3AF4A 4MKGA 4DR2B 4EUFA 5FFNA 2W70A 2W6MA 1PTKA 4PTLA 3SAJA 4FIDA 4Q18A 5FWDA 3HKDB 4M7RA 3KQLA 3IMEA 2HUPA 4H4DA 4UOEA 5KOIA 4ALMA 2QGFA 4J0IA 3KAJA 3DBOB 3I2FA 5FTWA 1NQWA 5EPOA 1A2BA 3KDSE 4B3MB 2VA9A 4RVGA 2YVQA 2C9MA 3NTVA 1YC5A 4Z3OA 5P8WA 1SVWA 3QU5A 4KRGA 1FP4B 1L5KA 2ZZMA 3BKXA 4WRRA 3U7RA 3SHVA 3EC1A 2MIIA 2GZ2A 4GMGA 2BCJQ 5CHYA 4H3SA 3IVGA 1KDTA 1MHTA 2RCNA 3IDSA 4RA6B 4PGHA 3BREA 2EP8A 3GLKA 5DHUA 3KHUA 1NQOA 3TEFA 3GBVA 4OOEA 4X8LA 4XVCA 4HS9A 1OWOA 2IK8A 4L9AA 5ECWA 2Q3MA 3ZCPA 4RTQA 3EVZA 1LBHA 1ZCJA 2HX1A 3QOWA 5F5LA 1KGSA 2EBWA 3P5BA 3EIEA 2BEWB 1CUHA 3ROGA 4PYQA 2I33A 1MAHA 1KEEA 2XW6A 3GGJA 3LJKA 2GLTA 2AJ8A 3DE7X 2LPMA 1WX1A 1P4GA 4XCXA 4S1NA 1N3IA 3LPLA 3WISA 1EFCA 1NFRA 4MVJF 4BRUA 3DDOA 4ZCPA 4MQ6A 5KJEA 4EFLA 3DE4X 3THYA 2SCUA 3R6TA 4BQEA 4DR3B 1NJ5A 4MROA 2H9YA 3FYHA 3EJ6A 1D5WA 2VK8A 3R0VA 3QSYA 1I10A 1XDZA 1CQPA 1ZU4A 4G41A 1JQBA 3RYCB 2UZ1A 1DBVO 1T8WA 1YBAA 3OECA 3IBYA 4HH0A 4JOSA 4B6FA 3C5EA 1P1IA 1J8YF 4GVXA 2ISQA 3FCXA 4IOLA 4ALLA 5BPFA 2I3ZA 3DPIA 2NAFA 4B79A 2HLPA 4K6CA 5D3MB 3PC8C 4WZ6A 2GDZA 1ZIYA 3BZWA 3A4NA 3ADCA 4DUYB 3OJEA 4QXRA 2EAUA 1V41E 2OHIA 3OA2A 1U4SA 3ONFA 4B87A 4D79A 1ZJYA 4AZ3A 2BDTA 2IEDA 2R25B 2EXXA 2JATA 3PVZA 1M8FA 1FUUA 1ZM9A 3D64A 4G86A 4UW9A 3KOWA 2F3PA 3HCCA 3I09A 3MCWA 1R8SA 2CXSA 4XX1A 1IEXA 5HP4A 3JYPA 1QRSA 3FTDA 4XD7A 2VHQA 4JYCA 4ER5A 1YUBA 5ELMA 3WIBA 2EDCA 1M2OA 3IGFA 3UMJA 5JMOA 3TOSA 2RG7A 1VCHA 3RC1A 1BH2A 2D1SA 1WLYA 1RQXA 1DMRA 3JQPA 3SBEA 2P2ZA 3IUNA 1NXWA 4X7BA 1KSHA 4ZV7A 2FF5A 5IWCA 4GMDA 2PZJA 3LQKA 1T5HX 2VLBA 3TK1A 4AICA 1XHLA 2J0UB 2HSEA 4MP6A 4JQCA 4WINA 1K7SN 4OUDA 4QAQA 3IT0A 4I9UA 4W63A 1BO6A 4F3RA 4F5YA 3ZHBA 4MHTA 1VLZA 4S0XA 4IS2A 4BNJA 5J4KA 1L7MA 2ASVA 2QTGA 2AG6A 2M6LA 1LPSA 3VR0A 3TG8A 3H6GA 5EA2A 3GEHA 1JHOA 1Q7RA 3GUVA 4KPGA 4GMXA 1Z8NA 1IXSB 4A6PA 1JWAB 3GRUA 2WYHA 4EHKA 3D9QX 1BJRE 1T43A 1Z37A 3RB8A 2VS1A 3ROEA 1XB2A 3RS5A 3CVUA 4H08A 2E5LB 3P0FA 4GIBA 2R96A 2WV7A 5FLXA 4O6VA 3T1VA 4Q7QA 4FNGA 1R10A 1K7EB 1J7KA 4NJEA 3EQ7A 3KOUA 4KBFA 1OLSB 1SB8A 3C7KA 3N39C 4HI0E 2NN3C 1L4FA 2CZCA 1WMSA 3FDZA 4MAMA 5L45A 4PLGA 1ZVMA 4AJLA 1PJAA 1ZG3A 5BV2P 2JLUA 3BAFA 3P5SA 4EJSC 2ESRA 4MR9A 2MOKA 4ZQIA 2ZJ6A 3SIWA 3PKZA 3WYBA 1NQTA 2AJTA 1HTBA 2DBZA 3C74A 1R0KA 4M1MA 2XQFA 2OCLA 2CHVA 2E9SA 3H1AA 4PBSA 5FYQA 3FE2A 2IQ5A 1PZGA 5JSZB 2QDKA 4UJ5A 3SQXA 2YYZA 4C5CA 2Q5IA 4R98A 4TL9A 1VG0B 2YV1A 3B5IA 4JUDX 4BJHB 4JNCA 3FGPA 3GJ6A 1QX4A 1GRQA 2E5WA 2HZBA 2XLCA 3OFJA 2IUUA 1Y63A 3DMTC 3NUGA 3ZDFA 4RIFA 1HDXA 3LYLA 2HUNA 2WJJA 2QN2A 2HSZA 3FMOB 1I5OA 5EYPB 2TRSB 3ROQA 5TXGA 4BN4A 4CMBA 4YCAA 3BSFA 2IH5A 2VIIA 2O48X 1FX0B 1H05A 4HQLA 2NT3A 1SVLA 2IYRA 3PXAA 5IVPA 2IFTA 4YCJA 3JVVA 4BS9A 3N8NA 2BFFA 2HI0A 2MCFA 1VYUA 5E6UA 2W8BA 2ZYUX 3RS2A 4GXTA 4WBNB 4RTLA 2AJLI 1DUSA 3M6UA 5AFSA 1RCTE 1KE2A 1KS9A 2GFIA 3QU7A 4CODB 2V7WA 4B3SB 1MC4A 1M7HA 4QFDA 2JAQA 3EX7C 1T1JA 3IBTA 3UWPA 2GRJA 1NI5A 2ZFUA 3G9UA 4TQ9A 3VO8A 1WDMA 2AOTA 4XWAA 4YIKA 5A04A 3P27A 1XYYA 2YJ3A 5EKDA 2WM8A 5KPDA 3WL4A 1OGIA 5FA5A 4CL2A 2XE7A 1NN3A 1E1QA 1TCVA 1JHVA 3TMKA 2WF7A 1DFGA 1N1GA 1YMQA 3HKEB 3HA7A 4KLRA 4RZUA 3WYEA 4E2ZA 2P9YA 2PZGA 1FLDA 1U6JA 2BTEA 2AFIA 1H23A 1XMVA 2FYTA 2I87A 3CJQA 3E70C 1FP4A 3AEKA 4IDGA 5HG0A 3TL6A 3BTOA 3EUWA 3P0JA 3HC7A 1WZ2A 1OJ7A 3TQCA 3IE1A 3R5TA 3DEKA 2WEKA 4WNAA 3GELA 4Y6RA 5HM6A 3L8HA 1ZXLA 1NIPA 4HAIA 4PRZA 4II2A 1I5EA 1XD2B 2CLMB 4GR4A 5C81A 4DLKA 5CK4A 4J0QA 5K99A 1JH9A 1DI0A 4KR9A 3H97A 4Q3DA 3BWBA 1SQSA 1TB4A 2XA1A 3WA6A 1L5RA 3UMCA 2WTXA 1GL9B 1IN5A 1TU3A 1L5YA 2X4LA 5KTTA 1L0BA 4Y6OA 4Q05A 3LL7A 4OSOA 1PZMA 1KZ7B 1Z2DA 3QG5A 1DAIA 2GXSA 2QZ9A 3ETLA 1S3IA 2C77A 4G0VA 1PWEA 1US8B 3RLFA 1FUYB 4EUNA 4JYPA 4PAWA 1B8NA 3FHJA 1Z56C 2BIFA 1Y8AA 1H66A 3M82A 4MV1A 4X20A 1SXJE 2ZUDA 3C70A 1LLUA 1Z5WA 4AG5A 1NLZA 2EERA 1M1XB 4FJ1A 5CX1A 3BMXA 5JS1A 5J4VA 3JD2A 1ZEMA 2VK1A 5CYOA 4D0GA 1NKTA 3O31A 3D1JA 5HZHA 4MYTA 4TTVA 4YCDA 3KSRA 4B7UA 4QFCA 3PT9A 5ADWA 1ABBA 1KSFX 1P0MA 2C2XA 2PVCA 3OOYA 3INNA 2CXTA 2RH4A 5HE9A 1YK0A 2Q5OA 3OJCA 4PAGA 4D2IA 3OZSA 4UTVA 2D13A 4XFJA 5HIJA 3RRNA 1D04A 2H18A 3IMKA 1GT91 2AH5A 3UT0A 1V9LA 5JNVA 3A1TA 1JFFA 2OEPA 4Z1MD 1NVTA 2XTAA 4E11A 2FMKA 3DOEA 3GZNA 2PD6A 3PEVA 3Q12A 5CYFA 4CT4B 5JC8A 4W6QA 1EESA 1GUDA 2UXCB 3AF2A 4HYYA 4EDFA 4MO2A 5E0KB 2FPIA 1D2NA 3PPVA 4I8IA 3RRZA 3UUFA 2F59A 1LRKA 4IM7A 1PT8A 4I19A 2OKGA 3VVBA 3KU4A 1JXAA 4FZJA 1BOOA 4HNRA 4OLAA 1QK4A 5BO5A 1GCAA 1GTZA 3KVRA 4KBYA 3G5AA 4PR3A 4EP1A 4R71A 5AICA 3W2IA 3H18A 1YBFA 4GI7A 1H6AA 4ROTA 3K0HA 3IB3A 2X0FA 1CUZA 1HFWA 4YAEA 2BHRA 3LGSA 1SC4A 2WIAA 5KNDH 3TW8A 5DXJA 1KBQA 4MW0A 3RNOA 4E94A 4FPXA 2R6FA 1NYTA 3KYDB 4EQZA 2FDCA 3IP9A 4OG2A 1MAAA 4BO4A 1MO3A 1NXTA 5CW2A 4DJ5X 2XV1A 4XD7D 5B1SA 3MAJA 5JH7A 3RFFA 5ICFA 1AHHA 1BHSA 1Q1AA 1QVVA 2EKBA 4OYHA 1G2OA 1W52X 4BJ6A 4CLDA 3BGVA 4BNGA 5LU9A 1X2EA 1QVZA 4LJAA 4C4ZA 4ZVQA 5FBRB 4B3CA 3EN0A 1T24A 5K3EA 1ZC3A 4REOA 2NVWA 3PE3A 2W2MA 4LPSA 4FJ0A 2BFBB 2QL7A 1NSYA 2DHDA 1IAQA 3MTEA 3ORHA 3H0CA 4C7OA 3DOUA 2JFWA 3H04A 1DXYA 4HLNA 4Y7DA 3RTAA 4CTNA 5HKKA 3BTUA 2FSPA 3FBWA 4E3ZA 4WK2B 3LW7A 2UYQA 3GMIA 3GUZA 3H6HA 3KLOA 4JX9A 5DHPA 1HBJA 5IVKA 1PR6A 2UVPA 2FPPB 1Y8RA 3I92A 1H9AA 2XGJA 4NVRA 2HWYA 1C3XA 1OXVA 2AR0A 4GBMA 3BKWA 3L8FA 3CZCA 4OKSA 3SF8B 2ALJA 4IQ0A 1JSCA 1DPFA 1NX9A 1X87A 2HA4A 3GJXC 4TOIA 1C8LA 4W9MC 1IM8A 3GEPA 4KLCA 3CVWA 3UKJA 1ABFA 4KSYA 1O96A 4YDRA 4ASUA 3OG9A 1IOVA 4HP8A 4RHYA 3TXYA 1NNEA 2GT1A 4MW7A 1VYTA 2JI7A 3EUAA 3HU2A 5IC6A 1VZ2A 1ZBQA 4P0TA 1SZDA 3ISTA 1EUQA 1XMIA 2JLSA 2ZTVA 3AJ8A 5DP2A 2B5WA 1W94A 1C9KA 3EASA 4LNUB 3JQBC 4Z4CA 3W5SA 3ZIUA 4Q4HA 3OHPA 1A7AA 2BLLA 4HH4A 4LGMA 1ISSA 1TL7C 3R23A 3TIGA 5AW4A 5KQLA 1EFKA 1GY8A 1X1AA 4J1NA 3E22A 3PKIA 2QRQA 2ZREA 3WRVA 3IALA 4J90A 4DJJA 4O2AB 2TMGA 5IJ9A 2NSLA 1BU5A 1IG3A 4P54A 2AIRA 3KWJA 4KC0A 1UFQA 1UANA 1XFDA 3AKDA 3OPYA 1RXYA 4IQ8A 4LVUA 4WPGA 1QPGA 2GN6A 4KAJA 4KAXA 3HU3A 4LTNA 1RIIA 3FN4A 3M6MD 4BAGA 4YMGA 1JKJA 1Z28A 2PKWA 3EVNA 4LZWA 1KI4A 2IS6A 3ST7A 1ZD9A 1FFHA 2REQB 1L8OA 3KO8A 1GGFA 4WK0B 3RSFA 4HBZA 3T9CA 2YXEA 1W4BA 3IVCA 2J46A 4X1KA 3Q8MA 2FFHA 3MT8A 3RYTC 2H85A 1BHO1 2B4KA 2WSLA 2XJ9A 2IEAA 5BUQA 5TMPA 1VL5A 2F9LA 3WWEA 4Q3EA 3OTWA 4YRDA 2NU6A 2GKOA 1W85A 1Q57A 3TX6A 1T2UA 4FB5A 1CR6A 2XZTA 3VC2A 1L5HB 1NBIA 4P5EA 1G21B 2J07A 2QSZA 3BFXA 4BV8A 2VJDA 1YNOA 3BD7A 1I32A 2CZGA 2C4UA 2CYAA 2BM0A 1JEQB 3DEZA 2CBXA 4WBXC 1BFDA 4IHJF 3IT2A 5FPYA 1YR8A 3FYCA 3ND6A 4JEMA 2JFZA 1VE6A 5CLIA 1XA3A 5JC1A 3A9WA 2X19A 3A6LA 4AYTA 2YHBA 3UN1A 4FFPA 3VX4A 2I1QA 3DFMA 5A5FA 1ORDA 2H92A 3BF8A 4FWTA 3KZCA 4QQFA 3EXFB 3FZQA 1J2EA 1T2CA 3L6BA 2UV8A 2E7ZA 4UZEA 5HIKA 5FBLB 5HFAA 2DQSA 4L57A 1OH7A 1SOVA 2YNMC 3NIFB 4FEGA 4PG6A 2V7UA 3ZI0A 1SCUB 2CCKA 2QK4A 1CHDA 4I6EA 5BR8B 1FB5A 4IDAA 5ALKA 3KLMX 1Z0JA 3R7WB 1XQWA 3UPUA 2G1UA 2JRLA 1W5SA 1H9CA 1YR7A 4OCZA 4IUBS 4D46A 5J2UF 3TZHA 2A0FA