1R0ZA

Phosphorylated cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
280
structure length
271
Chain Sequence
b'TGIIMENVTAFWEEGFGELLEKVQKHSDENNVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRILTETLRRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 86
structure length 271
sequence length 280
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r0zA00
1W0JD 5HR5A 5FBWB 4B44A 1VKJA 2GVDC 2XZOA 2BM1A 1OHHA 2ZQ5A 4DLSA 2C04A 2CK3D 4G5GA 5EE3A 3U3MA 4DLTA 1IXZA 1FP7A 3LW7A 1OKKA 5TARA 3TW8B 1QHSA 4KHZA 2IEYA 2VHTA 4ZPXA 2AK2A 2R9VA 3TR0A 2A3RA 1ZNXA 5DYIA 3ZVMA 1TQ6A 1OB2A 4RFSB 3U6BA 3CIOA 3GLHB 2J7PD 4QJ4A 4TTRA 2GVZC 1DAFA 2AXNA 2ECKA 2JJ8A 2ZI7A 3CF0A 3ZZUA 2BHRA 2J0UA 2NZ8A 1Z6AA 1SXJC 3THWB 1IONA 1KO5A 1YZTA 5FTMA 2Z83A 1OB5A 5C46F 4C0BA 4LY6A 4GT1A 1E2IA 1II8B 1E0JA 1Y3AA 2CE2X 1HY3A 1W48A 1SULA 1TU4A 2ATVA 2VA8A 3RYTC 2JJ1A 4MKHA 3VR1A 2P67A 1SGWA 2XAUA 1ZUIA 3IIMA 1E2MA 1JNYA 1TADA 1VCOA 4NU0A 1RVDA 2H16A 5J4VA 2A7QA 4X8HA 2FSHA 4MKIA 4S35A 1RJ9B 3WRYC 4C2UA 2GZHA 1EFHA 1VCMA 3KQKA 3IEUA 4UNQA 3HWSA 1MH1A 4TL6A 2XSZD 3OESA 1R10A 3RS5A 4B3XA 1X1RA 4RCYA 1WQ1R 4M0LA 4XJXA 1IJFA 3Q85A 2FEOA 3RDPA 1GNRA 2GRJA 3CNNA 5AWFC 1T6NA 1ZD9A 3RABA 4V0LA 4MA4A 1G1MA 2J87A 3DHWC 5EXSA 5E3HA 4LV8B 3VR3A 4LV6A 3C14C 4YC7A 5HCIA 1E4VA 1XEFA 2V7QA 3AKCA 3K53A 3QPVA 1F60A 3PIRA 1T0JB 3AKEA 5DI3B 1OYYA 2BBSA 4B2LA 4DEXA 4A8JB 3U3JA 4NPHA 2DFLA 5DLQC 2CVFA 4PZZA 1BO6A 1G6OA 3FMFA 5AJVB 4JLKA 3WBJA 1NRJB 1AM4D 1W4AA 3U2QA 4ERNA 2JASA 2PZEA 4Q00A 2YNMA 5J5CA 1EESA 2H92A 4LJ9A 4LZZA 4O2LA 4ZIRA 5E4FA 2B6HA 2GEDA 4ZDWA 4V0ME 3CR8A 5GJWC 4RZ2A 2KBFA 4K46A 3TH5A 3EPKA 3NC1C 2R6CA 4JVSB 1Z06A 2CHVA 3CONA 3SYKA 3UG6A 2XOKD 2OZEA 2OAQ1 4DLZA 5KNBA 1G20E 2QBYA 5B30A 4LHZA 3AP2A 3DKPA 5D3MA 4WA7A 2D3WA 3VTKA 1OXVA 2J9RA 5AJWA 5HPYB 4XD7D 2ASEA 1ZINA 2A78A 3IQWA 3NVAA 1YR7A 1RE0A 1NBMA 1FL9A 1N5KA 2QP9X 1P7CA 3BC1A 3Q7QA 3ADBA 4WZAE 1WRBA 5JJIA 1TPZA 4MYUA 4IRUB 2C98A 3EZ9A 2ZSEA 2IYVA 3NH9A 4HLDA 4LYAA 4PO1A 4QL3A 4W7SA 1AGPA 4B3FX 2GEUA 2PH1A 2ZVQX 3T15A 1Y63A 3MWJA 2DHRA 1FNNA 4TYYA 3R9IA 4LHWA 4DLVA 2BBWA 4JZKA 1Z8FA 1E2LA 2CJWB 1IY0A 2FE4A 3H0KA 4US2R 3M4YA 4KFTA 4LC1A 4LCBA 2FZLA 5DN6D 4KFRA 4Q19A 4MRPA 3C5CA 4TSFD 1CJUC 5JI2E 5EUMA 2RGEA 3SHWA 2IS2A 3B1YA 5JLJA 121PA 1NKSA 2F6RA 3NHBA 4M53A 3X1ZA 4LJ7A 4QG7A 4NYIQ 5L8VA 1HUQA 3PJRA 1Q44A 3MWLA 3ZVRA 1NIPA 2ZANA 3TW4A 4K81B 4GMXA 1W0JA 5A5GA 2Q0HA 2C96A 3LV8A 2SHKA 3NBXX 1ETUA 3Q7PA 3AVPA 5EE5B 3W5JA 2CK3A 1M7HA 3B8HA 3AVQA 3JVVA 1XEWY 2EQBA 2V3CC 1EX7A 1YQTA 5IHPA 4MKGA 3T06B 4CEJA 4KITB 4RD1A 2R44A 1DEKA 2JEOA 4CEHA 4CT5A 2NZJA 1KJWA 5JWHA 1AZSC 2F9MA 4MRRA 2MMCA 5LB4A 3UWKA 4MDEA 4IDNA 4G5QA 1UF9A 3CPEA 1J8MF 3GQBA 4PPGA 2LKDA 1G3MA 4DSNA 1YZUA 3BGWA 1JQJC 1PLKA 4GPTA 2HLDA 4PC3A 1LF5A 1NVXQ 1UM8A 2V6JA 2AKAB 1N6PA 2ERXA 2QL6A 3LXRA 2ZR0A 1G41A 1HH4A 1NVVR 4V0KA 2DY1A 2W0SA 4DCUA 5FL7D 3HR8A 5KDOA 5K8LA 1J70A 3SFZA 3TKLA 3TUJC 5JEEA 1U0LA 2X2EA 2BBOA 4XVUA 4KLZA 3TVTA 2PT5A 1K5DA 1TX4B 1W4CA 3G0HA 3K9LA 1R6BX 5AUOB 2BBTA 3CZPA 3ONWA 2E1RA 2EW1A 4YDSA 3NWJA 4BPBA 4C0AC 1KHTA 4M9SA 1WXQA 1U2RA 4TZ0A 2O8EA 2ZS8A 4DUGA 2RGGA 2KB0A 4LPSA 4NCJA 4IOJA 3VX4A 3K09A 4AKIA 4M22A 1AZTA 4RD4A 1VCIA 3KDSE 1D2EA 1YZGA 4QBHA 1COWA 2QT0A 1ODFA 1LS6A 2ZETA 1YZKA 1KK2A 4ARZA 2VQSA 5JHHB 4LDJA 4M2LA 4GL2A 1TF5A 5FUXA 4AG6A 3P32A 2P5TB 2W6JD 4B74A 4Q21A 1KMQA 1CTQA 5CDFA 4A36A 1N6IA 4W5WA 1W5SA 3W9YA 3K0SA 4S2EA 2IWRA 1Q21A 1JI0A 1MO6A 2WWIA 3IUYA 4H1VA 3QKUA 3TAUA 2DBYA 1NLZA 2PL3A 4PPNA 5DISB 2A9KA 3SZRA 3L0PA 4MRNA 2BCJQ 3EARA 5FH9A 1QDEA 1R0ZA 2G0TA 4C0QC 1E2KA 4E09A 3EPLA 5CJPA 4F93B 3RSLA 5KSZA 1GG2A 4LSGA 1NF3A 5JZVA 1XP8A 4DDWA 2QENA 2OSBA 1SVOA 3QXJA 1E3MA 4TQ9A 1U9IC 4Q9JA 2FFBA 5F3WB 3B7GA 1P4SA 1IXSB 2O52A 3AVWA 1DS6A 2WIBA 2BCGY 3TE6A 4TL9A 4URVR 2W2TA 2BKEA 3NTUA 3TGPA 3THXB 2XOKA 1GM5A 4PAOA 1E0SA 3BJIC 2WPDD 4D2IA 2UKDA 1DAIA 4NL4H 4ESHA 5GADl 1D6JA 5LD2B 2IK8A 2H18A 3AB3A 2Y8EA 2RKOA 3J81k 1I2MA 1T8TA 4XD7A 721PA 5C4GB 3K0AA 2HF9A 4Q1EA 3A1TA 1DAEA 3LH5A 2VSFA 1UKEA 5C4MA 4TL8A 3RS7A 5FBQB 1N6NA 2FSFA 2J0QA 2PLFA 4A0HA 2F1IA 4NH0A 5HE9A 3A37A 3RS2A 4C4PA 3QI2A 5H68A 1WF3A 2XNSA 3A1WA 3K09C 4BFTA 2QROA 2VYFA 3TK1A 3OIYA 4OKSA 3O8CA 3R9XA 3R9WA 1GKYA 4JT4A 3ZD7A 4TT3A 3AKYA 3GEHA 4TSFA 4PPQA 1SQ5A 2ZI5A 4JLDA 1IAQA 2CDNA 3A4LA 2F1JA 2FEMA 1ZIOA 4HLQB 5CYPA 2V54A 3A8TA 1L7VC 2QI9C 4GZMA 1CJKC 3CH4B 4IW3B 2IHYA 3T1OA 4TLAA 2A2ZA 5FOVA 1L4UA 5J47A 2BIFA 4HB2A 5F2EA 4XIGS 1KKLA 1QHHA 3Q72A 3MSXA 2GXAA 2A30A 1HE1C 3DMDA 1SXJE 1T5IA 2F1HA 4Q4AA 5GJVC 4I4LA 3KKOA 3MJRA 3T5GA 3E1SA 3V4FA 2QORA 5FTKA 2VPPA 1KI4A 1KY3A 4L4UA 4Q7MB 2GCOA 2QQEA 5E7MA 2FX3A 2OAP1 1ZD8A 5DYGA 6Q21A 5DHFA 5KSYA 2GILA 1KI1A 2I1QA 2ZRPA 3OEEA 2VP9A 5DHAA 1C4OA 3WMEA 5FTLA 1U94A 2ZI6A 4RCZA 3W8RA 4C0KA 2PEZA 2ZI9A 1T8UA 1OFUX 3HJNA 3K0FA 2IS1A 1VCNA 3RRZA 3SQWA 2ZRMA 4JT2A 3C8UA 3EC1A 1H65A 1ZC4A 1NN5A 3K0CA 4HZUA 4IOLA 1AGRA 1E32A 2IYUA 2OESA 3HU1A 5C2JB 1BMFA 2VTKA 2OV2A 4A0RA 3VNVA 2QPOA 4JLAA 3TUIC 3E2IA 3KB1A 3KJIA 3NEYA 5FL7A 1A1VA 1UBEA 2OO7A 5CIQA 4A8JC 3MD0A 2OT3B 5G3ZA 1N25A 3LBNA 3QE0A 3ZZ0A 1FFHA 4BGDA 2NO0A 1Q1BA 2OLKA 3OE7A 2IYXA 1Z6XA 4LI0A 2IUUA 2ORVA 1V5WA 5EP4A 1WBDA 3CH5A 2QTHA 1YR8A 5TDHA 5FTJA 1LFDB 2QUZA 3QEJA 5DH9A 4H1UA 3U6KA 1KOFA 2Q3MA 2UVQA 2J7KA 3V00A 1P9NA 4U5XA 4ZDKA 1KO8A 4PFSA 2CVHA 4YDHB 2Q3HA 4L5BA 2OFXA 2ZJZA 4UXIA 2PJZA 2Q9AA 2WJGA 4FMDB 3RRMA 2O8BA 1OJLA 2ONJA 1VG1A 1P2VA 3OF5A 1E2FA 4LOAA 3LWNA 5DNYB 4OHYA 3AF3A 1E1RA 2CCKA 2ZJBA 1Z6GA 4MUAA 4ILEA 1SZPA 2YOHA 2ZRAA 4W5JA 5AUQA 4Q4JB 3U61B 3WP0A 3RRYA 1MABA 5JBQA 5JJLA 2CCJA 3W6NA 1OT3A 1KIMA 2B8WA 5FPYA 3H2YA 2HT6A 2JCSA 3KJEA 3BERA 2CNWD 4BRWA 1E1QD 2B92A 2PX0A 4D0GA 2JLWA 2W83A 3MAAC 1ZNYA 3K0CC 2GXSA 2O0JA 2Z4SA 5FR1A 3W5IA 4DJTA 1JR6A 1OKKD 4P31A 1TQ2A 2HDNB 4BLQA 3PEYA 2QG6A 2IW3A 4YMSA 1CJTC 1GNQA 3KJGA 4QC2A 3T5DA 1K6MA 2ZJYA 4JLMA 1K5GA 4KVGA 3GLGA 2WPDA 2JLRA 3CB4A 3THOA 3PENA 4Q9KA 2ZSDA 1LB1B 1U8YA 1P6XA 3CF2A 4TYNA 1J7KA 1DG1G 1Q3HA 2C2HA 4ZCLA 3WMFA 1WA5A 4A82A 1CULC 1FUUA 4KJZA 4PSKA 2VP2A 4ZCIA 2F43A 3VX3A 4QM7A 3A6PC 4A1FA 4KBFA 2NPIA 5AJZA 1DAHA 5GJCA 4U00A 4JMPA 4AYXA 3CX7A 1DBSA 1XTRA 3TSWA 1A2KC 5J4YA 4JYBA 3NKVA 2RMKA 2BVNA 2VBCA 2W0MA 1XEXB 2PLRA 3MWYW 2B21A 2JJ1D 4NYMR 3SBDA 1DAMA 1OFTA 1ZC3A 4TLBA 5E7IA 4DSOA 3PUZA 1UKYA 2X1VA 1XPRA 4NMMA 5KDDA 4QRHA 4BZPA 4P4SA 1Z0IA 3FKSD 3IPXA 4MUBA 4OI0A 1N0VC 3TLXA 1CRPA 2R8RA 1ANKA 2E9SA 2QGZA 1NIJA 1R7RA 1NBME 3KXKA 1NY5A 1BS1A 5TB5A 5KPDA 4QXAA 3GLFA 2IYSA 2ERYA 2FPMA 4HI0E 4M9XA 2OCBA 1YRAA 3IO3A 1OXUA 3BH7A 2GCNA 3CNLA 1E99A 3KKQA 3MUFA 2ZJ8A 1ZYUA 1U8ZA 2EYUA 4D25A 1PLLA 3DL0A 4D80A 4HAVA 4IXMA 3IGFA 4NE2A 3IO5A 4JLPA 1SKYE 1OIWA 2GF9A 2GJKA 3SU8A 1LV7A 1BH2A 3AVTA 2WWYA 2XZLA 4TMTA 1P5ZB 1R8SA 3U5ZB 4XTCS 1AS0A 4EPWA 2QAJA 4TQAA 4US1R 1ZP6A 2NO9A 1L4YA 3ZQ6A 8OHMA 3QSYA 1O87A 2E87A 1I4LD 2P3SA 3B1VA 2EWWA 4D82A 3CZQA 5E95A 4U7DA 4P0TA 3NG1A 1X86B 5FI1B 2HYDA 5EE1A 1M8PA 2ZUDA 3FB4A 5L3QA 2OM2A 1KI3A 2P6NA 2XX3A 4R71A 1X8KA 1XD9A 2G9NA 1NN1A 5JEDA 1TEXA 3NEJA 4V0NA 1FW6A 3UKDA 4GBMA 2QMOA 4B75A 2ZI4A 1CRQA 5F9HA 3M6AA 5CB8A 5EE9A 5IT5A 5F9FA 2YYZA 1J8YF 4JLBA 4HLUC 2YJTD 4PC2A 1E9AA 1Z08A 3C4JA 2QPAA 1ZM9A 2FN4A 3AEZA 2HV8A 2ZSAA 4ACAA 5BWMA 1S3GA 3GJ6A 4PHHA 2B8TA 2P6RA 4M21A 1JR3A 3PITA 5FI0B 2QEQA 3GEEA 3EASA 1GRQA 3KFVA 4CEJB 2WBLC 4AIIA 4CW7A 3ZD6A 2IA5A 4LBZA 4GZLA 1HQYE 1N6OA 4ZKDA 1GKUB 1IBRA 5FUWA 4EJSA 4CEHB 4OI4A 2DCUA 4C7OB 4DLWA 4HDOB 1NG1A 2ZVPX 3SS8A 1Q1QA 4ESVA 3FWYA 4TMXA 4WZ6A 2MSDB 1FPMA 3VFDA 4R2HA 3LAWA 1A82A 1SKQA 1Z07A 3VU9A 4XVRA 1IN4A 2A5DA 521PA 1BYUA 3E70C 4JBYA 5F98A 2WJHA 1QHXA 1E9FA 1G18A 2QU8A 4G0NA 4JVLA 4W9MC 2RHDA 1PUJA 3QXSA 1ZM7A 3LA6A 3FFAA 2EFHB 3GJ0A 2H17A 3EIQA 4PSVA 1G8FA 2YHSA 5DGXA 1JPNA 1IOZA 2AR7A 2NMVA 4XVQA 3GJ7A 1W44A 4MQBA 3EZFA 2Z5FA 4QBGB 4B3DA 2CNWA 3MCAA 1E1QA 3A36A 3A1SA 3PCRB 3EIHA 4IJMA 4CIDA 1GWNA 2CMKA 3LW8A 1EWQA 2O8EB 2Q9BA 4CGZA 3VR5A 2H1LA 4CYMA 1GL6A 3WP1B 221PA 5JECA 2FV8A 2VO1A 4ARZB 2CLSA 2JAQA 1J90A 3GLHE 4KSCA 1SVWA 4LHYA 3EXAA 4RKEA 1Q1EA 3PUYA 3PUXA 3TSOA 1UBCA 5EQTA 3P1JA 4EFNA 2XNDD 2QAGA 4HB4A 1CEEA 4WZBE 4WIAA 3QENA 2IEZA 4MDFA 2WJJA 1EFTA 2HLDD 5GVRA 1GIAA 1N5IA 1XTKA 2WSSA 2GZDA 1XNJA 1YKSA 3BFVA 3LDAA 4P4TA 4M1KA 2Z4RA 2AK3A 5KPJA 4L9SA 4YONB 2YWEA 3EZ6A 3ZH9B 2GETA 3GD7A 1IJEA 2IXFA 4B43A 2GCPA 4Q4JA 1T4GA 2IF2A 4TWZA 4JIMA 2UZIR 1OH7A 5P21A 4HAXA 2BKUA 3H4MA 1Q0UA 3BB1A 1FUKA 1TU3A 3HPRA 1S96A 4PX9A 1W36B 1G8HA 1LW7A 3ADDA 2ZYVX 1PUIA 2IYLD 3OAAD 3L0OA 4I1OA 1OH8A 1IQPA 3REFA 4DUGD 1HURA 4LJAA 4MITA 3W3AA 2GEVA 1R0YA 4HAUA 3FKSA 2R62A 5HZKA 3H1TA 4OI2A 1COWD 1C1YA 2JLSA 1CJMA 2OUKA 3GLIA 1U99A 4ZV4A 2EVWX 3QBVA 4LJ5A 3K0AB 4FWIB 2QPTA 2ZJ2A 2WTUA 2REBA 3VHXA 3KX2A 4R7ZA 4J0QA 3EPJA 3TNFA 4GP7A 1HYQA 1R0WA 3KXIA 2GXUA 3QKRA 3ZVLA 5D3QA 5HTKA 3SOPA 1QBKC 3G5UA 3I4LA 3N5CA 4Y0AA 3QG1A 1XD8A 4QHTA 3UPUA 4AWXA 5C1BA 4N1AA 4AC9A 3VR2A 1R0XA 2ANCA 3QY0A 4Q1DA 5AR1A 5B2ZA 3UATA 1VYTA 1XEXA 2GWHA 3CWZA 5SZHB 5JWRA 3GJ5A 3A4NA 2CCGA 4XOIA 1XMSA 4Z8XA 4JJZA 4U02A 2G0NA 2PZFA 1FQJA 4Z1MD 3IIKA 1GAJA 1Z83A 1NVWQ 3AV0B 2QAGC 2BMDA 2ZE6A 3GEIA 1W36D 1O3YA 3I32A 2ZAOA 1U0HC 4NCNA 1KSGA 5KNDA 4TZ6A 4ITRC 5GJBA 3TBKA 4DCTA 1Z47A 2R6DA 1EK0A 3R20A 1GILA 1SHZA 3L8ZA 2IX3A 4V03A 1QHHB 3DVLA 4PZYA 2R6FA 5BN3A 4FD2A 4JLVA 2D62A 2QM7A 1F3OA 5BN4A 4Q4AB 2ANBA 2QP4A 4DVGA 2XGJA 1CKEA 3LBIA 4JSTA 1UDWA 3QXCA 2ORWA 2GCOB 4DCNA 3NBYC 1FP6A 1R5OA 3DO6A 4Q47A 2DR3A 2O5VA 4D0NA 4DCVA 2DYKA 4PTLA 4CEIA 3B82A 2YWHA 3Q9LA 4G5SA 2AKYA 3SFVA 1BKDR 1KY2A 2VP6A 2FFAA 3L8YA 1N6LA 3SJCA 3ZIAD 1XTSA 3K70B 3S1AB 1QZXA 3HYTA 3VHLB 4TL7A 5JMTA 3K0FB 4FI3C 1AKYA 2A5JA 2VEDA 3H86A 4TMWA 4B3CA 3BK7A 1R5NA 2NTYC 2WOJA 3CR7A 4TT3D 4JBWA 5EXXA 5FTNA 4DIEA 3C15C 3BOSA 2ZJOA 4HZUB 3VR6A 3ZQJA 1Z63A 2FA9A 5ANRB 1Q20A 1ZD1A 1MRNA 4PR0A 3GJ3A 2WOOA 1Z29A 3X1XA 3CF6R 2WWHA 1C9KA 4C0LA 1AQUA 2Z6VA 4TLDA 3AF1A 4I1VA 5DSZA 1P9RA 2QP3A 4NDZA 3FOZA 1AA9A 1NI3A 1TF7A 2BDTA 4BLOA 2ZAMA 1AQYA 1M34E 2OILA 3RS0A 1KO1A 3R8FA 3HP1A 1OSNA 2OBMA 3UMFA 3QVVA 2Q21A 3DMNA 4I1UA 4OI1A 2ZPTX 3EG5A 3PEUA 3EA5A 4JYCA 3PUWA 4IXNA 4P3YA 4KLNA 3KTAA 3OEED 2P6UA 3EWAA 4E5UA 4LJ6A 4C7OA 4MYTA 4AYWA 3K70D 5EP3A 3ZZTA 3IILA 1D5CA 4NYIR 1HEIA 2O8BB 3X1WA 1E2EA 3BXZA 4LJ8A 4D4LA 4MRSA 2XNDA 1UBGA 3P4YA 5JCZA 3LY5A 1Z5ZA 2P5SA 4DRZA 4TYPA 4WAUA 4JSYA 3P27A 1AKEA 4G5RA 3QQ5A 4E03A 4LX0A 2WM9B 3WYFA 1BMFD 1G8PA 4Q1AA 4DSUA 3UXMA 1KNXA 1W46A 2X2FA 4Q4HA 1ZJ6A 1MABB 5HKKD 1M7GA 1LVGA 3SJBA 1IY2A 2DWPA 1VYVA 4BZXA 2AWNA 2GAAA 5AJYA 2D7DA 2YC4C 4BWYA 4HZIA 4YMTA 3OE7D 4OK6A 3NH6A 4YMWA 1IM2A 4X8LA 3OAAA 1NSTA 4RFVA 3VKHA 2ZS7A 2O8CB 4QHYA 4B6EA 2BM0A 3CX8A 3EZ2A 1II0A 1E2GA 1NVUQ 3BWDD 2HYIC 4Z51A 2OHFA 3GLGB 2QMHA 2ZRIA 5EP2A 1KDPA 2WMOB 3IQXA 3SYNA 3EC2A 621PA 3WNCA 2XB2A 1CF4A 4Q48A 4ZI2A 4RKFA 3SN6A 1RIFA 3DPUA 4PQYA 1QHGA 1G8GA 1I4DD 4HAWA 2F43B 1XXHA 2R6GA 3K9HA 2J3EA 1ZU5A 4UNSA 2XB4A 4WW0A 5KSOA 3MRSA 2ZXUA 4MH0R 1W2HA 4PO8A 2XJ4A 1E1RD 1SVKA 1UPTA 2BMEA 2ZU6A 4DHEA 4BEBA 5KYKA 1YZNA 3IIJA 1CXZA 4O2RA 4RD0A 3SHFA 4FMCF 4NCHA 4D0LB 1XD2A 5L3SA 1G64A 3QOFA 4QKQA 1ZMXA 2QSYA 4Z1MA 2YWFA 3FHOA 4Z54A 5B57C 1LNZA 2QM8A 3U3KA 2C03A 4HUQA 4TYQA 4P4SB 4MYCA 2JIZD 2A5FA 4D6PA 1PZNA 1T3SA 3ADCA 3CNOA 2F3RA 5J40A 1P73A 1D9XA 3GLFB 3FYHA 4QBFA 3K8YA 1LTQA 1G7CA 1KYIA 3PVSA 1U81A 2KWIA 2PEYA 4E07A 2ZRGA 4TTQA 2Q3FA 1UFQA 4G1UC 3FE2A 4PZLA 3RVBA 4GDFA 2WIAA 1KK0A 3D6TB 3AUXA 2XZPA 3DKVA 2G3YA 4JBXA 2ODWA 2WKQA 4DB4A 1X1SA 4N0EA 2ZRKA 4KYIB 3SC3A 3B78A 4LPKA 3QXHA 4DKXA 1G3RA 2BMFA 3GPLA 1LS1A 3LBHA 2GK7A 2CBZA 3UMRA 3ZIAA 2IXGA 3ND8A 1XEWX 2VP5A 2ZRCA 2AN9A 4LHVA 1S1MA 4I1SA 3AUYA 3BH0A 4BRUA 1BOFA 2JLVA 3WXMA 1OYWA 4D4MA 1WCV1 5L3QB 4L9WA 4ZO4A 1CBUA 1XPOA 4FIDA 4B71A 2YOGA 2V55B 3RSOA 1OFIA 2GJ8A 3ASZA 1CR0A 2WWXA 4BZQA 5BN5A 4KAXA 3W6OA 1DTSA 3QF4A 2V9PA 4M9QA 2C9OA 3LLMA 2FU5C 2QRZA 4PANA 1SHKA 1Z2AA 1FOEB 1GNPA 2QMEA 1GITA 3DZ8A 1XCPA 4NTZA 2HCBA 1S2MA 2FMXA 1Z6YA 4URZR 1JEEA 4OHWA 3ASYA 2FFQA 1E6CA 1W36C 4LV5B 2G1JA 3I8XA 4EJSB 3RWMB 2BJWA 2J45A 3D7MA 1U90A 3IDQA 1HV8A 4C2TA 1F5NA 1OW3B 2OCPA 4DSTA 4V0MA 4OQFA 2A5YB 4DT1A 1G8YA 1UKVY 4QGAA 3RHFA 3QPUA 3S1AA 4DC9A 2YKGA 4GOKA 3X1DA 4DIDA 2PX3A 4M1YA 1VG8A 2IC5A 4Q02A 3VU9B 1Q1ZA 2DPXA 4P33A 3TAHA 2RH5A 3CM0A 5TXGA 5KHOC 1U0JA 1RZ3A 3AGQA 4KSBA 4BLPA 3ZLJA 2J46A 3LRPA 1R8QA 4QFMA 2J1LA 2D74A 3T34A 1P75A 5EUQB 3B9PA 4TMKA 2ONKA 1S3SA 3R7WA 1CLUA 3BIFA 4F4CA 3KKMA 4TTPA 1PJRA 2ZROA 4V02A 5HKKA 1A4RA 3PXGA 4QNRA 5G41A 3OHMA 4QGGA 5SZJA 1HE8B 1X8JA 1QVAA 2BMJA 2Q9CA 4HB3A 3KKNA 1N6RA 2G1KA 1CIPA 1G17A 2GESA 2GTPA 1JR3D 2FGJA 1TL7C 3CRVA 1NP6A 1RRGA 4EIWA 4YMUA 2VIIA 2GZAA 3EWSA 4B2PA 4AYTA 1PLJA 2D2EA 4BEJA 3KQUA 2ZREA 1ZW6A 3FMIA 3QKSA 2FH5B 1RFLA 2N46A 4PHGA 5IK2D 2ZUCA 5FPHA 1UDXA 4WXPA 1Z3IX 1P61B 1VPLA 3E5HA 2WAYA 4V0OA 2QAGB 5EXPA 1E9EA 2RGNA 3O8RA 3I72A 2D06A 2GJAA 5K8UA 3EX7C 2PMDA 3VKGA 3CRQA 4M1TA 3PG5A 4DLRA 1ZCAA 1JALA 1IXRC 3FHTA 1E94E 4NCKA 2IYZA 1E9BA 2XITA 3R8CA 3PFIA 5DI9A 3KQNA 3IKJA 5JCPA 2R6AA 4BFVA 1I2DA 4OHZA 4PAMA 2YC2C 3F5FA 1AK2A 3ECCA 3NBZC 3K70C 5CB6A 1KAOA 5UKDA 2ZYWX 1YHNA 1FMJA 4G5OA 5KUTA 2JGNA 2QN6A 2WSMA 3D31A 1MKYA 2FFHA 1UBFA 3RS4A 2GBLA 2IHBA 2ZITA 2JIZA 1W2GA 2ZJ5A 1HT1E 2C77A 1WBBA 1XTIA 4PO9A 3W90A 2ZSBA 3WBKA 2O8CA 3KZ1E 3FHCB 4FCTA 2JDIA 4DDUA 5AJXA 3GLIB 1KDOA 3OIUA 4HEJA 4JS0A 5JRZA 4DWJA 4O25A 1Q12A 4AI6A 1BYIA 4BFXA 2HJGA 4TMVA 4BLSA 1ZM2A 2JLXA 3FGNA 3N2IA 3AP3A 3QKRB 2BEKA 1K8RA 4QNMA 1VECA 2WSSD 4IEEA 1G19A 3RWOA 1QHNA 1NY6A 2W6IA 1XF9A 1XU4A 3B1XA 4RZUA 1F6BA 4BFZA 3Q8XB 1G5RA 4NHOA 1GRRA 4MGZR 1RRPA 1KSJA 3NXSA 3DDCA 1P2TA 1X8LA 1KDTA 4IVRA 4LYJA 1OPXA 4R2IA 1ZUHA 3I61A 4IVPA 3GFOA 4UXHA 1AJEA 4XTRA 4B3GA 4EAQA 4DLXA 2QMUA 1JAHA 1GTVA 1RYFA 4IOMA 4M1OA 3CPJB 2FGKA 1OXXK 3QXXA 3D8BA 1MO5A 1XB2A 1UEIA 4LJ4A 3SI7A 1US8A 1MOZA 4UQOA 2ZRDA 3CX6A 2WZQA 2W2VA 3T35A 1T9HA 5H1YA 2V4ZA 2L0XA 1NJFA 2I3BA 1TF2A 1E0KA 5TVKA 2JLQA 3AVVA 1W5TA 1QF9A 2EWVA 2AXPA 2OLJA 1KI8A 1FMLA 2P65A 4B35A 4CEIB 2GBLC 4OQMA 4MRVA 4Q01A 4N3NA 2X19A 4GI7A 3DM5A 4NYJQ 4ASUD 1W7AA 4OHVA 1XRJA 1YJ5A 1KAGA 4OQXA 2EFEB 5EZ5A 5SZIA 3VKWA 1H8HD 1KI6A 3QKTA 2F55A 4Q4LA 1FTNA 2AD1A 3NHAA 1NN0A 1Z28A 4Q03A 4HATA 5K8IA 1N6KA 1NLYA 2JLZA 4FN5A 3PEWA 3CUEF 1S1CA 2OG2A 3UIEA 3LQQA 1XJCA 2DWOA 2BJVA 3TJZA 3TUZC 4Q5IA 3P20A 2X8AA 3ND9A 4A0FA 5J4LA 4KV9A 1VMAA 1N6HA 1TQ4A 3DM9B 3HYRA 3THYA 4IDPA 4PC7A 3EA0A 3SEAA 3SR0A 2I4IA 3GFTA 4CZ2A 1WDTA 2ZI3A 1Z0FA 1F2TA 3ZVNA 1XZPA 1ZUNB 4HDCA 5HCNA 4LC0A 4WVFA 1VG0B 2B7CA 4A6XA 2FJUA 2C95A 3TVDA 3KQLA 2HEIA 3KTAB 4OJQA 5FOWA 3SDZA 5IF9A 4A0GA 2QTFA 5G40A 2HF8A 2H5EA 5IK2A 4M8NE 4NZYA 4BE7B 5KU1A 3BBPA 3UANA 5BW8A 3L0IB 1EG7A 1BIFA 2IT1A 1R5BA 4B32A 3WNBA 4LBWA 4BLTA 2JLUA 4L15A 5K8TA 2DB3A 4KXFB 1SXJA 2XXAA 4Q7JB 3M0EA 1IN8A 4RD3A 5CLQA 4Q4HB 2QSZA 1Z0AA 1DVRA 4LRWA 2QQ0A 1YR6A 2VLIA 3LX8A 4OBEA 1YR9A 5CK5A 2ZSFA 2WWGA 3RNLA 2ZRBA 2IS6A 3RLFA 4KCGA 2OXCA 2D7CA 1ESNA 2CLCX 4LBYA 4PHTA 2QBYB 3NDBB 3AVOA 3FMOB 2BC9A 3PEVA 4HB0A 4X8OA 5CM9C 4JJKA 1G3IA 4M4SA 2WJVA 4BLRA 2GAOA 1YVDA 1W1WA 1LF0A 2XTNA 1XTQA 3GJ8A 4A92A 4IDQA 1B23P 2VHJA 1JEDA 1EWRA 5GVSA 1W4RA 3LNCA 3GJ4A 4DBLC 4DDVA 1R4AA 1XWIA 5CDFE 1ONBA 3JZMA 1P9WA 2DFTA 1E4YA 4URXR 2D2FA 2C8VA 2NIPA 1XXHB 4JL8A 4F91B 3MMPA 3T61A 3OIWA 2O8DA 1HA3A 3ADKA 5JSZA 5DE3A 4NONA 2OCAA 3AKDA 4N0DA 2V1UA 2IS4A 2QE7D 3UK6A 1UKZA 4EQ6B 2O0KA 5A0FA 3B1ZA 4KODA 3UMSA 4HAYA 3B60A 1T3HA 3T1QA 4EJSC 3ZS9A 1GUAA 4WXRA 1XD2B 3GP8A 1QG4A 5L3SB 4CF7A 1Q22A 4DLUA 2IYYA 3IPYA 3RANA 4DXAA 1LY1A 4I81A 2ZE5A 1E0AA 2WAXA 3BH6A 1UEJA 1DO2A 2DWQA 1P2UA 3IBYA 2Z0MA 4B34A 4HUQB 1OIVA 1MV5A 1ZCBA 3V4RA 3AVXA 1DG3A 2RGCA 3BB4A 2IYRA 4TYWA 4QGFA 3SE0A 1Q57A 2H7VA 2IYTA 2C9CA 2RB4A 3ZJYA 5H8WA 1DOAA 2NG1A 3ICQB 1KTVA 3T1VA 5CJ2A 3U7EB 4ZDIA 1N2CE 2WJIA 5BYKA 3TQCA 4PSAA 3FMPB 5FOUA 3DZDA 1G4AE 3OZXA 1XCMA 1JQLB 1DAGA 1I4TD 2QA5A 3ETLA 5FPTA 1NG9A 2JATA 2RHMA 3EPHA 4MYHA 1XJQA 1TMKA 3FTQA 4KFSA 1QHIA 3B6EA 1G3QA 2ZRHA 4FMDF 3KUDA 3BD9A 2B7BA 5FOTA 1GP2A 4ASUA 5L3RA 4RVCA 2CXXA 3W6PA 4OHXA 1M6NA 1NNEA 1Z0KA 3BAFA 4B2IA 2C99A 4PC6A 1H8HA 1GZSA 5BYJA 1L2TA 2PBRA 4XSGA 1FNMA 3U44B 3VR4A 1KI7A 2ODNA 3OFNA 3BRWD 2CE7A 2VRWA 4MKFA 5JS8A 1QRAA 3CLVA 3QF4B 3F8TA 1IHUA 3RAPR 5TMPA 2DFKB 2ZTSA 4XWAA 1EFRD 4Q66C 3FDIA 2NGRA 1N0WA 1P2SA 3I8SA 1JB1A 4EFLA 5HE8A 4HDQB 4TQUS 4UNPA 3LO5A 2G83A 1H8ED 2WJYA 3U7FB 4AK9A 3SYLA 2KJQA 4K8OA 2R65A 5B64A 821PA 3P4XA 3I92A 2OFWA 2VSOA 4EPRA 5SZKB 1D2MA 2PZGA 1VIYA 3VMFA 5BXQC 4QGHA 4O3MA 2JJ2D 1CR2A 4QBIA 1E9DA 2GF0A 1EFCA 4JVNA 4DT1B 4AKHA 3NC0C 4EKDA 1FX0A 4US0R 4F4JA 3PQCA 2VSXA 2H8KA 5FBLB 4PAQA 2AWOA 3AQ4A 3IHWA 2FSGA 4DB2A 3RS3A 4LBVA 2I1VB 1OXSC 3RC3A 4YXWD 2A5GA 3I62A 4EPVA 5IDVA 3LVRE 2VP4A 2QZ4A 5FR2A 4KI0A 1ESMA 1NLFA 4TMZA 2QRNA 4A2WA 1X6VA 3R7WB 2HJVA 1F48A 1SVMA 4YMVA 1RPZA 1N0UA 3K1JA 3B85A 5DO9A 4BQSA 4M9ZA 3CBQA 3NIBA 2TMKA 5JRJA 1N5JA 4C0JA 1E9CA 3CRMA 3BE4A 4BFYA 4HSEA 4F92B 4IFBA 2DFNA 4GOJA 5J4HA 3Q3JB 5AUPB 2IYQA 2GK6A 3AF0A 1P62B 5DIFA 3ZYCA 4ABYA 3QKSB 4IDHA 1FZQA 1SVSA 3GFPA 2KE5A 2HXSA 1WB9A 1M74A 2FNAA 1OXTA 1OIXA 4KU4A 2W58A 4B6FA 2G77B 1P72A 4KBGA 1G4UR 5CLLA 3I3SR 4JLNA 3T12A 3KQHA 1TTTA 4LUCA 4RJLA 3SBEA 2O8FA 1S9HA 4Q9HA 4IVQA 3O8BA 2J5XA 2WICA 4JL6A 3LQRA 3O47A 2J0VA 4AG5A 2P2LA 3FFBA 1GKIA 1NVVQ 5FBRB 3QBTA 3BORA 1ZU4A 1GDDA 2QE7A 1MR3F 3MJHA 2PCLA 2MMGA 1E9RA 4Q7LA 3QNUA 5KSPA 1MO4A 5CM8B 2GNOA 3AF4A 2ODBA 2VL7A 2JLYA 1KMHB 1E98A 5KOYA 3CW2A 3HU3A 4DDTA 2REXB 4LHXA 2ZE7A 3RC8A 3O8DA 4IFEA 1OH5A 1TUEA 5JI3E 4CT4B 4EPXA 4D26A 3IHLA 1U9IA 2J7PA 1ZVQA 1G7TA 2ZYTX 1KZ7B 3HR7A 1XCGB 3L0SA 4LJYA 4M1MA 3M1IA 5LB2A 1WMSA 1ZRHA 2IXEA 2KI5A 2R2AA 2VHQA 3QVUA 3TR5A 3GLGE 4IOKA 1MT0A 3MWKA 4HLCA 4UJ3A 4XWKA 1QVRA 2AFHE 2FSIA 2CEAA 1IN6A 3B5JA 1KJZA 4DCSA 1PVOA 1DAKA 3BFXA 1E2JA 1WP9A 4Y0VA 4W5HA 3DOFA 3WY9A 421PA 3WRXC 4DLYA 3A1VA 1KSHA 2BV3A 1AS3A 1OF1A 3CRW1 1NL3A 4KO8A 5FBVB 4XH9B 4ZDJA 1DO0A 1EFUA 5JWOA 3CO5A 4LYFA 2WHXA 2IUTA 2VP0A 2YINC 1QG2A 5FPKA 2FG5A 1FQKA 2IBMA 2XSZA 3LLUA 1D9ZA 4EQ6A 4C9BA 1NJGA 4C30A 1T91A 1DE0A 3DOEA 1JECA 1KDRA 3MGCA 4GFDA 1G9XA 1Z6TA 4URWR 1A5TA 3FKQA 3P26A 4BUJA 4AY2A 4RFSA 2IF0A 3GLHA 3SNHA 5LPNA 1KK3A 4NBSA 5JS7A 1XBTA 4TLCA 4FXPA 2FPLA 3GLFE 3AF2A 4HYYA 2WKRA 4Z8YA 5EXTA 3THWA 4O0MA 3SJAA 1ZIPA 1EFRA 1II9A 2GXQA 2JDID 2RGXA 1US8B 4URYR 3QF7A 3U7GA 2ZE8A 4EPYA 1KNQA 1KGDA 2PMKA 1II8A 1E2HA 2WMNB 3WHKA 5HZHA 3LVQE 3MG9A 2W2XA 1H8EA 2QT1A 3BFKA 3KKPA 2D4HA 3I73A 2Q6TA 5FOSA 3I1FA 2ZEJA 3I5XA 1JPJA 2F7SA 3GMTA 2NO6A 4R98A 5KDLA 1RJ9A 1E96A 2W6ID 3BS4A 1E2NA 1JJVA 5LDDC 2RGAA 3QPWA 2JJ2A 4GP6A 1CP2A 2LCFA 2XEXA 3A1UA 3FVQA 2ZRNA 3QEOA 1RRCA 1VG9B 1XMIA 2RGDA 1Z22A 3LFUA 1HTWA 3VNUA 3SJZA 1KI6B 1G5TA 1ZAKA 2GA8A 5FUYA 2EFGA 2IWHA 2AFIE 1NKTA 5TY0A 1JJ7A 1RW4A 1ELOA 3EIEA 3REGA 4EDHA 4JL5A 4Q7KA 1CU1A 2G88A 5FPSA 4TLEA 2P0EA 3WMGA 4BFUA 4OQLA 4ON9A 1HQCA 1TEVA 4YXWA 2VHCA 3U44A 5KTYA 4RD2A 1JAIA 4UJ5A 4AURA 2IUSA 1YZQA 2H57A 1KKMA 2VHUA 3W3ZB 4A6PA 1W0KD 3A58B 5DI3A 2O0HA 4QOSA 4A2PA 2F1RA 4M1SA 4XWOA 4D81A 2MSCB 3C7KA 4A8JA 3THYB 3OEHD 1GVNB 1NMYA 2F3TA 4WOPA 1JR3E 3HPQA 4QJ5A 5M04A 1RKBA 2OE2A 4AKGA 5EZ6B 2EU8A 1MO3A 2CL7X 1S8FA 1KZGB 3PV0A 1F2TB 1F2UB 2J41A 4Q1FA 4NP6A 4JLOA 1JBKA 2FWRA 3F0TA 1AIPA 1R2QA 5DN6A 4JKYA 2J59A 2IL1A 2LKCA 4HUTA 2PCJA 1E2QA 1UADA 2XJ9A 4LWZA 4D4KA 4B3BA 1Z2CA 4DZZA 2BWJA 4LK2A 4B33A 4C3ZA 1M7BA 2CHQA 2ZM5A 3MLEA 1SVIA 3TIFA 3DEFA 1S9DA 2FDCA 3GCGA 4Q1CA 4JKIA 1J2JA 2NO7A 5G3YA 1SXJB 5BQ5A 1VDZA 1VYUA 2XXAB 1VTKA 1CS4C 1N3BA 4IEIA 5G53C 4PQRA 2G6BA 3VAAA 5EE0A 2OBLA 3K0EA 1OE0A 4CRWB 4ZCMA 2OXRA 2C5LA 3A4MA 2GKSA 3UWOA 1U8AA 4PC1A 4A9AA 1KSFX 1CR4A 4A15A 1E79D 3PR1A 1DELA 4IDOA 2FOLA 3TSZA 4KYUA 2CJWA 1Z0JA 1ZNWA 3D3QA 3CWQA 3NBFA 1DARA 3C41J 2ODEA 4GRAA 4KVAA 2WWFA 3CPHA 1XFAA 2FZ4A 2V8OA 4NKRA 3U4QB 1NN3A 1KO4A 3FPAA 2REOA 4JLJA 1U98A 1T0HB 4ACBA 3AH8A 1G5PA 3KJHA 1IN7A 3IBGA 1GSIA 3I5YA 3K9GA 1ZBDA 3EZ7A 3B13B 3H84A 1GRNA 1M2OB 4OYHA 2O8DB 4A4DA 5JJKA 1DADA 2VH5R 4AKEA 2NO1A 4GNKA 2OEPA 4BFSA 5JSZB 4NCIA 3QG5A 1MRSA 2ZR9A 3AVUA 2HT1A 1SXJD 2RAPA 2ZS9A 3TMKA 1GL9B 5AUNB 1D2NA 1G291 4URUR 4B73A 3CKLA 4FCWA 1CR1A 2VF8A 1TNDA 1XTJA 1KMHA 4M1WA 1OFHA 5A4JA 3U3OA 3K9NA 2YOFA 3C16C 2YWGA 3QIAA 4B47A 2QTVB 2W6JA 2EFDB 2GJSA 1XMVA 1B0UA 1OV4A 1W47A 2AD5A 1OLOA 2J0UB 1E9SA 3KL4A 2AX4A 2LWIA 2KSQA 4EFMA 3NDPA 4FW9A 5IRCD 2ZIAA 3MFYA 3GLIE 1XDBA 3PUVA 2QY9A 1EGAA 3KUCA 3SQXA 3CRRA 3EW9A 5E7JA 1S0UA 2HXYA 5L3VA 2WWWA 3B1WA 3AVYA 4QHSA 3N70A 4MGKR 1EXMA 4Q9IA 2PT7A 1HT2E 4L8GA 2OCYC 2ZR7A 1OHHD 1P60A 2ZU0C 1TAGA 4MGIR 4QJ3A 4FCVA 4FINA 5JHGB 1E69A 2YVUA 4I99A 3WHLA 4YQFA 2X77A 4PQFA 1SVLA 4AD8A 3LD9A 1J99A 2NPFA 4NYMQ 4A2QA 4F4IA 2V1XA 4IKEA 2OFOA 2BEJA 2ZUBA 5CIWA 3B2EA 3AP1A 2ZRJA 4P32A 5CITA 2WVJA 4CVNA 2WKPA 3AGPA 5FL3A 4Q18A 1AS2A 1IY1A 1Q3TA 3WNDA 1VHLA 2RGNC 2XTZA 4UXJA 2PJRA 1YE8A 4EPTA 5KO2A 5B58C 2QNRA 4PXAA 1TUIA 3QJYA 1NSFA 1ZM3A 3KXLA 2HCJB 2AHOA 3L82B 5AK0A 1W0KA 4HLUA 4G3XA 2N42A 2W00A 5H70A 1ZNZA 3OEHA 4FWTA 5FOXA 1KO7A 1RYHA 1G21E 2UZ3A 1JXMA 1W4BA 4RZ3A 2CL6X 4OL0A 4BFWA 2GJ9A 3W8NA 3T1TA 4ZIRB 1XJ0A 3LX5A 1OH6A 2RCNA 2IYWA 1YRBA 2ATXA 2NOAA 4MGYR 1EX6A 1QHYA 4GMDA 3WYGA 3Q5DA 4IHQA 1XX6A 4LGMA 2AL7A 4POAA 2ZJAA 3JZAA 4DEYA 1Z0DA 2VF7A 4H9GA 3L43A 4Q1BA 1WE2A 1FX0B 1E2PA 2YV5A 1AN0A 4C0SA 4BECA 1E2DA 5FUVA 3TRFA 5JFGA 3ZGXA 5D3MB 3THXA 4OJKA 3WYAA 1T3LA 2RGBA 3U7HB 1V43A 2ZYUX 4GOXA 2ZRLA 1KK1A 2ZRFA 5ELXA 3U60B 1CJVC 1GOTA 3RRNA 4UKDA 3OFND 4B76A 1RC8A 4FMBB 2YZ2A 5KNCA 1L8QA 1T5LA 2V7QD 3F3YA 4Q9LA 4ZI3A 1X3SA 4EUNA 3LXXA 4X8MA 3U3RA 2CL0X 3QUSA 1UJ2A 4E22A 1G7SA 1SKYB 2GDJA 2CLDX 1RRFA 1XPUA 1XMJA 3B9QA 2EFCB 2EYQA 5FFMA 3L2OB 4RD6A 1NMZA 4NYJR 4OK5A 3KFXA 4F7WA 1TQDA 1E79A 1FTSA 1GL7A 1ZM4A 4G01B 5CYOA 3BB3A 1YZLA 3UG7A 4F38A 4TN1A 1F2UA 2C9YA 1XZQA 5TV2A 1UAAA 5LBIA 1JXOA 1A2BA 2F9LA 1GFIA 4ZKEA 1DPFA 2ORIA 1A7JA 3TQFA 4GSYA 2GHIA 2J0SA 4CDGA 3ZDQA 3HU2A 2FPKA 2JA1A 3ICEA 5C18A 1G3UA 2O8FB 1G7RA 1D8TA 3EAQA 4II7A 4B48A 5EJEA 2Z43A 1W49A 4D4JA 4QM6A 1NBMD 4YLGA 3ZS8A 1G6HA 1G16A 1KI2A 4LYHA 3Q5EA 1VIAA 4PHFA 5J4KA 3W34A 5EP1A 2CHGA 4PPFA 1VHTA 4RZXA 1NMXA 3KB2A 4L16A 2XTMA 1S4QA 3X2SA 4BASA 4HAZA 2HUPA 4UNNA 4XSHA 3C5HA 2V6IA 4OK3A 4RSGA 5CK4A 4R9UC 3IEVA 3JVUA 5LD2C 2WV9A 1N5LA 2C78A 3X1YA 1YU9A 3AM1A 2NQ2C 1PV4A 2OBNA 4C0HA 3GJXC 4WBSA 2K5UA 2FF7A 2QGNA 3V9PA 4RY2A 4P4UA 3G82C 3OIVA 4UNRA 3HDTA 2N1BA 4FMCB 3VQTA 1P3JA 4OQNA 1KI9A 1KJYA 3U4QA 2KBEA 4KFUA 2BOVA 1XXHE 1IN5A 2MSEB 1M1YE 3N2EA 4JVMA
chains in the Genus database with same CATH superfamily
3SEZA 2Q45A 1OD6A 4K9KA 4U63A 4YDRA 4F5DA 1PL0A 2PT6A 3NBKA 4B44A 4BP3A 2RJ3A 3UBTA 1TECE 1EZ4A 4ZOLB 3WL8A 4JI5B 4RORA 4DLSA 3RSSA 3V46A 5KX5A 4R6XA 3DOHA 1NAHA 3W1WA 1WZCA 3U3MA 3E0QA 3KJFA 4DLTA 2JFXA 4GDMA 2RK4A 4O0LA 2FP3A 2XBUA 4KX3A 4KHZA 1ZD5A 4RPHA 5J2TF 2FZVA 2H5IA 3C8MA 1GFZA 4OA5A 4F4FA 4ZMRA 2QV0A 5ALQA 4MPPA 1XQVA 4R51A 1KEUA 3HCDA 2WFZA 4HFRA 3QA9A 2XVXA 2G9ZA 5BURA 1Y6RA 4RFSB 3UV6A 4XDHA 1VJDA 2RGRA 2NUPB 2GK4A 1A2OA 3QE2A 4QJ4A 3V7WA 4MWZA 3AILA 1U2DA 5KNDH 4Q0MA 1AMNA 2ZI7A 2JJ8A 2IU3A 2R1UA 5IAKA 9ABPA 4MPRA 3OT1A 3B36A 3B51X 2V7BA 3THWB 1LPAB 3WGTA 1J22A 4EMBA 4YJGB 3ZXYA 4EJMA 3LSYA 4RVDA 1A5BB 2OBFA 1OB5A 4YBRA 1GZ6A 1Y4AE 1ZICA 2P2DA 2WY2D 2CNBA 3QZUA 4DPMA 4U2KA 1II8B 1Y3AA 4BNHA 3AR3A 4X1YB 1OCEA 1W48A 1KHHA 3GU3A 3OZGA 4CDRA 2ATVA 1MTZA 1SWWA 3RYTC 4MKHA 3VR1A 2P67A 1ZUIA 2XWQA 2OUIA 3F9CA 1TADA 1BDIA 1MAWA 1RVDA 2A7QA 5T3UA 4E2ZA 1GRVA 3NXKA 4J1TA 2YFKA 2J9FA 4S35A 2PJDA 5LXTF 5F73A 2BRUA 3WRYC 4C2UA 4UD6A 1VCMA 5FHQA 3K1TA 4XASA 2FWMX 1E3WA 1EX9A 2V97A 1RWNA 4XE5A 5SICE 3UT0A 5KOJB 3TECE 2XSZD 1R10A 4YUXA 1X1RA 1BDJA 2P9EA 3ZGNA 5AVVA 2PQ0A 1IAVA 5KOIA 1GG9A 1GNRA 2XB9A 3T5TA 5DTJA 3S2EA 1IL0A 2GRJA 1O94A 5AWFC 3V2HA 3BMQB 1WD5A 4RL4A 4GYYA 1U28A 2EATA 1G1MA 2VZ0A 3DHWC 4BX8A 2O20A 4J0KA 4O1HA 4XFJA 5E3HA 1KBOA 1BU8A 1XE3A 1LDNA 2Q46A 3NORA 2GAIA 4B46A 2PFKA 2IYNA 1MJGA 1FJGB 2XNHA 3AHJA 3QPVA 4CLDA 1QV9A 3PIRA 5E2AA 1T0JB 2QLFA 2BBSA 3O8LA 3G1WA 4B2LA 3OZUA 1E5LA 1YDEA 3N0XA 1JHXA 1A72A 3BZBA 4NPHA 3WIVA 4KTVE 3CX4A 4PZZA 2BFBB 3PX2A 4MUNA 4B85A 3RREA 1QIIA 1L7MA 1MHTA 1PTKA 1MVNA 3ZIUA 1FFDA 4AJLA 4IV0A 1RI1A 4PG5A 3U2QA 3V7FA 5JPDA 1SOVA 5T8KC 2PZEA 4LA4A 4BVBA 4CUZA 1DNPA 1GYPA 4IIJB 3N6RA 1HFKA 2D1YA 2H92A 4ZO6A 4JV5B 4LZZA 4O2LA 2A86A 2FPPB 3ANYB 1A8QA 1DCKA 4LDPA 2XZLA 4LI3X 3A05A 3GYBA 5L6MB 1JDSA 1QIFA 3TH5A 3VGPA 1N3IA 2Z8YM 1DIAA 4YFYA 3GFGA 1IY9A 2FPUA 5JANA 4PQGA 4YRSA 5K0EA 1NBWB 5FTWA 1GR1A 1K8ZB 3LWZA 1KY4A 1QR6A 2VUIB 2OZEA 3TG8A 3R7AA 2WWRA 3E23A 1G20E 4N6OA 1I24A 1KS2A 1YV9A 2VJOA 1I7LA 4K9SA 5B30A 5L40A 5D3MA 1RYEA 3E2MA 4HG2A 1AV7A 5AJWA 4MHTA 4CGZA 1ZINA 2A78A 3A3KA 3IQWA 1QONA 3F6PA 1FQOA 3T95A 5JSUA 4LSWA 3UOGA 4GP9A 3BC1A 3V4SA 4AMGA 5C8XA 2WVAA 4NEHB 3EZ9A 1SG9A 3NH9A 4HLDA 3ZWYA 2B37A 3IV7A 2OZLB 4PO1A 4DQXA 3UGJA 3WO0A 2QN2A 2ZVQX 2R6ZA 2AR0A 4YHHB 4ZQGA 5DNEA 5EIWA 4ZOAA 4BCDA 3LK7A 1YI0A 2O1EA 3MWJA 1KYQA 2DHRA 1V9SA 3G88A 4FJ2A 1QIMA 3E35A 3H9GA 3LSTA 2W2KB 1FSZA 4OMCA 3DE7X 2FE4A 3ANSA 1G66A 2HPHA 1H5QA 3M4YA 4F84A 1RD4A 4LCBA 2FZLA 4OSPA 3VZSA 4IKPA 1RE1A 3C5CA 4TMYA 1LSJA 1T6XA 2IDKA 2X8JA 4TSFD 1WUHS 4XI9A 1W1IA 1E6UA 5TGZA 4D8TA 4G4SP 3TZKA 3V8MA 5EUMA 4BQEA 3H2SA 1Z13A 2I2AA 2C5BA 4IF4A 4Y3UA 3TINA 3B1YA 4CDMA 3GLUA 1GGNA 2NZ2A 4M46A 4M53A 1LBHA 3C48A 2PHZA 4JJIA 5DBIA 1OX6A 4NYIQ 2VKQA 1Q44A 4GI2A 3ZCRA 4QSMA 4FR0A 2GFHA 2W4IA 4FE4A 4HS4A 2C2ZA 4WZZA 3TW4A 3PDWA 4EP1A 1J4AA 2PTHA 2Y9MB 3AHCA 5GIOE 1P1BA 1W0JA 3WMRA 3FCUB 3NBXX 4UHKA 2X6RA 1A95A 3Q7PA 4KACA 2YNMC 1QAMA 3AVPA 3BWYA 4HX5A 4IUCS 4BV9A 2O2GA 2O2JA 4FC6A 3B8HA 1JHRA 4YCBA 4JI0B 3VYUB 1NE7A 5I9LA 1XEWY 2EQBA 5TR9A 5IHPA 3Q8WA 4GKKB 1NR1A 4KITB 4RD1A 2HRCA 5BSUA 1Z2PX 2XYQA 2R44A 5DW3A 3UJ6A 1TA4A 2POCA 4NFSA 4F9FA 3C7DB 4U9HS 2DPGA 3ZHTA 1Q50A 1EVEA 1VP3A 2IDMA 4IQGA 2DKOA 2FMIA 5G1OA 3ND7A 4WVLA 4V1CI 2MMCA 4MDEA 4IDNA 1FBTA 3D6AA 3U0BA 4CIWA 1LJLA 3PCXA 1Z38A 3HCWA 3IURA 4GQAA 3BGWA 1UK6A 1UC4B 3G6KA 4GXQA 4RO0A 1NVXQ 2V6JA 4U7PB 1KE2A 1N6PA 2OBXA 2GPNA 2VATA 3PQEA 5AVSA 5IYZA 2GJ4A 2QL6A 3DQPA 4KW7A 3HY3A 2FDRA 3BF7A 3W78A 2G25A 3IKLA 4YBZA 5BOVA 1SCKA 5FL7D 5G1NA 5KDOA 3PRKE 1G5IA 1E64A 1KQOA 1TUGA 2CXRA 1QE0A 3IPCA 4II2A 3SFZA 1W93A 3ZN2A 2WT8A 4XVUA 3PNLA 1EK2A 1P6QA 3ZQKA 2Q4DA 1TX4B 3JALA 4JJGA 3CZPA 5E0KB 3WA6A 2E1RA 1T9GS 3F8WA 2HJSA 3IMFA 4YDSA 1RYZA 2R79A 2R48A 1LRLA 4M9SA 5K8VA 1AHNA 2V74B 2PZ8A 2O8EA 4DIMA 3O4RA 3TXAA 3D6JA 4OLAA 1HDIA 2PGAA 4P3PA 1OMOA 2TRSB 3I9JA 3K09A 4JP2A 4M22A 2ZWVA 3C4VA 2GHRA 2DM6A 1COWA 2EP8A 3TD2A 2E37A 1YJBA 4Z49A 1GDTA 2RGUA 3ZZNA 1N8NA 1LLUA 2B99A 1EFPB 2VQSA 5JHHB 4I2VA 3W4JA 4GL2A 3A4YA 1OFGA 1Z2EA 3SPXA 2HJHA 3BCRA 3NWBA 4TV9B 1SA0A 4Z0NA 5FUXA 2I3GA 3MTIA 5KKCA 4AP5A 1TZMA 2VPXA 4Q21A 4UASA 4YPVA 2O50A 1ZQ9A 3UMCA 3LHKA 5EL0A 3FSGD 5GOTA 4D9HA 3K0SA 4UCQA 2GO1A 1RI2A 2WWIA 4H1VA 5HQ3B 3AUJB 1ID1A 1E7QA 3UHAA 2YFHA 3PPVA 3Q6NA 2BCJQ 1A7KA 5EQDA 1KIAA 4LW8A 3F3SA 4EKYA 3KETA 2FSPA 2QQ5A 5AESA 4F93B 5KSZA 1EUDB 3FRJA 5BUCA 4CN9A 4P2GA 3ETEA 1QZUA 4N5LA 3M1LA 4Q7EA 3QH4A 4TWAA 3WIDA 3HVJA 2QENA 3QXJA 4B4UA 5DBGA 3W8EA 3EVTA 1U9IC 2EDCA 4TQ9A 1X7GA 2GM4A 4X24A 5CH8A 2XE8A 2XVZA 3HJCA 5F3WB 2EKDA 4INZA 3LBFA 5FLKA 3NEAA 4YRJA 4UEKA 2IOFK 1C41A 2WJ6A 4LXTA 1QBGA 1ML3A 3FYUB 1QOZA 3B38A 2BKEA 1Y1KE 2QZPA 1QZZA 3JRNA 5BRAA 5CVTA 3THXB 4FTWA 1Z8HA 1DZIA 2UKDA 3OQIB 4NL4H 4PRLA 3E7PA 4ESHA 5GADl 4PFJA 5AVRA 3R3VA 2RKOA 1I2MA 3KQPA 1WCIA 1PK7A 5GTDA 1GLNA 1RMQA 2H6EA 4DY4A 3WI7A 2VSFA 1UKEA 1ZLXA 3ND5A 4AO7A 3HA7A 1TW3A 3DW1X 1KMCA 1C8BA 1N6NA 3GA5A 4YJ2B 1ZIDA 2X4LA 2QVLA 5KAMA 2F1IA 3NHZA 5HE9A 3A37A 3B7PA 3TPCA 3H2KA 4B79A 5AM0A 3UJNA 2WC1A 2BFPA 5FXMA 5IKXA 5JS1A 2QROA 3HHPA 3OBIA 2BFDB 2EP5A 5DHRA 3IALA 2HXGA 1FDRA 1ZR2A 3F4KA 1KU6A 1ZMTA 2GT1A 2NTNA 4LK3A 3S2YA 4OKSA 4JYAB 4XAQA 1Q14A 4Z6KA 3O93A 1GKYA 2QTBA 3L4BA 4L72A 4CIXA 3WB0A 1SJ9A 4E5DA 1C30A 1JDBC 3AKYA 1U6KA 4L6AA 1REQA 2QZSA 2RHTA 1IHYA 4BP9A 4C78A 1S02A 4HLQB 1AQNA 5CYPA 1QZTA 2V54A 1L7VC 2QI9C 3GRKA 1CJKC 2W2LA 4GZMA 1G4HA 2IHYA 1TVMA 5JCJA 4J0GA 3T1OA 1L4UA 3TSYA 5AW0A 1QSGA 4FFWA 5DZSA 2BKXA 3AHFA 3PA8A 1T2AA 3PJGA 4KXYA 1O4WA 5FV7A 3MSXA 1DZ3A 1MJGM 1PJ3A 3QMWA 3V4LA 1V4BA 3DMDA 2GZ3A 3EGOA 2HHHB 2F1HA 3L07A 5H5JA 3ZHSA 4F45A 1GZHB 4QLAA 3E1SA 3V4FA 4PEVA 1JLHA 1KY3A 2O3QA 2Z8ZA 3IR6A 2QQEA 1N8KA 4EQZA 2GSWA 5E7MA 2DAPA 3JD0A 4KN9S 3VOAA 3O38A 4MQ5A 3FZYA 3W7AA 4OUKX 2I34A 4M9UA 1YK0A 3QWAA 1KI1A 4ZHQB 3LYLA 2HRQA 2I1QA 4MAFA 3OEEA 4O4JF 5BVHB 1RP7A 2O2DA 2RK6A 3ZDEA 2CVOA 3HBJA 3W8RA 5AH0A 1L8LA 5I48A 4X66B 1A8HA 1D6MA 5DTRA 4C4YA 4EI2A 4DR4B 1VCNA 2IS1A 3SQWA 4N49A 2ZRMA 5F12A 2B69A 4D44A 1EQUA 1SPXA 1HDEA 2FW0A 2GYWA 3EEBA 2FN8A 3DVAB 3GEDA 4IZOA 3G1TA 4QSHA 3VYWA 3WQSB 1AGRA 3EOAI 3U17A 4F2WA 3RBZA 1XMQB 5LL6P 2IYUA 2QYTA 2P90A 2EJUA 1BMFA 2VTKA 3D4PA 5KVQA 5AM3A 4KE7A 2CB9A 1Q17A 2QPOA 2WM2A 2XT0A 3RARA 3Q9NA 1OTYA 3E2IA 3KB1A 3E22B 1A1VA 4A8JC 2HV9A 3T41A 2G80A 1SCBA 3AYXB 3HRKA 1ID8A 1N25A 3CIFA 1DU4A 3QLUA 4BV2A 4LRQA 2QRHA 3EQ8A 4UTOA 1Q1BA 5I47A 2OLKA 3OE7A 3BKXA 3ENKA 2FAXA 3LQFA 3TIIA 1YBFA 4WK0B 2Y0EA 2Z5GA 2ORVA 3ENZA 3H83A 4LI0A 5FWYB 4U4AA 5JPCA 1WBDA 2QTHA 4LMBA 1DBPA 5C7IO 3OM9A 4JZYA 1SKAA 3PCTA 3RAJA 3SS9X 2OGWA 3QEJA 1MEOA 4H1UA 2JBAB 3R3JA 1KARA 3AL3A 4GE3A 4DCCA 1A8UA 1KO8A 1RPNA 3PJFA 4OTZA 3S27A 1F12A 1Q11A 3WWOA 1H0RA 2MT9A 3L0CA 2AQ8A 1FVXA 1MX3A 2CVHA 3CEJA 2ZIUB 3L1JA 4GPBA 3GFVA 4QYIB 2OFXA 3QFSA 2JKVA 4OHOA 2Q9AA 2EJTA 1KJ8A 2WJGA 3OZBA 3R6WA 4OHUA 4UM8B 3RRMA 2RJNA 1VG1A 2P68A 3N2GB 3MRTA 4IHKA 2ONJA 4LOAA 3R41A 4MV8A 1DCFA 3R0VA 1E1RA 4HGZA 4QXOA 4EL0A 2PPLA 3P0JA 3HJFA 2OO3A 2IRWA 5CFZA 1M2JA 4F11A 4XLLA 1I30A 4W5JA 3WQBA 3RK1A 2VNAA 1XQWA 3WP0A 3LUGA 3EGDB 3T0FA 1GRCA 3UAVA 4KDCA 3CEPB 2CCJA 3UUWA 2IPAB 1OT3A 1YOBA 1KIMA 1UK8A 1N3LA 2B8WA 3HL0A 1DIGA 1FFXB 3VRHA 2ACKA 2HT6A 3MTQA 2ON6A 1FYVA 3FCCA 4Y6LA 3ILXA 4W9NA 2GXSA 2XYHA 3LRTA 5EA2A 1K8QA 1U8CB 5FR1A 3TFWA 4IQ4A 2D0OB 2YVQA 3VR5D 4MUIA 1TQ2A 2HDNB 2HSWA 4MV6A 4RA6A 2AEFA 5IULC 1ZX1A 3EVZA 4DADA 5A7GA 4JQYA 1GNQA 2FRDA 3HN2A 4EHDA 2XHZA 1K6MA 1USVA 2ZJYA 4IMJB 4JLMA 3RVQA 1TYBE 1RHJA 1UPBA 3GLGA 1VRVA 2JLRA 4FIZA 4WFKA 4GO1A 4Z4CA 2AFHA 1ZA1A 3EXIA 3OVMA 1ZSNA 1WKVA 2ZSDA 4IICA 4X3PA 5EMMA 1VBKA 4XPIA 3GVXA 2MHCA 4R1SA 3WMFA 3N0VA 4A82A 4Y6QA 1FUUA 1RDFA 1X9GA 1Z5VA 2VP2A 1CUCA 2YUIA 3GA7A 4HGPA 4OL9A 4WY5A 1GQOA 2GARA 4KBFA 5GP1A 4ZYYA 5AJZA 4BWGA 4EHKA 1PO7A 3AR2A 3R5TA 4AYXA 4BMZA 4NR0A 3TSWA 1FVOA 4PG8A 1A2KC 1X19A 2CN1A 2R96A 3JTMA 1U2QA 3AR9A 2BVNA 2IPLA 2BFFB 2VBCA 1KEEB 3AW9A 2PLRA 2E2WA 5BYAA 1KJIA 1ZZGA 2I1LA 3A06A 5JAUA 3WK4A 2ZB7A 5JU6A 1IE3A 1X3LA 1OBHA 2B21A 3WGNA 1K4YA 3A6GA 1Q0SA 2Z2ZA 3LC1O 1J5EB 3CEMA 5C8YB 3PC4A 3SBDA 1M54A 1NP3A 1ZC3A 4QQ8A 1ZN8A 1ULHA 4TLBA 5E7IA 1Q6YA 1Y3HA 2J5QA 4E32A 3KPJA 3L0YA 3PUZA 4ZYXA 4NABA 2G0AA 3C2QA 1P2BA 2I6TA 1X39A 5KDDA 4QIHA 4K2AA 2P2NA 2WILA 2FUG6 3NBMA 3PUIA 3IUNA 4OI0A 1QX3A 4WXMA 1RJFA 3ECSA 4K6HA 2R8RA 1ANKA 2QYSA 1NIJA 4S3MA 1BS1A 1HZJA 1L6IA 5CVUA 1L5HA 4BX9A 3L1KA 4HI0E 3DOOA 2IU4A 1O94D 3C39A 3L7LA 4J0IA 1C3EA 1YRAA 3IO3A 3NJ8A 4M9XA 4F4UA 5ALDA 2J6BA 2K7ZA 2ZJ8A 1J39A 4RH3A 1ZYUA 2LD4A 1U8ZA 1PLLA 3DL0A 3IGFA 1JR2A 1B4DA 2C2YA 4JLPA 1SKYE 1AUQA 5EIHA 3R23A 1SU8A 4UHHA 2WWYA 1DV1A 4TMTA 1NR7A 1P5ZB 1R8SA 3U5ZB 1CUBA 1XJ5A 4WKGA 4ZI7B 2AOUA 4EPWA 1TZ2A 3P9NA 1U2PA 3CURA 4R1TA 3PNMA 4TQAA 4CKEA 8OHMA 3ZQ6A 4CGYA 1RXYA 2DPHA 2EKPA 3GRYA 3L8CA 4N18A 1L7PA 2EWWA 4UBIA 3WGKA 3Q8LA 3JD3A 4P0TA 5C5IA 5FI1B 1X86B 2FF5A 5EJ4A 1Z5PA 2N1MA 4ES6A 2Q5IA 3FB4A 4DIBA 1JDVA 4P8RA 2AFIA 3S2IA 2OXEA 2XX3A 3BMOB 1YTUA 1PSWA 3DR3A 4GGOA 4YTEA 3WLHA 4V0NA 4D3DA 5B3JC 4BJ1A 2WAAA 1B6GA 5F9HA 2XDQA 3D0RA 3C3BA 4K9DA 2FRVA 1FW8A 1TA9A 3AWIA 3K0HA 4JLBA 4PC2A 2YJTD 3IJPA 1J0DA 1E9AA 1Z08A 2QPAA 1I1OA 1ZM9A 3HKBB 4O2BF 4GQBA 3QLVC 2H2AA 4Y9UA 2HV8A 3KBBA 4RK4A 2C7PA 2R7MA 2ZSAA 3ELWA 3A4IA 4TTTS 5BPHA 3GF4A 4PYJA 4D9MA 1MVOA 3UA4A 5FI0B 4HFJA 3GEEA 3SKVA 4C2BA 2YTZA 3EASA 4CW7A 4AIIA 1GKKA 3TX2A 2IA5A 1TVKA 3TFOA 3EDRA 2YZGA 1HQYE 1Z2DA 2QJRA 3PUJA 3B6MA 2W8BA 3D3WA 4EECA 3FNBA 4CF6A 1N75A 1R6DA 1JEYA 3HJTA 1NG1A 3KHSA 1C9DB 2QW1A 4C88A 2YYAA 1OLUB 4EGSA 1OBVA 2WHRA 4GI1A 3SS8A 3GGOA 1GG8A 1Q1QA 4FYPA 3G0IA 3HG7A 4WLFA 3D54D 4TMXA 5PNTA 1TCBA 3RKUA 4E46A 2R86A 4C08A 3BZWA 5MN6A 1FLAA 3GPDG 2QJFA 1EGHA 4Z2YA 1DKUA 1E1CA 1JG4A 1SKQA 3D8SA 2GSDA 521PA 4D99A 1XROA 4D56A 3O4GA 1ADCA 1K7XB 2B3TA 2DLNA 1VSBA 4XR4A 5J2TA 2CD7A 4J2HA 4L7VA 4Y6SA 5C1OA 2D54A 3QXSA 4OMUA 3HMQA 1J5PA 4CI9A 1K68A 4AJIA 3RASA 2VDNB 2PKXA 4EA6A 3DEIA 1ZOSA 4PSVA 4CKZA 1JPNA 3QVOA 1WW3A 4G4JA 3VSEA 2XKAA 1Y34E 2BI8A 2WHQA 2NMVA 3B3JA 1FPQA 4IJVA 3GMSA 3E4DA 3KQVA 4FZ3A 5H16A 4BU1A 4B3DA 5JYEA 1M6VA 2CFCA 3A1SA 3PCRB 3I0NA 3ABQB 5DLYA 1GWNA 5FLXA 5G0TA 4Z7NB 2QT9A 2W6CX 2Q9BA 4LXQA 1NASA 4CYMA 1ZITA 1QF6A 4H3KB 2H48A 3SHVA 5JECA 1SWVA 2C54A 1N32B 1JLSA 1XCJA 3HVKA 4N47A 2CLSA 2QPLA 1J90A 4ARZB 2FFRA 3A2MA 5KOHA 2Y05A 1SVWA 3JYOA 1I7SB 4L4SA 1RKXA 1BW9B 2QDXA 5LZ5A 1BD4A 3OJ0A 2R7NA 3PUYA 2AV6A 3LLSA 4XWGA 3N2YA 3T1NA 2PLAA 1RKUA 2HNAA 1F4LA 4ZC1A 3RYIB 5EJMA 5DM4A 5LXTA 4LYEA 4DVJA 1TD9A 1RYBA 3M3PA 5AHOA 4R9NA 4ZVPA 4C29A 4UUMA 4HO1X 3O91A 4YXFA 1GIAA 2EX1A 3BFVA 4P4TA 3SMVA 4J7AA 2GPTA 4UHDA 3VM6A 2ZWMA 4NJOA 1V39A 4L9SA 4B3MB 1YR1A 2YWEA 3LKZA 5BXYA 1NI4A 3GD7A 1SCJA 2AZMA 5KVVA 1ZY2A 3P0FA 4UOQA 2GOYA 4JIMA 1GZ7A 4ER6A 1KEWA 1ZFNA 1TW2A 1PR5A 4HAXA 3H4MA 4EGJA 1G8MA 1GSHA 2I6GA 4RQUA 3SF0A 4DNPA 2GPYA 4RMJA 4N3AA 3RUDA 3SOZA 3IQHX 3IEIA 2M32A 3NYQA 1W36B 1H3FA 4K7JA 1XN1A 1UFVA 1LW7A 5BYBA 1E1YA 3DOUA 4CMHA 2H07A 4DUYB 1PUIA 3OAAD 5IPFA 1OH8A 4RHTA 1H69A 1IQPA 3REFA 1XF1A 1HURA 1WVGA 2Z3WA 4KX5A 3W3AA 3OZWA 1OZAA 4LJAA 4D9JA 1CUXA 1M2HA 3ZCSA 5HZKA 1C1XB 4F3RA 4BY9E 1E62A 1COWD 2O1WA 4AJOA 1A9TA 2JLSA 1H2FA 3GLIA 2G9QA 2B5VA 1ZO8A 3PBKA 3VV3A 4LJ5A 1K4MA 3AEYA 3KQQA 3M81A 5B53A 1CLEA 1HO3A 2ZJ2A 4KQXA 5IFLA 1B8NA 2HRDA 5KWJA 1N2CB 3G2OA 3KX2A 1AKQA 5A4FS 5A5DA 4R7ZA 4JI6B 2SBTA 5DYTA 1SRRA 1CF2O 4MCHA 2ZIWB 4CF3A 1BKYA 2P9ZA 3SLRA 2BE9A 3H2HA 3NTLA 1Y0BA 1L5GB 4NE7A 3N5CA 1X1QA 2V5UA 1NW6A 3EXEB 4UHEA 4M7WA 5C1BA 1W59A 1ARZA 1J06A 2RAVA 1FSSA 1Q5PA 3RFUA 1R6TA 1JEQA 1WLSA 3IEKA 3NIFB 2Q5QA 5B2ZA 1VYTA 5TPWB 3ZX5A 3GB9A 3QRWA 5LYJF 5MGBA 3BK1A 5JWRA 5DNWA 5IM4F 5HBRA 4DV1B 4HVAA 3TQOA 4RPIA 2PZFA 4I4TF 3IQZA 4X61A 3JQPA 3I5UA 1VZ2A 4ZREA 4BO0A 3UY4A 4C4TA 4CKBB 4Z1MD 1Z83A 4HGOA 1MQ8B 1VE1A 1SBIA 1RU3A 1W52X 1U2DC 3GEIA 3ON5A 3W8FA 4UW9A 4GLOA 1Y6JA 3GFRA 3UAXA 4BTVA 2IUEA 1U0HC 1KSGA 4BJ5A 3OLYA 2CZQA 4CM4B 3O4HA 4TZ6A 3TBKA 3ZK8A 3H5WA 4DCTA 3R20A 1G8SA 1GILA 2IX3A 5K03A 1QHHB 4KR6A 2R6FA 4IGFA 1PJZA 3SF8A 3WYDA 5J5AA 2F3QA 1RTKA 1RM0A 3UH1A 5CD1A 4BWFB 4KUEA 5KQSA 2ANBA 4MEBA 4WLVA 1XTTA 1EVJA 3FMGA 4QTUB 2JFPA 1XNHA 3CG0A 4FQ7A 4JSTA 4RXTA 2O0MA 3QXCA 2GCOB 4DCNA 1V7ZA 4KI7A 3CXRA 2QN1A 3NBYC 4UVIA 4J1TC 4E2XA 3LPDA 4HNAA 1P2DA 4E21A 5MN5A 1UOQA 3H18A 4IS2A 2DR3A 4Z7QB 1TIPA 2DYKA 1ZK3A 4RZHA 3B82A 2YWHA 1H0HA 2VBGA 4G5SA 4JLSA 5EZYB 4YAUA 2AKYA 3SFVA 3VSDA 2VP6A 4G8CA 2EF0A 1SXHA 3L8YA 3NRCA 2PUTA 3SJCA 5IMSA 2EL7A 3S1AB 3K71B 1DT3A 4MB6A 4TL7A 4B80A 3K0FB 4UHFA 4QTZA 4PLZA 4TMWA 4B3CA 1DBRA 1O94C 4AXBA 1DRUA 4W6ZA 3D43A 4JBWA 1XCBA 1Z7YA 3VJRA 1Z63A 1U28C 2XMRA 1X80B 3Q11A 4LHEA 1ONPA 4QWMA 2NU7B 3VR6A 2J4DA 5JNVA 2UVDA 5ANRB 1ZD1A 2XUZA 5CA1F 1MRNA 4KQ1A 1KEZA 1GGJA 2CFSA 3X1XA 4KO1S 4AJPA 1P5FA 2QVGA 4WZAB 5C8VA 5JCJD 2FX2A 2W2OA 4K87A 2VYCA 1XU9A 1UPXA 4PTYA 2X5JO 1O4VA 5G02A 1RLJA 2QP3A 1AHPA 1JTEA 2TS1A 1JEJA 5DHSA 3MBIA 1MORA 1WF6A 3IVRA 1P33A 1QHEA 2OILA 4MV1A 4R83A 1KO1A 3LKDA 1ODKA 6PFKA 4KE8A 1NTOA 2YV1A 2Q21A 2RKWA 3GV0A 1WXIA 4FGWA 1RKVA 1USGA 4I1UA 2JANA 3PEUA 3EA5A 1FP4A 1RLIA 2J3KA 1EXVA 1Y6FA 1R18A 4QULA 4JXZA 1I3OA 3G23A 5BSVA 2BGLA 2PSFA 2JJQA 1KZYC 4AL4A 3IOMA 1VSUA 3OEED 4FONA 1G9TA 4G1BA 1YR3A 3EWAA 3IAEA 4E5UA 4ESEA 2R2GA 5KVSA 3W4KA 3RUHA 1X15A 1HNWB 2PQMA 1EDOA 1D5CA 1CJBA 3ONDA 3X1WA 1DC8A 1E2EA 5EMJA 3M70A 3JPYA 4NU6A 3T3GA 2XNDA 5T5QA 3PT9A 3ZTYA 1YA6A 4ND8B 1Z5ZA 4TYPA 1QX4A 2JC3A 1FZTA 3P27A 5K45A 1JFVA 4LX0A 5AI9A 4HQKA 1BMFD 3WYFA 3ZKAA 4YCCA 2ZBEA 2Q28A 3IBFA 1Z75A 3KB8A 4LC9A 4Q1AA 2IBTA 4GZ3A 1X92A 3NZEA 5A06A 5KMGA 1ZJ6A 4OHMA 2FYTA 1UP6A 3OA2A 2QOEA 1P7ZA 1IY2A 3BL6A 3SJBA 3V3TA 2GAAA 4GLFA 5AJYA 2HFKA 1QWOA 1R12A 3QBDA 4HUJA 3H5LA 1ZVKA 1D7OA 1XZMA 2CUZA 4EJ2A 2X0DA 4WLEA 1ZCZA 4YMTA 3OE7D 2GD0A 1W581 1P4RA 3MPUA 4M8IA 4YMWA 2XXJA 2HNKA 1IM2A 1EH5A 2RI1A 4RTPA 2PXHA 4PVCA 1B16A 4NCXA 4MJ3A 5JJCA 2BM0A 4KKXB 1E2GA 1BNCA 3DMPA 2MYTA 3EZGA 2UDPA 4O5OA 4Z51A 3E5RA 1L5QA 2ZRIA 4XIFA 5EP2A 3SKXA 1KDPA 1CW2B 2WMOB 3SYNA 3EC2A 3OX1A 4BVEA 1ZHFA 4CM9A 1VLLA 3KELA 4Q48A 1E4OA 1XQ9A 5THQA 3VZDA 5J2UF 2JFQA 3O8QA 4PV7A 16PKA 1RWKA 4EW3A 1L7RA 4NI5A 1QFXA 3L1VA 2WE7A 4F12A 4ZYZA 3FZNA 1ZH0A 4CR6A 1FDIA 2GTHA 2PYDA 4HNTA 5CB4F 2DQKA 2R6GA 4GKBA 4WW0A 4XGIA 3N2NA 4YMLA 5JASA 5KSOA 1FDOA 4MH0R 5TQVA 3FCXA 1E1RD 2QVBA 3PGKA 5HF9A 4B1FA 5K05A 1CUAA 4FMPA 1CUFA 3NI2A 1CHNA 2VCEA 4D57A 4OHPA 4BE4A 2CNDA 2W48A 4REQA 3JQRA 1IUNA 1SNYA 5KYUA 1NW7A 5B3AA 2IEBA 5CBPA 4FMCF 2HD4A 3VH2A 4D0LB 2QN3A 4BBZA 4FEEA 1C80A 1YRLA 2R4UA 1NJ5A 1R0LA 2V96A 3QOFA 3E6AA 1S3FA 1B93A 1WY7A 3EF1A 3FHOA 3E1KA 4Z54A 1NI5A 5IHXA 2AN4A 4L4XA 2H2DA 4YIKA 4D98A 4FX2A 4TYQA 3OZVA 5EQFA 3L1IA 1QO7A 2JIZD 3CZ4A 3EISA 2A5FA 5CX1A 4ZOLF 4D6PA 1FFWA 1PZNA 3CNOA 4JC5A 1SVUA 1O0CA 2RBKA 1D9XA 3JVDA 3FYHA 3K8YA 4CQNA 1AKTA 1GARA 4RW0A 5HFNA 2Y0CA 1RAFA 1ZXXA 2AMFA 2YBEA 3HJUA 4JT9A 5IX8A 1EM6A 1UPAA 2YFYA 4H0CA 4BE9A 3AI7A 3UC5A 3CRNA 3DZIA 3WLQA 2Q3FA 2C7QA 4JWTA 3A4VA 3QUCA 3RVBA 4LJLA 1WV1A 3TTVA 1OAAA 4PFKA 4OO3A 1KK0A 3E8MA 4L27A 1VJ0A 2RK3A 2XZPA 2QTMA 1I5OA 3AEXA 2XUGA 3DKVA 3FF1A 4UARA 5ERXA 2EZ4A 4ZRMA 3BWVA 4GR4A 5AKGA 4CWAA 4RWZA 1X1AA 4N8DA 2DTDA 3DAYA 3R5XA 2ZRKA 4N0EA 3SC3A 3B78A 4LPKA 2Z5VA 3BE6A 4GVPA 2BMFA 2GK7A 3RF6A 3QTTA 2P27A 4NFYA 3UMRA 3ZIAA 1QHFA 4LHVA 1A9QA 5BNIA 2D0IA 4GE0A 3WXMA 1OYWA 2ZJFA 4D4MA 4KOAA 1K0FA 4L9WA 2HCRA 1E6LA 4FIDA 1Y37A 4B71A 3UKJA 2O7SA 1JFLA 1OFIA 2GJ8A 3IPAA 4MW7A 1M1UA 1A50B 1JBQA 3GBVA 4BLVA 5EJ6A 5AJUA 5C3UA 3RR2A 4Q3CA 5DYNA 5BN5A 5BRJA 3W6OA 1WKCA 2AJ8A 3ZI0A 2BEVA 4Q6WA 4PX5A 4ROSA 4QUEA 4TXNA 1AX9A 1Q0TA 2GLTA 5U1PA 5A5EA 2DLDA 2E4VA 2C9OA 3I52A 1RPJA 2OG1A 4QDUA 5CDYA 2FU5C 2QRZA 1KVSA 2LW7A 5BSGA 2Z1NA 3QBJA 4PQEA 4R0MA 1FOEB 2VAVA 2F9FA 3D7SA 3HV2A 3S2FA 3TD9A 4TRJA 3UAWA 1U2TA 3KIPA 3OUUA 4RE6A 4PNZA 2BTQA 1GUFA 3WV5A 5C81A 2IOFA 3FNIA 2FMXA 4GGPA 5D01A 4DOMA 4ID9A 3P2JA 2L69A 4HLNA 3T3NA 1JAXA 4URZR 4ZXFA 1U5CA 2EAUA 4I3FA 3QPBA 3RSHA 4S1OA 2RC5A 3PHGA 4V2UA 4INOA 1E5TA 4EJSB 1KP3A 2YXNA 3G49A 3IDQA 1VLZA 1VBMA 2B2XA 2OZVA 3CUKA 3F2VA 1TAHA 1YCDA 3FCEA 3KD2A 4RNCA 1Z0UA 1UMDB 1EVLA 4DT1A 3AXTA 4QGAA 1LZKA 2Z09A 4A2CA 3L4EA 1XTBA 2YMPA 3ZH2A 3X1DA 1ZJZA 4D3SA 1OZGA 1FFBA 4Q02A 3VU9B 3DGEC 2WF7A 3OPYI 1QRRA 3TAHA 3CM0A 1RZ3A 1G20A 3AGQA 4KSBA 2VF2A 4IX1A 3DTTA 4AQDA 4RYLA 4G89A 4FR5A 4DV4B 1ZAYA 5HNKA 1I7PA 3M6WA 3TLKA 3ZLJA 4IIJF 4QFMA 2J1LA 2D74A 4V3CA 3B9PA 3OHPA 4WTOA 2P9GA 1ODIA 3VOBA 1H5NA 4XXHA 3R7WA 5IARA 3U31A 3U1VA 3KKMA 1T4MA 4TTPA 3LECA 3UMJA 5HKKA 3C7CB 2VAXA 1A4RA 3H9UA 4KK3A 4CCWA 2XZDA 2FSSA 4RPCA 5HF5A 2BMJA 1GXSB 1XUOA 4OJMX 3L4BC 4X7RA 2E4ZA 2PIAA 3KKNA 1W5FA 3KR1A 3NIGB 5E6RB 4B3JA 1ECGA 2J6CA 5KYXA 2PD6A 1UDRA 3TQHA 3PB3A 1TYCA 1RRGA 4TKUA 4IGAA 1ZDMA 3OE1A 1O6CA 1WZUA 1BCRA 1VRWA 3P97A 3PE6A 1I9GA 2Z98A 1SQFA 2WDZA 4XJTA 1M9NA 1K08A 4BEJA 3KQUA 4FFLA 3QKSA 3ZE0B 2FH5B 2OV8A 3QHAA 4E1VA 1Z4MA 5IK2D 3MWDB 3DZKA 2GH1A 4WV3A 1Z73A 4RLHA 2H1RA 3A9VA 3QE4A 1S7GA 4LJSA 4TM7A 5JNRA 4J07A 1P61B 1VPLA 4RPGA 3TOSA 4QPCA 4V0OA 2QAGB 4LWPA 3CNEA 1E9EA 1NVKA 3OSUA 2HM7A 4N9WA 3EX7C 1R8JA 1JRLA 3BXPA 3VKGA 5JAPA 1ZCAA 3HRHA 1JALA 1IXRC 4JU8A 4D8YA 5IN5A 1E94E 3LZ6A 4TM8A 3U26A 1S2GA 4C76A 5EWLA 3P9CA 2B98A 2WU4A 2JFVA 1V48A 3LKBA 1OI7A 4UU8A 5C1DA 3ZD8A 2R6AA 3FCOA 1V2GA 4X6UA 5D87A 1FSFA 3NBZC 4K1LA 1GPJA 3H11B 4LOHA 2Q7XA 3EIOA 3H1EA 2ZYWX 1YHNA 1FMJA 4J9UE 5UKDA 3UCFA 3C74A 4BKMA 1BJTA 3DT6A 3TYXA 2WSMA 3D31A 2I4OA 2B4RO 4CKWA 4GIBA 5IDWA 3PE3A 1RQRA 3SZUA 1UBFA 4I1YA 2IHBA 4JR2A 2ZITA 1YQWA 2ZWAA 4LDZA 4B8ZA 2R7KA 2ZJ5A 1ZN2A 4CQLA 3W5HA 1XTIA 1ZMRA 2GAFA 4PO9A 3W90A 5CXUA 2Y1LA 3RIGA 4RA9B 3KVRA 3UYKA 3VV2A