1R0ZA

Phosphorylated cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
280
structure length
271
Chain Sequence
TGIIMENVTAFWEEGFGELLEKVQKHSDENNVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRILTETLRRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 86
structure length 271
sequence length 280
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r0zA00
2OLKA 2VSOA 3LW8A 3IBYA 3NKVA 3Q85A 2GJKA 3THWA 2A78A 2FN4A 3OAAD 2FF7A 5E95A 2RKOA 1N2CE 1KY3A 2OBMA 4M1OA 3K0FB 3IEVA 2QP9X 1JB1A 1G64A 2V3CC 2DFNA 3AVTA 1KI6A 1NY5A 4IVRA 1NMXA 1W0KA 4BASA 4DLUA 3G82C 2F1JA 3UG6A 4IOKA 4A15A 4OHZA 1EXMA 1Z6AA 2PZEA 4RZUA 5FL7D 4DSUA 621PA 4NKRA 2F6RA 4PX9A 1X8KA 4TMVA 2VL7A 3UXMA 3C14C 1EFHA 3KKPA 1CF4A 4JBXA 1T5LA 2BIFA 3HU3A 5FI0B 4N3NA 4PHGA 3NHAA 1T8UA 3BFVA 4Q1DA 4Z1MD 3AVXA 4A82A 1K5GA 1Z6TA 1U0JA 2QROA 1YZKA 4FWIB 3OESA 2IC5A 1OKKD 5C2JB 1R10A 4ASUA 4QRHA 4BLQA 5KDOA 3LLMA 1GILA 1QVAA 2ZYUX 4MH0R 4TQUS 2W2TA 1KK1A 4C30A 1V43A 1VTKA 1XEWY 4B44A 5ELXA 1CULC 2Q0HA 4HUTA 5BYKA 2ZJAA 1CP2A 1JXOA 5EJEA 2RAPA 4CEIB 1MABB 4C2TA 4QKQA 2ZRFA 2AK2A 3CB4A 4TMXA 2IXFA 2ZJBA 3BFXA 2DFKB 3LBNA 3T5DA 4RD4A 4A2WA 4BFYA 1L7VC 2P2LA 2KSQA 2QT1A 1XJ0A 4W5HA 4B3FX 2JDIA 4U00A 4NP6A 4US0R 2EVWX 3H1TA 4Q4HB 1N6HA 4L16A 4ZO4A 4QFMA 3OIYA 3MSXA 1CJTC 5JRJA 1E2QA 4LBYA 1S3SA 1OKKA 1GRNA 2Q3FA 4DLXA 4Q4JB 3T1OA 2JLSA 3PUYA 3NBXX 3UK6A 3IO5A 2JJ1A 1IXSB 3CWQA 5HTKA 4LRWA 4D6PA 1XJQA 3VAAA 4M9QA 4LK2A 1XTRA 5EE1A 1KSJA 2XZPA 1YKSA 2NPIA 5K8LA 1G4UR 3CF6R 2IYUA 2NO7A 5H1YA 3LAWA 4OJQA 3W5JA 4XVRA 1G3UA 4KXFB 2D74A 3RS3A 4ZDWA 5GADl 1WE2A 2DWOA 1E2LA 3V9PA 3WP1B 4AG6A 3SFZA 3HDTA 2VPPA 2LCFA 2J3EA 5G40A 1AJEA 4B2IA 3VR5A 3SJZA 4Q9LA 1E1RD 2ZUCA 4LHZA 1Z0DA 1RIFA 2QMUA 2R6GA 3MJHA 1XEXB 1QHIA 3I61A 2J0SA 2IYWA 5KDLA 3W8RA 4HZUB 5DNYB 2WIBA 3RLFA 4LYJA 1KZGB 4GOXA 1GKUB 5EXXA 5FBVB 1VPLA 1OFHA 1W4AA 2F9MA 2XJ9A 1Z08A 3SJAA 2BWJA 5FOVA 2PH1A 4KYUA 2AKYA 2GBLC 3PITA 4LJ4A 1UADA 4EQ6A 4EPVA 2O8DA 1KAOA 1N6IA 5FOUA 1DAEA 3GLGB 1NG9A 1NLFA 1E9DA 4M21A 1FNMA 4JLNA 2O0JA 3KL4A 3GEEA 3DVLA 3JVVA 1J8YF 2E87A 2JA1A 3IPXA 5E7IA 4V0ME 4Q00A 2ZSDA 2Z83A 1R8QA 2RB4A 3BXZA 4NYJQ 3TW8B 1KNQA 2X8AA 4XJXA 2BM1A 3GJ4A 4N0DA 4R98A 5JHHB 1HV8A 1N0WA 2H8KA 4JLPA 2R44A 4NYIQ 2BMEA 2OUKA 5HCIA 2ZRAA 3I4LA 4A2PA 4U02A 1IY1A 2RGBA 1Q20A 2ZRIA 4M53A 1UBGA 3CWZA 4EPYA 2JLYA 3M1IA 1LS6A 1W1WA 2QZ4A 2WWGA 4YXWA 4UXIA 1FPMA 1A4RA 4LX0A 3THXB 1AZSC 3A36A 2FGKA 3GLGE 4I1VA 3KFVA 1E2GA 4H1UA 3LQRA 2OT3B 5KYKA 1M7GA 3QEJA 4JLAA 4LJ9A 4TSFD 3VFDA 1F5NA 1KK3A 4GSYA 1YZTA 2BV3A 3QXXA 3TSWA 2QN6A 1E9CA 1NP6A 1XD9A 2REOA 2OV2A 1Z0FA 3MCAA 3AVOA 1R6BX 3B85A 3IUYA 4ZIRA 1FL9A 1OXUA 2QSZA 4PPGA 4YONB 3THXA 4P4UA 3BORA 3NH9A 3R8CA 2GXUA 4TMKA 4V0NA 3Q72A 5D3MB 4N0EA 2GJSA 3AUYA 4DSNA 2VA8A 2GESA 1NN1A 2B7BA 4GP7A 5J5CA 2XITA 2ZI3A 4BEBA 3PEUA 5A0FA 4HDCA 4B33A 2ZJOA 2ZJ8A 3FVQA 2H92A 3IIJA 3GJ7A 2Z4SA 4F38A 5FPSA 2P0EA 3MD0A 2ZUBA 2CNWD 3KQNA 2EFGA 2GK7A 3KXIA 3SYLA 3MJRA 3SQXA 2C9OA 3R8FA 1DO2A 3ASYA 1T3SA 2BBWA 4JVLA 3W8NA 1CR1A 4M1MA 1VHTA 3PR1A 5IF9A 2DYKA 2WKQA 3HJNA 2CBZA 2G0NA 1D2NA 2YOHA 3CX8A 2A2ZA 2BDTA 3R9IA 4MDEA 1HT1E 4FWTA 4KBFA 4C0QC 3K1JA 3RRNA 2KI5A 3NEJA 1VCNA 4AURA 2JLUA 1OXTA 4URVR 1GL9B 2QAGB 1NVVQ 3CIOA 1P4SA 2YINC 3A1UA 2F7SA 4KVAA 1WXQA 5KSYA 4MRNA 1P61B 3TSZA 3PEWA 4R7ZA 3I32A 2NMVA 1GVNB 3L8ZA 1W5SA 2NG1A 1D8TA 1I4TD 1IOZA 4GZMA 1N5KA 1YR6A 3I5XA 1HA3A 4A92A 2DFLA 1OHHA 3K0EA 2LWIA 3PENA 5FI1B 3T35A 4RD1A 1KO8A 3VTKA 1IXZA 4JYBA 1R0XA 4ZCIA 2A5DA 4F4IA 1Z0AA 3GJXC 4KVGA 3PJRA 3EZ2A 1LB1B 2WPDA 4KYIB 4EPTA 3QPUA 5KTYA 1XMJA 1DOAA 1K8RA 1T4GA 4URWR 3AKCA 4DLZA 2A9KA 4GPTA 1RFLA 1YQTA 4WXRA 4DC9A 2IUSA 3LNCA 3OEED 4URXR 3RC8A 3V4RA 3K8YA 4QBIA 2P6NA 1KI9A 4TYQA 2VSFA 1XXHA 3ADCA 5A4JA 3EW9A 2GDJA 4Q18A 3JZAA 1P2VA 1SXJB 1FOEB 4XVQA 3UMRA 1ANKA 5JWOA 1KI1A 4LBVA 2Q21A 5HZHA 1BIFA 2QM7A 2E1RA 2P5TB 4OI1A 3O8BA 2JLWA 1DS6A 1XEFA 1Z2CA 3D7MA 4GDFA 2PMKA 3PUWA 2XZLA 1LY1A 3RANA 1E32A 2BMJA 4HYYA 2MMGA 1SVKA 2R6AA 2DR3A 3U44A 1Q1QA 4B2LA 4GZLA 1JQJC 2CHGA 4TL8A 1P62B 3DZ8A 2WJYA 4BUJA 3A37A 4IOLA 1C9KA 2XNDD 2C04A 2O8EB 5DI3B 4MGYR 4CEJB 3AH8A 2G3YA 1EWQA 3TNFA 2VIIA 1P9RA 2FPMA 3GJ8A 4OI0A 1ELOA 1TF2A 1UKEA 2FE4A 2W2XA 4HLDA 3QVVA 3KKMA 4ON9A 4TL6A 1DAIA 1S2MA 2F9LA 2QP4A 2VHJA 2GXAA 4W5WA 1EFCA 3FGNA 2WTUA 3A1SA 1NVXQ 4FCVA 4DJTA 3B1VA 4ITRC 4OK5A 4RFSB 2A30A 4DB4A 2BMFA 3U7GA 4CEJA 4LV5B 3OIVA 1Y63A 1U81A 5JS7A 1SKYE 5AJYA 1W36D 2I4IA 1X86B 1HQYE 2XJ4A 4PAOA 4BWYA 1UKZA 2CL7X 4G5SA 3DKPA 3FHCB 2NQ2C 5AUNB 4RVCA 4W5JA 4D0LB 2D62A 2CCJA 4JJKA 2HF8A 3AKDA 4DSOA 3X1DA 1ZP6A 3CM0A 1JR6A 1KI7A 2CL0X 1KI3A 3MAAC 3PXGA 1IXRC 2IYQA 2ZRGA 3RYTC 1XBTA 3SFVA 1YHNA 3AF2A 2FV8A 1GRRA 1QG4A 2FFHA 1UEJA 2OBNA 1G18A 3K9HA 1L8QA 2WSMA 4C0JA 1SHZA 5G3ZA 1R0ZA 3D8BA 1ZM2A 4ACBA 2KBFA 4PSAA 3SR0A 2VQSA 3N2IA 1GP2A 2RGEA 3A4LA 1MO6A 4BLTA 4PZZA 3WNCA 1MO3A 4DBLC 2GCPA 2EFCB 1XPUA 1GL6A 2B21A 3TIFA 4JKYA 1II8A 4OKSA 4ZCLA 1U8ZA 2UKDA 1Z5ZA 3NEYA 3I92A 2OCAA 4PFSA 4CT4B 1G8GA 3PIRA 4IKEA 3L8YA 1K6MA 1G6HA 2DWPA 4MYHA 4Q4LA 4JLVA 4BFZA 1K5DA 2RMKA 1KGDA 2V7QA 1XXHE 2C2HA 2QEQA 3H2YA 4QNRA 3TSOA 1E69A 3KJIA 1FP7A 5IRCD 3QNUA 5EP3A 3EZFA 1G9XA 2G77B 2ZTSA 1G3MA 4R2HA 1XD2B 1O3YA 5TVKA 1ZUIA 2QBYB 3GD7A 2QU8A 3L0OA 4B3BA 4FMCF 2W83A 3AP1A 4HI0E 5EZ5A 1N0UA 2ZU6A 3QG1A 5G41A 2PLFA 2J59A 5EE0A 4QL3A 2YKGA 1MH1A 1IHUA 4CEHB 1AQUA 2XTZA 3MWLA 1ZIPA 4UJ5A 1J70A 2C9CA 5G53C 3ZZUA 3LD9A 1J2JA 1O87A 3T5GA 5EP1A 2D2EA 2R6DA 4X8OA 1ZNYA 1KO4A 3GFTA 3R20A 1DO0A 1F60A 2QMOA 4FCTA 1GOTA 4P32A 5FBRB 1AGPA 1SVOA 3I73A 4J0QA 1OV4A 1Q1EA 3B1ZA 3L0SA 4Z1MA 5JEEA 2XTMA 1XTJA 3Q3JB 2GNOA 2YZ2A 4LJAA 4DB2A 2ZRDA 3B5JA 1P3JA 1YRBA 3EC1A 4IXNA 4Q1CA 4C0HA 2PCJA 3V00A 2QPTA 1BH2A 1NIJA 3B9PA 3U3JA 3TJZA 1NBMA 4G3XA 4KU4A 2J9RA 2IXGA 4WVFA 4BLPA 3T1QA 4LJ8A 3AGQA 1E98A 1RKBA 5FOXA 2BBSA 3TW4A 3VR4A 5CITA 1N6RA 2XGJA 3RC3A 1AK2A 4IVQA 2NPFA 1YZLA 1W47A 2QA5A 5FH9A 2FG5A 4BEJA 4JLJA 4KSCA 4HZIA 4CDGA 1NN3A 3ZIAD 5CJ2A 1E9SA 2I1QA 1Q1ZA 1G8HA 4Q7KA 5SZJA 1GKIA 4S35A 4MRRA 3TVDA 1XTIA 2ZAOA 2VO1A 1G3QA 3CF2A 3IPYA 3GJ3A 2PEZA 2X19A 4Q21A 4RKFA 3WNDA 3QPVA 4JLDA 4YXWD 2AXNA 2A5FA 2IEZA 4Q48A 3TQCA 1AS3A 2V1XA 2VF8A 3NTUA 3BWDD 1KSFX 4UXJA 3PQCA 4P4SB 2VHQA 4D0NA 4A0FA 2PZGA 4BFWA 1ZBDA 3TMKA 2W2VA 5JSZB 1DAFA 5J40A 1Q3HA 3Q5EA 1TNDA 1VYVA 1N6NA 2C95A 1XD2A 1KKLA 4N1AA 4RCYA 1WA5A 3BRWD 5FPHA 3THOA 2QGNA 3EASA 4AKGA 1WCV1 3NDBB 3W5IA 4OQLA 4KBGA 3RABA 1R4AA 1RRPA 1Z28A 2BKUA 2BOVA 2IHBA 1N5JA 3BB1A 3OEHD 3EZ7A 3GJ6A 5TARA 3WMGA 1M7HA 4Q47A 4M9SA 3W34A 4JT4A 2IWRA 2QTVB 4JYCA 5DGXA 1VG0B 2CK3A 4WZBE 4Q9JA 1ZD1A 2GAAA 3R7WA 2OFXA 4L8GA 4D80A 3CZQA 3AUXA 1KO1A 3BOSA 1VCOA 3MLEA 1TQ6A 1U8YA 3KFXA 2ZRPA 4C2UA 2FSFA 2VP9A 4JJZA 1FUKA 4JSTA 3IIMA 2GHIA 4QNMA 4NDZA 3RRZA 4ZKEA 2P6UA 3PFIA 5L3SA 4MUBA 1SQ5A 3K53A 4D0GA 3EAQA 3OFND 2OM2A 1N3BA 2W0SA 5SZHB 3WHKA 1SHKA 2R62A 4DIEA 4DIDA 3NHBA 3CBQA 2F1HA 1TEXA 4XH9B 4Q03A 4XTCS 1WP9A 3VX3A 4B2PA 2NO6A 1M1YE 1HY3A 1I4DD 2MMCA 4BZXA 4V0LA 3HR8A 3P27A 2EYQA 2ZETA 4UNPA 4BLSA 1UBCA 5CIQA 5EE5B 5EZ6B 5GJCA 3B60A 1HEIA 5FL7A 4A8JA 2VRWA 2LKCA 1U9IA 4A8JB 3O47A 2Q3MA 2Z43A 3RNLA 4MKHA 3FE2A 5K8IA 2OXRA 4PO8A 2AWOA 1CKEA 4QHSA 3SOPA 3MMPA 4A6XA 4DLTA 5JWRA 3K0SA 1SZPA 3FFAA 1DPFA 3HWSA 2JJ2D 4MDFA 1N0VC 1ZYUA 3ZLJA 4NONA 4TLBA 1S0UA 3BERA 2PX3A 4Y0AA 1IJFA 5IDVA 1W36C 2QAJA 5DI3A 3CZPA 2R2AA 3KB1A 1ZC4A 4C9BA 3DMNA 3GLGA 4DLVA 3DOEA 2WMOB 1U0LA 4AKHA 2YWEA 4F7WA 2O0KA 1I2DA 2VP6A 2ZRLA 4TLAA 1P72A 1G7CA 5KU1A 1OH8A 1WRBA 4WXPA 3QKRA 1M8PA 3W3AA 3QKRB 1ZD9A 4D4MA 1KYIA 2IUTA 3UKDA 2ATVA 1LFDB 2EU8A 4OQNA 1E99A 2CVHA 2CCGA 1NMYA 2JJ2A 4FMDF 1KDRA 1JXMA 4Q7MB 1T9HA 3ZVLA 1OXXK 2VBCA 4CF7A 2BEKA 3K70D 1CLUA 4JVMA 1I2MA 3OZXA 2XOKA 2RH5A 5DI9A 1IY2A 1B0UA 1D2EA 1G4AE 2VYFA 2FX3A 1DG3A 3VNVA 1U9IC 4RZXA 3SC3A 1FZQA 2GJ9A 3SYKA 5H8WA 1TMKA 3L82B 5HKKA 2FPLA 1NKSA 5F3WB 3PUZA 5AJXA 3BB4A 4XOIA 3GP8A 4M1SA 1OH7A 1TF7A 2GXQA 3TE6A 3U4QA 4KITB 3LVRE 1Q22A 5DISB 2YV5A 1GITA 4P3YA 3FMPB 2GRJA 1KI6B 1ONBA 4HB4A 2IA5A 1CRQA 1IY0A 2AKAB 1YR9A 2FEOA 1T91A 4JIMA 4Z8YA 1E2FA 1G7RA 1KMHB 1VYUA 2B92A 2ZI5A 3RSLA 5JCPA 4C4PA 1MT0A 2ANBA 1CXZA 2J7PD 4O25A 3GLHE 3BB3A 4OHWA 4QGGA 1F3OA 4C0SA 4PO1A 4QBHA 2GXSA 1VMAA 5KPJA 3KKOA 4IHQA 4CVNA 1UKYA 4LJ6A 2GEVA 4NYJR 1PUJA 1ESNA 2CEAA 2PJRA 2BVNA 2N46A 3ICEA 2JASA 3NC0C 3W6OA 1Y3AA 1W4CA 2H16A 1RVDA 4NU0A 4TLDA 3NH6A 4MGZR 1BS1A 3ZGXA 1OW3B 3THYA 1CU1A 1TUEA 5GJWC 5KSPA 3UANA 1S1MA 1IN5A 1BOFA 1Z07A 3I1FA 1KJWA 5FPYA 2GETA 221PA 1ZNWA 1OFUX 3C8UA 2PEYA 4NCKA 2HEIA 3WMFA 5CM9C 121PA 2XSZA 1QBKC 1E0KA 2J7PA 5JECA 4AG5A 5LD2C 1Q21A 2J41A 5LB4A 1KAGA 2TMKA 4TL7A 3IKJA 4DCVA 2C96A 4KJZA 1VHLA 2Y8EA 1YVDA 3Q9LA 1Q3TA 3P1JA 2O52A 1VKJA 4HAXA 1GRQA 4PQYA 4D4LA 1C1YA 1ZUNB 4D26A 2AWNA 3CW2A 5LB2A 1MOZA 3QJYA 4JBWA 4XSGA 4LJ5A 4EKDA 2C03A 3B6EA 1ZC3A 2RGNA 1LNZA 2J0VA 1HURA 4AIIA 1SVLA 1V5WA 2F1RA 4F91B 2QTHA 3VHLB 2G1JA 1P5ZB 3Q5DA 4B3GA 4L4UA 1AKEA 2HT1A 3KKQA 3RVBA 2FZ4A 3LRPA 3QKTA 3RS0A 3OAAA 3RRYA 1FTSA 5JJIA 4Q1EA 5M04A 1GNQA 2WICA 4LHXA 4ZIRB 3AVQA 2BJVA 2PJZA 3M0EA 3MWKA 3K0FA 4F4JA 4V03A 5DLQC 5CDFA 5AJZA 3U3MA 4A0HA 1RRFA 1JR3E 1QRAA 1EG7A 2ANCA 2QE7D 2XAUA 3LDAA 1A5TA 1R5NA 2VP0A 5KUTA 2F3TA 1YR7A 3TR5A 2WSSD 1TU3A 2O8BB 3W6PA 4GNKA 1DVRA 5EUQB 4JSYA 4GMDA 4G01B 2HXYA 2QQ0A 4XVUA 4C7OA 5H68A 4Q7LA 3QF4A 3EPKA 4A8JC 2PLRA 4C0BA 1GTVA 2IW3A 1R0YA 3ZS9A 1NJGA 1N6OA 1BYIA 2NO1A 3PG5A 4GRAA 1WBDA 5EP2A 2QE7A 1F2TB 3AF3A 3DO6A 2OFWA 1T0JB 1XMIA 3K70B 3BJIC 1A1VA 1OYWA 3QE0A 5B2ZA 5BW8A 2IWHA 3VR6A 3QG5A 1J99A 1SXJC 4IDQA 4KO8A 5DN6A 3RWOA 4F92B 1RRCA 2XNDA 5JI2E 2QTFA 4PPNA 1FQKA 1XTSA 4PQFA 3B8HA 3KJEA 1PLLA 4B71A 4FMCB 2XNSA 2GVZC 3T06B 5EE9A 4U5XA 2ATXA 4HB3A 1DARA 1AA9A 2F43B 4R71A 1W2GA 3WY9A 2L0XA 4JLOA 1R5OA 4ESHA 1H8ED 1ZM4A 4C0KA 4NE2A 5GVSA 2QBYA 5JRZA 1MV5A 3NIBA 4OQFA 2ZS7A 1E94E 2OO7A 5IHPA 5KPDA 4MRPA 4B35A 3RS2A 1OHHD 1OXVA 1VCIA 3LXRA 2CK3D 1W0JA 3SN6A 3SS8A 1TTTA 4CIDA 2REXB 2CLCX 2WM9B 4BZPA 1VG9B 1GNPA 4DCNA 5CYPA 2ORVA 4QGAA 2WWWA 2D7CA 2ZYWX 1E2JA 2ERXA 4HAUA 2O8EA 1ZD8A 4NYMR 5LBIA 5DN6D 5JS8A 3U7FB 3U3KA 2VHTA 3LH5A 2WV9A 5JHGB 1FW6A 2ZS8A 1II9A 2NO9A 3ZD6A 3GLFB 2JDID 2IYYA 4QGFA 4A1FA 1YR8A 1R5BA 2ASEA 5CK4A 3UMFA 4B3DA 1DAKA 4WAUA 1XMVA 2SHKA 2ZROA 4FMDB 5JI3E 2R9VA 3V4FA 3CX7A 3TUZC 4NPHA 4LI0A 3KJHA 4TZ6A 3QVUA 1G1MA 2MSDB 5BWMA 2FA9A 2EW1A 1KK2A 3ADDA 1MO4A 2WJVA 3CRW1 3L0PA 5LDDC 4G5RA 1Z2AA 1D2MA 5J4HA 2B7CA 3ZS8A 4B74A 1CBUA 2W6ID 1M34E 2IHYA 4LCBA 3WRYC 1R0WA 4LV6A 2NZ8A 2ZM5A 3AGPA 4LSGA 1W0KD 4DLSA 2XX3A 1NJFA 1MO5A 2K5UA 3CNNA 3VU9B 1CR0A 4A4DA 2OCPA 4URZR 1W5TA 3UWKA 3X2SA 3NWJA 3L43A 1Z06A 3TVTA 4D4KA 4QJ4A 1OIVA 1NMZA 1ZU4A 3GLIA 1W4RA 3NBFA 3ZVNA 2V54A 3T61A 3GFOA 1BYUA 2H57A 3B78A 4M1KA 3SU8A 2HT6A 4R9UC 2WZQA 2O8FA 4LHYA 2GCOA 4PTLA 2AK3A 4IDOA 4IDPA 1ZMXA 4JLMA 1E79D 4QM6A 3O8RA 5JJKA 2PT5A 3FMOB 2ZEJA 2UVQA 1VCMA 1ZM3A 2J7KA 2H7VA 1G21E 3BK7A 4MYTA 1L4UA 1CR2A 4QJ3A 1XEWX 4BRWA 4CEHA 5LD2B 2QAGA 3SEAA 1PZNA 1KSHA 2ZE7A 3BH0A 3EA5A 4W7SA 1NL3A 3CRQA 2ODEA 2D06A 2HF9A 2G1KA 1FMLA 3HYRA 4HLCA 1XCGB 3T12A 1W46A 3TK1A 3TQFA 4HLQB 5FR2A 4IFBA 3S1AB 3JZMA 1XJCA 2YJTD 4HAVA 3T15A 1OYYA 4ILEA 5IK2D 2AL7A 4QOSA 2OXCA 4HAWA 1FUUA 4RZ3A 1QHHB 1GWNA 3I8XA 2FH5B 4FINA 2A5YB 2CHQA 3N2EA 1X1SA 2OHFA 3M4YA 4F93B 1YZGA 3TKLA 2FNAA 1P2UA 5D3QA 4KFTA 4HAZA 1WBBA 3U7HB 1F2TA 3C5HA 1F2UB 3TR0A 1ZVQA 3I8SA 3ZH9B 3WBJA 1M2OB 2WWIA 1XCMA 3BH7A 4GOKA 2HCBA 4DT1B 4EJSC 1Q44A 3A8TA 2Q9BA 3DZDA 2DY1A 2CNWA 2C5LA 4E07A 4ZI3A 2YOFA 5E4FA 4AK9A 2IUUA 3CNOA 3ECCA 3G5UA 2FSGA 3SE0A 5C4MA 3REFA 4AYWA 1NVVR 3SZRA 4GL2A 4QJ5A 1UBFA 3RS7A 4DCTA 4AYTA 3EWSA 1SGWA 2ORIA 2HJVA 721PA 1SVMA 2FDCA 2YVUA 3DOFA 3S1AA 2GTPA 1S9DA 2WWHA 1OH6A 4OK3A 5F9FA 1WMSA 5FTKA 1G291 1PUIA 1F6BA 1T3HA 3LV8A 4DXAA 5B64A 4XD7A 2ZSBA 1KIMA 1ZNXA 3EARA 1TEVA 1Z0JA 2ZR9A 3CH5A 1CRPA 2ZI7A 3RDPA 4URYR 3SBDA 4TTPA 2QSYA 3LY5A 1MKYA 4HUQA 3ICQB 1OFTA 1VIAA 5SZIA 3ZZTA 4IDNA 1OB2A 4HB0A 5BN3A 5KDDA 1KKMA 1RJ9B 4KFSA 3CLVA 4JVNA 2QY9A 3W6NA 2PX0A 4TTQA 3SHWA 3HPRA 3ZZ0A 3VKWA 5DO9A 3FYHA 3TBKA 3MGCA 1G5TA 1CIPA 1NKTA 3D6TB 1KZ7B 1GAJA 2XZOA 4EQ6B 4YMWA 2ZANA 1KJYA 4GP6A 1RC8A 5DHAA 2A5JA 3VU9A 2A7QA 2NO0A 2ZIAA 4IFEA 3H84A 3ND8A 5B58C 1KY2A 4OQMA 4ZV4A 2PCLA 5D3MA 2Q9AA 4E03A 2P67A 2PMDA 2GAOA 5KSZA 1EWRA 2GK6A 1E9FA 2FOLA 3QKUA 1G8YA 5F9HA 2PT7A 4PQRA 4JKIA 3HP1A 1SXJA 3LX5A 3EPLA 1GFIA 1G6OA 1XWIA 5JFGA 1SVSA 1E0SA 1NSFA 1QHSA 2GVDC 4M8NE 4CT5A 2ZQ5A 2P65A 4RY2A 4UJ3A 4LWZA 4D25A 1I4LD 4XIGS 2D2FA 4JS0A 3B82A 3BBPA 2NIPA 4TYPA 3VR3A 3TAUA 5DSZA 3ZVRA 2RGDA 1HE1C 1KMHA 4LBZA 4NZYA 3O8CA 1ZUHA 4XWAA 3FWYA 4BFSA 2AXPA 1J8MF 3QKSB 2W00A 2ODBA 4IJMA 5JEDA 3OHMA 5CIWA 5JZVA 3OIWA 3AVPA 1OFIA 1ZRHA 3VHXA 4GFDA 5DYIA 1OXSC 4MKGA 4Z54A 4TLEA 1IN7A 4AYXA 4EFLA 1HT2E 5C46F 1LF5A 2MSEB 1OPXA 4Q4JA 4V0OA 5CB8A 4CW7A 1UKVY 4Y0VA 2GF0A 2A3RA 1U90A 2BBTA 1GDDA 5TDHA 1KSGA 1Z0KA 3FKQA 3IILA 2CJWB 4LOAA 3C15C 2ZSAA 1XPRA 4M9ZA 2DCUA 4BRUA 1YZUA 1RE0A 2X2FA 3ZDQA 2BEJA 1R2QA 2FJUA 1RRGA 2QAGC 3HU1A 2ONJA 3F5FA 4I99A 1AM4D 2LKDA 1XDBA 4RJLA 3WYGA 3ZD7A 3D31A 5AK0A 3GLHA 3CPHA 4QBGB 5JLJA 1FNNA 2ZI4A 2F43A 2XTNA 1Q57A 3AEZA 4TT3D 2R6CA 1AZTA 2JJ1D 1E2MA 3DHWC 3VNUA 4G5QA 3MWYW 2MSCB 1XEXA 3BIFA 4ZI2A 4X8HA 4GOJA 1A7JA 1S4QA 2XEXA 3B7GA 3QXHA 3JVUA 1A82A 2AD5A 2WOJA 1GNRA 2GZAA 2YHSA 2QG6A 2GEDA 3BE4A 2FEMA 1WQ1R 4Q4AB 3C5CA 5J47A 1DBSA 1G20E 3AKEA 4CRWB 4JLBA 1HH4A 2AFHE 4MRVA 2ZYVX 1NRJB 2IYLD 2QT0A 3DDCA 1N25A 1N5LA 3LWNA 1P7CA 1T3LA 3AF4A 4AKEA 2VHUA 1NIPA 5L3QB 1U0HC 1U99A 2WJIA 3A1TA 1M7BA 2Z6VA 1ETUA 4ASUD 4JT2A 1KMQA 1AS0A 3LO5A 1XCPA 4XSHA 2WAXA 3KQUA 2I1VB 3U2QA 2I3BA 3QF4B 2QORA 2EYUA 3AF0A 5JCZA 2RHDA 1Z47A 2WKRA 3OIUA 4HDOB 3IQWA 5FTMA 3K0AB 2XOKD 4KFUA 2O8BA 2IS1A 1M6NA 3LVQE 1RYHA 5L3RA 3LLUA 2IF2A 1SXJE 1XF9A 4MRSA 5CLLA 4MGKR 3TRFA 2ZJ2A 2GZHA 4MUAA 4AD8A 2RGAA 1P9WA 5HE9A 4BLOA 5B30A 1NSTA 1LTQA 3NXSA 3LA6A 1NVUQ 4O0MA 2ZPTX 3GEHA 3OEHA 4OHYA 3BS4A 3K0AA 1MABA 1VG1A 2ZU0C 1SVWA 1ZCAA 3C16C 3DM9B 4PC3A 4PZLA 3N5CA 1XRJA 3HR7A 4LC0A 3UIEA 1ZAKA 1JECA 1UF9A 1X1RA 4P0TA 2FU5C 2KWIA 1G3RA 3ND9A 4W9MC 2V1UA 1F2UA 2WJGA 4O2LA 2IBMA 4OI2A 4KV9A 4NHOA 2HV8A 1P2TA 5BYJA 4EPWA 1D9ZA 1KO5A 1GKYA 2H17A 2ZJ5A 4ARZA 1VG8A 2NOAA 3KB2A 4QM7A 1OLOA 4Q4AA 1UFQA 1QF9A 3KQLA 1SKQA 3L2OB 1MRSA 5BN5A 4ESVA 1U8AA 1W49A 4Q1AA 4G0NA 2EFDB 2G6BA 3HPQA 3EXAA 1UBEA 4UNRA 4P4TA 4C3ZA 1E9RA 3FDIA 2J46A 1G19A 2Z4RA 5HE8A 3THYB 4D81A 1AIPA 1UDXA 2WSSA 2J87A 3ETLA 2V55B 1IN4A 3QBTA 1TQDA 3U3OA 5FPKA 4UNNA 1AKYA 2IXEA 2BMDA 4A36A 4OYHA 3G0HA 5GJBA 2G83A 4NL4H 5FL3A 2VP5A 2DB3A 1Q0UA 5FBLB 2W6JA 1Z22A 4TTRA 1JAIA 2AD1A 2YC2C 6Q21A 3EZ9A 2OSBA 1E1RA 4X8MA 3C4JA 1NG1A 5EE3A 3QQ5A 421PA 3ADKA 4RSGA 2ZE6A 4DCUA 4ZDJA 1TQ4A 3MRSA 2ZI9A 1DAHA 1H8HD 4B3XA 4UQOA 2ODNA 2X2EA 3U4QB 4I1SA 2OESA 4I81A 3GLIB 3Q7QA 3W3ZB 2JAQA 3CRRA 1MRNA 3O8DA 3PCRB 4GI7A 2G9NA 3E5HA 5FUVA 3CPEA 2JIZD 4LGMA 5DIFA 1YZNA 2RGXA 4M9XA 1OSNA 4JBYA 2ZAMA 4Q9KA 2HLDA 1OIWA 2ZRBA 2YNMA 4V0KA 2IYSA 1SVIA 4OHXA 1KO7A 2CMKA 1PVOA 1WB9A 2KE5A 1UJ2A 5FUWA 2V4ZA 2UZ3A 4TYYA 3FKSD 5L3SB 3WNBA 1GSIA 2XB4A 2O8DB 4NTZA 4E5UA 1TL7C 3GMTA 3ONWA 4L15A 4CEIA 3CH4B 3AP3A 2ONKA 2QQEA 4FCWA 4XWOA 5FUYA 1OJLA 3CO5A 4NYMQ 4TSFA 2HLDD 4PC6A 1TX4B 4DDTA 1E9EA 3GLFA 2J5XA 1ZNZA 4PAQA 2RGCA 1Z0IA 4LY6A 2WWXA 1F48A 2OG2A 1EESA 1A2KC 3DPUA 4H9GA 4DCSA 2B8TA 1XZQA 2JCSA 1G8PA 4Q19A 2VH5R 4B48A 5KHOC 1E6CA 1Z6XA 2G88A 3KTAB 5FBQB 4QG7A 1PLJA 5F2EA 2IS2A 4G5OA 3FMFA 3OE7D 2R8RA 3ZIAA 2AX4A 4EAQA 1Q12A 3CRVA 4A2QA 2CL6X 2ZRMA 1RPZA 1S96A 2CJWA 2JIZA 4OL0A 2FFQA 4YMTA 2BCGY 2RHMA 2IK8A 3QOFA 4HUQB 3KQHA 1QHYA 1E1QA 1OIXA 2WMNB 4TL9A 4KHZA 1NLYA 1JALA 2VTKA 4MGIR 3AVWA 2ZJZA 5F98A 3VR1A 2C98A 1TAGA 4I4LA 4CZ2A 4WOPA 3QPWA 5JSZA 1C4OA 1HE8B 1W48A 1Z6YA 1N6LA 1RYFA 3SHFA 3QI2A 4JMPA 5FBWB 5KNDA 3SQWA 4RD3A 4TMWA 3HYTA 2QNRA 2J45A 4CGZA 2AHOA 4DLYA 4YLGA 1Z8FA 4ZKDA 1E3MA 4RD0A 4DSTA 1HUQA 3BC1A 4FI3C 2OLJA 1PLKA 3B1XA 4QHTA 1US8A 4TMTA 1XXHB 3VQTA 3NC1C 2V6IA 2OAP1 5G3YA 2QENA 2OILA 3X1WA 5E7MA 1YZQA 5TMPA 3RSOA 2CDNA 4HAYA 4PSKA 4IEIA 4RD6A 4DDUA 4D82A 2PBRA 2JGNA 3AF1A 3K9LA 3X1YA 1YJ5A 1KJZA 2GWHA 4MYCA 4PO9A 3RHFA 4BFXA 1HTWA 3IDQA 4LZZA 3RAPR 1L4YA 1XD8A 2ZS9A 4KFRA 4C7OB 4YC7A 3QIAA 1Z83A 3ZQ6A 3MWJA 3P20A 2W6JD 5L3VA 3P4XA 4LBWA 1JAHA 3K0CC 4Q9IA 2IT1A 5FR1A 2N42A 4EJSA 4RZ2A 4XWKA 4TYWA 1OF1A 1QHHA 3WBKA 4PC7A 1ZIOA 4DLRA 4URUR 4YDHB 1FP6A 1CTQA 1DTSA 4BFVA 4C0LA 2FGJA 3KUCA 1DELA 2Q6TA 4FW9A 4HATA 4R2IA 4D2IA 3IIKA 1OE0A 3IO3A 3KTAA 4XD7D 1QHGA 3FB4A 2RCNA 5C4GB 2NZJA 2ZE5A 5K8TA 4L9SA 1CJVC 3SYNA 2QRZA 2VP4A 4BFUA 2IS6A 2P5SA 3BD9A 2VSXA 1X6VA 1COWD 1IBRA 1GIAA 3U6BA 3A1VA 3WYFA 1LS1A 4TWZA 3KKNA 5AUQA 5FOTA 5FOWA 2ZVQX 2O5VA 1KI8A 5AWFC 4AC9A 5AR1A 1NVWQ 1EFRD 3W90A 1M74A 4YQFA 5C1BA 2X77A 2GCOB 1T5IA 1JPNA 4PC2A 3AQ4A 3UATA 2V8OA 1R8SA 3SBEA 2F55A 3LQQA 5UKDA 1PJRA 4DHEA 5P21A 2C8VA 4B76A 2VLIA 3FMIA 3K70C 1QHXA 4OJKA 3F0TA 3OE7A 1GUAA 3RS4A 2HYIC 3NBZC 3EC2A 1EFTA 3AVYA 4IEEA 2YWGA 4KCGA 1X8LA 3WMEA 2WJHA 1ZM9A 4LHVA 1KNXA 2QMEA 2VF7A 4A0RA 3SJCA 1W7AA 1WDTA 3QXJA 4DVGA 3EIHA 2ZXUA 4KODA 3GFPA 3A58B 1W2HA 1KK0A 2IYRA 4US1R 1N6PA 1LW7A 1U98A 5K8UA 1P9NA 2O0HA 1US8B 2ZYTX 2R6FA 4BZQA 2BHRA 2YYZA 3CRMA 2QM8A 4X8LA 5KNBA 2IX3A 1ZU5A 4MKIA 2O8CA 2QP3A 2CXXA 2ZSFA 2EFHB 1QG2A 4NCNA 1COWA 4AKIA 3E70C 2EWWA 2FFAA 2HYDA 2QUZA 2JJ8A 4HDQB 1OT3A 2DFTA 1UEIA 4GBMA 3E2IA 3CPJB 4Q66C 3GLFE 4BQSA 3WRXC 4LDJA 1G16A 2GZDA 2OZEA 3I5YA 1UPTA 3L0IB 3MG9A 2IEYA 3R9XA 4PHTA 3P32A 4LPKA 1D9XA 2ZRJA 3GCGA 2YWHA 4RFSA 2DPXA 3FHOA 3WYAA 1NBMD 4EUNA 1NNEA 4I1UA 3X1ZA 1QVRA 2ZVPX 1AQYA 2ZRKA 3SNHA 4AWXA 2IYVA 2OCYC 2QRNA 4ZDKA 2O8FB 3GEIA 3U5ZB 3LFUA 3ZVMA 3SI7A 2B8WA 1UM8A 3A6PC 3EA0A 3BGWA 4DKXA 5C18A 5CB6A 4Q1FA 4S2EA 1L2TA 1P6XA 1RZ3A 4TMZA 5CK5A 5FPTA 3LX8A 2ZITA 4NBSA 1NLZA 4LV8B 4L5BA 3TH5A 1NF3A 4M0LA 3CF0A 4DEYA 2Q3HA 3GLHB 1PV4A 1E2HA 1E4YA 2IF0A 3AV0B 3FFBA 3CNLA 4QGHA 1YRAA 4V02A 4BECA 2PL3A 4NCJA 2BJWA 2W58A 4A9AA 1II0A 2Z5FA 1G8FA 2V9PA 2WHXA 4LJYA 1HQCA 2FWRA 4Q1BA 5JBQA 1JEEA 1VIYA 4JVSB 2ZR0A 2QL6A 4TZ0A 4FN5A 3C7KA 4YMVA 4Q9HA 4RFVA 4B6EA 5J4KA 1DE0A 2H18A 2BCJQ 2ZREA 1N5IA 2ECKA 4H1VA 4KLNA 1E79A 4MKFA 5FTJA 3VKHA 5KOYA 4IVPA 2C78A 4PHHA 4DZZA 2CHVA 3VX4A 4ZPXA 2WKPA 2WAYA 1CR4A 1NN0A 1FFHA 1E0AA 1VDZA 2HDNB 4IW3B 2EFEB 4IDHA 3KX2A 1OH5A 3LBHA 4K81B 1IJEA 5EQTA 4E22A 1JI0A 3K0CA 1EFRA 3QEOA 4WW0A 2NTYC 1D6JA 3CKLA 4FD2A 4IOJA 2UZIR 3EZ6A 3KZ1E 4NH0A 4Q4HA 4DUGA 5HKKD 1IONA 1IAQA 2EQBA 2OEPA 3QF7A 3H86A 1QHNA 5FTLA 3KJGA 1G5RA 4TYNA 4B32A 1G7TA 5FFMA 2E9SA 1ZW6A 2JATA 3ZQJA 1A2BA 4NYIR 4Q7JB 4YMUA 3R9WA 3EPHA 1UDWA 3LW7A 5J4LA 2WBLC 4BGDA 1NN5A 2QGZA 5HCNA 3H4MA 3GLIE 4KI0A 2HCJB 4HB2A 4KAXA 3T34A 4AY2A 1KHTA 1XU4A 4TT3A 2V6JA 4L9WA 3X1XA 3D3QA 5L8VA 3AVUA 4DUGD 3BFKA 1DAMA 4PXAA 1S3GA 4PAMA 3EIQA 4F4CA 1P2SA 4DLWA 4K8OA 3Q8XB 3QXCA 2ZRNA 4QBFA 4ZDIA 4ARZB 3MFYA 2J0UB 3Q7PA 4PR0A 2BBOA 2ZJYA 5CDFE 4EIWA 5J4VA 1Q1BA 1RW4A 2GEUA 2CLSA 4IOMA 1Z29A 4WA7A 1MR3F 1KOFA 3AVVA 4M4SA 1E2IA 5EXSA 4B75A 2A5GA 5AUOB 3TLXA 1KTVA 1XX6A 3NDPA 3ADBA 1E9BA 1GZSA 2FSIA 5KSOA 1ODFA 4JL6A 3KUDA 1G7SA 2B6HA 4P4SA 5DHFA 4RD2A 5TY0A 3B1WA 4YMSA 4E09A 2HJGA 2X1VA 3ASZA 1E2EA 3I72A 3K09A 3U60B 4WIAA 3U6KA 1S1CA 1FTNA 2OFOA 1QZXA 2WWFA 5SZKB 1EX7A 4QHYA 3SJBA 3DM5A 2FSHA 3FHTA 3SDZA 1IM2A 4HSEA 3PEVA 4PHFA 4M2LA 2J1LA 4PSVA 5TV2A 3J81k 1E2DA 2N1BA 4GMXA 1ZM7A 1CJMA 5CLQA 5IT5A 2VHCA 1W4BA 1GG2A 4EFMA 3WHLA 5BXQC 1TUIA 4LJ7A 3WXMA 5GJVC 2QPAA 1IN6A 1EK0A 1SKYB 2WIAA 3IHWA 4HLUA 4M1YA 2KB0A 2WOOA 2WPDD 1G3IA 3RWMB 4TQAA 4BPBA 3K9GA 4JL8A 2J0UA 3UPUA 2BM0A 4FXPA 5FOSA 1JJVA 4POAA 3TUIC 3T1TA 2D7DA 2VP2A 2GJ8A 4Q5IA 1VYTA 5E7JA 1ESMA 2CVFA 4MITA 1RJ9A 3BAFA 1Z3IX 1UAAA 1LV7A 1BMFD 4BFTA 4V0MA 2OCBA 4QXAA 4TQ9A 5J4YA 1E2PA 2XSZD 3IQXA 1TQ2A 4LUCA 5BN4A 2YWFA 4IXMA 4HZUA 1H65A 5EP4A 5H70A 2XB2A 2ZR7A 1E4VA 4CYMA 2J0QA 4M1TA 3RS5A 1TU4A 2GBLA 5FUXA 5A5GA 2WWYA 1BO6A 1W44A 1YE8A 2CE7A 2V7QD 3KQKA 3I62A 1DG1G 2DWQA 2IS4A 1IQPA 1NBME 3IBGA 1BMFA 4PZYA 5DE3A 4LYHA 2KJQA 3U7EB 3ZJYA 4WBSA 1YU9A 3NVAA 1P73A 4GT1A 4PPQA 3U61B 2HUPA 1E1QD 1ZINA 5JWHA 3NG1A 4LYFA 1QDEA 4LHWA 5FTNA 4HEJA 3THWB 2H5EA 4Z8XA 4DDVA 1P75A 3HU2A 3PVSA 4A0GA 4DEXA 4OI4A 3IEUA 4ERNA 4PPFA 5JJLA 3F8TA 2WJJA 3QBVA 1KI2A 5E3HA 4NCIA 8OHMA 1ZJ6A 4B47A 5EUMA 4FIDA 2YOGA 1II8B 1OB5A 2QMHA 4B73A 1J90A 1XMSA 5L3QA 4O2RA 1ZCBA 2HXSA 2IL1A 3B13B 3CONA 3DL0A 4Z51A 2ZE8A 2C77A 2DHRA 3AP2A 5CM8B 1X3SA 2OAQ1 4G5GA 5HZKA 4TLCA 2GF9A 2Z0MA 1R7RA 1DAGA 1E9AA 1VECA 1XZPA 2ZI6A 2NGRA 3CR7A 1KDTA 1XTQA 4BE7B 1TPZA 4UNQA 3PUXA 4DWJA 4NCHA 1H8EA 3AB3A 5HR5A 1P60A 3EPJA 1DEKA 3FTQA 4MYUA 1T6NA 2ODWA 4U7DA 4BLRA 2IYXA 5JMTA 4G1UC 3TAHA 4B43A 1JPJA 3IGFA 1U2RA 2GCNA 2GA8A 3A4NA 2ORWA 3EG5A 4M1WA 2F1IA 1E96A 4US2R 1G41A 1XP8A 2FFBA 3K9NA 2GILA 3CX6A 5DYGA 2D4HA 2JLVA 3R7WB 2FZLA 4II7A 3VR2A 3QY0A 2ZRCA 2AR7A 5DH9A 2JLRA 4NMMA 4EPXA 3IHLA 1JBKA 1CJKC 5KO2A 3QSYA 4OK6A 1X8JA 3TGPA 2XXAB 4LC1A 4QC2A 2REBA 3DMDA 2RGGA 3PEYA 3BH6A 2W0MA 3I3SR 4EJSB 4KSBA 3QENA 3EWAA 4D4JA 1W36B 1G17A 5TB5A 4MQBA 1S8FA 2BKEA 4JZKA 2W6IA 1SXJD 2FPKA 1XNJA 4ACAA 2JLXA 1IN8A 1TADA 4FMBB 3QXSA 4M22A 2EWVA 2FMXA 1H8HA 2VEDA 3C41J 5HPYB 3QKSA 1XTKA 1NY6A 5ANRB 1JQLB 3WP0A 3MUFA 3B2EA 1FX0A 2G0TA 4PANA 2ZSEA 5AUPB 1E2KA 1KI4A 2IYZA 3K09C 4ZCMA 2CE2X 3OF5A 5CYOA 3B1YA 1FQJA 4DRZA 3UWOA 3DKVA 3UMSA 4OQXA 2QI9C 2GKSA 2R65A 5B57C 3NBYC 5CJPA 1JEDA 4EDHA 1T0HB 2PZFA 2KBEA 3EX7C 2DBYA 4K46A 4PC1A 1FX0B 2ZUDA 3P26A 4MA4A 3GQBA 3GJ0A 3OFNA 4Q01A 5AJWA 4UXHA 821PA 4OBEA 3TUJC 3AM1A 4UKDA 2D3WA 2RGNC 3OEEA 5EXTA 4JLKA 1KDOA 1S9HA 4LPSA 2Q9CA 1AS2A 2C9YA 1EFUA 2OE2A 5BQ5A 4EFNA 2AN9A 3GPLA 2JLQA 4RCZA 1AGRA 3FKSA 2OBLA 4B6FA 4YDSA 1NI3A 2AFIE 4O3MA 3M6AA 3GJ5A 5LPNA 3KXLA 1XPOA 1E0JA 1CS4C 5AJVB 1WF3A 5EXPA 3VKGA 4JL5A 3QUSA 5TXGA 2XXAA 1AN0A 1D5CA 4I1OA 1KDPA 1U94A 4TN1A 1E2NA 3PUVA 1JJ7A 3KXKA 1JR3D 1BKDR 1LF0A 3AKYA 3T1VA 4ABYA 3U44B 4UNSA 5KNCA 4P31A 1CJUC 3U3RA 1T8TA 2F3RA 1JNYA 4LYAA 2ERYA 3B9QA 3VMFA 4WZAE 4B3CA 2IYTA 1J7KA 2BC9A 4B34A 1FMJA 1Z63A 2QPOA 2YC4C 3FOZA 3PV0A 2CLDX 1TF5A 3A1WA 2JEOA 1N6KA 3UG7A 2O8CB 1JR3A 2C99A 3LXXA 4Q02A 5GVRA 521PA 4EPRA 4AI6A 1GM5A 4WZ6A 4KLZA 3RRMA 1W0JD 1G5PA 1Z6GA 2WVJA 1DADA 4P33A 1XB2A 2GJAA 1HYQA 3LBIA 1GL7A 2JLZA 3CUEF 3REGA 4DT1A 2ZRHA 2CCKA 3A4MA 4A6PA 1SULA 4C0AC 3W9YA 4HLUC 3H0KA 3KDSE 4DDWA 3DEFA 3E1SA 1B23P 4IRUB 4OHVA 3ZYCA 3CR8A 3FPAA 3N70A 4RKEA 3P4YA 2H1LA 1EX6A 3EIEA 1XFAA 2P6RA 1CEEA 1LVGA 1EGAA 5IK2A 4XTRA 3F3YA 2P3SA
chains in the Genus database with same CATH superfamily
2VSOA 1BDMA 2OORA 2A78A 1K97A 2WYWA 2FF7A 1I7SB 3UUGA 1VL0A 1Z75A 3R5KA 3W2EA 3PJEA 1W6UA 1KY3A 4ZZ3A 1YQUA 2OBMA 4G97A 3IEVA 3H3FA 2QP9X 3IQDB 4KMOA 2YUTA 4UAUA 1EEHA 2ZWOA 1JB1A 2P9EA 2XYRA 1E62A 1EAYA 2Y1FA 4LN1A 2SKEA 4G36A 3ULKA 1W0KA 4XIYA 5AW5A 3DAFA 1FIUA 1GPDG 2X0KA 3OTIA 4DLUA 3NGLA 3EOBI 3MXTA 4J4TA 4KJXA 3M1AA 3TD9A 4OLHA 1Y7LA 1JEYB 5JRJA 1UKCA 3HFJA 3OKFA 3ZBUA 1QTIA 4RZUA 2ZJ6A 4M87A 1CYEA 1AMUA 3FZGA 2BZSA 2JLBA 3O8OA 4DCOA 1A5ZA 1UBMS 1P1HA 1Q0QA 2QRLA 2VDJA 3CU5A 1CUAA 1DCKA 3TNDA 1ATIA 4FT4A 3EBOA 2BGIA 1EFHA 3VKUA 3X2FA 5M34A 5LL6P 1E0DA 4JBXA 1RWXA 2BIFA 3HDQA 2GTIA 3DV0A 5FI0B 3UENA 4O4IF 5CFLA 4N3NA 3V1KA 5FPQA 1Q1NA 5DLDA 1J1IA 3NHAA 1B76A 4L27A 3BFVA 1EYZA 2OO5C 3JY6A 4FDLA 4A82A 2R85A 4NX2A 4C4AA 3LF1A 2QROA 2BF4A 1JDJA 5CB4F 4KGVA 3U62A 2IC5A 1OKKD 2IPMA 2J30A 4BVJA 3GFFA 4DLLA 3HO1A 2W2TA 4YRMA 1ZMOA 1Q5PA 1Q15A 1V43A 2OD2A 3FWZA 1NUPA 4C30A 1J0DA 3A2NA 3RBVA 1P45A 4LVOA 2GD1O 5AI5A 2Q0HA 5JDIA 5IULC 4UC0A 3KSAC 1CP2A 3EODA 3BMXA 5EJEA 2D4AA 4BMSA 4X20A 3D02A 3GF4A 2HQSA 4EUSA 3ELYA 1DQYA 3WLPA 3CB4A 2IXFA 2ZJBA 3ZK8A 3T5DA 2KLHA 1JE1A 4RD4A 4A2WA 2B9EA 2KS6A 2KSQA 2QT1A 2RBKA 4JYMA 5EWMB 1HDEA 4GD3Q 2ZKLA 4ND3A 5BSMA 3VAZA 4E2WA 4F8JA 2O8VA 2XT0A 4NP6A 3GR6A 3DOUA 4P4LA 4Q4HB 1ZPDA 4ZO4A 4PLVA 1U6KA 2R8PA 2JL1A 1LDYA 1CCWA 4MX8A 3EMBA 4G5FA 4LBYA 5HF6A 1T2EA 2VJOA 4JI3B 1GKLA 3C7CB 3PFGA 4LWQA 3ABIA 1JBEA 2PSHA 1ZRNA 2QKYA 2JLSA 3M49A 1QUEA 3NBXX 3NV7A 1EP3B 3P0EA 1IXSB 4GWKA 3U4GA 3UK6A 2NZYA 2D1QA 4QT4A 4YJ2A 1AXEA 3FYUB 3U37A 1R0BA 3LQ4A 4L8FA 3HL4A 2J09A 3O38A 1C80A 1G4UR 4RPGA 2AMFA 5H1YA 2E4AA 5BN1A 3BULA 2Z6AA 1EGHA 4X7PA 1GQQA 3B36A 1JDTA 1GVHA 4RKYA 4ZDWA 1G6Q1 3OG9A 1WE2A 5AK5A 1E2LA 1U7ZA 3V9PA 2WYOA 3BJMA 3SFZA 1G21A 4AG6A 5A5VA 2VPPA 3FOFC 4IWNA 2QDXA 1SBTA 3I52A 4A8HA 5BPHA 4LSMA 5FP0A 3SJZA 4GOOD 4H4DA 4RK4A 4AZ0B 1GG5A 1Z0DA 1RIFA 3AI2A 4BMDA 2RGRA 2HW8A 4FOTA 1RHJA 4DA4A 1JT2A 1HORA 1NKVA 4ZI5A 3I2GA 3SC6A 1ZI9A 4AN1A 4AP9A 1GZUA 2DHDA 4LYJA 3RLFA 5T5QA 4CM8A 2OUIA 2V5VA 5EXXA 1PGOA 2WTNA 2H0AA 1N2CA 1OFHA 1U3WA 1WD5A 3LHIA 1Z08A 4W82A 3SJAA 5LKAA 2PH1A 1N7IA 1EHYA 5H9VA 4N8EA 2G6TA 1UADA 3ETDA 4LJ4A 4CCSA 4EPVA 1M1YA 3R0IA 2Q1UA 1N6IA 2O8DA 1DAEA 1TCVA 1NG9A 1NLFA 3O95A 3RFUA 1SC6A 5JNUA 4AJIA 3KL4A 4Z9AA 3E35A 3ZCPA 1SUBA 3JVVA 3ZZ0A 2GCIA 4V0ME 4Q00A 4FDUA 1S7CA 4NYJQ 2VQFB 4RY9A 2EX4A 1YQQA 3QLVA 4RMJA 2X8AA 1E2BA 3OM1A 5EWJB 3ER9A 2QLJA 1XWFA 2QN3A 1YAHA 2RHHA 2WJ4A 2H8KA 3HB0A 4JLPA 4R98A 1FK8A 4MIEA 1RCUA 5IHXA 3M3HA 3HJFA 2R44A 3FPLA 4IILA 3SQNA 1GQOA 4D96A 5HCIA 4N7RA 3EXEB 5EERA 4A2PA 2OK7A 4U02A 2ZM6B 4O33A 1N0HA 5AKGA 2OFPA 2ZRIA 2VUUA 1UBGA 1BEZA 3CWZA 4CKXA 1INLA 4ZEMA 1LS6A 2QZ4A 4RH3A 3VR4H 4YXWA 1FPMA 1A4RA 3EF0A 4LX0A 2FRDC 3S8MA 2OZLA 1Y6FA 2JK1A 3EEQA 2GHQA 1B74A 4N7MA 5KYKA 4RTSA 2EOAA 4FE7A 4GG1A 3FPEA 3T9FA 1KK3A 3M70A 4GSYA 1YZTA 4MRMB 5IBQA 4XKJA 2BEUA 3OETA 4F4HA 1XD9A 5BR7A 1J0XO 1TJNA 3AEYA 1PP4A 4I55A 3JQAB 1XDUA 3B85A 3AM1A 5DNDA 3ACBA 1FL9A 2HHJA 2QSZA 3OX4A 5LLSA 3RG2A 4CMBA 1T0PA 4X5OA 3H8SA 1KPHA 2GXUA 3GD5A 4RVGA 3RSZA 1Q17A 3RRJA 3DLPX 3Q72A 4N0EA 3KZMA 2GJSA 1I24A 4J7CA 1QGUB 4DSNA 1TZMA 3AEUB 4CTKA 2JKZA 3T3HA 2JBAA 1I7DA 3Q9UA 1I2CA 1X7WB 4GP7A 2ZWIA 3G59A 1AHIA 2XITA 5KSWB 2ZI3A 1GXSA 4Y6OA 3NT2A 3IMCA 4R51A 3FY4A 4O63O 3SMQA 1Q84A 1NW3A 3UJ8A 5F33A 1C1XB 3OI7A 3OT1A 3G2NA 3ZXSA 5E3IA 3L8CA 2IX9A 4BGVA 5A03A 4L07A 1K7XB 2VDRB 2QX7A 4XWGA 3SYTA 1N3LA 4CIXA 4Z9XA 6GPBA 4G0UA 5CFQA 4V2IA 3C6KA 5LC1A 5JS2A 1TJPB 2P9YA 2AFRA 1NFRA 3SCZA 3R8FA 2I6XA 2O2DA 1DIBA 4JGGA 4WADA 2HUNA 5EFOA 1WABA 2GVNA 2FHPA 1A8UA 2YRWA 4B0PA 3CE6A 2ZVDA 1HPLA 2YVKA 4FONA 2GWRA 1N4DA 3MCWA 2FZWA 1RTTA 2X58A 4MDEA 4KBFA 1IYZA 4IQGA 4Q16A 4WACA 3RRNA 1V1RA 3G0BA 3RAGA 2AQKA 4QAJA 3R6LA 4AURA 2FWBA 1HR0B 1QVWA 1OXTA 4H1TA 4N01A 4QUGA 5L3ZA 1GQYA 2X3UA 3CIOA 1MJ5A 1JMVA 1A9QA 1P4SA 2YINC 1QJ4A 3L0BA 3ZWXA 3KZNA 4UBNA 5ALIA 4XFKA 3VC2A 1IZ7A 1F8UA 3KAJA 1SK9A 3EGDB 4RTMA 4R7ZA 3I32A 1K9SA 2X14A 1GVNB 2B4YA 1XAJA 2QLFA 4OKNA 2B9VA 4UE6A 5JJBA 2NG1A 3CCCA 5MFZA 3GGSA 4CM9A 1HZZA 1I4TD 1N5MA 1U7WA 4EKIA 1O95A 4NEHB 4CKEA 1SUSA 3I5XA 4EKNB 4ZVRA 1LJ8A 1Y89A 3GP3A 2H00A 1DKQA 1OHHA 4C3VA 2LWIA 2Q28A 3PENA 3TPCA 1XKTA 5AVQA 3QELB 1XLUA 1SU7A 5HW0A 1U9ZA 4AL4A 1DX4A 1KERA 1KH1A 4NEQA 2W90A 4N4AA 5DHUA 4F4IA 3NI2A 1LB1B 2WPDA 4EPTA 1NX6A 3KBOA 4JASB 3QTBA 3I3OA 4X84A 2VJQA 5BOSA 4WXRA 1KVQA 1YQTA 1Y1LA 4XAQA 4DC9A 1OXKB 4XW2A 1EB9A 1SUEA 2CLEB 4UFNA 3IESA 2RK3A 4C7XA 1KAEA 5D6NA 1KXZA 5ALOA 2P6NA 3TDNA 5K05A 4FB4A 1XXHA 4UBOA 4YRAA 3ADCA 5BWBA 5K99A 5A4JA 2JFBA 4QDUA 4XA8A 1F1JA 3BRCA 2QAIA 4EI8A 4PM4A 4MSUA 3ITKA 3AETA 3OLVA 1D4ZA 4LYYA 3FHLA 4YIHA 4TV8A 4ABTA 1C50A 1UFRA 4LXXA 1PZGA 2DZDA 1Z5VA 3RBZA 1X77A 3NETA 4P92A 5CXSA 4HCJA 4FUTA 1BIFA 2QM7A 2E2WA 2P9QA 4ND8A 4XFJA 4OI1A 2JLWA 1DS6A 4DM3A 3PNKA 4ONEA 3PUWA 2Y0BA 1H4TA 1XMQB 1CIVA 1QQTA 4PGMA 3NAMA 2BMJA 4HYYA 3DE5X 2BEVB 2D5BA 2R6AA 2X8JA 3N8GA 5JQGA 3U44A 5LQMA 2W6PA 4IZIA 2CHGA 4TL8A 1R6AA 1GDTA 5HF9A 1Z3CA 2WJYA 5K09A 3W1WA 2O8EB 4RBNA 1K6JA 1ML4A 2PUHA 1XZHA 1UMCB 3DP9A 4JLSA 5ENDA 3TNFA 2LP4Y 1D2CA 3SP1A 3U7IA 4CMCA 1K1EA 2VCHA 1IEQA 1JHPA 1UWKA 2W2XA 1M1NB 1B42A 1DQSA 1CUDA 4AZ3B 2FQWA 2PUWA 5ARCA 5G0SA 2VHJA 1MVLA 2AG1A 2GXAA 3CEAA 5H83A 1N2OA 2PTGA 1NFQA 2OB2A 3USES 4L7VA 4MS3B 3BFPA 3IMFA 1SU4A 2A30A 4I4TB 3C97A 4DB4A 1FLVA 4CEJA 1Q7EA 2VNIA 4LV5B 1ZVJA 4YLYA 1LC3A 3OIVA 2Y71A 3FCAA 1TE2A 4KIFA 4DIUA 2WINI 3ETGA 5I7SA 1W36D 3PKZA 2XJ4A 4BNUA 4PSUA 2CL7X 4ICIA 1ONOA 1EMDA 5F64A 3I09A 3S2YA 3WX0A 3DL2A 1CK4A 3LCUA 4D0LB 4RM3A 4TMYA 2D62A 2BLNA 1KKUA 1ZVMA 4WESA 4JJKA 5KNCD 4N40A 3I76A 3C1UA 3KYJB 1ZGCA 4KRXA 5HILA 4DSOA 3X1DA 3CM0A 1JR6A 1E3LA 4HBZA 4QECA 2CL0X 2QN2A 5LP6C 1KI3A 5IP5A 3PXGA 1IXRC 1JIIA 5B1SA 1CRZA 1XBTA 4RSHA 3RYTC 4C4ZA 4QDTA 4JD5A 3MS2A 5PGMA 1Y81A 2FLKA 4L57A 3UJ7A 1HDIA 2OBNA 1G18A 3M5CA 4E30A 1PK7A 1UBRS 4PYJA 4TXLA 1PL8A 1J07A 1NI4B 1VBFA 3IMEA 2CFCA 2R79A 2ZPAA 4J0KA 3SZMA 4NATA 1OY1A 1BVYF 2WTXA 4GQAA 3RRFA 4H60A 2VQSA 1PJBA 3N2IA 2RGEA 3OOWA 5LQNA 1LH0A 4JJ6A 4BLTA 4ER7A 4WK6A 3H5OA 7AT1A 5CD1A 1T4CB 4R5HA 2XMGA 1Y8QA 2GCPA 1UL1X 2EFCB 2C07A 2BR5A 4OKSA 1QGZA 3H9BA 3KVNA 3O4VA 4ZHSA 1A77A 3ZHVA 3I92A 2E49A 4X1IA 1QO9A 5EIAA 2UV8A 3L8YA 1TO6A 1H0KA 3T1YB 4QVGA 1K0FA 3O2NA 4BFZA 1K5DA 3KWJA 1KGDA 2V7QA 4QNRA 1FBNA 2QEQA 3OO0A 4CMIB 1T8WA 5CDGA 3LTNC 4A3SA 4JELA 3TTXA 1PFYA 5IRCD 3RFTA 4FOPA 4ZZIA 1L8LA 2BGJA 3M5WA 3EMVA 3EZFA 3R0JA 4ATNA 5MF6A 2V7TA 1GGNA 3ABSB 1G3MA 5GAJA 3DF9A 3GW8A 3N75A 5TVKA 2NVWA 1ZUIA 2QBYB 3JR7A 3QJGA 1NBOA 3D4LA 4RORA 4IH9A 4B3BA 3TLBA 2RDMA 2YX1A 4XZ3A 2X5KO 1USGA 5G41A 4U7GA 3AESB 4UQPA 5I4BA 5EE0A 4QL3A 3BGSA 2YKGA 1M6VA 3ZQ4A 3PB3A 5ALVA 5GP1A 1I9CA 4RF3A 3AUJB 1UMDB 1T29A 4YAEA 3DQQA 2AJBA 1J70A 2Z2ZA 1FFWA 1C9YA 3DFIA 1WU8A 3IEIA 2AZDA 3LD9A 4UVIA 2D2EA 4J0IA 2R6DA 2WD7B 3V8MA 4X8OA 4KXVA 4DCGA 4IUCS 1KO4A 4TV8B 3R20A 1DO0A 1SUCA 2QMOA 2H7XA 4P32A 4Y2RA 4E51A 3O4FA 1BMQA 1O97C 4J0QA 1PN3A 2X41A 2AS0A 3IPCA 5B3JA 1XTJA 1S8AA 1ZOIA 2H4FA 3A6KA 3LSYA 5L4LA 3ACCA 4X1IB 2W43A 5HGJA 1ACJA 3W9BA 2GD2A 4FKZA 2VHYA 5THXA 5CFOA 1NIJA 1DQZA 1Q0SA 4DPMA 1AG9A 1W88B 2IXGA 5ADVA 1JTFA 3E3NA 1E98A 1SURA 1WX1A 4YMHA 5CA1F 3K16A 1RKUA 3OJFA 1QIIA 4KQCA 3RC3A 4B6PA 4F4DA 2XLBA 3ZV5A 3RARA 3MT8A 2NPFA 3ZLBA 3NBKA 4PCVA 2Q9UA 2P5UA 2HWXA 3P2MA 4CDGA 1ZK0A 1NN3A 1NR5A 3ZIAD 3IMGA 4CNBA 2GPTA 3DLAA 4PWYA 4ZU1X 1D6SA 2JAXA 4S35A 1DCTA 2VO1A 1JFFB 1T0BA 3V2HA 3ME5A 1G38A 1V7ZA 3WNDA 4K88A 3L1HA 4V2UA 3UMGA 2AXNA 3EGXB 5FWAA 3UMCA 2IEZA 1VMDA 4Q48A 4DWVA 3KG2A 1HNXB 2V1XA 3NTUA 2BR3A 3GEGA 1XZKA 2O9JA 1QGAA 4EB6B 4UXJA 5AK6A 3E4CA 1NJ2A 2VHQA 1WOYA 2Z58A 3G6WA 4KDRA 4A0FA 1QNLA 4D0NA 1H5NA 1MOPA 4BFWA 3F5MA 2E85A 3UB2A 3JTEA 2D8MA 2HFKA 3UICA 1F14A 1V6SA 3IDZA 3JSXA 2AZTA 2WUGA 5ALTA 4YP5A 4N1AA 1XD2A 4EYKA 2ILTA 1WA5A 3L1IA 3C8HA 4BO1A 3QYJA 4O0LA 4AKGA 1X80A 5TJ9A 1IPFA 3W5IA 1ORWA 3IBCA 1C5KA 1KU6A 1QDLB 1P4HA 1RHUA 4MLPA 4OQLA 5AK4A 1IHOA 5CBPB 4ZQEA 1R4AA 3DL7A 1Z28A 4QDXA 2BOVA 2Q4EA 2PKRA 3BB1A 3DT9A 4CCYA 3EZ7A 3GJ6A 3S8EA 1QU3A 4ZYXA 1J2TA 5I9LA 4S1VA 4QRDA 4Q47A 3CEJA 3VYSB 5IBCA 3W34A 4H0CA 3CVYA 2IWRA 2QTVB 2Q2WA 3I9V6 1JDVA 2R7KA 3Q10A 3G8YA 3EAGA 1VG0B 3GZNB 2A8YA 3MTQA 3NYWA 1VGQA 3CSSA 4JWKA 4W1PA 3ROMA 1ZD1A 5C5EA 4L02A 2QRMA 4IXWA 4LA4A 1T9GR 3BXFA 4L8GA 3TFWA 3IYLW 4DBLE 1TZJA 4PBRA 3AUXA 1KO1A 2JK0A 1VCOA 5JATA 4JP5A 3MK31 4Q3OA 2PSJA 3VH2A 4BO4A 4Z4GA 1U0OC 1Y8AA 4ARCA 2FSFA 1EK6A 2XUAA 3IBTA 2VP9A 2D54A 3OUTA 4P35A 1YO6A 4OP3A 5JW6A 1FUKA 1L5WA 2FEPA 3IIMA 5CCXA 1QC5A 4P5PA 4Q39A 1LLFA 4ZT2A 1BWQA 2NV2B 4NDZA 3ZHTA 1XZLA 2C5GA 3M6XA 2JH3A 4UHCA 1NBIA 1XK6A 4RHCA 4U8HA 1GT6A 2FCAA 2R00A 4WT7A 1JHOA 2XQVA 1N8SA 1N3BA 2BEUB 4LKRA 5JCOA 5SZHB 3UAOA 2AT1A 3LMKA 1K27A 3WHKA 3L49A 1YR3A 4WV3A 3O31A 1OWLA 1DQRA 1PNRA 3JQCA 3VX3A 1TEXA 3IR5A 4HD8A 2R5NA 1T6ZA 1WP9A 3R6DA 4Q03A 4KE6A 1M1YE 4XTCS 2C8LA 2MMCA 3L8MA 1RDFA 3TI9A 3HR8A 1JWBB 3P27A 4JROA 5LA6A 3IP1A 3ZOKA 5K8VA 5LLDA 2NT4A 3NHPA 1T2DA 1HEIA 2YYAA 3T9CA 1V1MB 1V3TA 2YYYA 1YB6A 1GN9A 1Y6GA 2Q3MA 3LPAA 4QYIB 2OXTA 1NNUA 3FYDA 4RMIA 5HDQA 1LLDA 2AN5A 3TQSA 2ETXA 1NHGA 4HEQA 2PM8A 1ENOA 4KYVA 4QREA 4PO8A 1DV1A 1CKEA 2AWOA 2FG6C 4L74A 4QA9A 4QHSA 3SOPA 3R7NA 3K0SA 1K5PA 3HWSA 4BKMA 4PYKA 2JJ2D 3TTYA 1XDSA 3Q12A 3U9TA 5ERGB 2XTAA 3GJYA 4N12A 4GVLA 3VVMA 1DQPA 4TLBA 4Y1RA 5FUMA 4U5QA 2RK6A 2PX3A 3ADOA 2F4VB 2DY0A 3G0CA 5C8YF 3RUIA 4CF3A 2Z5LA 4PLTA 1YJBA 3Q87B 1J09A 5T4FA 3GAMA 2AC2A 1JE0A 3HVRA 2OGWA 1ZC4A 4OFWA 4E31A 4P3XA 2WMOB 4HS9A 1BXKA 3GCZA 3G17A 2WT8A 2VJAA 1R9MA 4ZAGA 1A7KA 1S7GA 3RBAA 1OH8A 1JHVA 5K0LA 5HS4A 1TVEA 3QKRA 4W5QA 1M8PA 2O05A 2YS7A 5BUSA 1ZD9A 2J5QA 4KRFA 3H2ZA 2BJHA 4KK3A 3EQ6A 5FBHA 2QG9A 3GA0A 3T0GA 4PQEA 3B9BA 1BRTA 1QCDA 1Q1AA 2AEFA 3KZVA 2CVHA 4LZNA 5GGXA 4B4DA 2CCGA 3D1LA 1PFVA 1YBMA 5JSYA 4AJNA 5J1TB 2PMCA 4D1YA 5FWYA 5LOVA 2VBCA 2D6FA 4YUYA 2QTVA 4I0WB 2WHRA 2CB9A 4PLPA 1CLUA 4JVMA 1S2LA 4OP1A 5DGHA 4JN6B 3ZHQA 1M33A 1DBPA 4WCFB 1JJFA 1EQUA 1G4AE 2VYFA 3H7AA 1P77A 1U9IC 4RZXA 1FZQA 4M1ZA 4LZLA 3S2ZA 2NUTA 4PCLA 3DKRA 1NKSA 5ICMA 3LQ1A 5F3WB 4P53A 2Q1WA 3DWIA 1NQVA 1KEVA 3BB4A 2WVGA 4FYMA 4UCWA 3TE6A 4YRJA 1B8OA 2EZTA 1Z26A 2QN1A 4JEHA 4KQJA 4U6NA 4PG8A 2DHEA 2QZSA 1YR2A 2VUTA 2Z9BA 5FWXB 3OLQA 1GITA 1YIDA 4OU4A 2GRJA 3T7EA 4JGBA 1Y8ZA 1ACLA 4MW6A 3RVKA 4P86A 3R7BA 4FS8A 4HGQA 4JIMA 1ND6A 1YR9A 1T91A 2XCIA 1L4GA 3H0EA 4Z8YA 3ZTWA 4G0WA 1TKRA 3K0KA 4IHKA 4KO1S 5D6OA 5JAQA 2QD3A 4UPDA 1I7QB 4O25A 2J7PD 1IB6A 1NYLA 3HEAA 2R8OA 5HEKA 2DERA 2BGGA 3U4MA 4M0UA 4S05A 3FCCA 4MS4B 2H31A 5A5EA 4RLQA 4CKBA 1Q1GA 2QL7A 1MUUA 1QIMA 4YCDA 3KKOA 1V9CA 4FEGA 4XCQA 2GEVA 1SQSA 1PUJA 2M9MA 2CEAA 2H1SA 3HVKA 3ENZA 4NYJR 4MVJH 4I2VA 1WXIA 4ISCA 2N46A 2R6R1 3TPZA 1JRLA 2V7GA 1ISHA 4NU0A 1KAQA 4KXUA 1VPVA 4KPYA 1JR2A 3NH6A 4KAFA 4IX9A 4LRSB 4R1QA 5TEWA 5TQ2B 4MGZR 4CFZA 4CF5A 5JAIA 3D0RA 3THYA 1CU1A 1H2BA 3PXBA 1ZLYA 1PDOA 2GETA 2PGIA 4YJ2F 1ZNWA 2VJDA 3K6JA 3IDOA 1L5VA 2X3FA 4TV9B 5E8JA 1KDVA 1TMOA 2GNPA 4NCKA 4OFXA 3DBRA 2JJQA 5KJ1A 1YFJA 1W59A 1G0NA 5GQSA 3PUIA 3D8UA 1EWYA 5CM9C 121PA 5ED4A 1QBKC 3IHTA 2HRZA 4D0SA 4C06A 2NSLA 1Q21A 2Q5LA 3PR3A 5D8DA 5LB4A 1TIPA 3SXJA 3UT5A 1M6YA 1SEVA 3LGSA 2AOXA 4MVJG 4QYTA 4TL7A 4DCVA 2B1IA 5CVTA 2MR5A 4KJZA 1UBUS 5FAXA 2Y68A 3BRWA 1YVDA 1VFNA 2XE4A 3P1JA 3PGJA 4ZO8A 3SQDA 4CLHA 4LDZA 1UFKA 3OOYA 5A6SA 3IQGX 4D4LA 5K0JA 2E4UA 3M1YA 3DAOA 2AWNA 1IOLA 3CW2A 1MOZA 3DXXA 5LB2A 4IM7A 3H75A 3H2HA 1N2CB 4LJ5A 3UCXA 3VZPA 5HIMA 1LNZA 5B4VA 2YV3A 3HS3A 1TT5A 3VISA 4RWEA 4XEUA 2WV7A 4F91B 2QTHA 2JHAA 3W1VA 5E6RA 1GTSA 2QX9A 3NWOA 2GH1A 5CMLA 1HRDA 5I9NA 1PR6A 1S2OA 1AKEA 3KKQA 3P52A 2FZ4A 3LRPA 3G2JA 4FZVA 2X86A 4F2DA 3RS0A 3WL8A 1OA0A 1T1IA 5JJIA 4ALNA 1GJRA 2TRSB 3A9SA 2WICA 4QQNA 3P8ZA 4RZIA 4ENQA 1KS2A 1CJSA 2BJVA 1DT5A 2TSYB 2YQ4A 3GZJA 1EM8B 1XU7A 2P9ZA 4MVWA 4PYIA 1ORHA 3U3ZA 4F3CA 1JR3E 1H0HA 2XUKA 4KR7A 4D9EA 2V7XA 2J9FB 1P1BA 3D2CA 3G2IA 3QY9A 3LDAA 3UF0A 4L3WA 2JKYA 1R5NA 2VP0A 4IDDA 1PK8A 1YR7A 3JYQA 4IIJF 3PJGA 3KTOA 4BNDB 4I8DA 4UUNA 1Y9JA 2H51A 1DVRA 5EUQB 4JSYA 3SE7A 2HXYA 1RQPA 1UXKA 2XOXA 1CNEA 3PYXA 3QF4A 2BUAA 4IRMA 1GTVA 2VATA 3LL4A 5KZMB 1R0YA 1SC4A 3GYGA 3ZS9A 1PT9A 1N6OA 3AHGA 2NUTB 3UM9A 4LOHA 1N2BA 2WFLB 3VSCA 4H3KB 1J33A 5EP2A 5L6LB 3DO6A 4AO7A 2BFCB 3I5AA 4BP8A 4DUZB 4A27A 2VS1A 1A1VA 1XTTA 3X43A 1ML3A 2IWHA 3ORQA 4XYEA 2R11A 4TOIA 4KO8A 4LTMA 5DN6A 1XIVA 3WLKX 1KBQA 1J2YA 1HETA 2G4LA 2PXHA 4F92B 4PZPA 4GLOA 3TI7A 3VR2D 1MJGA 2XNDA 2HC9A 4KO3S 3ZXXA 2CJYA 5JI2E 1N5RA 1ADJA 1XTSA 1YXMA 2J3IA 3OCWA 4RADA 3G0GA 4MVYA 4G9GA 2XDAA 1BE0A 3ZWDA 3H13A 1H66A 1QSGA 2DU8A 3BSWA 5EE9A 5FQOA 3T06B 4A0QA 4BNWA 4GGOA 3KR2A 3BJRA 3RT9A 1DARA 1AA9A 2F43B 4I14A 3FCYA 2HNBA 4BJ6A 5K8JB 2ZBPA 2L0XA 2P2NA 2ENUA 3FMVA 1QP0A 4BVLA 4X93A 4GW3A 3TTSA 3KZOA 1ULSA 2GBCA 1ZM4A 2QLNA 1XTBA 4C0KA 3G1UA 3C5WP 3JQFC 3PJFA 1T10A 4MW0A 5IW8A 1JJIA 5GVSA 5JRZA 1B14A 1HFKA 1MV5A 4FKMA 4OQFA 2G5PA 2FWAA 3K2EA 4CKWA 1BROA 1P31A 3PYMA 1TZBA 2WQ6A 2OO7A 5B2FA 3RJTA 3RGWS 3FUVA 5E0OA 4UATA 5DB4A 3OIDA 3CN7A 5BSUA 1DBWA 3L1JA 3LXRA 1GTRA 1K98A 5DM0A 3UHPA 2V3WA 3IVRA 3SN6A 1UT8A 2J4DA 3ZHRA 1GNPA 2ORVA 4QGAA 1SPBS 3KQWA 4HRVA 3IOCA 1QGYA 4NYMR 2RBGA 5LBIA 4I5EA 3U7FB 3U3KA 1DOHA 5HJ7A 1FFEA 2AV6A 3KD2A 4U4AA 4LDAA 4XB2A 5JHGB 4M46A 2R25B 1II9A 2E0IA 3GH1A 5E4TA 5F78A 3HJGA 3MB8A 2BFEB 4CI0B 5KBYA 1XL0A 3TIXB 3O8NA 1YR8A 3E9MA 1MXHA 1R5BA 4PFQA 3HQ4O 5C8XA 4C03A 5HWSA 1DAKA 3SQLA 1XMVA 2CNKA 3A7DA 2XMQA 4GUDA 4G81A 2BHTA 2SHKA 3BX1A 1NF9A 4B7UA 5FDFA 3CZ9A 3G5AA 4ZCTA 3PFNA 1ORTA 2BLLA 4NPHA 4CL2A 5EIXA 3KJHA 3T7AA 5M5BA 4TZ6A 1M73E 1DBIA 1MNQA 1UPFA 2LBPA 3QMWA 3QVUA 5ECYA 5HIJA 4HYTA 4L5YA 2FA9A 1T43A 3LXMA 2PL1A 3ZIDA 2BONA 4YAIA 2WJVA 4FUQA 3L0CA 2ZSIA 4DANA 1VHQA 4WNCA 1F20A 4ZANA 2B7CA 4RY8A 4B74A 2BFNA 2W6ID 1KORA 3WO1A 4I9UA 3E9DA 2CYAA 5BOVA 4YUZA 4UW9A 2ZM5A 2DT8A 5FFFA 5IBRA 4NZ9A 5E1BA 1FVFA 2EWMA 3UWKA 3X2SA 4OGFA 1YVPA 3RLIA 1DNPA 1TCAA 4N48A 2VDOB 4D4KA 3GLIA 1NMZA 1ZU4A 3Q6NA 1QKJA 2II6A 1F1BA 1FNSA 5AKHA 5EESA 4BAUA 3PZRA 4G5YA 4BGEA 3ZVNA 3T61A 2XKAA 3GFOA 1VL5A 4WZAB 5CX1B 2IH4A 1K08A 4G63A 4KE7A 4M1KA 4NPCA 4R1SA 1FJHA 1ECJA 3VSDA 4EO4A 3A6FA 4UPEA 3QKIA 4LHYA 3Q3VA 2O8FA 1BD3A 1BX0A 4PTLA 4J07A 2IZZA 1ZMXA 1TAQA 3EPPA 4JLMA 3H18A 3ZGOA 1RQ7A 4IMJB 2OCXA 3K9FC 1FQOA 1ZRSA 1SD1A 4HWGA 2J7KA 4LFAB 1NQ5A 2Y92A 2Q45A 2VXYA 2H63A 4JJ8A 1PSZA 2WFZA 4KPUA 3GGDA 4O4LA 4J0CA 2I87A 7REQB 3W9UA 1OREA 1IEVA 1L6RA 1MJNA 1Z0SA 2C2WA 4UOZA 5KQGA 4BQRA 4W7SA 4RLSA 1TCBA 1JBQA 2D06A 3LUFA 3DWEX 1UXGA 5SV2A 4R68A 2HCFA 2HU8A 3K0HA 1PNTA 3F78A 4YT8A 3D1JA 4TS4A 2L42A 1XZMA 4IFBA 3QBJA 4FFPA 1MHPA 3JZMA 2YJTD 3T15A 4COKA 1WPQA 1AOXA 3OE5A 1M67A 2LD4A 1LPBB 5IK2D 4E88A 4YV7A 2AL7A 2QTRA 4R8MA 3T4EA 4B5KA 3C3YA 1JFFA 4RZ3A 1Y0BA 1MEOA 3RU3A 3X44A 3FZNA 2R1TA 3HFRA 3I8XA 5EIFA 1UDCA 3RU9A 3SPXA 2YFKA 1SH7A 1BFDA 4WZAA 5CX1A 4F93B 1VPTA 1LNQA 4KE8A 5I7OA 3E5RA 2EEPA 2ZLBA 1YZGA 3DYBA 5T67A 3TKLA 2HA2A 5FADA 1KYVA 5D3QA 4OX9Y 1M10A 1GZ7A 3TR0A 5HDBB 4JB3A 3SEFA 1YU6A 1X0XA 1M2OB 2C2GA 1CUSA 1QKIA 2QD2A 2XVXA 1XCMA 3AEUA 5CUQA 2G5GX 5IYZA 4EJSC 3EOZA 3A8TA 4MAMA 5EJAA 2GZ2A 1OLSB 3KETA 3BRSA 1UEXC 2BMWA 4JNCA 3O1LA 3EIOA 1JHQA 4K03A 1B4DA 2QDKA 3R3XA 4AYWA 3P2OA 2K6GA 1XRSB 1ZJ5A 3SZRA 4GL2A 5BT8A 2P9FA 2VYQA 4DCTA 4QATA 4ZREA 1MPXA 5EZYB 1IXKA 3K2QA 2XKJE 1SVMA 1M9NA 4KO4S 4KVFA 2GTPA 3KB6A 5F9FA 2YW9A 4BB5A 4EHHA 3AHCA 1Q0PA 1PJ2A 1CUCA 2JEYA 1JG6A 3BK1A 4WN9B 4H7KA 4O8CA 1T3HA 2WF8A 2WSYB 5B64A 4D3FA 1KIMA 3A9RA 4D4GA 1TEVA 2ZR9A 5KTPA 1V8PA 3BSFA 5DW3A 3C3CA 4AY4A 1HFWA 1XRQA 2AGVA 5C81A 4OH1A 3EQ2A 4ENSA 1P7VA 3OPQA 4YAUA 1ZOPA 1B8UA 5LZ2A 2BFMA 1ODJA 1HXHA 1VIAA 4WPGA 1J7JA 5SZIA 4DTCA 2G71A 4HB0A 1RJ9B 3ZCTA 3EFOB 3CLVA 3ZWVA 1OC4A 3SHWA 3KLOA 3OZTA 3I83A 2RC5A 1PGPA 3VKWA 4BBPA 2VHWA 4EKEA 4DMLA 2DKFA 1CIPA 4HH3C 3DUWA 3P2EA 4O8ZA 2OC9A 3RYIB 5LOVF 3QA9A 1QPZA 2G25A 4R7TA 5ENZA 1FU8A 2X5JO 4TUYA 2XZOA 4TVBA 2DPMA 3L7AA 4EQ6B 4YRSA 2ZANA 1KJYA 3RUFA 5KOHA 3GQVA 3K1AA 3L7CA 5AKIA 2QZZA 3EYAA 3JPYA 2ADFA 4MINA 1XNHA 4RYDA 4BVFA 1ZISA 4IJ6A 2NO0A 2OENG 1VP9A 5B58C 2ZCJA 3BMQA 4OQMA 1Y1SA 1Q0RA 5K20A 4E03A 1XZJA 2PMDA 2GAOA 4G5XA 4K9LA 4UUMA 2HEGA 1Z17A 3AJRA 3W3AD 1G8YA 4F3KA 1ZJJA 4OB7A 3HP1A 1SXJA 5EWLB 4EYSA 3HFGA 3U3DA 1XXLA 2BRUA 3JAKA 1TB4A 3AUAA 1QH8B 3UQYS 4IRXA 4WUVA 1P2GA 2GVDC 3V42A 3ZE9A 4OF4A 2ZQ5A 1UP6A 2P65A 4UJ3A 4LWZA 4UM9D 3G89A 1AHNA 5CHEA 2OXEA 3GMIA 2OHVA 2PGDA 2G36A 3IXMA 5FB3A 4JFRA 3TAUA 4AXBA 2ZUUA 4D97A 2RGDA 1HE1C 4WBXC 5T8KC 3SY8A 4MW7A 4YUWA 4NZYA 4A03A 3O8CA 1ZUHA 4IDAA 4ESOA 4RPKA 3FYUA 5IDQA 1S89A 1J8MF 5TQVA 4DILA 1CW2B 2H5LA 5JO9A 3JYHA 1OFIA 1ZRHA 3OOHA 4XLTA 1OXSC 2B6NA 3I28A 2JPDA 4Z54A 3ROKA 2ZBUA 1HT2E 5C46F 4MWSA 1OPXA 3OTGA 3ZJVA 2YICA 1V4NA 4CW7A 1UKVY 3DGEC 1IRIA 4Y0VA 3S68A 4CDMA 2A3RA 3ZDEA 2RHCA 4GKVA 2ZBDA 3CJTA 1F8GA 5C8DA 1C3OA 1ZX1A 2DHQA 2RAVA 1EJ6A 3UGJA 2A1TS 4RQTA 3N2GA 2C4WA 1YVRA 4MUYA 5HA5A 3FYCA 3BTSA 2V03A 4PNEA 1WQ3A 5TX7A 9ABPA 2BEJA 4RUKA 1QHFA 2J9GA 4Z0NA 3OZAA 2FJUA 2ZBVA 1PR1A 1OC2A 3GLQA 5DTIA 4RJLA 5SYMA 3WMWA 5IS2A 1A9RA 1PBNA 1N2HA 4L7QA 3CPHA 3N87A 4QBGB 4R2JA 4ZRNA 3S40A 3GIDA 3VHRA 3A27A 1TT5B 3T4UA 4EARA 4IXTA 3HVUA 1PJAA 2R6CA 1AZTA 1LVUA 1G1AA 1SG9A 2JLCA 2XLCA 3VBEA 1V96A 2CBXA 4UDOA 3W2IA 3NIWA 1A8SA 1QJCA 4G5QA 5EJ6A 3CY6A 3MWYW 4HV4A 2AJCA 4MW2A 1B1CA 4ZI2A 5LMNB 3EVDA 4X8HA 5L7YA 3WK9A 5LQJA 1A7JA 1S4QA 4DV0B 2XEXA 1LCIA 3QXHA 2AD5A 1H2ZA 1HL7A 4LJLA 3IAM6 4N8SA 4WFQA 4WXMA 3WFIA 3GJZA 2FEMA 4LEIA 4MPJA 3N8DA 1DFHA 4I5DA 3UGTA 1ZHOA 5J47A 1DBSA 3LHSA 4WNIA 2ZJFA 3IT2A 4E5YA 4XYLA 2F1KA 2J3MA 2JLAA 3L7DA 4MRVA 4G2TA 4RE6A 2HPHA 3R4CA 3DDCA 4KMSA 1QTRA 3MHPA 5B58T 4AKEA 2VHUA 3OCCA 1NIPA 2QVCA