1R0ZA

Phosphorylated cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
280
structure length
271
Chain Sequence
TGIIMENVTAFWEEGFGELLEKVQKHSDENNVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRILTETLRRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 86
structure length 271
sequence length 280
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r0zA00
2RGAA 1LV7A 1XTQA 4JLBA 3RS5A 5BXQC 3C4JA 1XTJA 1HQCA 4KFUA 1TUEA 2LKCA 1BMFA 3RWMB 1SHZA 2VIIA 3DOFA 1FMLA 4CEHB 3GJ0A 2W83A 4ZI3A 1XXHB 3QF7A 5DYGA 1OYYA 2O8EB 4KBFA 1JBKA 2IYTA 3FDIA 2D74A 3EIEA 1ZM3A 4G1UC 2FGKA 1U0JA 4WXRA 1M7BA 4IDHA 5H8WA 1SKYB 1OXUA 5CYOA 1WXQA 1QZXA 2IYQA 5FTLA 3PEWA 4M1KA 3DEFA 2OCPA 4F92B 1YRAA 1G6HA 4ZDJA 5F98A 5FR1A 4LHVA 1T9HA 2D06A 2DR3A 5C18A 3JVUA 4DUGA 1GITA 1KHTA 1RE0A 3IBGA 3GLFE 5J40A 4DCUA 4OHVA 3TKLA 3TQCA 3RVBA 2GXSA 1VYTA 2P0EA 3UWOA 1ZCBA 4U5XA 3I8XA 4FI3C 2HEIA 5EE5B 2VHUA 4A2QA 2W6JD 2ZI3A 1MRSA 2HDNB 1P4SA 4PSAA 3EA5A 3HU1A 1GRRA 1I2DA 2W2VA 1L7VC 5HE8A 1W5SA 4DB2A 2CXXA 2J0QA 1NBME 1T5IA 1N6OA 3QXJA 1ZP6A 2YWEA 2J45A 3CF0A 3UK6A 2N1BA 1UM8A 4RKEA 3CRW1 3GLGE 3IHLA 2ZI5A 1US8A 1P7CA 4QGAA 2WJGA 4ASUA 2QAGA 3H1TA 4ZDIA 4US1R 5LDDC 2F43B 3KKOA 4Q4AA 2K5UA 4LJ8A 1M7GA 4U00A 2ZJ8A 2WJIA 5AJZA 4XSHA 2PJZA 2LKDA 3RRZA 1T3SA 2KB0A 5DLQC 5EE3A 1KSJA 1ONBA 2OLKA 4D81A 4IKEA 1Z0FA 3AF4A 4FMDB 4KCGA 4EPVA 1E1RA 2FV8A 1ZNZA 3CH4B 4HUQA 1YZTA 3UG6A 4OQFA 2YOFA 1VYVA 4BPBA 1KSFX 3ZZTA 2CDNA 3BFKA 5A0FA 3TW4A 3W5JA 1QRAA 1D8TA 1KZ7B 4GZLA 2QGZA 4S35A 3KTAB 1X8KA 2XXAA 1W4BA 4NU0A 1NLFA 2FEMA 1O87A 5FTNA 4A0GA 4LRWA 1NVVR 3A1WA 1SXJA 1Q1EA 4DLTA 2GF9A 3LQQA 2VSOA 4NCKA 4LYFA 4QL3A 1OIXA 3LAWA 5TVKA 1LS1A 4RFSA 1V5WA 2NO7A 2VHTA 3SBEA 2D7DA 4DEYA 2FPLA 3W3AA 3GFOA 2WWWA 5AK0A 3X2SA 4FCVA 4BQSA 1LF0A 3LXRA 1UDWA 1AJEA 4D6PA 3OESA 2IK8A 1D2NA 4DSUA 2IYWA 1X3SA 1DELA 1NKSA 5F9FA 2GK6A 4PZZA 2J7PD 3K9NA 1R5OA 4E09A 2QA5A 5K8TA 1E9SA 6Q21A 2BBSA 3DOEA 1G3QA 4KAXA 3SHWA 4NH0A 4PAQA 2IX3A 621PA 2IS4A 3W6OA 2CE7A 5J5CA 3CX6A 3KB1A 4JMPA 2OE2A 3M4YA 1OFIA 5B30A 1KJZA 5DN6A 1SVLA 2ZU6A 4A82A 1KI1A 1G7SA 3RS4A 5HR5A 4MGZR 1CRPA 2CVFA 1RRPA 4Q7LA 1X6VA 3QKSA 4DZZA 4Z54A 1ZU5A 1AN0A 2ASEA 2CMKA 2HLDA 4RZ3A 2XGJA 2ZI4A 2OFXA 2HCBA 3LNCA 4LJYA 3RC8A 2R6FA 1RW4A 3RHFA 1N6HA 2QROA 3GFTA 1W0KA 1W47A 4KXFB 1E32A 3EIQA 4IFEA 1SXJE 2CK3A 1F2TB 4UXHA 3IGFA 5JWOA 1BH2A 4M53A 5TXGA 3O8RA 2Z43A 2NQ2C 1FNNA 4DCNA 1II0A 2UKDA 5KDDA 2ONJA 2CLDX 2OO7A 4ERNA 2FZ4A 2ZU0C 3B7GA 1E6CA 2NMVA 2WJJA 5CLQA 3NEYA 3EC1A 5HCIA 2UZ3A 1CJTC 3KUDA 4B76A 2AFHE 4Q4HA 5H68A 1A5TA 2NZJA 4NKRA 1X1SA 4O3MA 3OEEA 1P72A 2QMUA 5D3MB 4W5JA 1NL3A 3AGQA 1Q1ZA 3NDPA 2EFHB 3QIAA 5HTKA 3I8SA 2O0HA 1GNQA 4X8OA 2IYSA 4DLUA 4PPQA 4U7DA 1K5DA 3N2EA 2C99A 1MOZA 3EPJA 1W0JD 4M2LA 1AM4D 1GDDA 3W9YA 3K0FA 4F4JA 5TMPA 4DCVA 4L9WA 4EKDA 1JR3E 2JJ8A 4NCHA 2ZVQX 1Q57A 1LW7A 2N46A 5E3HA 5EZ5A 1KYIA 4PC1A 3EASA 4QBIA 2CVHA 4TTQA 4B2PA 4M8NE 3F8TA 5E7MA 1AK2A 4PQYA 2JLWA 2DWOA 2CL7X 2VP9A 4C0KA 2AKAB 5FI0B 2MMCA 1VMAA 1FX0A 4QFMA 4A0RA 5EXTA 2J46A 3GJXC 1EX6A 1NSFA 1ZUNB 3QNUA 4B75A 5BN5A 1MKYA 1I2MA 1YR9A 5FBQB 1HT1E 5FI1B 1G7TA 1W4RA 2QUZA 3SYKA 3BIFA 5JI3E 1QHXA 4IXNA 4I4LA 1NMZA 4M9XA 1Z6YA 2OCYC 4GSYA 4JBXA 4LHXA 4AY2A 3GEEA 2BMEA 3QBVA 5B64A 4PAOA 5M04A 2AXNA 2ZE5A 1DAGA 4FMCF 4TQAA 4I81A 1C4OA 3PEVA 2ZETA 2W0SA 5L3RA 4B6FA 4EFLA 1TF5A 1OKKD 1TF7A 3OIUA 3GLFB 1YVDA 4PPFA 4DLRA 4NMMA 3HPQA 2WBLC 1IN8A 2RB4A 2BCJQ 5DI9A 1GILA 1VCMA 3FKQA 4R7ZA 1E2LA 4TLBA 3GJ6A 4EPWA 4KI0A 1OHHA 3QXCA 2GKSA 5P21A 3WRXC 3A1VA 2JA1A 1SULA 1MO3A 1X8LA 3CPEA 4CZ2A 3GP8A 2B7BA 1H8HA 2V7QD 3VX4A 2B8WA 2IF2A 4C0LA 1WB9A 1TQ2A 3UKDA 5CM8B 3SS8A 4KVAA 2JGNA 2E1RA 2WKQA 5KTYA 3ZS8A 5J47A 1XTIA 1W2GA 1WQ1R 2JLXA 1CLUA 3PXGA 4IVPA 2ZE8A 4YMWA 1E9AA 1WMSA 3U3OA 3GQBA 4KFSA 2V4ZA 4AD8A 4CEIA 4H9GA 1VIYA 1GOTA 4OI2A 3X1WA 1E9DA 1N2CE 3THXA 221PA 1Z28A 2JDIA 1TEXA 2OV2A 4DSTA 3ND8A 3EW9A 2ZXUA 5DHAA 3REGA 1TU4A 1OPXA 3V4RA 3B1YA 5KPJA 3RS2A 5GJBA 2PMKA 1QHHA 2IXFA 2WM9B 4L5BA 2BHRA 4ITRC 1P62B 3BWDD 1U9IA 5JS7A 3EZ7A 3TMKA 2PX0A 3NVAA 1M34E 5JWHA 2XB2A 1EWRA 1NLYA 2AD1A 4GP7A 1TUIA 5K8LA 1OH5A 1G3MA 3SJZA 3A37A 3FWYA 1P2UA 3BH0A 1GUAA 1TNDA 4G01B 3G0HA 2I1QA 1QHIA 3VR5A 2IYXA 1PLJA 5AR1A 4F93B 2A30A 4TYPA 2GJ9A 1S3GA 4NL4H 1CJMA 1UKEA 1US8B 4KHZA 2VPPA 4UXIA 2GBLC 2QAGB 4XD7A 1Z0JA 4TLEA 3UWKA 2Z6VA 4Q4AB 3NC1C 4R2HA 5C46F 4LSGA 2MMGA 3BC1A 4YXWD 3Q7QA 2YHSA 3OE7D 1U8ZA 2J0UA 5JJIA 2O5VA 2F9MA 1XPRA 1GSIA 1IAQA 1NKTA 3ADKA 1F6BA 3IKJA 3LRPA 4EFMA 3I62A 4XVRA 1JB1A 4LJ7A 4LBZA 2FX3A 1Z6AA 4HUQB 3HWSA 5JFGA 1CJVC 2FWRA 5GVRA 2DFKB 3AF2A 5FPYA 2CE2X 1SVWA 2FG5A 4PO1A 5F9HA 4DLSA 4B32A 1FQKA 2XNSA 3AF1A 2HXYA 4KO8A 2XXAB 3GLHA 3LVQE 4WAUA 3FHOA 5HZKA 5E95A 2VYFA 1JXOA 2RHMA 4QNMA 4PC2A 5JJLA 2H1LA 1SXJB 3HR8A 1T8TA 3ASYA 4URUR 1W1WA 4AYWA 2A7QA 4E07A 2JJ1D 3SC3A 2ZROA 1DO2A 1ZUIA 4YMSA 4M1WA 2H5EA 3QKTA 1DADA 4IXMA 3J81k 1IY2A 3RYTC 4HDCA 2Z5FA 3UANA 4N0DA 4P4SA 4IEIA 4RJLA 2XOKD 3A1SA 1YZQA 4B3CA 2YKGA 1IONA 2KSQA 4OQMA 2YWFA 1AGRA 4D2IA 3ICEA 2X77A 2OBNA 4RD6A 2ORWA 4QM6A 3C14C 4QXAA 2YZ2A 3TBKA 4A6XA 1RRGA 1OF1A 1DE0A 3L2OB 4AYTA 5FOSA 3AP2A 3TH5A 4OHXA 4EQ6B 3IIJA 2FA9A 4ZI2A 1Q44A 1DOAA 4MUBA 2QAJA 4HAWA 4CDGA 4PR0A 4ZIRA 3U3RA 1GFIA 4Q7MB 4Q1AA 4KJZA 2VP6A 2UZIR 1E4YA 5JI2E 5JEDA 1NBMD 3ZVMA 4AWXA 2J59A 4PXAA 4RKFA 2MSCB 3Q7PA 5KSPA 2NO9A 2QI9C 1Z07A 4HZUA 4P3YA 5JBQA 4GPTA 2DBYA 1NMXA 1E9RA 1KKLA 1QHGA 5G3YA 3GLHE 3LO5A 2NZ8A 3B9PA 4Q03A 3WBKA 1TF2A 2GF0A 3SYLA 1Z8FA 3FKSA 2VLIA 1XEXA 1IN6A 2QTHA 1OV4A 1KO7A 1T0HB 1UEIA 3IQXA 2ZJ5A 1JQLB 2GZAA 3U7EB 1CJKC 1P5ZB 2DHRA 3RRYA 2X1VA 4TMXA 1GKYA 1Z0IA 4ON9A 4FCTA 2Z0MA 5DSZA 2WOJA 4R2IA 4B44A 4M9SA 3GFPA 1KO8A 4A2PA 4M9ZA 3N2IA 2ZANA 4NCIA 2YNMA 4Q4HB 2VO1A 2GNOA 4XH9B 2AK2A 3D6TB 2FFBA 3I73A 2VF7A 1CBUA 4M1TA 4TZ6A 5L3VA 5KSYA 1RRCA 1E9CA 2BEKA 2W2TA 3BOSA 1XMVA 3QXSA 4PHHA 1BYUA 2C04A 5DHFA 3W5IA 121PA 1ELOA 1E1QA 2GVDC 3CO5A 4RSGA 3T1VA 1U94A 4NYMR 3U4QB 2PT7A 3CR7A 3SZRA 5EQTA 2GWHA 2MSEB 3ICQB 3NHAA 3LBNA 5LD2C 1DEKA 4URZR 2NG1A 5KYKA 4IOKA 3ZDQA 3U5ZB 4KODA 3AVWA 1G4UR 1EESA 2JLRA 2W58A 2BCGY 2I4IA 1P2TA 1X8JA 1Q0UA 2ZM5A 4HZIA 3BGWA 4ASUD 2BM1A 4PHTA 4NONA 1FX0B 5TDHA 4CYMA 1OIWA 3TLXA 2V6JA 2FDCA 1DAKA 3U3KA 1G16A 2EYQA 2ZRAA 2OM2A 4RD0A 2GEVA 2QP4A 3Q5EA 3B1ZA 1Q20A 3CNOA 1X86B 4LYAA 2IL1A 3K0CC 1JJVA 3GMTA 4C0JA 1TX4B 4LDJA 2WSSD 1KIMA 4GZMA 3AVXA 1ZVQA 1E1RD 1FP6A 2ODNA 2C8VA 4JS0A 4URWR 3U6BA 2OSBA 2GETA 3QG5A 4UKDA 4JKYA 3LLMA 4D4MA 2CL6X 3Q85A 1S3SA 1BOFA 1ZD9A 4O0MA 1TQ6A 2O52A 3K9LA 3CRVA 4Z1MA 4GRAA 1T0JB 4HB3A 1RIFA 2VF8A 1FUKA 3TSZA 5J4HA 1SXJD 4PQFA 1KJYA 2OCBA 1NNEA 3H4MA 1XPOA 1Z5ZA 4Q18A 2CNWD 1RVDA 1AIPA 1W2HA 4HB0A 1QG2A 4IOLA 4Q1EA 3X1ZA 3R9XA 3TAHA 1IJEA 4UQOA 1NVVQ 1RFLA 4FMDF 3GEIA 5JWRA 1WCV1 1AS2A 2R44A 1E4VA 1S9DA 4AIIA 1NG1A 4DDWA 4QGFA 1ESNA 2NO1A 3RDPA 3REFA 4A8JA 5BN3A 5EXPA 4ZCMA 5FPHA 4PC3A 4QM7A 4Q5IA 2ZIAA 3D3QA 3EWAA 1Z2CA 1VHTA 3BXZA 5JCZA 2V1UA 4CEIB 1AS3A 1AA9A 2JLSA 1GTVA 4UXJA 4F4IA 4K8OA 3UMSA 5DN6D 5BW8A 3THXB 1GIAA 1VTKA 4B35A 2PEYA 1XP8A 3LX8A 5FL7A 1VG1A 1ZCAA 2GJAA 1F2UA 4IHQA 5FBWB 4KSBA 2FN4A 3ZZUA 1TU3A 2HLDD 3UMFA 4IEEA 4KVGA 3BB1A 1UJ2A 4NCNA 5DYIA 1QHHB 2QT1A 3AQ4A 3VR4A 4DXAA 4JT2A 4C0BA 1G9XA 2Q3HA 2W6IA 5J4VA 3GJ3A 1Z3IX 1W0KD 4X8HA 1UBGA 5FTMA 4AURA 2RCNA 2BV3A 2CK3D 4TL8A 1G8PA 2IUTA 2A5JA 3MD0A 3OZXA 2WWYA 4JBYA 2HYIC 1T91A 2IT1A 2ERYA 4ZDWA 3EPLA 3CNLA 4BFYA 4G5QA 4MKIA 2PMDA 5SZKB 2GTPA 3F0TA 3QXHA 1COWA 1GNPA 3SFVA 4Q1CA 5AUOB 2FE4A 1KY2A 5SZJA 4YDSA 1NIPA 3FB4A 3LV8A 3TUIC 4M0LA 3JVVA 5DE3A 5HPYB 4BLSA 1Z63A 5TARA 3WP1B 2QBYA 3OEED 4M4SA 1XEWY 2BWJA 3GLGA 1FOEB 2F9LA 2EVWX 3CRRA 4RFVA 4BFUA 1AKEA 1P2SA 4CIDA 1MT0A 5GADl 3AVOA 4OQLA 2WJVA 4RD4A 2OBMA 1IXRC 1RJ9A 4TYWA 4PC7A 2OAP1 4A1FA 2ZUDA 3CR8A 1R0XA 1E0JA 3KJEA 1KOFA 1R5BA 1R0YA 3K0AA 4V0OA 1OFHA 2OCAA 2O8DA 2CBZA 3HYRA 1WBDA 3QG1A 5HZHA 2PLFA 4DLYA 1KNXA 1GWNA 4JLOA 5JEEA 3IIKA 1E2GA 2RMKA 3Q72A 3KJIA 3AH8A 3U3MA 3QQ5A 1S4QA 4RCYA 1XCMA 1E0SA 1H8EA 3QKRA 4NDZA 2IS2A 1BIFA 3IBYA 4IOMA 5KUTA 2ZSBA 1E2PA 3VX3A 3QENA 1MV5A 2KI5A 3CLVA 3KX2A 4JLMA 3KFVA 5FUVA 1XZPA 2YVUA 2XJ9A 1MR3F 1OLOA 2AKYA 3CRMA 5F2EA 2QN6A 1R2QA 3B13B 1TAGA 3I32A 4QOSA 4TL7A 2BMFA 2XTNA 4BFWA 2AXPA 3VQTA 1KMHA 2P2LA 4RVCA 3LD9A 4RZUA 2AWNA 4A15A 5JMTA 4NP6A 1JPNA 3T5DA 1GP2A 1U98A 3L0OA 4EAQA 2D2EA 3OIWA 4KU4A 5G40A 4LGMA 3C5HA 2ZYTX 4OI1A 3CBQA 2IBMA 4P4SB 3WYAA 5JRZA 4O25A 4Q47A 3C16C 1ODFA 4BZQA 1R7RA 4AYXA 1YHNA 2C98A 1OH7A 1IXZA 3MWKA 8OHMA 1RZ3A 4QNRA 5EP4A 3U2QA 1LTQA 2W00A 1OHHD 4B48A 1NLZA 1J8YF 4MRPA 1QHSA 1VCOA 2BEJA 1H8HD 1RYHA 1RC8A 1MABA 3QUSA 3FVQA 3SE0A 4FINA 1R4AA 4A9AA 4ZIRB 4ESVA 5FOVA 4DJTA 3W34A 3TUZC 2H57A 4IVRA 3SYNA 1U90A 3SHFA 5LBIA 3BAFA 4ABYA 3N70A 3IIMA 3W6NA 2HF9A 4BFZA 3OAAD 4NZYA 3TGPA 3R9WA 4JLPA 1G3UA 1U0LA 4TLDA 4HZUB 3EPKA 2A5YB 2BBWA 3CX7A 1SKQA 2H7VA 3KJGA 1SHKA 1DAEA 3MWLA 521PA 1KJWA 3AF3A 5JS8A 4A36A 2BMDA 1IOZA 2FFAA 4DKXA 1IBRA 3WMFA 4L4UA 2VP2A 4QKQA 1D2MA 2ZSEA 2QZ4A 4Q48A 1XEXB 4TMTA 3EXAA 1E2QA 5KOYA 4AC9A 4A2WA 3O8CA 3FOZA 3SQXA 2A3RA 2OT3B 3I3SR 3LA6A 4LJ6A 2CHQA 1XD8A 4ZCLA 2D3WA 5JZVA 2JIZA 1W7AA 3E5HA 3F3YA 1FZQA 2PZGA 3DKPA 2JEOA 1E99A 3CZQA 4B3BA 2CEAA 5GJCA 1ZMXA 2ZS9A 2Y8EA 2RGNC 1EFUA 3DO6A 3AEZA 3ETLA 1UBFA 4LHWA 1EFHA 4OQNA 3K70B 1KZGB 4OKSA 1Z0AA 4D4KA 1FW6A 1OXXK 4JVMA 2V9PA 4OJQA 1EFTA 4GMDA 4MDFA 2B8TA 5H70A 2C96A 1E0AA 2ZEJA 3K09C 1LY1A 3H84A 1VG8A 1Z47A 3KUCA 1C1YA 4WZ6A 4YLGA 1HH4A 1JJ7A 2JASA 1JR3A 4BEBA 2IS6A 3DM5A 4GMXA 3ZVRA 1T8UA 2F3TA 4A92A 1OB2A 1XJCA 5A4JA 1G6OA 1E9EA 5KSZA 1EXMA 1DAFA 2J3EA 3LW8A 5IHPA 1CR4A 3KQHA 4HSEA 1YR7A 4MA4A 4I1UA 1OFUX 4A0FA 2VH5R 1JEDA 4D80A 2B7CA 4Z8YA 1YRBA 4Q4JA 1Z6GA 2Q9AA 1QBKC 2C77A 3GEHA 3IPYA 3Q5DA 4JVSB 4POAA 2UVQA 3W90A 1G8HA 2GJKA 2WPDA 3ZLJA 2CLCX 4M1SA 3HU3A 2VSFA 1IJFA 3WHKA 4TMWA 4OK3A 3BERA 2KJQA 4K46A 5EE0A 4DDVA 2CJWA 1XNJA 1KK3A 3A8TA 4JBWA 4BRUA 4XVUA 3T06B 3C41J 4B6EA 2X2EA 1JR6A 1E79D 4JLVA 3K0SA 5J4YA 3I5YA 3SEAA 4CEJA 3CNNA 3QI2A 3AKDA 3T35A 5KDOA 2DFTA 1XJ0A 4GFDA 3A4LA 4MRNA 2GA8A 5EZ6B 2CHVA 4MGYR 1MO5A 3PCRB 1OYWA 3ZGXA 1DAMA 4ARZA 4O2LA 2E87A 4J0QA 3EZ2A 4DHEA 2F1RA 5FPKA 3PFIA 4DBLC 3THYA 2SHKA 4QBFA 2QM7A 2VRWA 2OXRA 3CW2A 2IEYA 5FUWA 1M2OB 4YMUA 1ZM4A 2ATVA 2DYKA 3Q8XB 1XRJA 4N3NA 2RKOA 2YWHA 1HURA 4Q4LA 4A8JB 4TYNA 5AUPB 4TTRA 4TWZA 2J5XA 3U44A 1SVKA 2Q9CA 3PIRA 4QGHA 4CGZA 3GCGA 4LWZA 2FU5C 1OT3A 1L2TA 3LFUA 4G3XA 2ZRNA 1NVXQ 3AKEA 4D4LA 2JLZA 1QG4A 3RAPR 3UXMA 1VKJA 2YWGA 3BBPA 4MYCA 1Z0KA 4M9QA 5J4KA 3VHLB 4MQBA 3P20A 3CZPA 3MSXA 3KZ1E 1F2UB 2GAOA 4P32A 2ODWA 4P31A 3IDQA 4EJSC 2IUSA 3AP1A 1JNYA 1II8A 2QL6A 2IYVA 1KI6A 2Q3FA 1WBBA 1CS4C 2V6IA 1W36B 4JSTA 2C95A 2J0SA 1Q3HA 1UPTA 1PV4A 4TZ0A 3FHTA 3IO5A 4URVR 4FWTA 2DPXA 3ZIAA 2ZJZA 2ZUCA 3S1AA 3FKSD 1OFTA 5EP3A 2VL7A 4KLZA 1JPJA 2HCJB 2GCOA 4B2IA 3O8DA 3WHLA 3OHMA 3T12A 5C2JB 1JAHA 4ILEA 3PUXA 4QJ5A 1SVIA 4BLRA 4LV5B 3AM1A 1SVMA 1G1MA 3DL0A 3TR5A 2E9SA 1GZSA 4WW0A 1U2RA 3UG7A 5DI3A 1CKEA 1HV8A 1NVUQ 4XTRA 1G5RA 4TMVA 5EXSA 3RABA 1M7HA 2QPOA 1CJUC 2PT5A 3K70D 4TSFA 1T6NA 4PX9A 2WIBA 4WOPA 3GLGB 1Z6XA 5LD2B 4R9UC 2L0XA 3SU8A 2ONKA 3TK1A 2QQEA 5KNCA 4HEJA 2XAUA 3CH5A 4PANA 1RJ9B 2ZAOA 2G1KA 5DISB 4LHYA 1XBTA 1A1VA 2O8DB 3B1XA 3VR6A 1XTRA 1XCGB 1VCIA 2WSMA 2ZPTX 4JZKA 2RGXA 1ZRHA 1W46A 3N5CA 4NYMQ 4QGGA 1CF4A 3MGCA 4IVQA 3RWOA 4HAXA 2WV9A 3W3ZB 1OXSC 4QHYA 3V9PA 4MH0R 3NDBB 4KFRA 2WVJA 2WMOB 2XSZA 1PLKA 1WF3A 4ACBA 5DGXA 1G7CA 2DFNA 2ZR9A 3LLUA 3AVVA 1Y3AA 4H1UA 4IW3B 4TYQA 4ZKDA 2FSGA 4LBYA 1JI0A 3SOPA 1KI4A 3I1FA 5BYJA 5IT5A 1TQ4A 3TAUA 3U7GA 1W4CA 4DSNA 1KMHB 3ADBA 2QTFA 2ZRFA 4UNPA 2C03A 3CWQA 5CYPA 3V00A 3DVLA 2WOOA 3I4LA 1A7JA 1E98A 3UATA 3KQLA 4PQRA 2BM0A 4AG6A 3X1DA 2CCGA 2FSHA 3B78A 5BWMA 4GBMA 3VR3A 3ZQJA 4Z1MD 2DWPA 4BFTA 3VKGA 4L9SA 2ZSAA 2J7PA 1AZTA 4CT4B 2QEQA 3QSYA 4Q9IA 3KKQA 2F6RA 2BMJA 4Q02A 2VSXA 3QXXA 1LS6A 2ANCA 3QEJA 4R98A 4RD2A 4RY2A 1AZSC 1NMYA 3IUYA 3NH9A 3THWA 1MABB 2WAYA 4QHSA 1YE8A 3RS3A 4DDUA 1U8YA 5L3QA 4MKFA 1MRNA 2ZJOA 1VG9B 3FMFA 5EE9A 1H65A 5BQ5A 3K53A 1XMSA 3EG5A 3HU2A 4Q19A 1YU9A 2HJVA 4PHGA 1T5LA 4RZXA 5KO2A 2DB3A 2XZLA 3IEUA 4CEHA 4HLCA 4D0LB 2QU8A 1XMJA 2F1HA 2QY9A 2XNDA 3IQWA 2PBRA 3WXMA 1CXZA 1CU1A 1GL9B 3EZ9A 4WIAA 1Z22A 2ZE6A 4KITB 2YINC 2NPIA 4A0HA 3BFVA 3PITA 4Q1BA 1M1YE 1L4UA 1ZIOA 3P4YA 5IK2A 1NG9A 2IYLD 5FL7D 4KFTA 4TYYA 4RFSB 3B1WA 3R8FA 5KNBA 1P60A 1N0UA 2ZYVX 4PSKA 4UNSA 4ZPXA 1FTSA 4MGIR 5E7IA 2IWHA 3GLIA 3OEHA 2AHOA 4MYTA 2PX3A 1W36D 4TLCA 3K0EA 4JLJA 3VTKA 2BJWA 1VECA 5FL3A 4M1MA 5CK5A 3K8YA 4V0ME 2O8CA 3DPUA 3A1UA 3W8NA 1SVSA 2VP0A 2EFDB 1NIJA 1EFRA 4OK5A 2W2XA 3R7WA 3FFBA 2HYDA 3IO3A 2PZFA 1KSGA 1G41A 1N5IA 1P73A 1YZNA 2XEXA 1KO1A 2REOA 1KAOA 4XJXA 3BH7A 3W6PA 4Q00A 1PUJA 3TE6A 1GNRA 4V0LA 2P6UA 2C2HA 3PV0A 5K8UA 1BMFD 3QKSB 2F43A 1ZNYA 4UNNA 1DAHA 3K1JA 3M1IA 3SN6A 2EWWA 4QG7A 1TQDA 3NWJA 2WHXA 1FP7A 5CK4A 5JHHB 1UKZA 2FF7A 2REXB 4DLXA 4HAZA 2VHJA 4Q4JB 1Z29A 4B74A 3CWZA 3D7MA 4B73A 1UDXA 2ZRKA 1YJ5A 1CR2A 2GBLA 4GOKA 4IDOA 2XITA 3OIYA 2FPMA 2VTKA 1QVRA 5HKKA 3GLIE 2XX3A 4Y0VA 4FCWA 3Q3JB 1R5NA 2CJWB 2FOLA 5KDLA 2OG2A 3I72A 2KBEA 4DUGD 1KI2A 1EK0A 3AV0B 2Q0HA 4BWYA 1NI3A 2VA8A 2WZQA 1OKKA 1GM5A 1N6LA 2NOAA 4CEJB 1KSHA 2NO0A 5AJWA 3DM9B 4JLNA 2EW1A 4BE7B 2LWIA 4R71A 1NN3A 2ZS7A 2YOGA 5HCNA 1G64A 1Q1BA 3LY5A 2Q9BA 4Q9JA 1TTTA 1DG1G 4HDQB 3K9HA 4FMBB 1DTSA 2H16A 1Z2AA 4QJ4A 4ARZB 2X8AA 3U3JA 4BECA 3VR2A 1XTSA 2QG6A 3NIBA 5JCPA 3K0FB 1E2NA 2D7CA 4PZYA 4DIEA 1M6NA 3THYB 2O8FA 2EWVA 2BC9A 1N5LA 2G3YA 4C30A 1OXTA 1R8SA 4OQXA 4PFSA 1PVOA 4MRSA 1W49A 2QPTA 3NG1A 2ZRPA 1JXMA 4JJZA 1RPZA 1D6JA 1J70A 1HA3A 2GXUA 5CM9C 3P26A 2JLYA 2WIAA 3U44B 4V0KA 1KK0A 1U0HC 3BB3A 3GJ7A 1T3LA 1W36C 3E70C 5CITA 1PUIA 2J0VA 2ZUBA 4FN5A 4CVNA 3DMDA 3U61B 2XTZA 3SNHA 3T61A 4BLQA 4AKIA 2P5SA 4JLAA 3RLFA 4FWIB 4G5GA 2JJ2A 3CKLA 4BRWA 3T1OA 4G5OA 3TRFA 2A9KA 2H18A 4W5WA 3RSLA 1FUUA 3SBDA 1G18A 3VNVA 1II8B 4ZO4A 5SZHB 5KU1A 5JSZA 4IFBA 4NTZA 1OH8A 4US0R 4E5UA 1G8YA 3S1AB 3FPAA 4LYHA 2GJ8A 2QTVB 3BRWD 1JEEA 1IN4A 2OUKA 4I1OA 4MRRA 5B2ZA 4W5HA 1S2MA 4IDPA 3TR0A 5JJKA 1I4DD 2BBOA 2GCOB 3U7FB 2Z4RA 3I92A 4WBSA 4BASA 4JVLA 5BN4A 3D8BA 1TMKA 3V4FA 3KQNA 1KO5A 4PO9A 1GRNA 2WWIA 2QENA 3G82C 3NHBA 3MMPA 4LUCA 4P4UA 1DS6A 1Q22A 4WXPA 5DI3B 4UNQA 3O47A 4MYHA 1KDTA 5FR2A 5EJEA 2GESA 1IQPA 1G291 4URYR 3KXKA 1XFAA 4C4PA 3T1QA 3LDAA 1VDZA 3NBYC 2B6HA 4P33A 2FJUA 2OFOA 3D31A 3KFXA 1B23P 4HATA 2WMNB 4YXWA 5B58C 2A2ZA 2OFWA 2YC2C 3B8HA 2GCPA 1NP6A 3AKCA 2WKRA 4EPXA 1G8GA 4AG5A 1JR3D 2ZJ2A 3OFNA 2QORA 2G6BA 1G17A 2ORVA 4GDFA 5CIWA 2GJSA 1J2JA 4DLVA 3AUYA 1DBSA 3AF0A 4HLDA 4N0EA 5ANRB 4P0TA 4ZKEA 3VAAA 3C7KA 1Z06A 4OI0A 2XJ4A 4LBWA 2ZI7A 1OB5A 1N6KA 2RGEA 1NY5A 4HAYA 2GEDA 2IHYA 4M21A 5CIQA 1O3YA 1XTKA 4JL6A 3K9GA 2ZI6A 2QAGC 1R6BX 2DWQA 2WPDD 4LJAA 1IN7A 3RNLA 2ZTSA 4LY6A 2OILA 3EZ6A 2ZAMA 4NE2A 1J90A 4ESHA 2B92A 2GXQA 3KB2A 2RHDA 3C5CA 3VHXA 4RD1A 5H1YA 2O0KA 3ECCA 2W0MA 1N3BA 3L0IB 3AKYA 4JJKA 3NH6A 2B21A 3LX5A 2NPFA 4DEXA 1QHYA 2ZR0A 2EFCB 3KL4A 4GOJA 4DDTA 5L8VA 3AVYA 4BLPA 1YR8A 3NXSA 3K0CA 4XOIA 1U81A 4BGDA 1IY0A 1E9FA 4I1VA 3NEJA 2OLJA 3T1TA 4GT1A 3B9QA 3VR1A 3UMRA 2EU8A 2QP9X 1NN0A 4D82A 1YQTA 1Z08A 4C9BA 1DAIA 3PUZA 1G4AE 5C1BA 2N42A 3EC2A 4EDHA 2J0UB 2RAPA 1CP2A 3THWB 3RS7A 2GVZC 3T15A 2G88A 4XTCS 5L3QB 2EQBA 3IPXA 4CF7A 1SXJC 3FE2A 2VHCA 4XWAA 3PG5A 4US2R 2PJRA 5B57C 4II7A 1E94E 3ADDA 1XD9A 1ZIPA 4L8GA 2FSIA 2V3CC 5AWFC 4HLUA 1D9ZA 2IYRA 1J99A 2YJTD 3CRQA 1AS0A 4HDOB 4EPRA 3NBFA 3VFDA 4UNRA 2VHQA 4AK9A 3BJIC 1XD2A 4OHZA 3NKVA 4NYJQ 4I1SA 3GLHB 4DRZA 1MH1A 1R0ZA 2RGCA 1NN1A 4QBHA 5JHGB 2FH5B 4DCTA 1YKSA 3WMGA 2ANBA 4BLOA 1OJLA 3AVUA 1HEIA 4ZCIA 2QRZA 3ZJYA 1R10A 4U02A 2GHIA 2G0TA 3E2IA 5C4MA 3GLIB 2ZYUX 2J9RA 3AP3A 2R6DA 2BKUA 4LV6A 3JZAA 4OK6A 2JLUA 4WVFA 2WTUA 1VPLA 1S8FA 2ZR7A 2P67A 1CRQA 2ZRDA 4UJ5A 3ZIAD 4C0SA 3P32A 3FMOB 2GCNA 2GK7A 5LB4A 4NYIR 2O8CB 3LW7A 4HI0E 3P4XA 2GXAA 1NJGA 4C0QC 4CW7A 2QT0A 3I5XA 1D5CA 3DHWC 4TQ9A 4ZDKA 1N0VC 3LQRA 3PUVA 1KDOA 3R7WB 3M6AA 1XB2A 1ZD1A 2C9CA 4HYYA 1CTQA 4RCZA 1ZINA 4QJ3A 2AD5A 2JLQA 3KDSE 2IW3A 2ZRIA 1E2FA 1LNZA 5FOWA 4TSFD 3F5FA 2D4HA 3BORA 2OESA 3AUXA 3PVSA 3X1YA 3EAQA 4GI7A 3MCAA 2GRJA 2DY1A 3L8ZA 4PPNA 1CIPA 3C15C 2MSDB 3ASZA 2O8BA 4K81B 4GL2A 3QY0A 4JYBA 3U60B 3BK7A 2H17A 1WE2A 5AJXA 2TMKA 2JDID 4F91B 1NJFA 2HUPA 2WWHA 1LB1B 4B43A 4C0AC 1EGAA 2WSSA 4CRWB 1VCNA 4V02A 4XWKA 2PL3A 3ZZ0A 2CLSA 3A36A 4YQFA 2HF8A 1T3HA 2CL0X 1Q1QA 1N25A 2AR7A 3TIFA 2OZEA 3GJ4A 4O2RA 4NHOA 1UF9A 3CF6R 2QRNA 2XSZD 2VP5A 1GVNB 4NPHA 3WNBA 3B60A 3E1SA 2C78A 2NO6A 4P4TA 5F3WB 2R8RA 1XZQA 1HT2E 4JSYA 3P1JA 4FXPA 4KYIB 5KHOC 4JKIA 1ZYUA 1E69A 2CNWA 1IN5A 3MJHA 1GKUB 1SGWA 2ZE7A 4YC7A 4XSGA 4YDHB 3WNCA 5L3SA 3TSOA 3SI7A 2HT6A 2BDTA 1GL6A 4M1OA 5K8IA 3CIOA 3C8UA 4TL9A 1TL7C 3EZFA 4MKGA 2LCFA 3KKMA 3QJYA 3PR1A 2IA5A 5GJVC 3QKUA 2O8FB 3PUYA 2ZYWX 5AUQA 1FFHA 4RZ2A 4OBEA 5C4GB 4NBSA 2QE7A 3VU9A 1JAIA 1SVOA 4XD7D 1KAGA 1QHNA 3KXIA 3NBXX 4EQ6A 4QHTA 3OF5A 1G3RA 2WICA 1YZUA 3BB4A 5FOTA 1EWQA 1Y63A 4Z8XA 3CX8A 1G5PA 3L8YA 3UIEA 3BE4A 3CB4A 1HTWA 3DZDA 3MRSA 1F60A 1KY3A 4Q66C 2ERXA 2I1VB 1P75A 2C5LA 3VMFA 2C9YA 1FQJA 2ZI9A 1Q3TA 1LF5A 3O8BA 1HUQA 3KQKA 3DZ8A 4NCJA 3SFZA 2XNDD 1G3IA 4B47A 2ZVPX 4EPYA 2DFLA 1KDPA 1E2KA 3GPLA 4ACAA 2ODEA 2RGGA 5JSZB 3IEVA 2FPKA 3PQCA 1E2MA 5EUQB 3QVUA 5HE9A 4TQUS 1FTNA 2RGDA 3EX7C 3AVPA 1I4LD 1CEEA 5IK2D 3QOFA 2X19A 5SZIA 3LWNA 3QF4A 4YONB 5GJWC 4BLTA 3H0KA 4QC2A 1XPUA 3LXXA 3OEHD 4TT3A 4LC1A 1G20E 1Q21A 4PPGA 2HXSA 3R20A 4WA7A 2OXCA 3CUEF 421PA 1F3OA 5CJ2A 4KV9A 1XMIA 1Q12A 2XB4A 3QE0A 2IWRA 4EPTA 3FGNA 1IM2A 4B33A 4NYJR 4B71A 3FHCB 4OI4A 2R2AA 3U4QA 1P9WA 1JECA 1EFRD 2BKEA 1IHUA 5FBRB 2A5DA 1K6MA 1M8PA 5A5GA 4B3DA 4DB4A 2RGNA 1U9IC 3R9IA 2ECKA 1UEJA 1Z6TA 3VKWA 5FTJA 2IUUA 1S0UA 2XZOA 4L16A 4YMTA 1G8FA 3ZD7A 3JZMA 3CPJB 3CPHA 3HDTA 5J4LA 2XZPA 2ZJBA 4JVNA 3K09A 4KYUA 2XTMA 2IEZA 4TN1A 4C7OA 3AVTA 1DO0A 4KBGA 1PJRA 2WAXA 2G0NA 3B6EA 2FMXA 2GAAA 1EFCA 2QPAA 2W6JA 5D3QA 1S9HA 5EP2A 3WYFA 1E96A 2PH1A 4FIDA 1UKYA 1RYFA 2WWGA 5HKKD 2QGNA 1ZNWA 2CHGA 5KNDA 3ADCA 4H1VA 4G5SA 1ESMA 4HAUA 3KKPA 2FFQA 4JL8A 2QP3A 1E2DA 2JCSA 3DKVA 3HP1A 3RRNA 3TW8B 2IF0A 1N6NA 5IF9A 1U99A 5FPSA 2QBYB 4LOAA 3RSOA 1J7KA 2FEOA 1E2IA 1KI9A 2C9OA 1KGDA 1A2KC 1N6IA 1D9XA 3B82A 1YR6A 3NTUA 4LZZA 4MYUA 5EXXA 1E1QD 4EUNA 1DVRA 1G7RA 5AJYA 5CB6A 2WJHA 2QM8A 4BEJA 4DLZA 2CCKA 1R8QA 4A4DA 2GDJA 5E7JA 1E3MA 2F3RA 1UKVY 3K0AB 3L43A 2IYZA 3U6KA 4TMKA 3TUJC 4LK2A 1HQYE 1ANKA 3B85A 4W9MC 1GG2A 2NIPA 5JRJA 1DG3A 3QBTA 1V43A 3OAAA 1E9BA 2ODBA 1P9RA 3SJAA 3QKRB 2VEDA 1ZM2A 3MAAC 4AKEA 2OBLA 1FNMA 3BD9A 1DARA 1XD2B 2AL7A 2YOHA 1N0WA 4C0HA 4AI6A 2KWIA 1N6PA 2BJVA 1Z0DA 4DT1A 1KMQA 4GP6A 5KPDA 4HLQB 3LBIA 2NTYC 1OH6A 1W5TA 2J41A 1HYQA 2ZRLA 4C2UA 4LI0A 4X8MA 1RRFA 3MFYA 4OHYA 2JJ2D 1G21E 1K5GA 1KKMA 1UBEA 2FNAA 2R6CA 4KLNA 4PC6A 3RC3A 1J8MF 4URXR 4QBGB 1W48A 1S96A 2ZRCA 4DVGA 2J87A 4AKGA 2QMOA 3B2EA 3HPRA 5LPNA 3AB3A 3PEUA 2YC4C 2AK3A 5BYKA 2PCLA 4DWJA 4B3XA 4E03A 1LFDB 3RANA 3ND9A 4MKHA 4OJKA 1UAAA 3EARA 3GJ8A 5CLLA 5AJVB 3SJCA 4V0MA 3ZD6A 1XF9A 3CF2A 2BOVA 4EFNA 4EJSA 2IC5A 4Q21A 1CR1A 3ZS9A 4LJ5A 4LC0A 5TB5A 5DO9A 3W8RA 4MGKR 821PA 1Z83A 5FUYA 3U7HB 2PZEA 2Q21A 2Q6TA 2GZDA 1DPFA 3ZVLA 4BFXA 1B0UA 721PA 4OYHA 3HJNA 3LH5A 1WA5A 4IOJA 2PLRA 2ZJYA 3QVVA 2OHFA 2Z4SA 1YZKA 3B1VA 1XXHA 2O8EA 3M0EA 2G9NA 4IRUB 5FTKA 1A2BA 2WWFA 3MUFA 4W7SA 2ZRGA 1BS1A 1ZM9A 1W4AA 4LHZA 5LB2A 4MRVA 1AGPA 3WBJA 4HB4A 2F1JA 4D4JA 2O8BB 1OIVA 3K70C 1E2EA 3GD7A 1NF3A 5UKDA 3H2YA 3OFND 1PZNA 3WP0A 1ZUHA 4LBVA 1HE8B 1L4YA 4Z51A 4BUJA 3L0PA 3A58B 1RKBA 1F48A 1NY6A 4WZBE 1E79A 2ZRHA 1KI3A 3PEYA 2J1LA 1ETUA 1WRBA 5FOXA 1EX7A 1IY1A 2I3BA 1BKDR 2W6ID 4RD3A 5GVSA 1HE1C 1XEFA 1XX6A 4OL0A 3HR7A 1HY3A 4MDEA 1AQYA 1E2JA 2CCJA 4LPKA 4TMZA 5DIFA 3KQUA 3A1TA 1E0KA 4A6PA 2IYUA 1W0JA 4F38A 3BS4A 1ZW6A 2AWOA 1COWD 4TTPA 3CONA 3WY9A 1P3JA 2AX4A 3IILA 1OW3B 1TEVA 2A5FA 2GZHA 5L3SB 4M1YA 2KE5A 5FBLB 2ZREA 5FFMA 1C9KA 1PLLA 1M74A 3ONWA 4DC9A 1NRJB 1KNQA 3T5GA 4FMCB 1FL9A 5DH9A 3QEOA 1GAJA 1ZAKA 2D2FA 3PUWA 2P5TB 4G5RA 4Q1FA 1VG0B 1CR0A 2QMHA 1XXHE 4PHFA 1BO6A 1EG7A 5JLJA 5FPTA 3WYGA 4N1AA 3FYHA 4E22A 4M22A 3VU9B 4AKHA 1JQJC 2V54A 2ORIA 2F7SA 3KKNA 2VP4A 3PENA 1SKYE 4D26A 5E4FA 3AGPA 5DNYB 4D0GA 3MWJA 1KO4A 5FH9A 4WZAE 1TPZA 1XJQA 2ZQ5A 2ZS8A 3RRMA 3G5UA 3TVTA 3WMEA 1QF9A 4GOXA 1XWIA 3VKHA 2R65A 3EA0A 2G1JA 4MITA 3I61A 4JLKA 2FGJA 2IXGA 4BFSA 4XWOA 3VNUA 4V03A 1LVGA 2KBFA 1OXVA 2YV5A 1H8ED 2HT1A 3KTAA 1IXSB 4HAVA 4FW9A 2Q3MA 4LPSA 5CB8A 1AKYA 2O0JA 1I4TD 3THOA 3TVDA 3QPUA 3BH6A 3A4NA 3DDCA 4IDQA 3EPHA 4A8JC 2ZRBA 2Z83A 3MJRA 2BIFA 2WWXA 3X1XA 4B2LA 2P6NA 3QPWA 3PJRA 3QF4B 5TY0A 1A4RA 2V7QA 2JATA 1P2VA 3FFAA 3UPUA 5FOUA 2H92A 2GILA 2EFGA 4XIGS 1E2HA 1NSTA 2G83A 3R8CA 3TJZA 4MUAA 4X8LA 4F4CA 4HB2A 5KSOA 1ZU4A 2YYZA 1WDTA 3DMNA 1ZD8A 2R6AA 1U8AA 2F55A 4EIWA 4L15A 4OHWA 4B34A 3A6PC 2HJGA 4PZLA 1T4GA 5FBVB 3LBHA 1OE0A 2R9VA 3NC0C 4Q9LA 1QDEA 2X2FA 2V1XA 1KTVA 1ZC4A 4NYIQ 1KI7A 4LJ9A 1XCPA 4JLDA 3TQFA 1XU4A 4Y0AA 3BFXA 5EUMA 1KDRA 2R6GA 1JALA 1NVWQ 4DLWA 4DCSA 3FMIA 1ZBDA 1CULC 1QVAA 2P65A 4PO8A 4LJ4A 4LYJA 1R0WA 4JIMA 4IDNA 1KI6B 4Q7KA 1MO6A 5ELXA 3NBZC 1G5TA 2ZSDA 4YMVA 1SZPA 4S2EA 1F2TA 2FFHA 4LX0A 1ZM7A 1GL7A 1II9A 4HUTA 2ZRMA 4C7OB 4BZXA 2P3SA 1P6XA 1ZNXA 2REBA 2QQ0A 1UBCA 2IYYA 5G53C 4DIDA 1K8RA 1S1MA 1OSNA 2AN9A 2JIZD 3Q9LA 1XDBA 3MWYW 1KI8A 4D0NA 5G3ZA 1ZC3A 4BZPA 3MLEA 3FMPB 2H8KA 2FZLA 2G77B 2NGRA 2VBCA 3CM0A 3IHWA 1N5KA 5D3MA 4F7WA 1SQ5A 2PEZA 1GRQA 2DCUA 2ZRJA 3L82B 5JECA 2ATXA 1A82A 4FD2A 2OAQ1 4TL6A 2RGBA 3OIVA 3RS0A 4HLUC 2D62A 3ZVNA 4GNKA 3TSWA 3OE7A 4BFVA 1X1RA 3EIHA 5IRCD 1KK2A 3GJ5A 4PSVA 2V8OA 2J7KA 1ZJ6A 1F5NA 2R62A 3H86A 5CDFA 2GEUA 3MG9A 1P61B 3SJBA 4CT5A 1S1CA 2V55B 1VYUA 2QMEA 1NN5A 4Q1DA 1FPMA 2A78A 5EE1A 3ZH9B 4UJ3A 2QE7D 2QSYA 2EYUA 5FUXA 2BBTA 5TV2A 3FTQA 1N5JA 5G41A 2EFEB 2JLVA 1L8QA 3A4MA 2A5GA 3ZYCA 1AQUA 4PAMA 2PCJA 1N6RA 5CJPA 1UFQA 4LV8B 2IXEA 4JYCA 4DT1B 2QSZA 2IS1A 3T34A 1MO4A 1KK1A 1YZLA 2JJ1A 3HYTA 4TLAA 2BVNA 2OEPA 1G19A 2AFIE 2QNRA 5IDVA 1P9NA 4Q9KA 3SQWA 2P6RA 3QPVA 4I99A 2ZJAA 1VIAA 2FSFA 2WJYA 2F1IA 4IJMA 1WP9A 4LCBA 1BYIA 3SDZA 4C3ZA 2XOKA 4PTLA 4B3FX 4JT4A 1XEWX 4DSOA 4KSCA 4Q9HA 3SR0A 3GLFA 4Q7JB 2ZSFA 2VQSA 4D25A 1YZGA 2WKPA 3P27A 3AVQA 1D2EA 3WRYC 1VHLA 2ZITA 3ZQ6A 3KJHA 2IHBA 1GKIA 3LVRE 4ZV4A 3WNDA 1FMJA 2RH5A 2JAQA 3L0SA 4EJSB 1TADA 5EP1A 1W44A 4V0NA 3EWSA 3B5JA 4B3GA 4JL5A 5AUNB 4G0NA 4C2TA 4XVQA 3TNFA 1UADA 4Q01A 4QRHA 4TT3D 2HV8A 5CDFE 3KXLA 1NBMA
chains in the Genus database with same CATH superfamily
4PRZA 1LV7A 3VDNB 3WB0A 2DZDA 3K16A 1N9KA 3WAGA 1Z0ZA 1O0SA 4NOLA 1BMFA 3RWMB 3OQHA 4DWVA 3IHTA 1I2CA 1C9EA 1RLMA 3L1UA 1GV1A 3MF4A 1FMLA 1KMNA 3GJ0A 3NDRA 2W83A 3QEMA 4MX8A 4R1NA 3RV3A 4XVCA 4CEHB 5DYGA 4NV3A 3BK2A 1JBKA 1SXHA 1CY1A 2D74A 2MWMA 1ZM3A 4G1UC 2ZK7A 2FGKA 2QG9A 1A9RA 4W8HA 4WXRA 5DTMA 3EG9B 3VVBA 3TZKA 2IOHA 3HP4A 5E6UA 5A5VA 3KTOA 4M1KA 1FFCA 2X86A 3JATB 4YT4A 3MUEA 3OCJA 1ML4A 4LZJA 16PKA 5K0JA 5C52B 1Q1NA 2O2GA 1QGUA 3V7UA 2VBFA 2C2OA 3JVUA 2IUFA 4TUYB 4GBJA 3CV3A 1YI1A 4EG1A 4AQDA 1RE0A 1G5QA 2RK3A 2IZZA 5J40A 3SMVA 3OX2A 2H54A 3LT4A 4DCUA 4ZYVA 4BCCA 1NPDA 1ZD3A 3TKLA 5K05A 2X2PA 3NAZA 1IVNA 3G2HA 5IM4A 1ZCBA 4GI5A 1N8SA 4PPYA 3FAZA 1Y42X 2AJ8A 3I8XA 4FGKA 4HDMB 2GAIA 1NHGA 2HEIA 2O2IA 2YRXA 3DGEC 4KIFA 4PQEA 2ZI3A 4C0WA 5CB0A 3L8MA 5CYGA 5DXAA 3E23A 5JJBA 1HT0A 1MRSA 2ZWAA 5GAJA 3G9UA 1YA8A 1LI5A 2Q5IA 5CA1B 1FFXB 3OU2A 3ODGA 1FDVA 3KLOA 1E7SA 4JC4A 1XTVA 3OE5A 3TOXA 1HDIA 2H85A 5KNDD 4JSRA 1L7VC 3BZWA 3KTFA 1QZ3A 3UOAB 1BAPA 3H99A 3I0MA 2NP6A 2P4UA 1RKUA 2H3HA 5A5FA 4ZTZB 4YJGB 1PQPA 3BMNB 3I2JA 3Q7EA 3GFVA 3LYLA 1E6LA 1W4LA 1XCOA 3ASVA 3E84A 4Z0PA 4CV0A 4HC4A 4F4UA 3PPIA 2QAGA 3Q1KA 4I50F 4D6XA 4ZDIA 3W2GA 2RIPA 4RJIA 1K5PA 2NU9A 3OLYA 4Q4AA 4B7UA 1G0NA 1PYOA 3GW8A 5DWQA 2PIDA 2YIDA 2WJIA 2BW0A 1GPUA 1N2OA 1UP7A 1DDOA 1Z4KA 1NWCA 2PRYA 2PKQO 2FMIA 4ZAZA 3PKZA 5DLEA 5BR1A 3MN1A 2CXUA 1DEHA 1PCXA 1QFZA 4LTMA 1MU0A 1ONBA 4G09A 1WXIA 4GLJA 3X1MA 4D81A 3UMGA 1IHDA 3LT2A 1Z0FA 3SX4A 5DBOA 4CN8A 1W85B 1HKUA 1YZTA 2Q62A 4LSZA 5DW0A 3TXXA 3UFXB 5I51A 3DOUA 4BKUA 4YP0A 1TM2A 1UPUA 2E2WA 2G36A 3WLQA 1WUKS 2VWHA 4KQIA 4ZOAA 4I2NA 1YO6A 2VAMA 3N2NA 3HDQA 3V80A 3W5JA 4BO6A 4KN9S 4S35A 2X8WA 3W9UA 3V97A 1RXWA 1X8KA 2XXAA 1EDOA 2SNIE 4EHFA 3C6QA 2A8YA 5A03A 1TK2A 2I4LA 4MHSA 4GPAA 2Z2KA 1NVVR 3A1WA 1I3LA 4Z4HA 1NYQA 4EY6A 5TVKA 1AGYA 2XB9A 2GNPA 3I8OA 2XWSA 1L3CA 3IEKA 4RFSA 2VHTA 3SBEA 4GQIA 4KIUA 2D7DA 1NVAA 2FPLA 1NURA 4XM1A 2Y1EA 3PU6A 1I1OA 2F9FA 4MCAA 1B1AA 1ZZGA 2ID8A 4MJ3A 2G6TA 4D9GA 3LK7A 4RY0A 4L5IA 3UMMA 3FOAA 1J2YA 4KPUB 4TRNA 1HGXA 3WBBA 3WKAA 1JDJA 2VC2B 3V1TC 3D6VA 2IEAA 1Q0SA 2DPMA 1RD4A 4AU1A 1NXQA 4N7RA 4ZCRA 4R2LA 4L08A 1UDCA 1UJ4A 3PS9A 1ABBA 5F9FA 2GK6A 4TXJA 4NMXB 1YIOA 2J7PD 3K9NA 1R5OA 3CLUC 4BMCA 4DA7A 1IQ0A 3W4JA 3AJAA 6Q21A 1G3QA 3SHWA 3TI7A 1J8FA 1I9GA 5GONB 4C0LA 4PAQA 3SQOA 2IGBA 2CE7A 2JL1A 1TMGE 4JMPA 1VHWA 4HVLA 3S2GA 5CAEA 3LIIA 3SHVA 3SIRA 3L6EA 4G0ZA 2CHFA 2ZU6A 1OLSA 4MUGA 1G7SA 1I3OA 4JUIA 5HR5A 4MGZR 2XQGA 3G3EA 2CFOA 1I80A 3PXXA 3LT1A 2X9LA 6CHYA 3WA6A 1X6VA 2B1IA 3DMTC 3QKSA 3ROXA 4KJXA 4Z54A 2R8OA 3LK6A 3SR3A 2ASEA 3PNLA 2CMKA 1M8JA 3E5NA 3W7AA 1TYDE 4RZ3A 2XGJA 1D1QA 2OFXA 4FBMA 5GOTA 3RFFA 2HBQA 4LJYA 2QW8A 4D44A 3KSDO 2QROA 1W0KA 4ER3A 1E32A 3C6YA 3ZHZA 4IFEA 3M5WA 1TD9A 3HB5X 5CB4A 4WKBA 1AHNA 3IGFA 5JWOA 5KJFA 3G1WA 3O8RA 3ZV5A 2Z43A 2NQ2C 1FNNA 1X7DA 3EXIB 2UKDA 2PT9A 2FVYA 2ONJA 1E4OA 1LDBA 4YRJA 2BD0A 4NCXA 2V58A 1PQ4A 2RK4A 3B7GA 4OQZA 4MUJA 4REQA 4GMFA 1H3NA 1JG7A 4C76A 1D09A 4KQFA 5G4KA 5FDFA 2NMVA 2WJJA 5A3JA 3NEYA 1I6LA 3MT9A 2NXJA 1BXKA 5EPUA 2GPAA 5HCIA 5A0VA 2BFOA 4IH1A 2EBUA 4FSHA 4WOBA 2FZVA 4HJRA 4XLZA 1EFPA 1I4OA 2NZJA 1GKKA 4BBAA 3JWHA 2PUHA 4XD2A 3QLUA 4KV7A 2FKAA 3G0DA 3OEEA 3R7AA 2QMUA 2YN4A 2YZMA 1XKTA 5KI6A 4MVJH 4W5JA 3NDPA 5HXAA 2O0HA 3ONVA 1C3XA 1GNQA 5DT9A 5C8YA 1AB6A 1C7IA 2POQX 3U7QB 1V2GA 4U7DA 1UBRS 1P0MA 3N2EA 1BEZA 3B2NA 2B3TA 1QIEA 4P3PA 4Y9DA 4BO7A 2O5CA 1E9VA 1GDDA 1TJYA 2D8MA 2QOEA 4BYMA 5JADA 5LOVA 3W9YA 3K0FA 5TMPA 2H1OA 2G70A 4R83A 4DCVA 4L9WA 1HOTA 3SBOA 2Z9BA 4NCHA 1LW7A 1O57A 3ACCA 3AEXA 4E5YA 4K03A 2IIQA 4G1CA 3BMCA 1GT6A 4QBIA 3GA0A 2XGMA 2CVHA 4TTQA 1ODLA 1SUSA 1X1QA 2GM4A 4GKVA 5E7MA 1J0CA 1OBFO 2QLLA 4LKOA 4LF5B 2AKAB 5FI0B 1U7OA 1V47A 4NMWA 1Y37A 2QNIA 2ZUFA 2PL1A 1IYZA 2VZ8A 1G66A 3ICVA 3PFHA 3IAEA 4L8LA 4A0RA 1IFXA 5EXTA 1PJCA 1CUXA 2J46A 3GEPA 3W5HA 4B75A 5BN5A 1QJ4A 1BS9A 1A2QA 1I2MA 1P19A 2PXXA 4ZRMA 1KP9A 4K1XA 3BJEA 4KTTE 4TROA 4XE5A 1WULS 1HMYA 2QUZA 1N36B 5K3CA 1E61A 1IUPA 2HSDA 2OQIA 1QHXA 5HGJA 2XD9A 1SBIA 4M9XA 1V1RB 1Z6YA 4GSYA 1K7XB 1T25A 3DBRB 3OY7A 4LGVA 5B64A 4DV0B 4PAOA 5M04A 4B3HA 1T2VA 3PC2A 1RKXA 1BMTA 1M0SA 1NXPA 4TQAA 3D4NA 2K7FA 3PEVA 2ZETA 3OTGA 3H4IA 3ESZA 3MK31 4EFLA 3TOSA 3OIDA 4O63O 1OKKD 4MVJF 1F38A 3GLFB 2W2KB 4NMMA 4XUEA 2NX2A 5DI9A 3IXLA 2BCJQ 1G6Q1 1ZH4A 3I52A 1KAMA 4B6GA 4J0EA 1JHRA 5BQOA 2VSNA 2BN4A 2HRCA 4KI0A 3FDFA 3QELB 5DTRA 5KEIA 2JA1A 1HYHA 1SULA 1X8LA 3GP8A 2B7BA 3LDHA 3C8MA 1H8HA 1Y3IA 4KXVA 5ALWA 4BKOA 5AVSA 5CM2Z 5CRIA 5DCWA 3VX4A 2IH4A 3KAPA 1E5XA 1ADCA 1Z4MA 4MR8A 4ES6A 5EFOA 5CM8B 5AK3A 4K6GA 4R05A 3GLSA 2QW1A 3MW8A 4QAJA 4U3JA 2C5AA 2WKQA 1K08A 4ER6A 5BSFA 1W2GA 4YO8A 3RHTA 2HGSA 4I9FA 4QDXA 4B4OA 5HQ3B 1RAAA 4IGKA 5F9MA 3QEMB 3WLAA 1KERA 4FYKA 3MUOA 3DPSA 4L0QA 1QSGA 3L8EA 1VIYA 3UICA 4MAAA 3OD1A 4WK4B 2G1UA 4FT4A 3P9QA 2H7XA 4RHYA 2VXCA 1MX5A 1Z28A 2EF1A 3OZWA 4UM7A 1IHOA 2XYQA 5E6UB 4NRDA 2OV2A 5C9ZA 3Q1LA 3HKEB 3AQIA 1RHKA 5DBEX 2VDPB 1WSAA 2YS6A 3G1TA 3PGMA 4E11A 3I2HA 1JTEA 1I30A 4P93A 4HRYA 3V4RA 2P1ZA 4Y8VA 2J09A 1P1RA 1QHHA 1TZBA 2IXFA 1U04A 3RUEA 1ONOA 1UXHA 2XAAA 3DL7A 4ITRC 3C5VA 3UK1A 3WNVA 5G1PA 1Y81A 1GA4A 1WLSA 3HRKA 3RVKA 2PX0A 3NVAA 5TVGA 3HN7A 2WJPA 4QPPA 2YL2A 5JWHA 4UBNA 1DPGA 3DNFA 5TEVA 2XB2A 4O2AF 4WY5A 5JAOA 1EWRA 1PNTA 1TUIA 1OH5A 3WGZA 2PD4A 3F8WA 1G3MA 4LXXA 4MCIA 4W9NA 3SJZA 3ZNOA 4BBZA 3HCAA 2AOTA 2AT1A 5HILA 1D4AA 4G56A 1P2UA 1RI5A 5I9SA 4D9HA 3WWEA 4XWGA 4EZBA 1VE7A 4G01B 3G0HA 4FDUA 1RRCA 2D5CA 3QU9A 1KYVA 4OMCA 3ZNPA 4GL4A 3NHFA 3LIPA 4JA0A 2ILVA 4MP3A 3U49A 2IYXA 1ST3A 3ABRB 5LCXA 4XYMA 1RYMA 2A0YA 3JQRA 3P2EA 1UKEA 3O90A 4WASA 2J9YB 4ZZ2A 4JFAA 1GGEA 3JARA 2QAGB 4UXIA 4XD7A 3O4GA 2QMYA 5ENDA 5AXCA 2Z6VA 3IOBA 4Q4AB 2IDKA 4GPEA 4FP9A 4I9GA 1RYDA 8LDHA 3L49A 2LBPA 5EQJB 3BC1A 1VJRA 2WJ3A 4G37A 1MB4A 1LQUA 2J0UA 3GFQA 1KC1A 5JJIA 3WTCA 4PYQA 3FFXA 2ZCJA 3HXQA 2PR2A 3ADKA 4U7GA 2O2EA 2H2FA 2QXTA 4NESA 3O75A 4LJ7A 2FX3A 3N2ZB 1FSSA 1K2VN 2PUTA 1OZ0A 1USWA 5E0KB 2P69A 5BQFA 4JV5B 2FJ0A 1BOOA 3PNYA 1PTJA 1TKBA 1TZKA 3IERA 3MS4A 1H23A 3TTYA 1T34A 4U63A 5T6BA 3OOYA 1PGNA 3C8ZA 1R9NA 1Y0BA 2GLTA 4R4JA 2XXAB 3GLHA 2P9CA 4WAUA 1BU5A 3FHOA 1FU7A 2FSPA 4L78A 3EY9A 5DYNA 5E95A 3DHYA 3RADC 2H1LA 3PHGA 3OBBA 5B7GA 3HR8A 4A03A 3BJMA 3GGJA 4URUR 4DVGA 2A7QA 2C4HA 1VFNA 2ZB4A 1PK7A 2BTQB 2ZROA 1FFDA 4QBKA 3SC3A 3X2FA 1DC7A 2F48A 3ROFA 1Z5VA 1JFRA 1ZUIA 3U4HA 3T0GA 3TWOA 3KPWA 2PL9A 3IJEB 2VXYA 1JQKA 3B6IA 3QWIA 4HDKA 2YIJA 4N01A 4OU4A 4V39A 4LZLA 4BV8A 2D1YA 1UAGA 2V0NA 3F7OA 3GCXA 3QVKA 4QUHA 4RJLA 3UANA 3ZIDA 2UYYA 3DZFA 1YZQA 4B3CA 1U2EA 1VGRA 2VTDA 4ND4A 3ICEA 1Z4IA 1DKUA 2C31A 2X77A 5AXBA 1MFZA 2P2DA 1UXIA 2D5AA 4DV7B 4QELA 4KBYA 3UJ8A 4NZ9A 2QRQA 1SC1A 1EFLA 2YZ2A 1QVWA 4RHCA 1HEUA 5IU6A 3HL0A 3UGJA 4RTMA 1OF1A 2XADA 2R751 3OX4A 3AP2A 5FOSA 4UOZA 3UJCA 4OHXA 5CFPA 7ADHA 4ZZ3A 4ICIA 2EJVA 5ISMA 3K32A 3WC4A 1DOAA 2C9MA 5LU8A 1NUUA 1QC5A 4PR0A 1CERA 5K0BA 2OGWA 3U3RA 4WBNA 3HV2A 3R7NA 2UYHA 1XSEA 2VP6A 3CXUA 1OLSB 2UZIR 3D3EA 4G0OA 5DHPA 1CJBA 1RXIA 3I53A 4PXAA 1RTTA 4H0CA 1QRDA 1DQNA 2V9ZA 1KKUA 1O9GA 3EK2A 4GI1A 1EZ1A 3LOQA 3NTRA 3DKRA 3RYFA 5T4FA 3BDIA 4P2BA 5JBQA 4ZOLA 2NQTA 4FU0A 4DR7B 1M6VA 5K6RA 2QXYA 5G3YA 1YCHA 4BIIA 1H05A 2IEGA 2NZ8A 3B9PA 4Q03A 4BRSA 2Z8YM 4FHCA 1YD7A 1O4VA 4JCOA 4O4LF 5SICE 1K6XA 4DHWA 4CM9D 5K51A 4V0SA 4DJEC 1SKMA 1OROA 1B41A 1T0HB 1VI6A 2XUPA 3IQXA 2GZAA 4HYQA 4RK4A 3SBXA 4F46A 1I1NA 3LUCA 4RVUA 2DM6A 1MX1A 4XCVA 3ZU5A 1GKYA 3SSMA 1Z0IA 4JLSA 5ENVA 2FG7C 1W5EA 5ESXA 1P1CA 2JBAA 3FWPA 5EAIA 2LIVA 2NTNA 3PNPA 2B5WA 1MMFB 2O59A 4Z3OA 4B44A 1EZZA 1M54A 2H1HA 1I3CA 1L9KA 1NR5A 1PGJA 2PX6A 3FRIA 5C37A 4NK4A 1J49A 2O7SA 1EFPB 2VT3A 4JLWA 2C92A 1L5HB 5BMOA 4BU0A 2C1EA 1QFJA 2VF7A 2PXAA 1Y3CE 2Q2OA 3AR9A 3A6DA 1O5OA 5L3VA 4MGEA 1ZIXA 3G6WA 3NX4A 3V8VA 3GUZA 2IPLA 1E9CA 1YGYA 5A9TA 2C04A 5C8YB 121PA 2EATA 1E1QA 2CNOA 3CO5A 4UUPA 1KJ9A 5LNK6 2FUEA 1ZK2A 3CZMA 4OJYA 2PT7A 3ITKA 3SZRA 3MOIA 2HGZA 2C97A 3QVTA 2GWHA 2MSEB 4KE6A 5HFJA 2IV3A 3VJLA 4RFLA 4TTSA 1DJOA 3NHAA 4X97A 2ORED 3VNQA 3WLSA 1XA0A 5LOVB 3PX7A 3L0BA 2NSYA 2NG1A 3EEQA 2KM1A 3ZDQA 2HJSA 4F5WA 3R76A 1RJWA 1SWVA 1EESA 2GFQA 3FSJX 2BCGY 2WTAA 4TUYF 3A4IA 4A91A 5C32A 5B2EA 1YNOA 1CG6A 1IK6A 4ASUD 4P7FA 1RLJA 3E8MA 5AHKA 2IBTA 1J5EB 3G9XA 4K3VA 4PLYA 3D4OA 2H2IA 1EE1A 4YO7A 1ZSVA 3HVJA 1DIOB 3U3KA 2WUEA 4Q3DA 4WESA 1G16A 2ZRAA 3ILXA 4H6XA 4RD0A 2GEVA 5ECDA 5AK4A 1AN9A 1CFZA 3E1KA 3IV6A 4D9CA 3CNOA 4HFNA 1THGA 5CA1F 4M0FA 4MQ5A 3GMTA 2HA4A 4C0JA 1TX4B 4LDJA 2WSSD 1KIMA 3PNKA 3AVXA 1ZVQA 2ODNA 2OSBA 1PWEA 2HY7A 5FI3A 4DQ0A 3L7KA 4JKYA 3A1FA 4IUYA 2CL6X 4D4MA 4JJ8A 1M2HA 1MQ8B 3Q85A 4FZRA 4RZSA 3RBAA 4FGSA 1JKFA 3AUUA 3LECA 1L5FA 3LHDA 3W2IA 4HRXA 1T0IA 2QMQA 4V3BA 4AN1A 1XAHA 4EI8A 1T0JB 2EJBA 1YIDA 1FYDA 3FCUB 1RIFA 2ZUVA 3JY6A 5J4HA 1FP4A 1GHTA 3RO7A 4E30A 3VC3A 3ILYA 5LMCA 1XPOA 2IZ6A 3BSFA 4QUGA 1H2YA 1P91A 2A58A 1G8MA 4Q18A 4CLRB 2CZCA 3AFOA 3D3WA 3KT0A 4Q1EA 4IOLA 3DTVD 3A25A 2QRVB 3B36A 4XX0B 3R9XA 3S8MA 1K97A 3N07A 4UQOA 3REOA 4QOHA 1A8IA 3K1YA 3T38A 5C5CA 1WCV1 3D6HA 4PRKA 3SS7X 5KX5B 3T9FA 4YQEA 4MR8B 3S99A 3GAMA 3ICCA 3HBLA 1RWMA 1WZUA 2R1TA 1B0ZA 1E3SA 1ESNA 3LOUA 5DKFA 5AK6A 2BISA 1DWUA 1F4PA 1VMEA 3GK3A 1SU6A 1X19A 1YGPA 3JX9A 2ADOA 2PPVA 1QQ6A 4PC3A 4Q5IA 4R8LA 2IDJA 4GVLA 1VHTA 1VFPA 4L7QA 3K0HA 4G8CA 5A1TA 1MQSA 2I4MA 3VTAA 1AS3A 4YHBA 4BVFA 5IX8A 4RJJA 5JQWA 5AOCA 4B4DA 1GTVA 3BMQB 4W4TA 2IGTA 3NONA 4K8OA 3UMSA 2E82A 1DC8A 1JHQA 2VJNA 2VQ3A 3LX8A 3BXEA 5JNVA 1GDTA 3LZCA 4IDEA 4RY8A 5BSMA 1ZCAA 2GO7A 1P3Y1 2YYYA 1OC2A 5BV0A 2ZPUA 5DTEA 2HF2A 3A26A 1NATA 3GVXA 4E4RA 2IOYA 1GPBA 2EG9A 3EF1A 1OXBB 1UJ2A 4NCNA 5DYIA 1QHHB 3IESA 3VR4A 1O95C 1W87A 4J07A 4II3A 4R5HA 1G9XA 1K2WA 1K7YA 5KQLA 1K63A 4E4YA 4QTZA 2H1SA 3TZHA 4FQ8A 1UFKA 2OUIA 1KYZA 2BV3A 2RCNA 3F5SA 2QQ5A 3MCUA 3MD0A 4TL8A 5GONF 4B82A 2WWYA 2HYIC 2IT1A 1TFRA 2ERYA 1T9KA 3LLSA 1P4HA 2OQRA 2WPNA 3L7IA 4MKIA 5EHQA 1L4LA 2R4QA 3ZKWB 4CHGA 3F0TA 3QXHA 1K8ZB 2W4IA 1GNPA 1XVIA 4JOQA 4Z2YA 2AOTB 1U28C 2AHRA 1H6AA 4F8YA 3DQQA 4CF4A 5MN5A 4Q1CA 2FE4A 5AHRA 4IIGA 3ZGYA 2IXTA 1KY2A 5EUBA 4YDSA 2DSTA 3FB4A 2WWTA 5ICSA 1JN0A 1KR2A 4P53A 5DLPA 5IF3A 1KXZA 3L8GA 5DE3A 5HPYB 2Q4BA 4WCDA 2O0LA 3WP1B 1JFFB 5AM2A 4M4SA 5BQ3A 4IIEA 2EVWX 4BFUA 2FK7A 4RIEA 4UVEA 1MT0A 4X24A 4E5SA 4IJ5A 4WFIA 2I3GA 5E3IA 4A1FA 5IANA 3CLKA 1JDSA 1V25A 1FYEA 3A7DA 3KVVA 1R0XA 1E0JA 2NZWA 1R5BA 2AGVA 1R0YA 3DE0X 3IRVA 3K0AA 3NJRA 2Y1KA 3NZEA 4DWWA 5FWYB 4Y6QA 4KR9A 1Y8QB 4E6PA 3TZQA 4DLYA 4EY3A 2PFSA 2WHEA 3IIKA 1U2DA 3O26A 3Q72A 4KQWA 4RGVA 3U3MA 1A3CA 4LNAA 5I7SA 2AZMA 2BGNA 4PG6A 3AZOA 1AV7A 4UVGA 3L6RA 4CQMD 4WXMA 3HFSA 1BIFA 4BKQA 1JIJA 3JZIA 1E2PA 5J2TA 3CKKA 1J1UA 1MV5A 3KFVA 3EGCA 1Q7CA 1ZXLA 2NSDA 1MR3F 4PYRA 4NDAA 1YJXA 3HY3A 3OEYA 5ADVA 3I32A 3K3PA 5BW4A 3WI7A 2FN8A 4ZT3A 1GPKA 4BFWA 2AXPA 3VQTA 4Y18A 1VE9A 4RVCA 2NNWB 5GM2A 1IVYA 1RWNA 1JEYA 2WG0A 4PVCA 5TRTA 1QJCA 3T5DA 3BE6A 1EA7A 1GP2A 1U98A 1U80A 5BWBA 4EAQA 1GZ7A 4FFMA 4HDKB 1D4FA 4OA5A 4DCCA 2JRLA 2A33A 1MVNA 1WNFA 3V6LA 4C89A 3C5HA 1VP9A 3O7WA 2FEXA 3LP8A 5E6RB 5JRZA 4Q47A 3C16C 3HUUA 4G25A 3IJ5A 2G25A 4ZO7A 4PBTA 3GNTA 2FN3A 2Q6KA 3AL3A 2AN5A 3DZGA 2P4QA 4KQEA 1YQXA 1B6GA 2V7PA 4OGFA 1ATZA 3CEJA 3COPA 4AWBA 3KSMA 3JYOA 1SCQA 2D2XA 4FONA 1RC8A 5JALA 1V7QA 1R4AA 1QC5B 3NB0A 4A9AA 4J3FA 4EGQA 5BV2P 4DJTA 5F7JA 1DUSA 3W34A 4WBNB 4Z86A 4RVOA 1RMYA 5A4KA 2YHIA 4IVRA 4HFRA 3AOEA 2AG1A 5KYUA 4GM0A 1U90A 4O33A 3VNAA 3GGSA 1YVUA 3AR5A 3BAFA 4ABYA 1LSOA 3N70A 3PDWA 1EHYA 1WR8A 4CMGA 1LQTA 3ZJ5A 3ZWNA 3TGPA 4JLPA 2DOKA 4FSDA 4ZOLB 4OEHA 1BVHA 1ZPDA 1GLVA 3KJGA 5ALTA 2R8XA 1MIOA 3DUFA 2IDMA 4EF4A 3AF3A 2OCXA 1I7NA 2BGTA 2BMDA 4DKXA 5KU7A 1IBRA 3IAHA 4A8TA 2VP2A 4QKQA 1ZGHA 2QZ4A 2E4WA 3HRHA 4Q48A 3UOWA 5AJUA 1OBCA 1KJJA 3D7SA 2X9VA 3R3WA 4TV8A 4DY4A 4LJ6A 3I3SR 4IWNA 2XCQA 2CHQA 3UNXA 1QP7A 2O19A 4KK4A 1YS7A 1FZQA 3DKPA 1T8RA 4YASA 1LU9A 2HIHA 2JBAB 4B3BA 1NQVA 1NDQA 2I6UA 2MTBA 1LPOA 2JLAA 2A0WA 2CFTA 3DO6A 4YAKA 3PDHA 4DAEA 3OQBA 2QLNA 1NKVA 3A1EA 1EWVA 3WOHA 5LQDA 4ENWA 2OHIA 1MFPA 1X1EA 4J9UE 4OKSA 3C0KA 1KR5A 4D4KA 2C9DA 1A8SA 4TPKA 1V48A 2V9PA 1EFTA 2VJCA 3LC7O 2DERA 2W6QA 2B8TA 1P1KA 1T8WA 2C96A 2WAMA 3K09C 1VYHA 3NWOA 3KLBA 4OY3A 3DOCA 4TM8A 6AT1A 4DCNA 1VG8A 3H0EA 3HG7A 1QK3A 3GVIA 4HQRA 4OMUA 4E5PA 2HN9A 4PYMA 3VR5D 4EI9A 4BEBA 3KELA 5JDIC 1L4FA 3AINA 3BX1A 3HWX1 4M86A 3ZVRA 2F3TA 3NYWA 4TGLA 4A92A 4BO3A 1OB2A 2XBLA 2QPLA 5A4JA 1A69A 1EXMA 2J3EA 3V4SA 1K88A 2QVGA 1ZDMA 3D1LA 4H7HA 3VYUB 4BO2A 4W1PA 1CR4A 2P3LA 3KQHA 4HSEA 3ZPXA 1THTA 4I1UA 4A0FA 1AUQA 2C8KA 3DDHA 2JH3A 1A9ZA 4Z8YA 4AY6A 5TJHA 4WESB 2YCBA 4CNQA 3MRVA 1Z6GA 5JV5A 4YRMA 2GPTA 4W1RA 1QBKC 2N1MA 3IPYA 4JVSB 1IXKA 2GJKA 2WPDA 4M1SA 4HWOA 1UFOA 2VSFA 5FYQA 3ZGNA 2EXXA 4EFDA 2KJQA 1P5FA 5BR7A 5JCJA 3PT9A 3A8TA 1G59A 3T06B 3ESQA 4UNIA 1DIRA 5K09A 2X2EA 2P9GA 3K0SA 5GZ3A 1TT7A 4ZJPA 2Y92A 2V7TA 1VIDA 5EA2A 2GN6A 1B8UA 5D1HA 4CEJA 2V7EA 1SFRA 3H2KA 1Q0TA 4KQ9A 4GZ5A 1XJ0A 3ZE8A 2WHQA 2AF4C 4X1OA 3P5SA 1X38A 4MRNA 1KH3A 2JEZA 2CHVA 4MGYR 1VZ3A 1VJ5A 1MP0A 1FSZA 1N9ZA 5HBRA 1DAMA 4G41A 4NNJA 3D3WB 1NMSA 2D54A 4O2LA 1XZDA 2HQRA 2FSUA 2JGEA 2RGWA 3E1GA 3EZ2A 2F1RA 3IP3A 4KQHA 4DHEA 3PFIA 5GV7A 4NFHA 4BO0A 5FPKA 1S2OA 2HO4A 3CR3C 4JELA 4RU1A 4AN0A 3THYA 1C2TA 4QBFA 1RZRA 3N6XA 3NVMB 3CW2A 4RZHA 2NAPA 3A32A 2R1TB 1KAHA 2BUCA 2DYKA 3G8YA 4MVJE 5E9WA 5TQVA 2YWHA 1ORTA 5AUPB 1LLFA 3HCWA 2CNLA 4TTRA 4K6HA 3IELA 4HMOA 2Q9CA 4QGHA 5HKLA 5I9IA 4CGZA 2OZLA 4LWZA 5T41A 2OP1A 1OT3A 1NQ5A 1R8XA 1WKCA 4G3XA 4FFDA 3QZUA 1NVXQ 4MQEB 3WIEA 1LBIA 2NQ8A 4DNOA 1EDDA 4HWRA 4EYOA 1N2CA 4F4FA 3RAPR 2BTEA 1J39A 3I05A 4RPJA 5EMJA 2YWGA 3E9EA 4MYCA 1Z0KA 4D45A 4A5SA 4COOA 3H1EA 1F0PA 1GU7A 4IQGA 2P5UA 1ZWLA 4MQBA 3MSXA 3DBIA 3EJ6A 1HQDA 2GAOA 4HZGA 3BXFA 3IDQA 1WEHA 4QPNA 1C9MA 1D07A 5C8VA 1II8A 4FYMA 2HMWA 3SAJA 3FPFA 4TRMA 1TKCA 4CDNA 1KFJB 1W36B 2C95A 4MWGA 3B7PA 4DQXA 2Q1YA 3TQHA 4ZI5A 3FHTA 2IPNA 3IO5A 4URVR 3CTPA 1QU3A 3KWMA 2DTEA 2ZJZA 2ZUCA 1XC7A 1ACMA 3RSCA 3FKSD 3TSYA 1EINA 1GPMA 1WTCA 2J8ZA 3UUEA 1H85A 2D6FA 2EGHA 4INAA 4JDUA 3DMTA 4YGXB 4DN6A 3JSAA 4KLZA 5ECWA 1H9AA 2XGOA 4X3CA 1QDLB 3P2OA 3QWHA 2I2XB 4YECA 4QJ5A 3MS7A 4HQFA 2XGGA 4BLRA 3AM1A 1XO1A 3E53A 3Q2KA 2JLBA 2E9SA 1B2RA 3TR5A 2C61A 1PX2A 2C3UA 1HV8A 3E3MA 3ENNA 4JUFA 3W0LB 3AUKA 5KNLA 2RE8A 3MMSA 5EXSA 1M7HA 1LEHA 4JXKA 1DKLA 2ISCA 4YP6A 1Q3KA 1T6NA 5IZ4A 3PXBA 4ARSA 4PX9A 4WADA 5CAEB 5LP6B 5LD2B 4R3WA 1DV1A 1T9AA 2VPTA 1XYGA 3H2SA 1N77A 3TK1A 1WUHS 4GI2A 3G89A 3BZUA 3BILA 4NG5A 4UHCA 4EHIA 1PNOA 1RC1A 3RQSA 3DMPA 2G1KA 3Q87B 4MIEA 2UZ1A 3ZUPA 1EQUA 3ZHSA 1Q0QA 3FY4A 1Y5MA 3G8DA 4P5DA 1VCIA 5KJEA 3WNZA 4JZKA 1UP6A 3N5CA 2ZZKA 3OI7A 4ZVSA 1V9SA 2PBLA 2BFWA 2PS0A 4UFNA 1CF4A 2PH7A 2R00C 3ZWYA 4JJ6A 3RE1A 1U0GA 4QYMA 3HS3A 1HSZA 3A9WA 1OI2A 2CNDA 1QF7A 2WV9A 4RUKA 2B94A 2ZQYA 1Y3BE 4QHYA 1IBKB 3JYNA 3BSYA 1ZGZA 2C5EA 2LP4Y 4C3OB 4OO3A 2BFCA 2H4WA 2WIDA 2AOUA 2XE7A 5J2TB 2WMOB 1TLLA 3PX3A 4IILA 4R1OA 3I9NA 2ZR9A 1ND6A 5C8YF 3EDQA 4H1UA 4KR0A 5HKAA 3GIWA 1DEAA 1QK5A 1TRKA 1MEJA 3SOPA 1R9MA 3AIIA 5HJ5A 1TQ4A 3TAUA 1F3LA 1H69A 3CCFA 1W4CA 2QWXA 3OOSA 4MPJA 5FLKA 3O0TA 4AUNA 1UMBA 2QJTA 1Y89A 5LOVF 3ADBA 3V00A 4RGYA 1N4DA 3G85A 3DVLA 2GCEA 1A7JA 1E98A 1ID1A 4XPZA 1VKOA 4TS4A 2BM0A 2FEAA 1G63A 4HP8A 3DT9A 5G0SA 3X1DA 4DADA 2FSHA 3O94A 3KVYA 4KUEA 3S7ZA 4DNQA 5F12A 1A8QA 3TLGA 4Z1MD 1XDSA 4K6OA 3ZHBA 1IBMB 3RARA 4EOGA 4ZQCB 5E9JA 1QVZA 3KSZO 1XT6A 4CT4B 4Q9IA 3FW1A 1KYWA 2BMJA 4Q02A 2VSXA 4I8XA 2XUFA 4ALLA 4DCOA 4D96A 2ANCA 4J0IA 1AZSC 4W1QA 1P7ZA 4PLZA 4LVCA 3K73O 5DU2A 4UM5A 2DRIA 3RGGA 3IUYA 3NH9A 2FSSA 3ZKAA 4WD3A 2WAYA 3RF7A 3ZTTA 1T5DX 2EP7A 1NV9A 2Q1TA 3LCJA 4DMMA 2AI2A 2ZJOA 3FMFA 3CZRA 3PC6A 5BQ5A 1Y8CA 2V03A 1XMSA 4G5FA 3BXXA 5KYUB 3JYLA 4FYYA 2J6IA 1G0OA 4PHGA 2Q50A 4TZKA 5DNUA 4HLCA 4D0LB 3GLRA 1UOEA 1YTLA 4P84A 4Q6WA 2JAWA 3RIXA 2F1HA 2YS7A 3IQWA 3KZVA 3EBPA 1WZNA 1Y80A 2FMKA 4PYJA 1KU6A 1XRLA 1EQ2A 1MIOB 3DUFB 3OZGA 4WDQA 3RFUA 4DA8A 5IAOA 3QEAZ 2YINC 1V6CA 2NPIA 3O9VA 4DSZA 4J29A 1JSZA 3PITA 1M1YE 1L4UA 4TS9A 3P4YA 5FL7D 2Z6AA 4KFTA 1C4XA 1VSBA 4KPGA 1BEEA 3QMVA 4TV8B 5KX5F 1D1PA 4M36A 4QUAA 1PU2A 1YE5A 1XMQB 4U2BA 4ZPXA 3M3PA 4MGIR 1CUEA 1DBRA 5JSUA 3RVPA 2MYNA 3QPBA 4YJFB 3AHGA 2PX3A 4IIVA 1WJGA 5LA6A 5F1KA 2OZPA 1VECA 4NSNA 4N9QA 1Q0HA 5LLTA 5IT4A 1NU6A 1KAQA 3FI0A 1WPXA 1IL0A 5DYYA 1BJRE 3UW1A 4GOLD 3VGJA 5B3AA 1DT3A 4AQYB 4K5QA 4Y2HA 1T29A 5I7WA 1F7VA 4F2WA 2FZKA 3R7WA 4LHSA 3FFBA 3ZXYA 2HYDA 3DL4A 2OWDA 1KSGA 5K3BA 4CG2A 1GGNA 1JFTA 1J0DA 1X14A 3NT4A 4GR5A 4DQUA 1Y4UA 1DFHA 1P73A 2D1RA 4REOA 1LC3A 2HMSA 2O7QA 5FUQA 3CEMA 3Q3GE 4KRYA 2P3OA 3KQYA 4R0NA 3VZBA 4YR9A 1PUJA 3ANXA 1GA1A 4YRKA 4LKRA 4HADA 3AHHA 4BO9A 1JLHA 3PV0A 2O57A 1JKJA 2AN4A 4CEHA 3ZDFA 5CX1A 1ZNYA 1I51A 4ZYUA 3OOJA 5AKKA 2WABA 2OXEA 3ANYB 3ENVA 2HH9A 2WHXA 1HC7A 2YWCA 3FWNA 3N7UA 4G36A 1GFSA 4ARBA 3H42B 2IPOA 1V5EA 1TVKB 5CHEA 4ECAA 3P0IA 2VHJA 4B74A 2G5GX 2YXNA 1RWXA 2G80A 3AY7A 2F8LA 3M4XA 3RRJA 4AMBA 4LXUA 5DJ5A 3ZCTA 2RARA 3CW9A 2J9FA 3W8FA 1R74A 1UDXA 4B73A 1YJ5A 3LY8A 4GOKA 4JXXA 2FPMA 3GRUA 4PBRA 4FNOA 1IHXA 1WKVA 4FCWA 4RPKA 5E4TA 2FOLA 1ECJA 1CQJA 1ZJ5A 3KQQA 4YH1A 5TPZA 4ALIA 2ECFA 2WZQA 4CDMA 1S3IA 2EL7A 2M1ZA 4LF8B 2NOAA 4LOLA 4CEJB 1KSHA 4NFLA 4BE7B 4R71A 3ZQ4A 2I2DA 2ZKLA 3TZ6A 5EXDA 1Q1BA 3LY5A 4DIOA 4Q9JA 4GO1A 1GVHA 3FBGA 4JT9A 4EI7A 3VDMA 2ZJ3A 4DV1B 3E5MA 1OAOC 2J31A 3KJZA 4FMBB 3I9JA 4QJ4A 3QNWA 1CRLA 3MRXA 4MA5A 4BECA 4ZCTA 2YQ5A 3EBLA 3WQQA 5A06A 5BUQA 3JZDA 3T0IA 4FKBA 1BDHA 1P17A 5DHSA 1N2IA 4HJXA 1CEYA 2XXBA 4P2GA 2X9QA 3ZX4A 1M6NA 4AX8A 2C9ZA 4DIEA 3THYB 1H1TA 2D2IA 2EWVA 1EJ6A 1NF9A 2EAUA 4WX2B 1A0OA 4C30A 1OXTA 3HXKA 4OQXA 2PQ2A 3WGUA 1CZUA 4DILA 5FADA