1R1BA

Eprs second repeated element, nmr, minimized average structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
MVYDKIAAQGEVVRKLKAEKAPKAKVTEAVECLLSLKAEYKEKTGKEYVPGLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA SYNTHETASE
publication title A recurrent RNA-binding domain is appended to eukaryotic aminoacyl-tRNA synthetases.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Ligase
total genus 16
structure length 56
sequence length 56
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 1998-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1r1bA00
4JI0O 4YY3O 1HNXO 1HNZO 4JI5O 4JI4O 2FKXA 4LFAO 5LMNO 1XMQO 4A5UB 4GKKO 2UU9O 1AB3A 1XNQO 2DOSA 1AILA 4JI3O 5FLXN 1N32O 3SDLA 1G1XB 4NXMO 2UXCO 3F5TA 4DR6O 1HNWO 4DV6O 4JI1O 5A2QN 1R6TA 4DUYO 5BR8O 4DV0O 4X62O 4LF7O 2VQEO 2UUBO 3T1HO 1IBKO 5BXZA 3O65A 4JI6O 4AQYO 4X66O 4LFBO 2UUAO 2ZKOA 1DK1A 3J7AU 3JAMN 5LMUO 4K0KO 1X59A 4JV5O 1FYJA 4OPHA 4DV1O 4B3TO 2VQFO 1J5EO 1R1BA 1XEQA 1IBLO 4JI7O 4LF4O 4LF8O 1I94O 2UUCO 1FKAO 3R66A 2F4VO 3RT3C 2HHHO 1FJGO 1XMOO 4NXNO 4JI8O 2Z0AA 2ZM6O 4B3RO 1D2DA 3M8AA 4LFCO 4JI2O 2N74A 4DR7O 2UXBO 3OTOO 3T1YO 4B3SO 2AGAA 4X65O 4DUZO 2LW7A 4DR5O 4B3MO 4OX9O 1N33O 1A32A 3J80N 2JRIA 1HR0O 4YHHO 1YZBA 1KUQA 4DR4O 2E5LO 4DV4O 1XNRO 4DV2O 2DJVA 4KHPO 1NS1A 4DR2O 3J81N 4OPAA 4DR3O 5IWAO 4DR1O 5LL6Y 5BY1A 1IBMO 4LF6O 4GKJO 4DV3O 4DV7O 1N36O 4LF9O 4LF5O 4DV5O 2UXDO 1N34O 1F7YA 5IT9N 4JYAO 4X64O 5H5NA
chains in the Genus database with same CATH superfamily
1QR9A 4HNAB 4H33A 3TJTA 1NKDA 2ARHA 3CCVV 2IM9A 3E83A 4TSFG 2EINB 3TK1A 4JTDB 1VQ8V 2QR4A 4DK0A 2P06A 1GO3F 4PI2A 4DV6O 1VQMV 5A2QN 3STLC 2L35A 1YSCA 1YTFD 3TXQA 2OCCB 5B1AC 3I56V 4QE7A 1NH2B 5LMNB 5BMVA 2EX3A 1XNQB 4WFEA 1KP3A 5D5PA 1H2KA 2XUMA 2GSMB 1O9GA 5EIBD 2DYSC 1PL0A 2RJZA 5CBHA 3OMAB 2V7QG 3MDSA 4R50A 3D8CA 2VQEB 2UUBB 2NN4A 5DEDA 2BSKB 4GLXA 2YUAA 2YEVA 1ZTEA 1GK9A 1JX9A 4B3SO 4LFBB 3OUFA 4CZZA 4I55B 1A32A 4X8AA 1YZBA 3H9VA 4BIUA 1KUQA 4O4LA 4YXWG 5CB4A 3JAWA 2LQTA 2LFSA 5E1AC 1JJOA 1S77D 3CS5A 1AJPA 3ZRSA 4UCOA 5GTIZ 5BY1A 4N23A 2EIJC 5GTHZ 1VQPV 4B7EA 3RN4A 3FB6C 4O4HB 2A9HA 3ZHTA 5LMUB 4FZ1A 3Q4HB 3CXHF 1IBLB 3JCUZ 1L0LH 4LFAO 3UO2A 3C3TA 5CA1A 2HHHB 4PI0A 1SQXH 5FLXN 1K7DA 1M57B 5B5EZ 3HKBA 1AI6A 2FTKA 1LUWA 1OCRB 4UXNA 4FZ0A 3E86A 3W7UA 3BRCA 3BA9A 5IJ9A 5J2TB 3MD0A 2QKAA 1AR1B 4U3JA 2GHYA 1H8EG 1YJWV 4GX5A 2HJDA 2DE0X 5LMUO 2PUSA 4ZOLB 2C2AA 3K5OA 3N2KB 1J5EO 1IBLO 1FD9A 1SETA 3L73H 2IJHA 3ABTA 2HHHO 2GDSA 5JH7B 3SYAA 4PELA 1G4YB 4ZHQB 5B1AB 3EFFK 3BCCH 1QNMA 5IYZB 2VWKA 2EULA 2B1IA 4B3MO 2OTLV 1R73A 3AK2A 5K1PA 2A06H 1KQSU 3W7XA 2DYSB 4UV9A 2ZXWC 2DWEC 1O9HA 4RUEA 2ZE6A 4KL1A 4LF7B 4CH6A 1H38A 4JZ2A 1S72V 4MVSA 4N21A 5IY5C 3CJHB 2ODMA 1QCEA 4X9QA 1FXKB 4DV3O 3AG3C 2AHZA 3OTFA 2DW4A 4DUZB 4O4JB 1FAFA 3KCXA 2Q69A 3JD2A 3DGEA 3FB7C 5CBFA 5EYPB 1AI5A 4UVAA 3G71V 2BOBC 2EJRA 4FFBB 4EKWA 4C7UA 2ZM6B 1T5EA 1CXZB 1SERA 4JI2B 3VQYA 1GM9A 3K5NA 2EIJB 3LSQA 2E74B 4UB6Z 1N36B 4LF9B 1XQ8A 4LF7O 1P84F 4JYAB 3T1HO 3HPLC 3ZIAG 4LH7A 1SZXA 3O65A 1IVSA 5KLVH 2Q7HA 4PA3A 1XMQB 4F6RA 4ZOLA 2YICA 3N2KA 3ASOB 2JGUA 4R6ZA 5EBLC 3QO7A 1J95A 4BW5A 4YIOA 5TISZ 1R1BA 4K8XA 3HKCA 3KG2A 4MTOA 3LDEA 2D3OW 4I9QA 3P32A 5JH7A 4JYYA 3DTUB 2WLMA 3ABKC 3OGIB 5LHIA 2OIGA 5IYZA 3IJ4A 2ZM6O 4JI5B 5EC1C 4U3FH 4YIPA 3W7WA 4JI2O 4H0LB 4DR7O 4DRXA 3T1YO 2HG5C 2QJ1A 3BEHA 5KHKA 1Q86W 1B04A 1VQ4V 1VEWA 4BR6A 3ZMTA 4QNHB 3K79A 3JAKA 1SQGA 5LGNA 5J2UB 1P7GA 1DTOA 4EB6A 2P7TC 1JQ0A 3S3XA 4TT3G 3A0RA 5C93A 3L70H 3W7SA 1JA8A 4DV7O 1WP7A 3IFXA 1Q43A 4IIJA 3APOA 4O4JA 4DO2A 3AG1C 4OXSA 3PN1A 4W4KA 4QPKA 4CS2A 2IH3C 4LWSB 2KQXA 4RO2A 1ZWIC 4JI5O 1AI4A 2WLLA 1SZTA 4L87A 4UCSA 2ZXWB 5JJNB 4JI3O 3B8NA 1S5HC 1ZX3A 4LR3A 1NR7A 5IE9A 5K1XA 1IXMA 3H1JH 2UXCO 3WB1A 3F5TA 2YXHA 5LBQA 4MW8A 3AG3B 4E4EA 3CHXA 4O4IA 3D3IA 4JAVA 5LGUA 4UVCA 1TUBB 1HNXB 1I7FA 2CH7B 3CCUV 1IXBA 5KA6A 3ZX6A 1DK1A 2Z5UA 2LP7A 3JYCA 2NR5A 3T2MA 3B09A 2GV9A 4B3TO 1AP6A 2ZR3A 4LF4O 3CC7V 2MW2B 3CYOA 2P4KA 1I08A 1V9PA 1S0VA 2Z0AA 3K08A 1RPOA 1IBKB 4ZIBA 2X6BA 4NYKA 2BOCC 3QVNA 4MVUA 3L74H 2VRZA 3JCZA 1VQKV 1NJIW 1MABG 2QTSA 4ABMA 2PYLA 4JTCB 3CE2A 3LSUA 1RP3B 1VQ5V 1BS3A 5EZYB 3ZN1A 4ZI7A 1X4TA 3ZHRA 2B5UA 4DV1B 3OM3B 2QWQB 1M90W 1F51A 2DJVA 2QWOB 3OR7C 3SJCC 3ZHQA 3MHHC 3ABKB 2WLNA 1TUEB 2LO1A 3AG7A 2EIKB 2OWOA 4B3RB 2HJFC 2YIAA 1SKVA 4J10A 4BW9A 5B3SB 5H6QA 1NZ6A 1EZVH 5CA0B 3APQA 4G28B 2Q73A 3LNMB 4GKKO 5CN0A 1AB3A 1I5XA 4HAMA 4PA6A 3UT5B 2Y0PA 3CC4V 1ENVA 1EN6A 4K8ZA 3H1LH 3CX5F 3SPJA 2ZR2A 4PD4F 3OGCC 5HFLA 3P3PA 2AW9A 4QE9A 1JJ2U 3IC9A 3BAAA 1JR9A 4LP8A 3CCMV 2A0LA 1R6TA 2YC0A 2OCCC 1SQQH 4JI0B 4TOIA 3G80A 3O9OA 4CC6A 3SPHA 1BT8A 4JAAA 4U7OA 4CS4A 1NU1H 3ZBHA 1SS3A 2KSDA 3VOUA 1GH6A 5EC2C 4X1KA 4XBFA 1SESA 1Y66A 1X59A 3HKDA 3D36C 4X20A 2DQ0A 3TXSA 2HR3A 2N05A 3CRCA 4ICGA 2CAZC 2IH1C 4QJFB 3G6EV 3RYCA 5EBMC 1L1FA 3ABLB 3ABUA 4LH6A 2WLHA 4JI6B 1MZFA 3OTOO 3K9AA 3A2FA 2H3OA 1YDXA 5BMVB 1Z2GA 2Q7EA 3P30A 2UUAB 3R65A 2GBOA 4DR5O 3EVKA 4WFFA 2JEXA 2Y4TA 3OR6C 1IURA 4DV4O 1Y4MA 2YIDA 1US6A 3B77A 1XNRO 2Q9LA 4IT5A 2CGOA 2W6IG 4BIOA 5CMUA 4JI8B 5LL6Y 4PHZA 5L3BA 1U96A 1SF9A 4AQYB 2PY5A 4G27B 3ZHSA 3ZRXA 3W7TA 2YEVB 1MOFA 1OCOC 2WA3A 5H2FZ 2GTSA 4YY3O 1K92A 4GZRB 3WG7B 2E5LB 1PL4A 1W2BU 3RBZA 1M57C 1M9NA 2ZD9A 4O4LB 1TVKA 1IDSA 2YSUB 2X7RB 3E89A 4J9YB 3OMIB 1CEZA 3FYEB 1XHZA 3G4SV 5DECA 4DV0O 3C90A 4Z1MG 3TETA 1K4CC 2VS0A 4YHHB 1NVPB 5LXTB 4CH3A 4AQYO 2AHYA 1Q5OA 3I55V 3B8MA 3E8GA 5KHIA 4QIWF 2UU9B 3GB7C 1M56B 4KHPB 2RDCA 4DYLA 5CA1B 2Q8VA 1I5YA 4I0XA 1OJHA 3HKBB 1Q82W 3L72H 3RT3C 3GWOA 2JS3A 4FLWA 4AILC 5IJ9B 3STZC 4MTGA 4P9PA 2A7WA 5EIBC 5KX5A 4U3JB 2ZDIA 2AGAA 4X65O 1PD3A 1VQOV 1PP9H 3J80N 3CRRA 4YHHO 1KP2A 1GKFA 4I9WA 1P7BA 2LGQA 2IJJA 2UUCB 4KHPO 2YXLA 3QTCA 1FXKC 1Y74A 4EEQA 5JJJB 4FVMA 1ZL8B 1EN4A 2P90A 1D5AA 2YI9A 1W59A 2WLIA 2ITCC 3ZEDA 5IT9N 2QKCA 3CCQV 2UXNA 5GW7A 3B2EE 2EZOA 5LMNO 3RW0A 1XNQO 1AILA 4DV2B 1WN7A 1H2MA 1AR5A 5KHGA 1URFA 2HVKC 3VQXA 1QVFU 1VARA 3SDLA 4K3AA 4TV8A 3ZS8C 2XTAA 4TUYA 3LDCA 4D7SA 4HBNA 1MA1A 3RVZA 4FM0A 4NR1A 5LXTA 1OCOB 4H44B 3S3WA 2VQEO 2UUBO 3ZCCA 4PDMA 1NQTA 1HNZB 1IX9A 3ASOC 4LFBO 2IJKA 2QGNA 2YDEA 4CS3A 1N4CA 2WWWA 2E75B 4UB8Z 1PNMA 4I50B 3EXAA 5IDJA 2DWDC 1XEQA 5IJ0A 2K1EA 4NVPA 2PF4E 3GVMA 3JD1A 4LF5B 1KB9F 3AEIA 4JI1B 2HP8A 2CK3G 1YJ9V 1G8MA 1B3QA 1D2DA 4D6TH 2H94A 3WB2A 2KKWA 4HZ3A 4F6RB 4JAUA 1RSOA 1YI2V 1YTFB 2ZIMA 2MK3A 4JI7B 1UPGA 1YF2A 1NTKH 1H8HG 1CP9A 5EBWC 2NNUA 3JATA 3HKCB 2ZINA 1ZL8A 1KC8W 1FXVA 1R6NA 2F43G 3ETEA 4L8JA 4LF5O 2IW5A 4DRXB 2WLKA 5H5NA 4OX9B 1AVMA 2VQFB 1HR0B 1MMMA 1DF5A 3JAKB 4WCEV 2HLDG 2R70A 2XASA 3CRAA 4O2BA 3CMEV 4CC5A 3EHBB 4PV1B 4EB6B 2X6AA 3K9SA 4CH5A 2CTWA 1JOYA 1SA0A 1VF6A 2CTQA 1VF5B 4DW0A 2EILB 3RYFA 2OTJV 1N34B 4IIJB 5DN6G 2PYJA 2V4DA 1VF7A 1Q3EA 2XT9A 4AI8A 1GTOA 2L6LA 2LW1A 5JCOA 5CA3A 1F4NA 3CC2V 1YIJV 2XAFA 2WLLB 1Q6UA 4R7CA 4I50A 1ZUQA 4Q20A 3VQWA 5KAIZ 4GCZA 3K5LA 2VQFO 2CDYA 2WA4A 3TCUA 1WAZA 1Q8IA 4X88A 2Y48A 1VMGA 4X62B 4BWAA 1Y76A 5IYCO 4O4IB 2GTAA 1WP8A 3ZHVA 1MSDA 1Z5VA 2CGNA 1EFRG 2P4VA 3QO8A 4MVZA 5DM6V 1I0HA 4DUZO 4LNUA 4K0KB 5HFMA 1F4MA 1M93A 3E8BA 3NR7A 1KU9A 3UKMA 1SRYA 5JJEB 5CBGA 5JWPA 2EIKC 3QNEA 3WFVA 4NXNB 3C3SA 4J7KA 3E2EA 2EIMC 5B1OA 4J7JA 1PPJH 4KUMA 3ZJZA 5B3SC 4JZGA 1KKCA 1N36O 4LF9O 2ZE5A 4PA7A 3U0ZA 2LGWA 4KP4A 4JYAO 1XBLA 4QGPA 4JV5B 3SJBC 3SYCA 4FIPC 2X6CA 2ZNJA 4ZI7B 1PV0A 1XMQO 2DOSA 2EZPA 2V1DA 3HR0A 3RYHA 2JK5C 3CRQA 4DR1B 1OCZC 2FMLA 5L3DA 3FD9A 4GKJB 3D3QA 3CP1A 1BZKA 3OMNB 4DV5B 1THZA 5LP6A 5JVDB 1VQ9V 3OAAG 2RQ6A 3CXCU 4X64B 4NTYA 1UFIA 5BXZA 1L8DA 5L3GA 4WFGA 4X89A 2BE3A 3HKEA 1R6KA 4UCTA 5D5QA 1GM8A 2ZKOA 1RM1C 4JGSA 1OZ0A 4JV5O 2O57A 1N32B 3VBBA 2XAJA 2R9AA 1KYOF 2E3CA 1GRJA 4ASUG 4DUYB 1QHTA 3ABLC 3ASNB 1DF4A 3RGBA 2W0XA 2Q5ZA 3OW2U 3AK1A 3SR2C 5LHHA 1MZEA 4PDLA 5GONA 2ZDIC 3H1HH 4X1KB 2ADPA 3HKDB 3K0GA 1KMIZ 4WBNB 4X20B 3ZMVA 4LF8B 2WSSG 2W6JG 1HNWB 4GUNA 2A3QA 2ZIOA 3OT7A 4FJCC 2ZT9B 1YXBA 4JTAB 1XMOB 3K58A 3RYCB 4J41A 1Q81W 2QDOA 1Q90D 1V55B 4IYIA 2UXBB 5FNVA 1FFTB 3WG7C 1IZ3A 1NTMH 1V54C 1HNXO 1ROPA 4RAIA 4FM2A 3ZMZA 5KA5A 3ZN0A 4DR4B 2Q68A 2PI4A 1PNKA 2OCHA 4DR2B 2IBZH 2EIMB 3QF7A 3RVYA 4FLVA 5JVDA 4RQEA 1HNWO 4PA9A 3JALA 2IU3A 1XOUA 4IYHA 1HW7A 4JPRA 3CPWU 1IBKO 2F23A 1KKDA 1PNLA 3UO3A 4IGGA 1AI7A 4YJ2B 1Z5WA 3LNNA 3N2GA 1M56C 3OUSA 4WFHA 2RMKB 2R9RB 5IWAB 2HKOA 1TVKB 2F1MA 4DV1O 4LF6B 1OCZB 4FLZA 2E76B 4KXRA 3R66A 3U10A 3VQVA 4DR6B 5LYJA 4TV9A 4BAYA 4GT1A 1YITV 3FAVA 3OEEG 5KUKA 4B3RO 4ZKIA 2X0LA 2AZ2A 4K35A 4LCUC 4J9ZB 3ZRWB 4X1IA 3BA8A 5H9CA 4WBNA 3DSQA 1VIBA 3SYOA 1RM1B 3ZMSA 1BCCH 3FKSG 3SYPA 2P6JA 4I0XB 5ITZA 1K8AW 1I94B 2YXYA 1L0NH 4WFBV 2F4VB 3H01A 5KHHA 2WLJA 4D7TA 1NH2D 1XHXA 5IWAO 1E79G 1LUVA 2Q4PA 4LF6O 4X66B 4LFCB 1N0NA 2DN9A 2ZE7A 2LJ2A 1BL8A 1K33A 5KX5B 2ZNIA 2JS5A 5FL7G 4JI0O 5L3FA 1N33B 4I5SA 3ZMUA 2YIBD 1FJGB 1S5JA 4J42A 1GMGA 5KUMA 2G38A 3B40A 2ETNA 4DR3B 4MTXA 1GN3A 1VF6C 4DW1A 3E22A 1Y74B 3JSNA 3CEIA 4E2LA 4YJ2A 2WLIB 2AZ0A 2BCCH 3CSXA 1Y67A 3ML0A 3JASA 1V54B 2KB1A 1H2LA 4G2KA 4JI6O 3DC6A 2JDIG 1WNSA 5JCOC 4P2ZA 4X66O 5KMGA 1EM1A 1NBMG 2FL4A 1FFXA 2UUAO 1YVWA 1BE3H 3JAMN 4TQFA 3BY6A 5LOVB 4FLTA 1JFFA 4PJ0Z 1FYJA 4OPHA 1SQPH 3TGUH 1LNQA 4TV8B 5B66Z 2NLJC 3M7MX 4Z2WA 4TUYB 4DV6B 4X1YA 4B7KA 1FJGO 4JI8O 2OIEA 4JI4B 1P4RA 3ZRWA 1WPXA 1JMKC 5AG2A 1HDJA 1K97A 4JASA 2Y69C 1GN6A 1K5SA 3LDDA 3BFRA 3AK3A 4Q6GA 3JD0A 4GX2A 3IC7A 1MNGA 2E5LO 5IJ0B 4CH4A 3K59A 1NS1A 2Q6AA 4EFEA 1E1RG 2JGDB 1Q6IA 3RWRD 3L9DA 1F23A 2D2CB 4BIZA 2UXDO 2CTPA 1EBOA 3HB3B 2HFEC 4B3SB 1PM9A 2PTMA 4MSWC 3UQ8A 4YJ3A 4J80A 3SYQA 4JI4O 1N0JA 1RSOB 3K06A 1B6QA 1YCIA 2GUZA 5F2VO 1ORQC 2Q0AA 2M7WA 3OFNG 2UU9O 2YI8A 3G6BA 4UVBA 4WFAV 3DXRA 3JATB 3CMAV 2ATKC 3CD6V 3U11A 1H2GA 2EILC 4I7ZB 1G1XB 3X2QB 3CCJV 3T4ZA 4MVRA 2Y0IA 1VQ6V 5LP6C 2BTQA 1OHHG 1GAXA 1COWG 5C8YA 4LFAB 5LOVA 2P67A 3M99B 2XAGA 4O2BB 1NI8A 5JQGA 1OCCB 4PDVA 1SA0B 4QPJA 3CCSV 1BQZA 2UUCO 2QKSA 2KG7A 3RYFB 2Y4UA 4IHJB 3CB2A 2CUGA 2AXTZ 3M8AA 1ZSPA 2N74A 3JARA 1KECA 4HNAA 1QLEC 4UFZA 1LR1A 1XL6A 1J5EB 3B4SA 4J11A 4DV2O 2JGDA 1BSMA 4RUFA 1KD1W 2CTRA 3CCEV 1XL4A 1Y76B 1EZJA 3K04A 4EFBA 2ZCEA 2JJ1G 1ZLZA 2Y69B 4GX0A 2PZSA 2QM4A 4OPAA 1M4UA 4B3MB 4FK5C 4F4LA 4LNUB 1HNZO 3NXSA 2ADQB 2FYUH 3I5DA 1RFYA 1SQBH 1JVMA 3WB0A 3A8TA 3D36A 2IJIA 5L3CA 5B1BC 3OE7G 3JD4A 5IYDO 1OV9A 4JI1O 3OEHG 4DV3B 3K5MA 2F95B 2YIBA 4UCRA 2BSKA 1U97A 1AR4A 3RYIB 2ITDC 5FPOA 2K9PA 4P9OA 4TQDA 1FXHA 3L71H 3F7YC 4MW3A 4I55A 2P22C 4Z1VA 1VQNV 4GX1A 3RYHB 1R3KC 3MAQA 3CCRV 3ETGA 1BHAA 2JJ2G 1IBMB 2W0FC 4JI7O 1D5NA 3ETDA 3ASNC 3A0HZ 3E8HA 3KZIZ 4IHJA 2BTOA 1AJQA 5LP6B 3QO5A 3FB8C 3T1HB 1KBHA 4MVQA 3E8FA 4WF9V 4UV8A 2LFRA 4O4HA 4XDKA 3SGIA 3HKEB 3Q4HA 2QTOA 4OX9O 2JRIA 1HR0O 1N8RW 2QWNB 4UUJC 4FLYA 2PGGA 2XAQA 4MVMA 1M5IA 5KAFZ 3ABMC 2WPDG 2QM8A 5BR8B 4FLXA 1W0JG 2RNBA 4DXWA 3N27A 1UJWB 1DGSA 3K03A 3IAYA 1DLBA 1V55C 1K34A 1IBMO 1Y6XA 2DQ3A 3LUTB 4DR7B 3T1YB 1N34O 5J9PC 1F7YA 5J2TA 5KHJA 5GONB 1QLEB 2QWPB 1S76D 2FKXA 4A5UB 4AHCA 1K4DC 1HP8A 3K3WA 4HYOA 4RQFA 2QM7A 1NR1A 3AG2C 2Q67A 1YJNV 1MSWD 4NTWA 1QQCA 3RYIA 1HWYA 4DV7B 5BR8O 4H37A 2EBOA 4X62O 2F93B 2HEPA 4TWKA 1XI1A 5FPRA 5FNVB 1BHBA 4ZHQA 1XUQA 3K0DA 3CCLV 2JEUA 5BZBA 3KCYA 4JI3B 3J7AU 1SQFA 4K0KO 2ILMA 3BABA 5B1BB 3MHSC 2UXCB 2N04A 3H1KH 3F7VC 1AP5A 2XAHA 3JALB 5LA6B 3CJHA 4NXNO 1FXKA 3FB5C 4J7ZA 1K3EA 3OD4A 3N2GB 2OYQA 1NTZH 1VP7A 2LW7A 2ZQMA 4DK1A 2JIZG 4NXMB 5EYPA 4B3TB 1QR8A 2PI5A 5B1NA 4LF4B 4O2AB 4B08A 3CRMA 4MS2A 4FFBA 1AJNA 1P49A 1S3JA 5EK0A 5LYJB 3SJQC 4TV9B 3J81N 1XREA 3FYIB 1ZAUA 3H1IH 4DR1O 3FAVB 1R3JC 5IY5B 3BHPA 4GKJO 5H6RA 3LSSA 2M6YA 4DV5O 4JYBA 3ZRVA 4X1IB 4X64O 3FFQA 3ZHUA 2XNDG 1QU7A 3ABMB 5ITZB 4UCVA 2DYRC 4JYCA 1N32O 2Q0OC 3WU2Z 1B06A 3AG4C 4NKGB 1QBZA 3E35A 4NXMO 2B1GA 4DUYO 1H2NA 3ETQA 2FB5A 2QSAA 4IL6Z 3SJAC 3P3NA 4CBCA 2R9IA 4FM1A 4GKKB 1WJZA 1S5LZ 4MTFA 2EJ7A 3ICXA 3UM7A 3SPGA 5J2UA 3AG2B 1AROP 2F66C 4LF8O 4NB5A 5LA6A 3L75H 1FKAO 3E22B 1WA8B 4XDLA 2R72A 1XMOO 1H2SB 4PDRA 1VQLV 1SC5B 1CPYA 1JPXA 3FX7A 3JASB 4R8CA 2UXBO 4P30A 5KMGB 1GN4A 2XHBA 1FFXB 4MVOA 4LWSA 1BQ0A 1K73W 2ZE8A 4O2AA 2Q7GA 1E1QG 4PA4A 1JFFB 3RFRA 3IGAC 4DR4O 1K9MW 4W4LA 2EINC 4I4TB 2QWRB 1NVPD 1NT2B 4DR2O 3QG5A 4F6EA 4JF3A 4X1YB 1Q6HA 3JSLA 1MG1A 3OTOB 4FMTA 3UCSC 1FPOA 4ZBMA 4OGQB 1TUBA 5IYBO 3AG1B 4DR5B 1FS0G 1R3LC 2CH7A 2IU0A 3JD3A 1Q7YW 5E79Z 5LGTA 4DV4B 1YEWA 1XNRB 4GYCB 2RN9A 3PJSK 3X2QC 3T4DA 5A9GA 1WPBA 1WB8A 5LHGA 3THOA 4DR6O 1BGYH 4MT8A 1QVGU 2VWJA 1VQ7V 1WLEA 2OT5A 5L3EA 1EN5A 1GN2A 2DMXA 3BVOA 1TGOA 2WAMA 4NTXA 4YY3B 3BPZA 3KKYA 4YJ3B 1M1KW 3T1CA 2GUZB 1G6UA 3A0BZ 2QEXV 2Z3YA 4LC1A 1PKXA 5EZYA 1SQVH 1OCCC 2DYRB 3DXRB 1K5QA 1JCHA 3SPIA 3AG4B 1XILA 1WA8A 1R3IC 1I94O 2YS8A 1GM7A 2F4VO 2HVJC 4FPPA 2P5OA 4DV0B 2UXDB 1W0KG 2QE7G 2RCVA 1QLNA 2BTQB 2JVDA 3G67A 4H13B 2H8PC 2B9ZA 4UCUA 4LFCO 5C8YB 1BMFG 2CE4A 1TAEA 5CA0A 2XOKG 1N33O 3SPCA 1WB7A 4RWUA 4I4TA 2UXXA 5JQGB 3CWBH 2QA4V 3UT5A 3GWKC 1XDCA 4KFMA 2KG7B 4U7NA 2A79B 4DR3O 5CB4B 4LBEC 3JAWB 4FFKA 3K57A 1OCRC 3F5WC 4XDJA 4FLUA 1YHQV 3DC5A 1TA8A 4X65B 3JARB 1RPRA
chains in the Genus database with same CATH topology
4JI0O 4YY3O 1HNXO 1HNZO 4JI5O 4JI4O 2FKXA 4LFAO 5LMNO 1XMQO 4A5UB 4GKKO 2UU9O 1AB3A 1XNQO 2DOSA 1AILA 4JI3O 5FLXN 1N32O 3SDLA 1G1XB 4NXMO 2UXCO 3F5TA 4DR6O 1HNWO 4DV6O 4JI1O 5A2QN 1R6TA 4DUYO 5BR8O 4DV0O 4X62O 4LF7O 2VQEO 2UUBO 3T1HO 1IBKO 5BXZA 3O65A 4JI6O 4AQYO 4X66O 4LFBO 2UUAO 2ZKOA 1DK1A 3J7AU 3JAMN 5LMUO 4K0KO 1X59A 4JV5O 1FYJA 4OPHA 4DV1O 4B3TO 2VQFO 1J5EO 1R1BA 1XEQA 1IBLO 4JI7O 4LF4O 4LF8O 1I94O 2UUCO 1FKAO 3R66A 2F4VO 3RT3C 2HHHO 1FJGO 1XMOO 4NXNO 4JI8O 2Z0AA 2ZM6O 4B3RO 1D2DA 3M8AA 4LFCO 4JI2O 2N74A 4DR7O 2UXBO 3OTOO 3T1YO 4B3SO 2AGAA 4X65O 4DUZO 2LW7A 4DR5O 4B3MO 4OX9O 1N33O 1A32A 3J80N 2JRIA 1HR0O 4YHHO 1YZBA 1KUQA 4DR4O 2E5LO 4DV4O 1XNRO 4DV2O 2DJVA 4KHPO 1NS1A 4DR2O 3J81N 4OPAA 4DR3O 5IWAO 4DR1O 5LL6Y 5BY1A 1IBMO 4LF6O 4GKJO 4DV3O 4DV7O 1N36O 4LF9O 4LF5O 4DV5O 2UXDO 1N34O 1F7YA 5IT9N 4JYAO 4X64O 5H5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 O;  4YY3 O;  1HNX O;  1HNZ O;  4JI5 O;  4JI4 O;  2FKX A;  4LFA O;  5LMN O;  1XMQ O;  4A5U B;  4GKK O;  2UU9 O;  1AB3 A;  1XNQ O;  2DOS A;  1AIL A;  4JI3 O;  5FLX N;  1N32 O;  3SDL A;  1G1X B;  4NXM O;  2UXC O;  3F5T A;  4DR6 O;  1HNW O;  4DV6 O;  4JI1 O;  5A2Q N;  1R6T A;  4DUY O;  5BR8 O;  4DV0 O;  4X62 O;  4LF7 O;  2VQE O;  2UUB O;  3T1H O;  1IBK O;  5BXZ A;  3O65 A;  4JI6 O;  4AQY O;  4X66 O;  4LFB O;  2UUA O;  2ZKO A;  1DK1 A;  3J7A U;  3JAM N;  5LMU O;  4K0K O;  1X59 A;  4JV5 O;  1FYJ A;  4OPH A;  4DV1 O;  4B3T O;  2VQF O;  1J5E O;  1R1B A;  1XEQ A;  1IBL O;  4JI7 O;  4LF4 O;  4LF8 O;  1I94 O;  2UUC O;  1FKA O;  3R66 A;  2F4V O;  3RT3 C;  2HHH O;  1FJG O;  1XMO O;  4NXN O;  4JI8 O;  2Z0A A;  2ZM6 O;  4B3R O;  1D2D A;  3M8A A;  4LFC O;  4JI2 O;  2N74 A;  4DR7 O;  2UXB O;  3OTO O;  3T1Y O;  4B3S O;  2AGA A;  4X65 O;  4DUZ O;  2LW7 A;  4DR5 O;  4B3M O;  4OX9 O;  1N33 O;  1A32 A;  3J80 N;  2JRI A;  1HR0 O;  4YHH O;  1YZB A;  1KUQ A;  4DR4 O;  2E5L O;  4DV4 O;  1XNR O;  4DV2 O;  2DJV A;  4KHP O;  1NS1 A;  4DR2 O;  3J81 N;  4OPA A;  4DR3 O;  5IWA O;  4DR1 O;  5LL6 Y;  5BY1 A;  1IBM O;  4LF6 O;  4GKJ O;  4DV3 O;  4DV7 O;  1N36 O;  4LF9 O;  4LF5 O;  4DV5 O;  2UXD O;  1N34 O;  1F7Y A;  5IT9 N;  4JYA O;  4X64 O;  5H5N A; 
#chains in the Genus database with same CATH topology
 1QR9 A;  4HNA B;  4H33 A;  3TJT A;  1NKD A;  2ARH A;  3CCV V;  2IM9 A;  3E83 A;  4TSF G;  2EIN B;  3TK1 A;  4JTD B;  1VQ8 V;  2QR4 A;  4DK0 A;  2P06 A;  1GO3 F;  4PI2 A;  4DV6 O;  1VQM V;  5A2Q N;  3STL C;  2L35 A;  1YSC A;  1YTF D;  3TXQ A;  2OCC B;  5B1A C;  3I56 V;  4QE7 A;  1NH2 B;  5LMN B;  5BMV A;  2EX3 A;  1XNQ B;  4WFE A;  1KP3 A;  5D5P A;  1H2K A;  2XUM A;  2GSM B;  1O9G A;  5EIB D;  2DYS C;  1PL0 A;  2RJZ A;  5CBH A;  3OMA B;  2V7Q G;  3MDS A;  4R50 A;  3D8C A;  2VQE B;  2UUB B;  2NN4 A;  5DED A;  2BSK B;  4GLX A;  2YUA A;  2YEV A;  1ZTE A;  1GK9 A;  1JX9 A;  4B3S O;  4LFB B;  3OUF A;  4CZZ A;  4I55 B;  1A32 A;  4X8A A;  1YZB A;  3H9V A;  4BIU A;  1KUQ A;  4O4L A;  4YXW G;  5CB4 A;  3JAW A;  2LQT A;  2LFS A;  5E1A C;  1JJO A;  1S77 D;  3CS5 A;  1AJP A;  3ZRS A;  4UCO A;  5GTI Z;  5BY1 A;  4N23 A;  2EIJ C;  5GTH Z;  1VQP V;  4B7E A;  3RN4 A;  3FB6 C;  4O4H B;  2A9H A;  3ZHT A;  5LMU B;  4FZ1 A;  3Q4H B;  3CXH F;  1IBL B;  3JCU Z;  1L0L H;  4LFA O;  3UO2 A;  3C3T A;  5CA1 A;  2HHH B;  4PI0 A;  1SQX H;  5FLX N;  1K7D A;  1M57 B;  5B5E Z;  3HKB A;  1AI6 A;  2FTK A;  1LUW A;  1OCR B;  4UXN A;  4FZ0 A;  3E86 A;  3W7U A;  3BRC A;  3BA9 A;  5IJ9 A;  5J2T B;  3MD0 A;  2QKA A;  1AR1 B;  4U3J A;  2GHY A;  1H8E G;  1YJW V;  4GX5 A;  2HJD A;  2DE0 X;  5LMU O;  2PUS A;  4ZOL B;  2C2A A;  3K5O A;  3N2K B;  1J5E O;  1IBL O;  1FD9 A;  1SET A;  3L73 H;  2IJH A;  3ABT A;  2HHH O;  2GDS A;  5JH7 B;  3SYA A;  4PEL A;  1G4Y B;  4ZHQ B;  5B1A B;  3EFF K;  3BCC H;  1QNM A;  5IYZ B;  2VWK A;  2EUL A;  2B1I A;  4B3M O;  2OTL V;  1R73 A;  3AK2 A;  5K1P A;  2A06 H;  1KQS U;  3W7X A;  2DYS B;  4UV9 A;  2ZXW C;  2DWE C;  1O9H A;  4RUE A;  2ZE6 A;  4KL1 A;  4LF7 B;  4CH6 A;  1H38 A;  4JZ2 A;  1S72 V;  4MVS A;  4N21 A;  5IY5 C;  3CJH B;  2ODM A;  1QCE A;  4X9Q A;  1FXK B;  4DV3 O;  3AG3 C;  2AHZ A;  3OTF A;  2DW4 A;  4DUZ B;  4O4J B;  1FAF A;  3KCX A;  2Q69 A;  3JD2 A;  3DGE A;  3FB7 C;  5CBF A;  5EYP B;  1AI5 A;  4UVA A;  3G71 V;  2BOB C;  2EJR A;  4FFB B;  4EKW A;  4C7U A;  2ZM6 B;  1T5E A;  1CXZ B;  1SER A;  4JI2 B;  3VQY A;  1GM9 A;  3K5N A;  2EIJ B;  3LSQ A;  2E74 B;  4UB6 Z;  1N36 B;  4LF9 B;  1XQ8 A;  4LF7 O;  1P84 F;  4JYA B;  3T1H O;  3HPL C;  3ZIA G;  4LH7 A;  1SZX A;  3O65 A;  1IVS A;  5KLV H;  2Q7H A;  4PA3 A;  1XMQ B;  4F6R A;  4ZOL A;  2YIC A;  3N2K A;  3ASO B;  2JGU A;  4R6Z A;  5EBL C;  3QO7 A;  1J95 A;  4BW5 A;  4YIO A;  5TIS Z;  1R1B A;  4K8X A;  3HKC A;  3KG2 A;  4MTO A;  3LDE A;  2D3O W;  4I9Q A;  3P32 A;  5JH7 A;  4JYY A;  3DTU B;  2WLM A;  3ABK C;  3OGI B;  5LHI A;  2OIG A;  5IYZ A;  3IJ4 A;  2ZM6 O;  4JI5 B;  5EC1 C;  4U3F H;  4YIP A;  3W7W A;  4JI2 O;  4H0L B;  4DR7 O;  4DRX A;  3T1Y O;  2HG5 C;  2QJ1 A;  3BEH A;  5KHK A;  1Q86 W;  1B04 A;  1VQ4 V;  1VEW A;  4BR6 A;  3ZMT A;  4QNH B;  3K79 A;  3JAK A;  1SQG A;  5LGN A;  5J2U B;  1P7G A;  1DTO A;  4EB6 A;  2P7T C;  1JQ0 A;  3S3X A;  4TT3 G;  3A0R A;  5C93 A;  3L70 H;  3W7S A;  1JA8 A;  4DV7 O;  1WP7 A;  3IFX A;  1Q43 A;  4IIJ A;  3APO A;  4O4J A;  4DO2 A;  3AG1 C;  4OXS A;  3PN1 A;  4W4K A;  4QPK A;  4CS2 A;  2IH3 C;  4LWS B;  2KQX A;  4RO2 A;  1ZWI C;  4JI5 O;  1AI4 A;  2WLL A;  1SZT A;  4L87 A;  4UCS A;  2ZXW B;  5JJN B;  4JI3 O;  3B8N A;  1S5H C;  1ZX3 A;  4LR3 A;  1NR7 A;  5IE9 A;  5K1X A;  1IXM A;  3H1J H;  2UXC O;  3WB1 A;  3F5T A;  2YXH A;  5LBQ A;  4MW8 A;  3AG3 B;  4E4E A;  3CHX A;  4O4I A;  3D3I A;  4JAV A;  5LGU A;  4UVC A;  1TUB B;  1HNX B;  1I7F A;  2CH7 B;  3CCU V;  1IXB A;  5KA6 A;  3ZX6 A;  1DK1 A;  2Z5U A;  2LP7 A;  3JYC A;  2NR5 A;  3T2M A;  3B09 A;  2GV9 A;  4B3T O;  1AP6 A;  2ZR3 A;  4LF4 O;  3CC7 V;  2MW2 B;  3CYO A;  2P4K A;  1I08 A;  1V9P A;  1S0V A;  2Z0A A;  3K08 A;  1RPO A;  1IBK B;  4ZIB A;  2X6B A;  4NYK A;  2BOC C;  3QVN A;  4MVU A;  3L74 H;  2VRZ A;  3JCZ A;  1VQK V;  1NJI W;  1MAB G;  2QTS A;  4ABM A;  2PYL A;  4JTC B;  3CE2 A;  3LSU A;  1RP3 B;  1VQ5 V;  1BS3 A;  5EZY B;  3ZN1 A;  4ZI7 A;  1X4T A;  3ZHR A;  2B5U A;  4DV1 B;  3OM3 B;  2QWQ B;  1M90 W;  1F51 A;  2DJV A;  2QWO B;  3OR7 C;  3SJC C;  3ZHQ A;  3MHH C;  3ABK B;  2WLN A;  1TUE B;  2LO1 A;  3AG7 A;  2EIK B;  2OWO A;  4B3R B;  2HJF C;  2YIA A;  1SKV A;  4J10 A;  4BW9 A;  5B3S B;  5H6Q A;  1NZ6 A;  1EZV H;  5CA0 B;  3APQ A;  4G28 B;  2Q73 A;  3LNM B;  4GKK O;  5CN0 A;  1AB3 A;  1I5X A;  4HAM A;  4PA6 A;  3UT5 B;  2Y0P A;  3CC4 V;  1ENV A;  1EN6 A;  4K8Z A;  3H1L H;  3CX5 F;  3SPJ A;  2ZR2 A;  4PD4 F;  3OGC C;  5HFL A;  3P3P A;  2AW9 A;  4QE9 A;  1JJ2 U;  3IC9 A;  3BAA A;  1JR9 A;  4LP8 A;  3CCM V;  2A0L A;  1R6T A;  2YC0 A;  2OCC C;  1SQQ H;  4JI0 B;  4TOI A;  3G80 A;  3O9O A;  4CC6 A;  3SPH A;  1BT8 A;  4JAA A;  4U7O A;  4CS4 A;  1NU1 H;  3ZBH A;  1SS3 A;  2KSD A;  3VOU A;  1GH6 A;  5EC2 C;  4X1K A;  4XBF A;  1SES A;  1Y66 A;  1X59 A;  3HKD A;  3D36 C;  4X20 A;  2DQ0 A;  3TXS A;  2HR3 A;  2N05 A;  3CRC A;  4ICG A;  2CAZ C;  2IH1 C;  4QJF B;  3G6E V;  3RYC A;  5EBM C;  1L1F A;  3ABL B;  3ABU A;  4LH6 A;  2WLH A;  4JI6 B;  1MZF A;  3OTO O;  3K9A A;  3A2F A;  2H3O A;  1YDX A;  5BMV B;  1Z2G A;  2Q7E A;  3P30 A;  2UUA B;  3R65 A;  2GBO A;  4DR5 O;  3EVK A;  4WFF A;  2JEX A;  2Y4T A;  3OR6 C;  1IUR A;  4DV4 O;  1Y4M A;  2YID A;  1US6 A;  3B77 A;  1XNR O;  2Q9L A;  4IT5 A;  2CGO A;  2W6I G;  4BIO A;  5CMU A;  4JI8 B;  5LL6 Y;  4PHZ A;  5L3B A;  1U96 A;  1SF9 A;  4AQY B;  2PY5 A;  4G27 B;  3ZHS A;  3ZRX A;  3W7T A;  2YEV B;  1MOF A;  1OCO C;  2WA3 A;  5H2F Z;  2GTS A;  4YY3 O;  1K92 A;  4GZR B;  3WG7 B;  2E5L B;  1PL4 A;  1W2B U;  3RBZ A;  1M57 C;  1M9N A;  2ZD9 A;  4O4L B;  1TVK A;  1IDS A;  2YSU B;  2X7R B;  3E89 A;  4J9Y B;  3OMI B;  1CEZ A;  3FYE B;  1XHZ A;  3G4S V;  5DEC A;  4DV0 O;  3C90 A;  4Z1M G;  3TET A;  1K4C C;  2VS0 A;  4YHH B;  1NVP B;  5LXT B;  4CH3 A;  4AQY O;  2AHY A;  1Q5O A;  3I55 V;  3B8M A;  3E8G A;  5KHI A;  4QIW F;  2UU9 B;  3GB7 C;  1M56 B;  4KHP B;  2RDC A;  4DYL A;  5CA1 B;  2Q8V A;  1I5Y A;  4I0X A;  1OJH A;  3HKB B;  1Q82 W;  3L72 H;  3RT3 C;  3GWO A;  2JS3 A;  4FLW A;  4AIL C;  5IJ9 B;  3STZ C;  4MTG A;  4P9P A;  2A7W A;  5EIB C;  5KX5 A;  4U3J B;  2ZDI A;  2AGA A;  4X65 O;  1PD3 A;  1VQO V;  1PP9 H;  3J80 N;  3CRR A;  4YHH O;  1KP2 A;  1GKF A;  4I9W A;  1P7B A;  2LGQ A;  2IJJ A;  2UUC B;  4KHP O;  2YXL A;  3QTC A;  1FXK C;  1Y74 A;  4EEQ A;  5JJJ B;  4FVM A;  1ZL8 B;  1EN4 A;  2P90 A;  1D5A A;  2YI9 A;  1W59 A;  2WLI A;  2ITC C;  3ZED A;  5IT9 N;  2QKC A;  3CCQ V;  2UXN A;  5GW7 A;  3B2E E;  2EZO A;  5LMN O;  3RW0 A;  1XNQ O;  1AIL A;  4DV2 B;  1WN7 A;  1H2M A;  1AR5 A;  5KHG A;  1URF A;  2HVK C;  3VQX A;  1QVF U;  1VAR A;  3SDL A;  4K3A A;  4TV8 A;  3ZS8 C;  2XTA A;  4TUY A;  3LDC A;  4D7S A;  4HBN A;  1MA1 A;  3RVZ A;  4FM0 A;  4NR1 A;  5LXT A;  1OCO B;  4H44 B;  3S3W A;  2VQE O;  2UUB O;  3ZCC A;  4PDM A;  1NQT A;  1HNZ B;  1IX9 A;  3ASO C;  4LFB O;  2IJK A;  2QGN A;  2YDE A;  4CS3 A;  1N4C A;  2WWW A;  2E75 B;  4UB8 Z;  1PNM A;  4I50 B;  3EXA A;  5IDJ A;  2DWD C;  1XEQ A;  5IJ0 A;  2K1E A;  4NVP A;  2PF4 E;  3GVM A;  3JD1 A;  4LF5 B;  1KB9 F;  3AEI A;  4JI1 B;  2HP8 A;  2CK3 G;  1YJ9 V;  1G8M A;  1B3Q A;  1D2D A;  4D6T H;  2H94 A;  3WB2 A;  2KKW A;  4HZ3 A;  4F6R B;  4JAU A;  1RSO A;  1YI2 V;  1YTF B;  2ZIM A;  2MK3 A;  4JI7 B;  1UPG A;  1YF2 A;  1NTK H;  1H8H G;  1CP9 A;  5EBW C;  2NNU A;  3JAT A;  3HKC B;  2ZIN A;  1ZL8 A;  1KC8 W;  1FXV A;  1R6N A;  2F43 G;  3ETE A;  4L8J A;  4LF5 O;  2IW5 A;  4DRX B;  2WLK A;  5H5N A;  4OX9 B;  1AVM A;  2VQF B;  1HR0 B;  1MMM A;  1DF5 A;  3JAK B;  4WCE V;  2HLD G;  2R70 A;  2XAS A;  3CRA A;  4O2B A;  3CME V;  4CC5 A;  3EHB B;  4PV1 B;  4EB6 B;  2X6A A;  3K9S A;  4CH5 A;  2CTW A;  1JOY A;  1SA0 A;  1VF6 A;  2CTQ A;  1VF5 B;  4DW0 A;  2EIL B;  3RYF A;  2OTJ V;  1N34 B;  4IIJ B;  5DN6 G;  2PYJ A;  2V4D A;  1VF7 A;  1Q3E A;  2XT9 A;  4AI8 A;  1GTO A;  2L6L A;  2LW1 A;  5JCO A;  5CA3 A;  1F4N A;  3CC2 V;  1YIJ V;  2XAF A;  2WLL B;  1Q6U A;  4R7C A;  4I50 A;  1ZUQ A;  4Q20 A;  3VQW A;  5KAI Z;  4GCZ A;  3K5L A;  2VQF O;  2CDY A;  2WA4 A;  3TCU A;  1WAZ A;  1Q8I A;  4X88 A;  2Y48 A;  1VMG A;  4X62 B;  4BWA A;  1Y76 A;  5IYC O;  4O4I B;  2GTA A;  1WP8 A;  3ZHV A;  1MSD A;  1Z5V A;  2CGN A;  1EFR G;  2P4V A;  3QO8 A;  4MVZ A;  5DM6 V;  1I0H A;  4DUZ O;  4LNU A;  4K0K B;  5HFM A;  1F4M A;  1M93 A;  3E8B A;  3NR7 A;  1KU9 A;  3UKM A;  1SRY A;  5JJE B;  5CBG A;  5JWP A;  2EIK C;  3QNE A;  3WFV A;  4NXN B;  3C3S A;  4J7K A;  3E2E A;  2EIM C;  5B1O A;  4J7J A;  1PPJ H;  4KUM A;  3ZJZ A;  5B3S C;  4JZG A;  1KKC A;  1N36 O;  4LF9 O;  2ZE5 A;  4PA7 A;  3U0Z A;  2LGW A;  4KP4 A;  4JYA O;  1XBL A;  4QGP A;  4JV5 B;  3SJB C;  3SYC A;  4FIP C;  2X6C A;  2ZNJ A;  4ZI7 B;  1PV0 A;  1XMQ O;  2DOS A;  2EZP A;  2V1D A;  3HR0 A;  3RYH A;  2JK5 C;  3CRQ A;  4DR1 B;  1OCZ C;  2FML A;  5L3D A;  3FD9 A;  4GKJ B;  3D3Q A;  3CP1 A;  1BZK A;  3OMN B;  4DV5 B;  1THZ A;  5LP6 A;  5JVD B;  1VQ9 V;  3OAA G;  2RQ6 A;  3CXC U;  4X64 B;  4NTY A;  1UFI A;  5BXZ A;  1L8D A;  5L3G A;  4WFG A;  4X89 A;  2BE3 A;  3HKE A;  1R6K A;  4UCT A;  5D5Q A;  1GM8 A;  2ZKO A;  1RM1 C;  4JGS A;  1OZ0 A;  4JV5 O;  2O57 A;  1N32 B;  3VBB A;  2XAJ A;  2R9A A;  1KYO F;  2E3C A;  1GRJ A;  4ASU G;  4DUY B;  1QHT A;  3ABL C;  3ASN B;  1DF4 A;  3RGB A;  2W0X A;  2Q5Z A;  3OW2 U;  3AK1 A;  3SR2 C;  5LHH A;  1MZE A;  4PDL A;  5GON A;  2ZDI C;  3H1H H;  4X1K B;  2ADP A;  3HKD B;  3K0G A;  1KMI Z;  4WBN B;  4X20 B;  3ZMV A;  4LF8 B;  2WSS G;  2W6J G;  1HNW B;  4GUN A;  2A3Q A;  2ZIO A;  3OT7 A;  4FJC C;  2ZT9 B;  1YXB A;  4JTA B;  1XMO B;  3K58 A;  3RYC B;  4J41 A;  1Q81 W;  2QDO A;  1Q90 D;  1V55 B;  4IYI A;  2UXB B;  5FNV A;  1FFT B;  3WG7 C;  1IZ3 A;  1NTM H;  1V54 C;  1HNX O;  1ROP A;  4RAI A;  4FM2 A;  3ZMZ A;  5KA5 A;  3ZN0 A;  4DR4 B;  2Q68 A;  2PI4 A;  1PNK A;  2OCH A;  4DR2 B;  2IBZ H;  2EIM B;  3QF7 A;  3RVY A;  4FLV A;  5JVD A;  4RQE A;  1HNW O;  4PA9 A;  3JAL A;  2IU3 A;  1XOU A;  4IYH A;  1HW7 A;  4JPR A;  3CPW U;  1IBK O;  2F23 A;  1KKD A;  1PNL A;  3UO3 A;  4IGG A;  1AI7 A;  4YJ2 B;  1Z5W A;  3LNN A;  3N2G A;  1M56 C;  3OUS A;  4WFH A;  2RMK B;  2R9R B;  5IWA B;  2HKO A;  1TVK B;  2F1M A;  4DV1 O;  4LF6 B;  1OCZ B;  4FLZ A;  2E76 B;  4KXR A;  3R66 A;  3U10 A;  3VQV A;  4DR6 B;  5LYJ A;  4TV9 A;  4BAY A;  4GT1 A;  1YIT V;  3FAV A;  3OEE G;  5KUK A;  4B3R O;  4ZKI A;  2X0L A;  2AZ2 A;  4K35 A;  4LCU C;  4J9Z B;  3ZRW B;  4X1I A;  3BA8 A;  5H9C A;  4WBN A;  3DSQ A;  1VIB A;  3SYO A;  1RM1 B;  3ZMS A;  1BCC H;  3FKS G;  3SYP A;  2P6J A;  4I0X B;  5ITZ A;  1K8A W;  1I94 B;  2YXY A;  1L0N H;  4WFB V;  2F4V B;  3H01 A;  5KHH A;  2WLJ A;  4D7T A;  1NH2 D;  1XHX A;  5IWA O;  1E79 G;  1LUV A;  2Q4P A;  4LF6 O;  4X66 B;  4LFC B;  1N0N A;  2DN9 A;  2ZE7 A;  2LJ2 A;  1BL8 A;  1K33 A;  5KX5 B;  2ZNI A;  2JS5 A;  5FL7 G;  4JI0 O;  5L3F A;  1N33 B;  4I5S A;  3ZMU A;  2YIB D;  1FJG B;  1S5J A;  4J42 A;  1GMG A;  5KUM A;  2G38 A;  3B40 A;  2ETN A;  4DR3 B;  4MTX A;  1GN3 A;  1VF6 C;  4DW1 A;  3E22 A;  1Y74 B;  3JSN A;  3CEI A;  4E2L A;  4YJ2 A;  2WLI B;  2AZ0 A;  2BCC H;  3CSX A;  1Y67 A;  3ML0 A;  3JAS A;  1V54 B;  2KB1 A;  1H2L A;  4G2K A;  4JI6 O;  3DC6 A;  2JDI G;  1WNS A;  5JCO C;  4P2Z A;  4X66 O;  5KMG A;  1EM1 A;  1NBM G;  2FL4 A;  1FFX A;  2UUA O;  1YVW A;  1BE3 H;  3JAM N;  4TQF A;  3BY6 A;  5LOV B;  4FLT A;  1JFF A;  4PJ0 Z;  1FYJ A;  4OPH A;  1SQP H;  3TGU H;  1LNQ A;  4TV8 B;  5B66 Z;  2NLJ C;  3M7M X;  4Z2W A;  4TUY B;  4DV6 B;  4X1Y A;  4B7K A;  1FJG O;  4JI8 O;  2OIE A;  4JI4 B;  1P4R A;  3ZRW A;  1WPX A;  1JMK C;  5AG2 A;  1HDJ A;  1K97 A;  4JAS A;  2Y69 C;  1GN6 A;  1K5S A;  3LDD A;  3BFR A;  3AK3 A;  4Q6G A;  3JD0 A;  4GX2 A;  3IC7 A;  1MNG A;  2E5L O;  5IJ0 B;  4CH4 A;  3K59 A;  1NS1 A;  2Q6A A;  4EFE A;  1E1R G;  2JGD B;  1Q6I A;  3RWR D;  3L9D A;  1F23 A;  2D2C B;  4BIZ A;  2UXD O;  2CTP A;  1EBO A;  3HB3 B;  2HFE C;  4B3S B;  1PM9 A;  2PTM A;  4MSW C;  3UQ8 A;  4YJ3 A;  4J80 A;  3SYQ A;  4JI4 O;  1N0J A;  1RSO B;  3K06 A;  1B6Q A;  1YCI A;  2GUZ A;  5F2V O;  1ORQ C;  2Q0A A;  2M7W A;  3OFN G;  2UU9 O;  2YI8 A;  3G6B A;  4UVB A;  4WFA V;  3DXR A;  3JAT B;  3CMA V;  2ATK C;  3CD6 V;  3U11 A;  1H2G A;  2EIL C;  4I7Z B;  1G1X B;  3X2Q B;  3CCJ V;  3T4Z A;  4MVR A;  2Y0I A;  1VQ6 V;  5LP6 C;  2BTQ A;  1OHH G;  1GAX A;  1COW G;  5C8Y A;  4LFA B;  5LOV A;  2P67 A;  3M99 B;  2XAG A;  4O2B B;  1NI8 A;  5JQG A;  1OCC B;  4PDV A;  1SA0 B;  4QPJ A;  3CCS V;  1BQZ A;  2UUC O;  2QKS A;  2KG7 A;  3RYF B;  2Y4U A;  4IHJ B;  3CB2 A;  2CUG A;  2AXT Z;  3M8A A;  1ZSP A;  2N74 A;  3JAR A;  1KEC A;  4HNA A;  1QLE C;  4UFZ A;  1LR1 A;  1XL6 A;  1J5E B;  3B4S A;  4J11 A;  4DV2 O;  2JGD A;  1BSM A;  4RUF A;  1KD1 W;  2CTR A;  3CCE V;  1XL4 A;  1Y76 B;  1EZJ A;  3K04 A;  4EFB A;  2ZCE A;  2JJ1 G;  1ZLZ A;  2Y69 B;  4GX0 A;  2PZS A;  2QM4 A;  4OPA A;  1M4U A;  4B3M B;  4FK5 C;  4F4L A;  4LNU B;  1HNZ O;  3NXS A;  2ADQ B;  2FYU H;  3I5D A;  1RFY A;  1SQB H;  1JVM A;  3WB0 A;  3A8T A;  3D36 A;  2IJI A;  5L3C A;  5B1B C;  3OE7 G;  3JD4 A;  5IYD O;  1OV9 A;  4JI1 O;  3OEH G;  4DV3 B;  3K5M A;  2F95 B;  2YIB A;  4UCR A;  2BSK A;  1U97 A;  1AR4 A;  3RYI B;  2ITD C;  5FPO A;  2K9P A;  4P9O A;  4TQD A;  1FXH A;  3L71 H;  3F7Y C;  4MW3 A;  4I55 A;  2P22 C;  4Z1V A;  1VQN V;  4GX1 A;  3RYH B;  1R3K C;  3MAQ A;  3CCR V;  3ETG A;  1BHA A;  2JJ2 G;  1IBM B;  2W0F C;  4JI7 O;  1D5N A;  3ETD A;  3ASN C;  3A0H Z;  3E8H A;  3KZI Z;  4IHJ A;  2BTO A;  1AJQ A;  5LP6 B;  3QO5 A;  3FB8 C;  3T1H B;  1KBH A;  4MVQ A;  3E8F A;  4WF9 V;  4UV8 A;  2LFR A;  4O4H A;  4XDK A;  3SGI A;  3HKE B;  3Q4H A;  2QTO A;  4OX9 O;  2JRI A;  1HR0 O;  1N8R W;  2QWN B;  4UUJ C;  4FLY A;  2PGG A;  2XAQ A;  4MVM A;  1M5I A;  5KAF Z;  3ABM C;  2WPD G;  2QM8 A;  5BR8 B;  4FLX A;  1W0J G;  2RNB A;  4DXW A;  3N27 A;  1UJW B;  1DGS A;  3K03 A;  3IAY A;  1DLB A;  1V55 C;  1K34 A;  1IBM O;  1Y6X A;  2DQ3 A;  3LUT B;  4DR7 B;  3T1Y B;  1N34 O;  5J9P C;  1F7Y A;  5J2T A;  5KHJ A;  5GON B;  1QLE B;  2QWP B;  1S76 D;  2FKX A;  4A5U B;  4AHC A;  1K4D C;  1HP8 A;  3K3W A;  4HYO A;  4RQF A;  2QM7 A;  1NR1 A;  3AG2 C;  2Q67 A;  1YJN V;  1MSW D;  4NTW A;  1QQC A;  3RYI A;  1HWY A;  4DV7 B;  5BR8 O;  4H37 A;  2EBO A;  4X62 O;  2F93 B;  2HEP A;  4TWK A;  1XI1 A;  5FPR A;  5FNV B;  1BHB A;  4ZHQ A;  1XUQ A;  3K0D A;  3CCL V;  2JEU A;  5BZB A;  3KCY A;  4JI3 B;  3J7A U;  1SQF A;  4K0K O;  2ILM A;  3BAB A;  5B1B B;  3MHS C;  2UXC B;  2N04 A;  3H1K H;  3F7V C;  1AP5 A;  2XAH A;  3JAL B;  5LA6 B;  3CJH A;  4NXN O;  1FXK A;  3FB5 C;  4J7Z A;  1K3E A;  3OD4 A;  3N2G B;  2OYQ A;  1NTZ H;  1VP7 A;  2LW7 A;  2ZQM A;  4DK1 A;  2JIZ G;  4NXM B;  5EYP A;  4B3T B;  1QR8 A;  2PI5 A;  5B1N A;  4LF4 B;  4O2A B;  4B08 A;  3CRM A;  4MS2 A;  4FFB A;  1AJN A;  1P49 A;  1S3J A;  5EK0 A;  5LYJ B;  3SJQ C;  4TV9 B;  3J81 N;  1XRE A;  3FYI B;  1ZAU A;  3H1I H;  4DR1 O;  3FAV B;  1R3J C;  5IY5 B;  3BHP A;  4GKJ O;  5H6R A;  3LSS A;  2M6Y A;  4DV5 O;  4JYB A;  3ZRV A;  4X1I B;  4X64 O;  3FFQ A;  3ZHU A;  2XND G;  1QU7 A;  3ABM B;  5ITZ B;  4UCV A;  2DYR C;  4JYC A;  1N32 O;  2Q0O C;  3WU2 Z;  1B06 A;  3AG4 C;  4NKG B;  1QBZ A;  3E35 A;  4NXM O;  2B1G A;  4DUY O;  1H2N A;  3ETQ A;  2FB5 A;  2QSA A;  4IL6 Z;  3SJA C;  3P3N A;  4CBC A;  2R9I A;  4FM1 A;  4GKK B;  1WJZ A;  1S5L Z;  4MTF A;  2EJ7 A;  3ICX A;  3UM7 A;  3SPG A;  5J2U A;  3AG2 B;  1ARO P;  2F66 C;  4LF8 O;  4NB5 A;  5LA6 A;  3L75 H;  1FKA O;  3E22 B;  1WA8 B;  4XDL A;  2R72 A;  1XMO O;  1H2S B;  4PDR A;  1VQL V;  1SC5 B;  1CPY A;  1JPX A;  3FX7 A;  3JAS B;  4R8C A;  2UXB O;  4P30 A;  5KMG B;  1GN4 A;  2XHB A;  1FFX B;  4MVO A;  4LWS A;  1BQ0 A;  1K73 W;  2ZE8 A;  4O2A A;  2Q7G A;  1E1Q G;  4PA4 A;  1JFF B;  3RFR A;  3IGA C;  4DR4 O;  1K9M W;  4W4L A;  2EIN C;  4I4T B;  2QWR B;  1NVP D;  1NT2 B;  4DR2 O;  3QG5 A;  4F6E A;  4JF3 A;  4X1Y B;  1Q6H A;  3JSL A;  1MG1 A;  3OTO B;  4FMT A;  3UCS C;  1FPO A;  4ZBM A;  4OGQ B;  1TUB A;  5IYB O;  3AG1 B;  4DR5 B;  1FS0 G;  1R3L C;  2CH7 A;  2IU0 A;  3JD3 A;  1Q7Y W;  5E79 Z;  5LGT A;  4DV4 B;  1YEW A;  1XNR B;  4GYC B;  2RN9 A;  3PJS K;  3X2Q C;  3T4D A;  5A9G A;  1WPB A;  1WB8 A;  5LHG A;  3THO A;  4DR6 O;  1BGY H;  4MT8 A;  1QVG U;  2VWJ A;  1VQ7 V;  1WLE A;  2OT5 A;  5L3E A;  1EN5 A;  1GN2 A;  2DMX A;  3BVO A;  1TGO A;  2WAM A;  4NTX A;  4YY3 B;  3BPZ A;  3KKY A;  4YJ3 B;  1M1K W;  3T1C A;  2GUZ B;  1G6U A;  3A0B Z;  2QEX V;  2Z3Y A;  4LC1 A;  1PKX A;  5EZY A;  1SQV H;  1OCC C;  2DYR B;  3DXR B;  1K5Q A;  1JCH A;  3SPI A;  3AG4 B;  1XIL A;  1WA8 A;  1R3I C;  1I94 O;  2YS8 A;  1GM7 A;  2F4V O;  2HVJ C;  4FPP A;  2P5O A;  4DV0 B;  2UXD B;  1W0K G;  2QE7 G;  2RCV A;  1QLN A;  2BTQ B;  2JVD A;  3G67 A;  4H13 B;  2H8P C;  2B9Z A;  4UCU A;  4LFC O;  5C8Y B;  1BMF G;  2CE4 A;  1TAE A;  5CA0 A;  2XOK G;  1N33 O;  3SPC A;  1WB7 A;  4RWU A;  4I4T A;  2UXX A;  5JQG B;  3CWB H;  2QA4 V;  3UT5 A;  3GWK C;  1XDC A;  4KFM A;  2KG7 B;  4U7N A;  2A79 B;  4DR3 O;  5CB4 B;  4LBE C;  3JAW B;  4FFK A;  3K57 A;  1OCR C;  3F5W C;  4XDJ A;  4FLU A;  1YHQ V;  3DC5 A;  1TA8 A;  4X65 B;  3JAR B;  1RPR A; 
#chains in the Genus database with same CATH homology
 4JI0 O;  4YY3 O;  1HNX O;  1HNZ O;  4JI5 O;  4JI4 O;  2FKX A;  4LFA O;  5LMN O;  1XMQ O;  4A5U B;  4GKK O;  2UU9 O;  1AB3 A;  1XNQ O;  2DOS A;  1AIL A;  4JI3 O;  5FLX N;  1N32 O;  3SDL A;  1G1X B;  4NXM O;  2UXC O;  3F5T A;  4DR6 O;  1HNW O;  4DV6 O;  4JI1 O;  5A2Q N;  1R6T A;  4DUY O;  5BR8 O;  4DV0 O;  4X62 O;  4LF7 O;  2VQE O;  2UUB O;  3T1H O;  1IBK O;  5BXZ A;  3O65 A;  4JI6 O;  4AQY O;  4X66 O;  4LFB O;  2UUA O;  2ZKO A;  1DK1 A;  3J7A U;  3JAM N;  5LMU O;  4K0K O;  1X59 A;  4JV5 O;  1FYJ A;  4OPH A;  4DV1 O;  4B3T O;  2VQF O;  1J5E O;  1R1B A;  1XEQ A;  1IBL O;  4JI7 O;  4LF4 O;  4LF8 O;  1I94 O;  2UUC O;  1FKA O;  3R66 A;  2F4V O;  3RT3 C;  2HHH O;  1FJG O;  1XMO O;  4NXN O;  4JI8 O;  2Z0A A;  2ZM6 O;  4B3R O;  1D2D A;  3M8A A;  4LFC O;  4JI2 O;  2N74 A;  4DR7 O;  2UXB O;  3OTO O;  3T1Y O;  4B3S O;  2AGA A;  4X65 O;  4DUZ O;  2LW7 A;  4DR5 O;  4B3M O;  4OX9 O;  1N33 O;  1A32 A;  3J80 N;  2JRI A;  1HR0 O;  4YHH O;  1YZB A;  1KUQ A;  4DR4 O;  2E5L O;  4DV4 O;  1XNR O;  4DV2 O;  2DJV A;  4KHP O;  1NS1 A;  4DR2 O;  3J81 N;  4OPA A;  4DR3 O;  5IWA O;  4DR1 O;  5LL6 Y;  5BY1 A;  1IBM O;  4LF6 O;  4GKJ O;  4DV3 O;  4DV7 O;  1N36 O;  4LF9 O;  4LF5 O;  4DV5 O;  2UXD O;  1N34 O;  1F7Y A;  5IT9 N;  4JYA O;  4X64 O;  5H5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...