1R1BA

Eprs second repeated element, nmr, minimized average structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
MVYDKIAAQGEVVRKLKAEKAPKAKVTEAVECLLSLKAEYKEKTGKEYVPGLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A recurrent RNA-binding domain is appended to eukaryotic aminoacyl-tRNA synthetases.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Ligase
molecule keywords TRNA SYNTHETASE
total genus 16
structure length 56
sequence length 56
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 1998-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1r1bA00
4X65O 4OPAA 4X62O 2UU9O 4LF6O 1I94O 4OPHA 4YY3O 4LF4O 1N36O 1R1BA 4JI0O 2UXBO 4JI7O 4DV7O 5BY1A 1J5EO 2ZM6O 2JRIA 4JYAO 4LF8O 2UUCO 2VQFO 1IBMO 2Z0AA 3M8AA 1N33O 4JI5O 4JI4O 2ZKOA 3OTOO 1N32O 4LF9O 1NS1A 1F7YA 2UXDO 1FYJA 2F4VO 3O65A 2E5LO 3T1HO 2DOSA 4DR1O 5LL6Y 1R6TA 1HNXO 4DUZO 1X59A 4DV3O 1FJGO 1G1XB 5IT9N 3J80N 4DR5O 5LMUO 5BR8O 4KHPO 2UXCO 4B3TO 4B3MO 1XEQA 3T1YO 1KUQA 1DK1A 1IBKO 4LFBO 5H5NA 1XNQO 3R66A 3J7AU 5IWAO 1XMQO 4K0KO 2N74A 4DV6O 4GKKO 4JI8O 2HHHO 3RT3C 2AGAA 5FLXN 4DR7O 4DR2O 1XNRO 4JI6O 4B3RO 1AILA 4GKJO 2UUBO 1AB3A 1HR0O 3F5TA 2UUAO 4LF5O 1HNWO 4A5UB 5LMNO 2LW7A 4DV0O 4DV2O 4JI2O 3JAMN 4JI1O 2FKXA 4X64O 4LFAO 3SDLA 4JI3O 4DV5O 4DUYO 1N34O 5A2QN 4LFCO 2DJVA 3J81N 1HNZO 4X66O 4LF7O 5BXZA 4DV4O 4JV5O 1IBLO 4NXMO 4OX9O 1YZBA 4AQYO 4NXNO 2VQEO 4DR6O 4DV1O 4DR3O 4B3SO 1A32A 1FKAO 4DR4O 1D2DA 1XMOO 4YHHO
chains in the Genus database with same CATH superfamily
3ZHRA 1GMGA 5CBFA 1M5IA 3F5WC 5EIBC 2WLMA 1QLNA 3FKSG 3SJBC 5B3SB 2WSSG 2HVKC 4TV8B 1R3LC 3DC5A 2Q5ZA 1GN3A 4X65B 4FK5C 4YY3B 1F51A 1K4DC 3VOUA 4XDJA 5GTHZ 4AHCA 3T4DA 3JAKA 1L0LH 2QWPB 3LNMB 2OYQA 1RFYA 3G6BA 4CH5A 5KHJA 4O4HB 1JCHA 2Q7EA 4H0LB 4GX0A 2XAJA 4X89A 1IBLB 3OTOB 4IHJA 1H38A 4FLTA 3ETQA 4I9QA 1PM9A 4MVRA 4ABMA 1PPJH 2X7RB 4X20A 1HP8A 4LWSB 1KMIZ 3ZHTA 4FZ0A 4LF6B 1BMFG 2WPDG 1OV9A 1S72V 3OM3B 2GUZA 1VQLV 3BFRA 1DTOA 1QBZA 4TV9B 1XNRB 4UB6Z 4H37A 2WAMA 1WA8B 1PKXA 3JSLA 3CC7V 3JCUZ 5L3BA 1X4TA 4EKWA 3LSSA 4ZI7B 4E4EA 3RYCB 1SQPH 3NR7A 1GN4A 4TUYA 2QR4A 3VQWA 2LO1A 4JI1B 2FYUH 3K57A 4PDRA 5CA1A 2EINC 4WFFA 2HJFC 4Q20A 5CB4B 2QWQB 1JQ0A 4YHHO 2BCCH 1Q5OA 2QE7G 3EHBB 2Y0IA 2UXBB 3LSQA 4MVQA 4F6EA 4WFAV 4JI0O 4WBNA 3JARA 2JEUA 4Z1VA 4J42A 3G80A 3ETDA 2UXDO 4AILC 5KLVH 4U3JA 3I5DA 1CEZA 5LA6B 1S77D 1S3JA 1TUBA 4QIWF 1EN4A 1PNKA 4DW1A 2AW9A 3JASB 4O2BA 3A2FA 2F93B 4UUJC 1W2BU 3AG1B 1K8AW 5FL7G 2DW4A 3PJSK 1S76D 1NI8A 4HNAA 1K5QA 3A0RA 1PNLA 1AJNA 3FYEB 5KHHA 3CX5F 3CP1A 4UVBA 3D3QA 3BRCA 1HR0O 3JASA 1VQ4V 1VQ8V 2IBZH 1NQTA 2XAGA 2CH7B 1PD3A 2PY5A 2Q67A 5IE9A 3JD1A 1Q81W 1ZL8B 3N27A 3AK1A 4I5SA 4MVMA 1AI6A 2PUSA 1P7GA 4PHZA 4QPKA 1H2GA 1KYOF 3E89A 2Q7GA 1R3KC 2Y69B 4DR3O 3ZCCA 3KCXA 5DM6V 4IGGA 3SR2C 1N8RW 4I50A 2YIAA 1SKVA 4PA7A 4ZHQA 3TJTA 5J2UA 3H1KH 2QSAA 4LF4O 2GUZB 3OE7G 2ZQMA 1H2KA 4GT1A 2XTAA 3WU2Z 2HG5C 4TSFG 4BAYA 1BSMA 2OT5A 1R73A 1YIJV 2CUGA 3G71V 4JTAB 4FM1A 2OIEA 1E1QG 4FJCC 4F4LA 2XUMA 5LXTB 1S5HC 5FPOA 1VQ9V 4RUFA 4U7OA 3SGIA 1X59A 5F2VO 4W4LA 5LHIA 3ZMVA 4C7UA 5CMUA 1URFA 4CZZA 1ROPA 2RN9A 5IDJA 4TV9A 1N34B 1WLEA 3S3XA 4QJFB 3WB1A 1GO3F 1M56C 1N4CA 1SQFA 2PYLA 4CBCA 1Y74A 3L74H 4N21A 5AG2A 1HR0B 3M7MX 2QWRB 4NTWA 4UCOA 2PI5A 1W59A 4JI2O 5IYBO 3OMAB 4JF3A 3JAMN 4JI1O 2VQEB 4PELA 2Q8VA 4MTFA 1ZWIC 4BIUA 4NKGB 5L3DA 4ASUG 4JV5O 3JSNA 4LFCB 2FL4A 3TETA 4OX9O 3RWRD 2ZR2A 4LFAB 1AI4A 1FFXB 1MNGA 3AEIA 5B1BB 1V54B 5KA5A 4L87A 4TQDA 2ZIOA 4JYBA 2UXDB 1AP5A 1BQ0A 1FD9A 1KKCA 5EC1C 4LF6O 4DUYB 3CD6V 5ITZA 2YXHA 5D5PA 4RUEA 5IY5B 2UXNA 3ZN1A 1RSOA 3OTOO 1NS1A 3ZN0A 1XMOB 2FMLA 3AG7A 2Q0OC 1HNXO 4GZRB 3L9DA 1EN6A 3J80N 5BR8O 1GN2A 2HHHB 3BPZA 4QPJA 4KFMA 4B3TO 2ADPA 1CXZB 1DF4A 3KG2A 3CMAV 3F7YC 4I4TB 3TXSA 2P7TC 3HPLC 1JPXA 1RSOB 3F7VC 5LGTA 5EIBD 2B1GA 1F23A 4H44B 3HB3B 1TAEA 3CCJV 1AILA 1B04A 3L73H 2YS8A 4FIPC 4LBEC 3RGBA 3VQXA 1SERA 1J95A 1SRYA 3HKDB 1TUEB 2ITCC 1SQQH 1K9MW 2ZM6B 4X64O 2HVJC 3TK1A 3FYIB 3OR7C 4I9WA 2CGNA 1QU7A 4TV8A 1BE3H 1VF6C 1TA8A 1VIBA 4E2LA 1NT2B 1Y74B 1M57C 1NTZH 5JQGB 3QO5A 3OR6C 5KX5B 2CTQA 4XBFA 5CBHA 4YJ2B 2DE0X 3WG7B 5JJNB 1CP9A 1W0KG 3FAVB 2KSDA 1XMOO 2YXLA 5LXTA 3ETGA 3OMIB 1XILA 5IYCO 3A8TA 3K06A 1THZA 1P84F 2KQXA 3ZRXA 1IX9A 3O9OA 1XDCA 4U3FH 2JRIA 2L35A 1WAZA 5JWPA 2QTSA 2Z0AA 2BTQA 4FFBA 2GTSA 2F23A 2JIZG 4ZKIA 1DF5A 5CN0A 3W7UA 3S3WA 3JCZA 3B40A 3CC4V 1K33A 4LF7B 2QJ1A 2F1MA 1LUVA 1WA8A 3CSXA 1OCOB 2DQ3A 4JI5B 4K0KO 3TGUH 2YEVB 1HDJA 4FFBB 3E2EA 1K7DA 3W7TA 3UCSC 2QTOA 1NVPD 4JI2B 5LOVB 2BTQB 4GKJO 1OCZC 1I5XA 4J10A 4O4LB 1F4NA 3JYCA 1NJIW 2L6LA 2FB5A 2JJ1G 4I50B 2JDIG 3ZMSA 2IU0A 4IHJB 5LYJA 4NVPA 2OCHA 3SPCA 5FNVA 3B8NA 3E83A 4J7JA 2DMXA 2KG7A 4UFZA 1NZ6A 1SQXH 1S5LZ 5H6RA 3CPWU 3E8GA 4UCUA 4AQYO 4B3SO 1VF5B 1WPBA 1YXBA 1COWG 2A06H 4G28B 1FXKB 2Q9LA 3HKEB 3C90A 4DUZB 4KUMA 3HKEA 2UUBB 1NR1A 4WFBV 2QEXV 3GVMA 3ABUA 3EXAA 4LP8A 2BOBC 5IJ9A 1I0HA 5BY1A 1J5EO 4YJ2A 2Y4UA 4MW8A 4EFBA 2YXYA 1GK9A 1XREA 2Z5UA 3LDCA 4LF4B 1ENVA 3DSQA 3ZJZA 1M4UA 2DYRC 3G67A 3OGCC 3CWBH 1AJQA 2E5LO 4J80A 1IXBA 4DR1O 4GX2A 3AG4B 1FJGO 3ASNB 1VF6A 3ASNC 2HLDG 3OFNG 5K1PA 4NXNB 4DV6B 2GTAA 2WLKA 2QA4V 1ZX3A 3CHXA 4LFBO 2CGOA 3BY6A 3R66A 2R9IA 3CRCA 2N74A 1IVSA 1PL4A 3AK3A 1SZTA 4DR7O 3HKDA 3CMEV 3K5MA 2QKCA 3BCCH 2GV9A 2IH1C 3P3NA 4DYLA 1O9GA 2UU9B 2RDCA 2UUAB 1G4YB 2ARHA 4YIOA 3RYIB 4HZ3A 2DN9A 4ZOLA 1CPYA 3QO8A 4LF5O 1HNWO 4A5UB 2X6CA 3JD0A 3CCUV 3FX7A 3N2KB 4DR6B 2VWJA 3D8CA 3AG1C 3IC9A 4I55A 4MW3A 2DJVA 2WA4A 3I55V 2EIJB 4BR6A 2E75B 1ZUQA 2QM8A 1US6A 1KQSU 2B9ZA 2ZR3A 5B1NA 2ILMA 1BZKA 4DV0B 1FAFA 4WFEA 4DV4B 1D2DA 3B4SA 4CC5A 4UCTA 3JAKB 2P22C 4X88A 4DV7O 2EX3A 1NH2B 1XI1A 1VARA 2ODMA 3LNNA 2EZPA 1JA8A 3QVNA 4JYAO 4R6ZA 4LF8O 4JI0B 3T4ZA 1K34A 2F66C 2R9RB 4IL6Z 3L72H 1EZVH 4FVMA 3BEHA 1MSDA 2ZKOA 2R72A 1D5AA 2AHYA 3A0HZ 2EILC 5EBMC 2ATKC 3E22B 2QWNB 3Q4HB 4IIJB 5LL6Y 3T2MA 1V55C 2HFEC 3ASOB 2YSUB 5LMUO 4X1IB 4G27B 4JZ2A 4MVOA 3ABLB 4LH7A 3N2GA 1AI7A 3AG2C 1WP8A 1R3IC 2VRZA 1VQ6V 1MG1A 1BQZA 2Y48A 5E1AC 4DXWA 3QO7A 1VQPV 2AHZA 4DR2O 3IAYA 2A79B 3GWOA 5E79Z 3X2QB 3UT5A 3CRAA 4R50A 4X62B 2LFRA 3D3IA 5C8YA 1BL8A 3DTUB 4O4JB 2LW7A 2CTRA 2XASA 2WLIA 4FLZA 5K1XA 3BHPA 4IT5A 4B08A 1QVFU 2RJZA 2F43G 2Y0PA 4DR4B 5IY5C 1FXVA 1FFTB 4I4TA 1IBLO 4MVSA 5GW7A 3KZIZ 3H1JH 1G6UA 1PV0A 4JTCB 2LGQA 1EZJA 1M57B 5IJ0B 5CA0A 1UJWB 3APQA 5CA0B 3VQYA 1N33B 2C2AA 2UXXA 3KCYA 3E35A 4X20B 1UPGA 3ETEA 3RVZA 3CXHF 4BIOA 4YY3O 2IJHA 1ZSPA 3K59A 5B1AC 3ZHQA 2JK5C 1E79G 3CCRV 3U10A 2XNDG 3CCSV 2QKSA 1BHBA 1MZFA 3K5LA 1XMQB 3K03A 5H2FZ 4PD4F 4R7CA 4B3MB 5B1BC 1SF9A 1U96A 3WG7C 1B3QA 2ZE6A 2IW5A 2OCCC 2CTPA 3OD4A 3FD9A 2Q6AA 3K3WA 1UFIA 2RMKB 3CS5A 5IWAO 1EM1A 4TQFA 3D36C 5LA6A 4DV2B 4O4IB 1SESA 2BSKA 4B3RO 5JH7A 4DK0A 4IYIA 1JX9A 4EFEA 3SYCA 4J7KA 1AB3A 1VP7A 1JJOA 4NTYA 3JALA 4EB6B 3RVYA 4HAMA 5B1OA 2IJKA 4LC1A 2E3CA 2QM7A 3ZHSA 3QF7A 1KD1W 2JEXA 1I94B 2RCVA 2EJ7A 1N0JA 4UVAA 4X66O 2EZOA 2D3OW 4FPPA 1VEWA 1Z5VA 2HJDA 1V55B 3ABLC 3W7SA 2X6AA 3HKCB 5LMNB 4CS2A 4DV3B 1U97A 1H2SB 1P7BA 3HKBB 3OMNB 4O4LA 1IDSA 2DYRB 5LYJB 2YIBA 3DC6A 4MVUA 2DQ0A 4OPAA 2BOCC 2HEPA 5H6QA 3ZRWB 4LR3A 2ITDC 1P4RA 1VQMV 3K0GA 3I56V 1O9HA 4LWSA 5IJ0A 1Q6HA 1IBMO 2P06A 1K92A 1SZXA 4KP4A 5B66Z 4XDKA 4JI4O 2CAZC 1FYJA 1IBKB 1YDXA 3OAAG 3CCQV 1MOFA 2B1IA 1V9PA 1OCRC 4OXSA 3ZEDA 1XEQA 5LGUA 1IBKO 1GH6A 5EYPA 1N32B 1XNQO 5LHHA 1KECA 4GKKO 4K8XA 1Z5WA 1GN6A 4O4JA 2QKAA 5HFLA 5FLXN 5GONB 3OGIB 5HFMA 1ZL8A 1KP2A 2F4VB 3WFVA 2F95B 4UB8Z 2R9AA 1Q82W 2ADQB 1Y6XA 4RQFA 4PI2A 4FLXA 3CCVV 5LMNO 4JI7B 1JOYA 1TVKA 2V4DA 4DV5O 1QLEB 2BE3A 5KHGA 2LP7A 2BSKB 4X8AA 1MABG 1VF7A 1AR1B 5L3CA 1YITV 5BXZA 4UCRA 5JCOC 3W7WA 4WFGA 4FM0A 1FJGB 1HW7A 3PN1A 4WCEV 4RWUA 5KMGA 2UXCB 4X9QA 1M9NA 1LR1A 4DR5B 4L8JA 3D36A 4TT3G 1GTOA 3SYQA 1MMMA 1TUBB 1VQ5V 2OIGA 2DWDC 4MTXA 4JASA 4DRXB 2ZNJA 3RYHA 4DV5B 1PNMA 4LNUB 1SQGA 4FMTA 1K73W 2WWWA 3ASOC 1NTMH 2QGNA 4N23A 1QR8A 1XL4A 4K3AA 4FFKA 2ZNIA 2YDEA 1OCCB 5H9CA 4J41A 4JI6B 1BHAA 4HBNA 2OCCB 4GX1A 4B3SB 2DOSA 1SC5B 1Q86W 4Z1MG 3GB7C 2O57A 2Q69A 4FM2A 4MSWC 2ZE5A 5KUKA 4GKKB 4R8CA 2JGDB 2DYSC 4FLYA 1KUQA 1OCOC 1FFXA 5H5NA 3SPGA 3K04A 3ZRVA 4FLWA 3OUFA 2RNBA 2LQTA 2XAHA 5JJJB 1V54C 3DXRB 1GKFA 1XQ8A 1K97A 1H2NA 2ZIMA 2AXTZ 5LGNA 4F6RB 4CH3A 2A0LA 3CJHB 2P67A 3CJHA 3T1HB 4PJ0Z 3B2EE 2LFSA 4FLVA 4LF9B 4JI4B 2FTKA 1IBMB 2EBOA 5D5QA 3BA9A 4UXNA 3Q4HA 4IIJA 4UCVA 5C8YB 4DV2O 1WJZA 4FZ1A 3UM7A 2VS0A 4I0XA 4B7KA 5KAFZ 2P6JA 4TWKA 5EC2C 1D5NA 3H01A 1OZ0A 1E1RG 3FB8C 3OTFA 4JI8B 5KA6A 3K58A 2XT9A 3MHHC 3WB0A 3CRRA 1FXKC 1IURA 2LGWA 4Q6GA 1QVGU 2YICA 3T1YB 5B3SC 1YVWA 4QNHB 4PV1B 1VMGA 1XHZA 1PP9H 4WF9V 3K5NA 1RP3B 2EIKB 3NXSA 1I94O 2EIMB 2EIMC 3ICXA 3H1LH 4WFHA 3K79A 4JYCA 2LW1A 2AZ0A 3SJQC 3LDEA 5B1AB 3UQ8A 2RQ6A 2UUCO 3RN4A 1N36B 3ZBHA 2VQFO 1N33O 3MHSC 2WLHA 3ML0A 4GX5A 1QLEC 3U0ZA 4ZI7A 2H8PC 5J2UB 4JGSA 4CC6A 5JCOA 3T1YO 5BZBA 2ZXWC 5J2TA 3JAWB 1YJWV 4NR1A 3K9SA 3FFQA 3LDDA 3OEEG 3SYAA 1JMKC 1XHXA 4LF8B 2AGAA 1KB9F 5CB4A 2Q0AA 1JFFB 4X1YB 5CBGA 3IFXA 2YEVA 1G8MA 2CDYA 2NN4A 2PYJA 4TUYB 3E8HA 1K5SA 4O2AA 5CA3A 2ZCEA 4IYHA 4DV0O 3RBZA 4EB6A 1AROP 2A7WA 4RAIA 4ZIBA 1SA0B 4PA4A 4HNAB 1SA0A 3E8BA 3E8FA 4PDVA 1BT8A 5EBLC 4GYCB 1FXHA 2CTWA 1Y76A 4NXMO 4QE9A 4B7EA 4W4KA 1QCEA 3W7XA 3K9AA 4DR6O 1A32A 3E86A 1OHHG 4CS4A 4UCSA 1I5YA 2BTOA 4DR4O 1F4MA 1WP7A 3ABMB 4JYAB 3HKBA 3OW2U 1NU1H 2D2CB 3JALB 1VQ7V 4CH4A 3QG5A 3SPHA 3G4SV 3TXQA 5DECA 4GUNA 1Q6UA 1YJNV 4YIPA 1AJPA 2DYSB 1MZEA 1SETA 2CK3G 5IJ9B 2NR5A 1N32O 2Q7HA 4LF9O 4LFBB 3E22A 3T1CA 5BMVA 3T1HO 2QDOA 4O2BB 1KP3A 3CC2V 4LH6A 4OX9B 1MSWD 1DLBA 5IT9N 3STZC 1OCRB 5KAIZ 3WB2A 4UV8A 1FXKA 2EULA 5LOVA 1K3EA 4P30A 3IGAC 1WPXA 3SJCC 4P9PA 1L1FA 4JAAA 3MDSA 3H1HH 4Z2WA 1NTKH 4JI3B 5EYPB 4K8ZA 2QM4A 3EVKA 2JVDA 3SJAC 5LP6B 4JI6O 2KG7B 3VBBA 3ABTA 3CRQA 4NYKA 4AI8A 2WLJA 1KC8W 2ZXWB 4MT8A 1Q7YW 2UUBO 2GHYA 2ZINA 2K9PA 3DXRA 2AZ2A 1Z2GA 4QE7A 2Y69C 4I7ZB 1HWYA 4JI3O 2XAQA 4QGPA 2ZD9A 3QNEA 1L8DA 1WN7A 3CE2A 5A9GA 3J81N 1IXMA 5EK0A 4UVCA 4DV4O 1XNQB 2P4KA 5IYDO 3JATB 1IZ3A 5J2TB 1QNMA 2W0XA 3JD4A 1GRJA 1M56B 1YSCA 2JJ2G 2XAFA 4JZGA 1GAXA 4J7ZA 1J5EB 3B09A 3CB2A 3RYHB 3HR0A 3OEHG 1R1BA 4JI7O 3ZS8C 5B5EZ 2Q73A 4BW5A 1NVPB 1YTFD 1FS0G 1YI2V 1H8HG 2CE4A 3P30A 3RFRA 3M8AA 1WB8A 4YJ3A 4JI5O 3LSUA 5J9PC 1AR4A 2ZDIA 5KHIA 3SYOA 2F4VO 4DR3B 1R6TA 3JAWA 4FLUA 1I08A 4P2ZA 4DV3O 2KKWA 5GTIZ 4J11A 3THOA 2DWEC 4B3MO 2WLLA 3ZRSA 2WLLB 5LBQA 2G38A 4DO2A 1Q43A 1QR9A 3MD0A 4NXMB 1TVKB 3C3TA 5EZYA 3RYFB 3J7AU 3CRMA 1XMQO 4DV6O 4X66B 4DRXA 1XUQA 2OWOA 4D7TA 1AR5A 1M1KW 4MS2A 1QQCA 3BAAA 3IC7A 4I0XB 1SS3A 2YUAA 4H13B 4NB5A 3H1IH 1T5EA 2EINB 4MVZA 4PI0A 4U3JB 1KBHA 3R65A 2JGUA 3C3SA 3CCLV 3RYFA 1NKDA 2P5OA 2FKXA 1W0JG 5TISZ 4F6RA 2K1EA 4LF7O 3UO3A 3CEIA 5ITZB 2P90A 1ZAUA 3UO2A 2PZSA 3ZMUA 4G2KA 4BW9A 3CYOA 1BGYH 4X1KB 4P9OA 1BCCH 2YIBD 3AK2A 4X62O 1ORQC 1FPOA 2VQFB 1N36O 2UUCB 2UXBO 4MTGA 5JVDA 4ZHQB 1M90W 4RO2A 1R6NA 2NLJC 2XOKG 4NTXA 4YHHB 4PDLA 1GM7A 4K35A 5JVDB 3TCUA 3HKCA 1P49A 2JS5A 1F7YA 4B3RB 3BVOA 4PA6A 1PL0A 2IU3A 4RQEA 3BA8A 4X1KA 5BR8B 1G1XB 2X6BA 5JJEB 2X0LA 1DK1A 1JVMA 1Y67A 3ZMTA 3FB5C 5BMVB 5L3FA 4JI8O 3UKMA 3RT3C 3AG3C 5EBWC 2WLNA 2P4VA 5KMGB 1I7FA 3ZHUA 4BIZA 3CCMV 2N05A 4DV7B 1XNRO 1VQNV 4KL1A 4J9ZB 2V7QG 4HYOA 2N04A 4JYYA 3OT7A 3MAQA 4LNUA 1RM1B 3STLC 1QHTA 1GM8A 5JQGA 1SQBH 1ZLZA 2W0FC 1Y66A 4LFAO 3SDLA 1NH2D 2ZDIC 1H8EG 1R6KA 2EIKC 4DR2B 5A2QN 2M6YA 3OUSA 1YTFB 4LFCO 2ETNA 3AG3B 4JV5B 1WB7A 3A0BZ 1OCCC 1OCZB 3P32A 3FB6C 3ZMZA 4PA3A 1YF2A 3FB7C 3M99B 4D6TH 2VQEO 2H3OA 1AP6A 2PTMA 1YJ9V 2MW2B 1RPOA 4GLXA 4X65O 1H2LA 2YC0A 3SPIA 4EEQA 2UU9O 4ICGA 1NR7A 2QWOB 2ZM6O 5DN6G 1XBLA 4JTDB 2YI9A 4LCUC 3ABKC 4MTOA 1YCIA 3ZX6A 1H2MA 5KUMA 2H94A 2E74B 1JFFA 2HP8A 4X1YA 4CS3A 4JAVA 5C93A 1SQVH 5FNVB 1L0NH 1KKDA 1K4CC 5KHKA 4DR5O 4KHPO 1BS3A 2UXCO 5L3GA 5LP6A 1HNZB 2E5LB 2PI4A 1OJHA 3AG2B 1NBMG 2WLIB 3BABA 4ZBMA 4H33A 3CXCU 4B3TB 2A9HA 4D7SA 2HHHO 5LMUB 1B6QA 1EFRG 5DEDA 2Z3YA 1HNXB 2ZE7A 2EJRA 1DGSA 3SYPA 1HNWB 1VQKV 3ZRWA 3P3PA 4LF5B 1LUWA 2YIDA 2PGGA 2W6IG 2UUAO 3K08A 2Q68A 4DUYO 1N34O 4DR7B 4XDLA 4GCZA 2HKOA 1R3JC 1ZTEA 2A3QA 4O4HA 3CCEV 1RM1C 4U7NA 3JD3A 3X2QC 1YZBA 3AG4C 1RPRA 4DK1A 3APOA 5KX5A 4NXNO 3L75H 1S0VA 4DV1O 2HR3A 3U11A 1FKAO 1XOUA 3UT5B 2VWKA 4KXRA 3SPJA 4DR1B 2IH3C 2ZT9B 3RW0A 3EFFK 5GONA 3K0DA 3JD2A 3G6EV 2OTLV 1TGOA 4JAUA 2M7WA 1Q3EA 3FAVA 3B77A 4OPHA 1Q8IA 2KB1A 1KU9A 3VQVA 3L71H 3GWKC 4O4IA 4PDMA 2WA3A 4K0KB 4WBNB 3ZHVA 2Q4PA 5LHGA 3ZIAG 1JJ2U 4OGQB 2GDSA 3JARB 1MA1A 3O65A 3JATA 4PA9A 4DV1B 4O2AB 4J9YB 2XHBA 4DUZO 4I55B 1VQOV 4YJ3B 1GM9A 3N2KA 2IJJA 1Q6IA 2LJ2A 5CA1B 5IYZA 2EIJC 3IJ4A 3ABKB 5IYZB 4CH6A 2W6JG 3KKYA 3L70H 2YI8A 4ZOLB 2IJIA 2E76B 4TOIA 1Y76B 1EN5A 2Y4TA 1JR9A 2NNUA 3RYCA 5L3EA 1N0NA 1Q90D 3RYIA 2B5UA 1LNQA 2V1DA 1B06A 1XL6A 5FPRA 2JS3A 1YEWA 4JPRA 3ABMC 2GBOA 2MK3A 3F5TA 2IM9A 4GKJB 3QTCA 1AI5A 2R70A 2OTJV 2EILB 2JGDA 3H9VA 1M93A 3DGEA 1HNZO 2CH7A 1S5JA 5IWAB 4KHPB 1Y4MA 4YXWG 5LP6C 3B8MA 2PF4E 5EZYB 3N2GB 4X64B 1AVMA 4AQYB 3K5OA 1WNSA 2ZE8A 5JH7B 3LUTB 4X1IA 1YHQV 4DW0A 1EBOA 4UV9A 2GSMB 4BWAA
chains in the Genus database with same CATH topology
4X65O 4OPAA 4X62O 2UU9O 4LF6O 1I94O 4OPHA 4YY3O 4LF4O 1N36O 1R1BA 4JI0O 2UXBO 4JI7O 4DV7O 5BY1A 1J5EO 2ZM6O 2JRIA 4JYAO 4LF8O 2UUCO 2VQFO 1IBMO 2Z0AA 3M8AA 1N33O 4JI5O 4JI4O 2ZKOA 3OTOO 1N32O 4LF9O 1NS1A 1F7YA 2UXDO 1FYJA 2F4VO 3O65A 2E5LO 3T1HO 2DOSA 4DR1O 5LL6Y 1R6TA 1HNXO 4DUZO 1X59A 4DV3O 1FJGO 1G1XB 5IT9N 3J80N 4DR5O 5LMUO 5BR8O 4KHPO 2UXCO 4B3TO 4B3MO 1XEQA 3T1YO 1KUQA 1DK1A 1IBKO 4LFBO 5H5NA 1XNQO 3R66A 3J7AU 5IWAO 1XMQO 4K0KO 2N74A 4DV6O 4GKKO 4JI8O 2HHHO 3RT3C 2AGAA 5FLXN 4DR7O 4DR2O 1XNRO 4JI6O 4B3RO 1AILA 4GKJO 2UUBO 1AB3A 1HR0O 3F5TA 2UUAO 4LF5O 1HNWO 4A5UB 5LMNO 2LW7A 4DV0O 4DV2O 4JI2O 3JAMN 4JI1O 2FKXA 4X64O 4LFAO 3SDLA 4JI3O 4DV5O 4DUYO 1N34O 5A2QN 4LFCO 2DJVA 3J81N 1HNZO 4X66O 4LF7O 5BXZA 4DV4O 4JV5O 1IBLO 4NXMO 4OX9O 1YZBA 4AQYO 4NXNO 2VQEO 4DR6O 4DV1O 4DR3O 4B3SO 1A32A 1FKAO 4DR4O 1D2DA 1XMOO 4YHHO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 O;  4OPA A;  4X62 O;  2UU9 O;  4LF6 O;  1I94 O;  4OPH A;  4YY3 O;  4LF4 O;  1N36 O;  1R1B A;  4JI0 O;  2UXB O;  4JI7 O;  4DV7 O;  5BY1 A;  1J5E O;  2ZM6 O;  2JRI A;  4JYA O;  4LF8 O;  2UUC O;  2VQF O;  1IBM O;  2Z0A A;  3M8A A;  1N33 O;  4JI5 O;  4JI4 O;  2ZKO A;  3OTO O;  1N32 O;  4LF9 O;  1NS1 A;  1F7Y A;  2UXD O;  1FYJ A;  2F4V O;  3O65 A;  2E5L O;  3T1H O;  2DOS A;  4DR1 O;  5LL6 Y;  1R6T A;  1HNX O;  4DUZ O;  1X59 A;  4DV3 O;  1FJG O;  1G1X B;  5IT9 N;  3J80 N;  4DR5 O;  5LMU O;  5BR8 O;  4KHP O;  2UXC O;  4B3T O;  4B3M O;  1XEQ A;  3T1Y O;  1KUQ A;  1DK1 A;  1IBK O;  4LFB O;  5H5N A;  1XNQ O;  3R66 A;  3J7A U;  5IWA O;  1XMQ O;  4K0K O;  2N74 A;  4DV6 O;  4GKK O;  4JI8 O;  2HHH O;  3RT3 C;  2AGA A;  5FLX N;  4DR7 O;  4DR2 O;  1XNR O;  4JI6 O;  4B3R O;  1AIL A;  4GKJ O;  2UUB O;  1AB3 A;  1HR0 O;  3F5T A;  2UUA O;  4LF5 O;  1HNW O;  4A5U B;  5LMN O;  2LW7 A;  4DV0 O;  4DV2 O;  4JI2 O;  3JAM N;  4JI1 O;  2FKX A;  4X64 O;  4LFA O;  3SDL A;  4JI3 O;  4DV5 O;  4DUY O;  1N34 O;  5A2Q N;  4LFC O;  2DJV A;  3J81 N;  1HNZ O;  4X66 O;  4LF7 O;  5BXZ A;  4DV4 O;  4JV5 O;  1IBL O;  4NXM O;  4OX9 O;  1YZB A;  4AQY O;  4NXN O;  2VQE O;  4DR6 O;  4DV1 O;  4DR3 O;  4B3S O;  1A32 A;  1FKA O;  4DR4 O;  1D2D A;  1XMO O;  4YHH O; 
#chains in the Genus database with same CATH topology
 3ZHR A;  1GMG A;  5CBF A;  1M5I A;  3F5W C;  5EIB C;  2WLM A;  1QLN A;  3FKS G;  3SJB C;  5B3S B;  2WSS G;  2HVK C;  4TV8 B;  1R3L C;  3DC5 A;  2Q5Z A;  1GN3 A;  4X65 B;  4FK5 C;  4YY3 B;  1F51 A;  1K4D C;  3VOU A;  4XDJ A;  5GTH Z;  4AHC A;  3T4D A;  3JAK A;  1L0L H;  2QWP B;  3LNM B;  2OYQ A;  1RFY A;  3G6B A;  4CH5 A;  5KHJ A;  4O4H B;  1JCH A;  2Q7E A;  4H0L B;  4GX0 A;  2XAJ A;  4X89 A;  1IBL B;  3OTO B;  4IHJ A;  1H38 A;  4FLT A;  3ETQ A;  4I9Q A;  1PM9 A;  4MVR A;  4ABM A;  1PPJ H;  2X7R B;  4X20 A;  1HP8 A;  4LWS B;  1KMI Z;  3ZHT A;  4FZ0 A;  4LF6 B;  1BMF G;  2WPD G;  1OV9 A;  1S72 V;  3OM3 B;  2GUZ A;  1VQL V;  3BFR A;  1DTO A;  1QBZ A;  4TV9 B;  1XNR B;  4UB6 Z;  4H37 A;  2WAM A;  1WA8 B;  1PKX A;  3JSL A;  3CC7 V;  3JCU Z;  5L3B A;  1X4T A;  4EKW A;  3LSS A;  4ZI7 B;  4E4E A;  3RYC B;  1SQP H;  3NR7 A;  1GN4 A;  4TUY A;  2QR4 A;  3VQW A;  2LO1 A;  4JI1 B;  2FYU H;  3K57 A;  4PDR A;  5CA1 A;  2EIN C;  4WFF A;  2HJF C;  4Q20 A;  5CB4 B;  2QWQ B;  1JQ0 A;  4YHH O;  2BCC H;  1Q5O A;  2QE7 G;  3EHB B;  2Y0I A;  2UXB B;  3LSQ A;  4MVQ A;  4F6E A;  4WFA V;  4JI0 O;  4WBN A;  3JAR A;  2JEU A;  4Z1V A;  4J42 A;  3G80 A;  3ETD A;  2UXD O;  4AIL C;  5KLV H;  4U3J A;  3I5D A;  1CEZ A;  5LA6 B;  1S77 D;  1S3J A;  1TUB A;  4QIW F;  1EN4 A;  1PNK A;  4DW1 A;  2AW9 A;  3JAS B;  4O2B A;  3A2F A;  2F93 B;  4UUJ C;  1W2B U;  3AG1 B;  1K8A W;  5FL7 G;  2DW4 A;  3PJS K;  1S76 D;  1NI8 A;  4HNA A;  1K5Q A;  3A0R A;  1PNL A;  1AJN A;  3FYE B;  5KHH A;  3CX5 F;  3CP1 A;  4UVB A;  3D3Q A;  3BRC A;  1HR0 O;  3JAS A;  1VQ4 V;  1VQ8 V;  2IBZ H;  1NQT A;  2XAG A;  2CH7 B;  1PD3 A;  2PY5 A;  2Q67 A;  5IE9 A;  3JD1 A;  1Q81 W;  1ZL8 B;  3N27 A;  3AK1 A;  4I5S A;  4MVM A;  1AI6 A;  2PUS A;  1P7G A;  4PHZ A;  4QPK A;  1H2G A;  1KYO F;  3E89 A;  2Q7G A;  1R3K C;  2Y69 B;  4DR3 O;  3ZCC A;  3KCX A;  5DM6 V;  4IGG A;  3SR2 C;  1N8R W;  4I50 A;  2YIA A;  1SKV A;  4PA7 A;  4ZHQ A;  3TJT A;  5J2U A;  3H1K H;  2QSA A;  4LF4 O;  2GUZ B;  3OE7 G;  2ZQM A;  1H2K A;  4GT1 A;  2XTA A;  3WU2 Z;  2HG5 C;  4TSF G;  4BAY A;  1BSM A;  2OT5 A;  1R73 A;  1YIJ V;  2CUG A;  3G71 V;  4JTA B;  4FM1 A;  2OIE A;  1E1Q G;  4FJC C;  4F4L A;  2XUM A;  5LXT B;  1S5H C;  5FPO A;  1VQ9 V;  4RUF A;  4U7O A;  3SGI A;  1X59 A;  5F2V O;  4W4L A;  5LHI A;  3ZMV A;  4C7U A;  5CMU A;  1URF A;  4CZZ A;  1ROP A;  2RN9 A;  5IDJ A;  4TV9 A;  1N34 B;  1WLE A;  3S3X A;  4QJF B;  3WB1 A;  1GO3 F;  1M56 C;  1N4C A;  1SQF A;  2PYL A;  4CBC A;  1Y74 A;  3L74 H;  4N21 A;  5AG2 A;  1HR0 B;  3M7M X;  2QWR B;  4NTW A;  4UCO A;  2PI5 A;  1W59 A;  4JI2 O;  5IYB O;  3OMA B;  4JF3 A;  3JAM N;  4JI1 O;  2VQE B;  4PEL A;  2Q8V A;  4MTF A;  1ZWI C;  4BIU A;  4NKG B;  5L3D A;  4ASU G;  4JV5 O;  3JSN A;  4LFC B;  2FL4 A;  3TET A;  4OX9 O;  3RWR D;  2ZR2 A;  4LFA B;  1AI4 A;  1FFX B;  1MNG A;  3AEI A;  5B1B B;  1V54 B;  5KA5 A;  4L87 A;  4TQD A;  2ZIO A;  4JYB A;  2UXD B;  1AP5 A;  1BQ0 A;  1FD9 A;  1KKC A;  5EC1 C;  4LF6 O;  4DUY B;  3CD6 V;  5ITZ A;  2YXH A;  5D5P A;  4RUE A;  5IY5 B;  2UXN A;  3ZN1 A;  1RSO A;  3OTO O;  1NS1 A;  3ZN0 A;  1XMO B;  2FML A;  3AG7 A;  2Q0O C;  1HNX O;  4GZR B;  3L9D A;  1EN6 A;  3J80 N;  5BR8 O;  1GN2 A;  2HHH B;  3BPZ A;  4QPJ A;  4KFM A;  4B3T O;  2ADP A;  1CXZ B;  1DF4 A;  3KG2 A;  3CMA V;  3F7Y C;  4I4T B;  3TXS A;  2P7T C;  3HPL C;  1JPX A;  1RSO B;  3F7V C;  5LGT A;  5EIB D;  2B1G A;  1F23 A;  4H44 B;  3HB3 B;  1TAE A;  3CCJ V;  1AIL A;  1B04 A;  3L73 H;  2YS8 A;  4FIP C;  4LBE C;  3RGB A;  3VQX A;  1SER A;  1J95 A;  1SRY A;  3HKD B;  1TUE B;  2ITC C;  1SQQ H;  1K9M W;  2ZM6 B;  4X64 O;  2HVJ C;  3TK1 A;  3FYI B;  3OR7 C;  4I9W A;  2CGN A;  1QU7 A;  4TV8 A;  1BE3 H;  1VF6 C;  1TA8 A;  1VIB A;  4E2L A;  1NT2 B;  1Y74 B;  1M57 C;  1NTZ H;  5JQG B;  3QO5 A;  3OR6 C;  5KX5 B;  2CTQ A;  4XBF A;  5CBH A;  4YJ2 B;  2DE0 X;  3WG7 B;  5JJN B;  1CP9 A;  1W0K G;  3FAV B;  2KSD A;  1XMO O;  2YXL A;  5LXT A;  3ETG A;  3OMI B;  1XIL A;  5IYC O;  3A8T A;  3K06 A;  1THZ A;  1P84 F;  2KQX A;  3ZRX A;  1IX9 A;  3O9O A;  1XDC A;  4U3F H;  2JRI A;  2L35 A;  1WAZ A;  5JWP A;  2QTS A;  2Z0A A;  2BTQ A;  4FFB A;  2GTS A;  2F23 A;  2JIZ G;  4ZKI A;  1DF5 A;  5CN0 A;  3W7U A;  3S3W A;  3JCZ A;  3B40 A;  3CC4 V;  1K33 A;  4LF7 B;  2QJ1 A;  2F1M A;  1LUV A;  1WA8 A;  3CSX A;  1OCO B;  2DQ3 A;  4JI5 B;  4K0K O;  3TGU H;  2YEV B;  1HDJ A;  4FFB B;  3E2E A;  1K7D A;  3W7T A;  3UCS C;  2QTO A;  1NVP D;  4JI2 B;  5LOV B;  2BTQ B;  4GKJ O;  1OCZ C;  1I5X A;  4J10 A;  4O4L B;  1F4N A;  3JYC A;  1NJI W;  2L6L A;  2FB5 A;  2JJ1 G;  4I50 B;  2JDI G;  3ZMS A;  2IU0 A;  4IHJ B;  5LYJ A;  4NVP A;  2OCH A;  3SPC A;  5FNV A;  3B8N A;  3E83 A;  4J7J A;  2DMX A;  2KG7 A;  4UFZ A;  1NZ6 A;  1SQX H;  1S5L Z;  5H6R A;  3CPW U;  3E8G A;  4UCU A;  4AQY O;  4B3S O;  1VF5 B;  1WPB A;  1YXB A;  1COW G;  2A06 H;  4G28 B;  1FXK B;  2Q9L A;  3HKE B;  3C90 A;  4DUZ B;  4KUM A;  3HKE A;  2UUB B;  1NR1 A;  4WFB V;  2QEX V;  3GVM A;  3ABU A;  3EXA A;  4LP8 A;  2BOB C;  5IJ9 A;  1I0H A;  5BY1 A;  1J5E O;  4YJ2 A;  2Y4U A;  4MW8 A;  4EFB A;  2YXY A;  1GK9 A;  1XRE A;  2Z5U A;  3LDC A;  4LF4 B;  1ENV A;  3DSQ A;  3ZJZ A;  1M4U A;  2DYR C;  3G67 A;  3OGC C;  3CWB H;  1AJQ A;  2E5L O;  4J80 A;  1IXB A;  4DR1 O;  4GX2 A;  3AG4 B;  1FJG O;  3ASN B;  1VF6 A;  3ASN C;  2HLD G;  3OFN G;  5K1P A;  4NXN B;  4DV6 B;  2GTA A;  2WLK A;  2QA4 V;  1ZX3 A;  3CHX A;  4LFB O;  2CGO A;  3BY6 A;  3R66 A;  2R9I A;  3CRC A;  2N74 A;  1IVS A;  1PL4 A;  3AK3 A;  1SZT A;  4DR7 O;  3HKD A;  3CME V;  3K5M A;  2QKC A;  3BCC H;  2GV9 A;  2IH1 C;  3P3N A;  4DYL A;  1O9G A;  2UU9 B;  2RDC A;  2UUA B;  1G4Y B;  2ARH A;  4YIO A;  3RYI B;  4HZ3 A;  2DN9 A;  4ZOL A;  1CPY A;  3QO8 A;  4LF5 O;  1HNW O;  4A5U B;  2X6C A;  3JD0 A;  3CCU V;  3FX7 A;  3N2K B;  4DR6 B;  2VWJ A;  3D8C A;  3AG1 C;  3IC9 A;  4I55 A;  4MW3 A;  2DJV A;  2WA4 A;  3I55 V;  2EIJ B;  4BR6 A;  2E75 B;  1ZUQ A;  2QM8 A;  1US6 A;  1KQS U;  2B9Z A;  2ZR3 A;  5B1N A;  2ILM A;  1BZK A;  4DV0 B;  1FAF A;  4WFE A;  4DV4 B;  1D2D A;  3B4S A;  4CC5 A;  4UCT A;  3JAK B;  2P22 C;  4X88 A;  4DV7 O;  2EX3 A;  1NH2 B;  1XI1 A;  1VAR A;  2ODM A;  3LNN A;  2EZP A;  1JA8 A;  3QVN A;  4JYA O;  4R6Z A;  4LF8 O;  4JI0 B;  3T4Z A;  1K34 A;  2F66 C;  2R9R B;  4IL6 Z;  3L72 H;  1EZV H;  4FVM A;  3BEH A;  1MSD A;  2ZKO A;  2R72 A;  1D5A A;  2AHY A;  3A0H Z;  2EIL C;  5EBM C;  2ATK C;  3E22 B;  2QWN B;  3Q4H B;  4IIJ B;  5LL6 Y;  3T2M A;  1V55 C;  2HFE C;  3ASO B;  2YSU B;  5LMU O;  4X1I B;  4G27 B;  4JZ2 A;  4MVO A;  3ABL B;  4LH7 A;  3N2G A;  1AI7 A;  3AG2 C;  1WP8 A;  1R3I C;  2VRZ A;  1VQ6 V;  1MG1 A;  1BQZ A;  2Y48 A;  5E1A C;  4DXW A;  3QO7 A;  1VQP V;  2AHZ A;  4DR2 O;  3IAY A;  2A79 B;  3GWO A;  5E79 Z;  3X2Q B;  3UT5 A;  3CRA A;  4R50 A;  4X62 B;  2LFR A;  3D3I A;  5C8Y A;  1BL8 A;  3DTU B;  4O4J B;  2LW7 A;  2CTR A;  2XAS A;  2WLI A;  4FLZ A;  5K1X A;  3BHP A;  4IT5 A;  4B08 A;  1QVF U;  2RJZ A;  2F43 G;  2Y0P A;  4DR4 B;  5IY5 C;  1FXV A;  1FFT B;  4I4T A;  1IBL O;  4MVS A;  5GW7 A;  3KZI Z;  3H1J H;  1G6U A;  1PV0 A;  4JTC B;  2LGQ A;  1EZJ A;  1M57 B;  5IJ0 B;  5CA0 A;  1UJW B;  3APQ A;  5CA0 B;  3VQY A;  1N33 B;  2C2A A;  2UXX A;  3KCY A;  3E35 A;  4X20 B;  1UPG A;  3ETE A;  3RVZ A;  3CXH F;  4BIO A;  4YY3 O;  2IJH A;  1ZSP A;  3K59 A;  5B1A C;  3ZHQ A;  2JK5 C;  1E79 G;  3CCR V;  3U10 A;  2XND G;  3CCS V;  2QKS A;  1BHB A;  1MZF A;  3K5L A;  1XMQ B;  3K03 A;  5H2F Z;  4PD4 F;  4R7C A;  4B3M B;  5B1B C;  1SF9 A;  1U96 A;  3WG7 C;  1B3Q A;  2ZE6 A;  2IW5 A;  2OCC C;  2CTP A;  3OD4 A;  3FD9 A;  2Q6A A;  3K3W A;  1UFI A;  2RMK B;  3CS5 A;  5IWA O;  1EM1 A;  4TQF A;  3D36 C;  5LA6 A;  4DV2 B;  4O4I B;  1SES A;  2BSK A;  4B3R O;  5JH7 A;  4DK0 A;  4IYI A;  1JX9 A;  4EFE A;  3SYC A;  4J7K A;  1AB3 A;  1VP7 A;  1JJO A;  4NTY A;  3JAL A;  4EB6 B;  3RVY A;  4HAM A;  5B1O A;  2IJK A;  4LC1 A;  2E3C A;  2QM7 A;  3ZHS A;  3QF7 A;  1KD1 W;  2JEX A;  1I94 B;  2RCV A;  2EJ7 A;  1N0J A;  4UVA A;  4X66 O;  2EZO A;  2D3O W;  4FPP A;  1VEW A;  1Z5V A;  2HJD A;  1V55 B;  3ABL C;  3W7S A;  2X6A A;  3HKC B;  5LMN B;  4CS2 A;  4DV3 B;  1U97 A;  1H2S B;  1P7B A;  3HKB B;  3OMN B;  4O4L A;  1IDS A;  2DYR B;  5LYJ B;  2YIB A;  3DC6 A;  4MVU A;  2DQ0 A;  4OPA A;  2BOC C;  2HEP A;  5H6Q A;  3ZRW B;  4LR3 A;  2ITD C;  1P4R A;  1VQM V;  3K0G A;  3I56 V;  1O9H A;  4LWS A;  5IJ0 A;  1Q6H A;  1IBM O;  2P06 A;  1K92 A;  1SZX A;  4KP4 A;  5B66 Z;  4XDK A;  4JI4 O;  2CAZ C;  1FYJ A;  1IBK B;  1YDX A;  3OAA G;  3CCQ V;  1MOF A;  2B1I A;  1V9P A;  1OCR C;  4OXS A;  3ZED A;  1XEQ A;  5LGU A;  1IBK O;  1GH6 A;  5EYP A;  1N32 B;  1XNQ O;  5LHH A;  1KEC A;  4GKK O;  4K8X A;  1Z5W A;  1GN6 A;  4O4J A;  2QKA A;  5HFL A;  5FLX N;  5GON B;  3OGI B;  5HFM A;  1ZL8 A;  1KP2 A;  2F4V B;  3WFV A;  2F95 B;  4UB8 Z;  2R9A A;  1Q82 W;  2ADQ B;  1Y6X A;  4RQF A;  4PI2 A;  4FLX A;  3CCV V;  5LMN O;  4JI7 B;  1JOY A;  1TVK A;  2V4D A;  4DV5 O;  1QLE B;  2BE3 A;  5KHG A;  2LP7 A;  2BSK B;  4X8A A;  1MAB G;  1VF7 A;  1AR1 B;  5L3C A;  1YIT V;  5BXZ A;  4UCR A;  5JCO C;  3W7W A;  4WFG A;  4FM0 A;  1FJG B;  1HW7 A;  3PN1 A;  4WCE V;  4RWU A;  5KMG A;  2UXC B;  4X9Q A;  1M9N A;  1LR1 A;  4DR5 B;  4L8J A;  3D36 A;  4TT3 G;  1GTO A;  3SYQ A;  1MMM A;  1TUB B;  1VQ5 V;  2OIG A;  2DWD C;  4MTX A;  4JAS A;  4DRX B;  2ZNJ A;  3RYH A;  4DV5 B;  1PNM A;  4LNU B;  1SQG A;  4FMT A;  1K73 W;  2WWW A;  3ASO C;  1NTM H;  2QGN A;  4N23 A;  1QR8 A;  1XL4 A;  4K3A A;  4FFK A;  2ZNI A;  2YDE A;  1OCC B;  5H9C A;  4J41 A;  4JI6 B;  1BHA A;  4HBN A;  2OCC B;  4GX1 A;  4B3S B;  2DOS A;  1SC5 B;  1Q86 W;  4Z1M G;  3GB7 C;  2O57 A;  2Q69 A;  4FM2 A;  4MSW C;  2ZE5 A;  5KUK A;  4GKK B;  4R8C A;  2JGD B;  2DYS C;  4FLY A;  1KUQ A;  1OCO C;  1FFX A;  5H5N A;  3SPG A;  3K04 A;  3ZRV A;  4FLW A;  3OUF A;  2RNB A;  2LQT A;  2XAH A;  5JJJ B;  1V54 C;  3DXR B;  1GKF A;  1XQ8 A;  1K97 A;  1H2N A;  2ZIM A;  2AXT Z;  5LGN A;  4F6R B;  4CH3 A;  2A0L A;  3CJH B;  2P67 A;  3CJH A;  3T1H B;  4PJ0 Z;  3B2E E;  2LFS A;  4FLV A;  4LF9 B;  4JI4 B;  2FTK A;  1IBM B;  2EBO A;  5D5Q A;  3BA9 A;  4UXN A;  3Q4H A;  4IIJ A;  4UCV A;  5C8Y B;  4DV2 O;  1WJZ A;  4FZ1 A;  3UM7 A;  2VS0 A;  4I0X A;  4B7K A;  5KAF Z;  2P6J A;  4TWK A;  5EC2 C;  1D5N A;  3H01 A;  1OZ0 A;  1E1R G;  3FB8 C;  3OTF A;  4JI8 B;  5KA6 A;  3K58 A;  2XT9 A;  3MHH C;  3WB0 A;  3CRR A;  1FXK C;  1IUR A;  2LGW A;  4Q6G A;  1QVG U;  2YIC A;  3T1Y B;  5B3S C;  1YVW A;  4QNH B;  4PV1 B;  1VMG A;  1XHZ A;  1PP9 H;  4WF9 V;  3K5N A;  1RP3 B;  2EIK B;  3NXS A;  1I94 O;  2EIM B;  2EIM C;  3ICX A;  3H1L H;  4WFH A;  3K79 A;  4JYC A;  2LW1 A;  2AZ0 A;  3SJQ C;  3LDE A;  5B1A B;  3UQ8 A;  2RQ6 A;  2UUC O;  3RN4 A;  1N36 B;  3ZBH A;  2VQF O;  1N33 O;  3MHS C;  2WLH A;  3ML0 A;  4GX5 A;  1QLE C;  3U0Z A;  4ZI7 A;  2H8P C;  5J2U B;  4JGS A;  4CC6 A;  5JCO A;  3T1Y O;  5BZB A;  2ZXW C;  5J2T A;  3JAW B;  1YJW V;  4NR1 A;  3K9S A;  3FFQ A;  3LDD A;  3OEE G;  3SYA A;  1JMK C;  1XHX A;  4LF8 B;  2AGA A;  1KB9 F;  5CB4 A;  2Q0A A;  1JFF B;  4X1Y B;  5CBG A;  3IFX A;  2YEV A;  1G8M A;  2CDY A;  2NN4 A;  2PYJ A;  4TUY B;  3E8H A;  1K5S A;  4O2A A;  5CA3 A;  2ZCE A;  4IYH A;  4DV0 O;  3RBZ A;  4EB6 A;  1ARO P;  2A7W A;  4RAI A;  4ZIB A;  1SA0 B;  4PA4 A;  4HNA B;  1SA0 A;  3E8B A;  3E8F A;  4PDV A;  1BT8 A;  5EBL C;  4GYC B;  1FXH A;  2CTW A;  1Y76 A;  4NXM O;  4QE9 A;  4B7E A;  4W4K A;  1QCE A;  3W7X A;  3K9A A;  4DR6 O;  1A32 A;  3E86 A;  1OHH G;  4CS4 A;  4UCS A;  1I5Y A;  2BTO A;  4DR4 O;  1F4M A;  1WP7 A;  3ABM B;  4JYA B;  3HKB A;  3OW2 U;  1NU1 H;  2D2C B;  3JAL B;  1VQ7 V;  4CH4 A;  3QG5 A;  3SPH A;  3G4S V;  3TXQ A;  5DEC A;  4GUN A;  1Q6U A;  1YJN V;  4YIP A;  1AJP A;  2DYS B;  1MZE A;  1SET A;  2CK3 G;  5IJ9 B;  2NR5 A;  1N32 O;  2Q7H A;  4LF9 O;  4LFB B;  3E22 A;  3T1C A;  5BMV A;  3T1H O;  2QDO A;  4O2B B;  1KP3 A;  3CC2 V;  4LH6 A;  4OX9 B;  1MSW D;  1DLB A;  5IT9 N;  3STZ C;  1OCR B;  5KAI Z;  3WB2 A;  4UV8 A;  1FXK A;  2EUL A;  5LOV A;  1K3E A;  4P30 A;  3IGA C;  1WPX A;  3SJC C;  4P9P A;  1L1F A;  4JAA A;  3MDS A;  3H1H H;  4Z2W A;  1NTK H;  4JI3 B;  5EYP B;  4K8Z A;  2QM4 A;  3EVK A;  2JVD A;  3SJA C;  5LP6 B;  4JI6 O;  2KG7 B;  3VBB A;  3ABT A;  3CRQ A;  4NYK A;  4AI8 A;  2WLJ A;  1KC8 W;  2ZXW B;  4MT8 A;  1Q7Y W;  2UUB O;  2GHY A;  2ZIN A;  2K9P A;  3DXR A;  2AZ2 A;  1Z2G A;  4QE7 A;  2Y69 C;  4I7Z B;  1HWY A;  4JI3 O;  2XAQ A;  4QGP A;  2ZD9 A;  3QNE A;  1L8D A;  1WN7 A;  3CE2 A;  5A9G A;  3J81 N;  1IXM A;  5EK0 A;  4UVC A;  4DV4 O;  1XNQ B;  2P4K A;  5IYD O;  3JAT B;  1IZ3 A;  5J2T B;  1QNM A;  2W0X A;  3JD4 A;  1GRJ A;  1M56 B;  1YSC A;  2JJ2 G;  2XAF A;  4JZG A;  1GAX A;  4J7Z A;  1J5E B;  3B09 A;  3CB2 A;  3RYH B;  3HR0 A;  3OEH G;  1R1B A;  4JI7 O;  3ZS8 C;  5B5E Z;  2Q73 A;  4BW5 A;  1NVP B;  1YTF D;  1FS0 G;  1YI2 V;  1H8H G;  2CE4 A;  3P30 A;  3RFR A;  3M8A A;  1WB8 A;  4YJ3 A;  4JI5 O;  3LSU A;  5J9P C;  1AR4 A;  2ZDI A;  5KHI A;  3SYO A;  2F4V O;  4DR3 B;  1R6T A;  3JAW A;  4FLU A;  1I08 A;  4P2Z A;  4DV3 O;  2KKW A;  5GTI Z;  4J11 A;  3THO A;  2DWE C;  4B3M O;  2WLL A;  3ZRS A;  2WLL B;  5LBQ A;  2G38 A;  4DO2 A;  1Q43 A;  1QR9 A;  3MD0 A;  4NXM B;  1TVK B;  3C3T A;  5EZY A;  3RYF B;  3J7A U;  3CRM A;  1XMQ O;  4DV6 O;  4X66 B;  4DRX A;  1XUQ A;  2OWO A;  4D7T A;  1AR5 A;  1M1K W;  4MS2 A;  1QQC A;  3BAA A;  3IC7 A;  4I0X B;  1SS3 A;  2YUA A;  4H13 B;  4NB5 A;  3H1I H;  1T5E A;  2EIN B;  4MVZ A;  4PI0 A;  4U3J B;  1KBH A;  3R65 A;  2JGU A;  3C3S A;  3CCL V;  3RYF A;  1NKD A;  2P5O A;  2FKX A;  1W0J G;  5TIS Z;  4F6R A;  2K1E A;  4LF7 O;  3UO3 A;  3CEI A;  5ITZ B;  2P90 A;  1ZAU A;  3UO2 A;  2PZS A;  3ZMU A;  4G2K A;  4BW9 A;  3CYO A;  1BGY H;  4X1K B;  4P9O A;  1BCC H;  2YIB D;  3AK2 A;  4X62 O;  1ORQ C;  1FPO A;  2VQF B;  1N36 O;  2UUC B;  2UXB O;  4MTG A;  5JVD A;  4ZHQ B;  1M90 W;  4RO2 A;  1R6N A;  2NLJ C;  2XOK G;  4NTX A;  4YHH B;  4PDL A;  1GM7 A;  4K35 A;  5JVD B;  3TCU A;  3HKC A;  1P49 A;  2JS5 A;  1F7Y A;  4B3R B;  3BVO A;  4PA6 A;  1PL0 A;  2IU3 A;  4RQE A;  3BA8 A;  4X1K A;  5BR8 B;  1G1X B;  2X6B A;  5JJE B;  2X0L A;  1DK1 A;  1JVM A;  1Y67 A;  3ZMT A;  3FB5 C;  5BMV B;  5L3F A;  4JI8 O;  3UKM A;  3RT3 C;  3AG3 C;  5EBW C;  2WLN A;  2P4V A;  5KMG B;  1I7F A;  3ZHU A;  4BIZ A;  3CCM V;  2N05 A;  4DV7 B;  1XNR O;  1VQN V;  4KL1 A;  4J9Z B;  2V7Q G;  4HYO A;  2N04 A;  4JYY A;  3OT7 A;  3MAQ A;  4LNU A;  1RM1 B;  3STL C;  1QHT A;  1GM8 A;  5JQG A;  1SQB H;  1ZLZ A;  2W0F C;  1Y66 A;  4LFA O;  3SDL A;  1NH2 D;  2ZDI C;  1H8E G;  1R6K A;  2EIK C;  4DR2 B;  5A2Q N;  2M6Y A;  3OUS A;  1YTF B;  4LFC O;  2ETN A;  3AG3 B;  4JV5 B;  1WB7 A;  3A0B Z;  1OCC C;  1OCZ B;  3P32 A;  3FB6 C;  3ZMZ A;  4PA3 A;  1YF2 A;  3FB7 C;  3M99 B;  4D6T H;  2VQE O;  2H3O A;  1AP6 A;  2PTM A;  1YJ9 V;  2MW2 B;  1RPO A;  4GLX A;  4X65 O;  1H2L A;  2YC0 A;  3SPI A;  4EEQ A;  2UU9 O;  4ICG A;  1NR7 A;  2QWO B;  2ZM6 O;  5DN6 G;  1XBL A;  4JTD B;  2YI9 A;  4LCU C;  3ABK C;  4MTO A;  1YCI A;  3ZX6 A;  1H2M A;  5KUM A;  2H94 A;  2E74 B;  1JFF A;  2HP8 A;  4X1Y A;  4CS3 A;  4JAV A;  5C93 A;  1SQV H;  5FNV B;  1L0N H;  1KKD A;  1K4C C;  5KHK A;  4DR5 O;  4KHP O;  1BS3 A;  2UXC O;  5L3G A;  5LP6 A;  1HNZ B;  2E5L B;  2PI4 A;  1OJH A;  3AG2 B;  1NBM G;  2WLI B;  3BAB A;  4ZBM A;  4H33 A;  3CXC U;  4B3T B;  2A9H A;  4D7S A;  2HHH O;  5LMU B;  1B6Q A;  1EFR G;  5DED A;  2Z3Y A;  1HNX B;  2ZE7 A;  2EJR A;  1DGS A;  3SYP A;  1HNW B;  1VQK V;  3ZRW A;  3P3P A;  4LF5 B;  1LUW A;  2YID A;  2PGG A;  2W6I G;  2UUA O;  3K08 A;  2Q68 A;  4DUY O;  1N34 O;  4DR7 B;  4XDL A;  4GCZ A;  2HKO A;  1R3J C;  1ZTE A;  2A3Q A;  4O4H A;  3CCE V;  1RM1 C;  4U7N A;  3JD3 A;  3X2Q C;  1YZB A;  3AG4 C;  1RPR A;  4DK1 A;  3APO A;  5KX5 A;  4NXN O;  3L75 H;  1S0V A;  4DV1 O;  2HR3 A;  3U11 A;  1FKA O;  1XOU A;  3UT5 B;  2VWK A;  4KXR A;  3SPJ A;  4DR1 B;  2IH3 C;  2ZT9 B;  3RW0 A;  3EFF K;  5GON A;  3K0D A;  3JD2 A;  3G6E V;  2OTL V;  1TGO A;  4JAU A;  2M7W A;  1Q3E A;  3FAV A;  3B77 A;  4OPH A;  1Q8I A;  2KB1 A;  1KU9 A;  3VQV A;  3L71 H;  3GWK C;  4O4I A;  4PDM A;  2WA3 A;  4K0K B;  4WBN B;  3ZHV A;  2Q4P A;  5LHG A;  3ZIA G;  1JJ2 U;  4OGQ B;  2GDS A;  3JAR B;  1MA1 A;  3O65 A;  3JAT A;  4PA9 A;  4DV1 B;  4O2A B;  4J9Y B;  2XHB A;  4DUZ O;  4I55 B;  1VQO V;  4YJ3 B;  1GM9 A;  3N2K A;  2IJJ A;  1Q6I A;  2LJ2 A;  5CA1 B;  5IYZ A;  2EIJ C;  3IJ4 A;  3ABK B;  5IYZ B;  4CH6 A;  2W6J G;  3KKY A;  3L70 H;  2YI8 A;  4ZOL B;  2IJI A;  2E76 B;  4TOI A;  1Y76 B;  1EN5 A;  2Y4T A;  1JR9 A;  2NNU A;  3RYC A;  5L3E A;  1N0N A;  1Q90 D;  3RYI A;  2B5U A;  1LNQ A;  2V1D A;  1B06 A;  1XL6 A;  5FPR A;  2JS3 A;  1YEW A;  4JPR A;  3ABM C;  2GBO A;  2MK3 A;  3F5T A;  2IM9 A;  4GKJ B;  3QTC A;  1AI5 A;  2R70 A;  2OTJ V;  2EIL B;  2JGD A;  3H9V A;  1M93 A;  3DGE A;  1HNZ O;  2CH7 A;  1S5J A;  5IWA B;  4KHP B;  1Y4M A;  4YXW G;  5LP6 C;  3B8M A;  2PF4 E;  5EZY B;  3N2G B;  4X64 B;  1AVM A;  4AQY B;  3K5O A;  1WNS A;  2ZE8 A;  5JH7 B;  3LUT B;  4X1I A;  1YHQ V;  4DW0 A;  1EBO A;  4UV9 A;  2GSM B;  4BWA A; 
#chains in the Genus database with same CATH homology
 4X65 O;  4OPA A;  4X62 O;  2UU9 O;  4LF6 O;  1I94 O;  4OPH A;  4YY3 O;  4LF4 O;  1N36 O;  1R1B A;  4JI0 O;  2UXB O;  4JI7 O;  4DV7 O;  5BY1 A;  1J5E O;  2ZM6 O;  2JRI A;  4JYA O;  4LF8 O;  2UUC O;  2VQF O;  1IBM O;  2Z0A A;  3M8A A;  1N33 O;  4JI5 O;  4JI4 O;  2ZKO A;  3OTO O;  1N32 O;  4LF9 O;  1NS1 A;  1F7Y A;  2UXD O;  1FYJ A;  2F4V O;  3O65 A;  2E5L O;  3T1H O;  2DOS A;  4DR1 O;  5LL6 Y;  1R6T A;  1HNX O;  4DUZ O;  1X59 A;  4DV3 O;  1FJG O;  1G1X B;  5IT9 N;  3J80 N;  4DR5 O;  5LMU O;  5BR8 O;  4KHP O;  2UXC O;  4B3T O;  4B3M O;  1XEQ A;  3T1Y O;  1KUQ A;  1DK1 A;  1IBK O;  4LFB O;  5H5N A;  1XNQ O;  3R66 A;  3J7A U;  5IWA O;  1XMQ O;  4K0K O;  2N74 A;  4DV6 O;  4GKK O;  4JI8 O;  2HHH O;  3RT3 C;  2AGA A;  5FLX N;  4DR7 O;  4DR2 O;  1XNR O;  4JI6 O;  4B3R O;  1AIL A;  4GKJ O;  2UUB O;  1AB3 A;  1HR0 O;  3F5T A;  2UUA O;  4LF5 O;  1HNW O;  4A5U B;  5LMN O;  2LW7 A;  4DV0 O;  4DV2 O;  4JI2 O;  3JAM N;  4JI1 O;  2FKX A;  4X64 O;  4LFA O;  3SDL A;  4JI3 O;  4DV5 O;  4DUY O;  1N34 O;  5A2Q N;  4LFC O;  2DJV A;  3J81 N;  1HNZ O;  4X66 O;  4LF7 O;  5BXZ A;  4DV4 O;  4JV5 O;  1IBL O;  4NXM O;  4OX9 O;  1YZB A;  4AQY O;  4NXN O;  2VQE O;  4DR6 O;  4DV1 O;  4DR3 O;  4B3S O;  1A32 A;  1FKA O;  4DR4 O;  1D2D A;  1XMO O;  4YHH O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...