1R1BA

Eprs second repeated element, nmr, minimized average structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
b'MVYDKIAAQGEVVRKLKAEKAPKAKVTEAVECLLSLKAEYKEKTGKEYVPGLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA SYNTHETASE
publication title A recurrent RNA-binding domain is appended to eukaryotic aminoacyl-tRNA synthetases.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Ligase
total genus 16
structure length 56
sequence length 56
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 1998-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1r1bA00
4KHPO 1N34O 4X66O 1XMOO 2UUCO 4DR5O 4JV5O 4GKJO 4YY3O 1N33O 2Z0AA 4LF5O 1XEQA 1N36O 4LFAO 1KUQA 2UUAO 4OPAA 1I94O 2E5LO 4DV4O 3RT3C 4LFBO 2JRIA 1XNRO 4JI8O 4DR6O 1NS1A 4A5UB 1XNQO 4OX9O 2HHHO 5LL6Y 4YHHO 1F7YA 4DR4O 3T1HO 1HNXO 4B3MO 1DK1A 1HNWO 3F5TA 4DV1O 4K0KO 1FYJA 4X65O 3M8AA 4AQYO 4B3SO 4LF7O 1R6TA 4JI1O 4DR2O 2DJVA 5BXZA 5BR8O 2LW7A 4LF9O 4JI4O 4X64O 4JI7O 1FKAO 5IWAO 1IBMO 1IBKO 4DV7O 1A32A 4LFCO 4NXMO 2VQEO 2ZKOA 2UUBO 4OPHA 1AILA 4DV5O 1YZBA 3T1YO 2N74A 3R66A 1XMQO 4DUYO 3J80N 4NXNO 4B3TO 4DR1O 4DV3O 1HNZO 2AGAA 5A2QN 4LF4O 4JI2O 4JI6O 4DUZO 1FJGO 4JYAO 5H5NA 4GKKO 1J5EO 3J81N 2ZM6O 3JAMN 3O65A 4JI0O 3J7AU 4X62O 5IT9N 4LF6O 1X59A 1G1XB 2DOSA 1IBLO 2UXBO 2UU9O 4LF8O 4B3RO 1N32O 2UXCO 4DV6O 1R1BA 5FLXN 4DV2O 3OTOO 2FKXA 5BY1A 3SDLA 2F4VO 4DV0O 4DR7O 2UXDO 1D2DA 4JI5O 5LMUO 1AB3A 5LMNO 4JI3O 4DR3O 2VQFO 1HR0O
chains in the Genus database with same CATH superfamily
1QU7A 1QLEB 2QA4V 2WLJA 1N8RW 3UO2A 2Z0AA 1FFTB 3SPCA 1IZ3A 5LOVA 4TOIA 3ABLC 3P3NA 1VIBA 1I94O 2UXCB 1I08A 3RT3C 3AG1C 3CRMA 4U3JA 2F4VB 1BS3A 3K9SA 1QQCA 3NXSA 2ZXWB 5LGTA 3HKDA 1ZUQA 4LF7O 3ZHSA 1DGSA 1PD3A 3S3WA 1IBKO 2W6IG 1QLEC 4OXSA 2ZKOA 4YJ3A 5KHGA 2B1GA 2UUAB 4JAAA 1BHBA 3ZRWB 2YIBA 4MTOA 4IGGA 2WLKA 4BR6A 1XNRB 5IE9A 4FM0A 3CX5F 1YJ9V 2CE4A 2HHHB 2LP7A 4ZI7B 1TUBA 4LR3A 5A2QN 3ZS8C 1RPRA 4DRXB 2EZOA 5H5NA 1J5EO 4LWSB 2VWKA 2YUAA 1SERA 2DMXA 2DW4A 5EIBC 2WA4A 4JI7B 4UCTA 1K3EA 4O2BB 4GT1A 1GM9A 2FL4A 4I7ZB 4EEQA 3H01A 3E8HA 1RFYA 3E35A 4QE9A 3ETEA 5EBWC 3K5LA 3JAKB 1FJGB 3DC5A 4I55A 3K5MA 5LMUO 2QTSA 3ETQA 4CS4A 2OTJV 1S5LZ 3MD0A 3RBZA 2IH3C 1HR0O 2FYUH 2EBOA 2UUCO 3QO8A 3F7YC 4LNUB 1M5IA 3K0GA 4DO2A 4O4IB 1XHXA 5JCOC 4LF5O 4Q6GA 1E1RG 1DLBA 3CCEV 3QO5A 4YIPA 5CN0A 2ZE6A 4BIOA 4FLTA 2QKCA 1OCOC 1JJ2U 4DV2B 5IJ9A 1XNQO 2OCHA 4DW1A 1V55B 3SJCC 2KQXA 2QR4A 2HG5C 3GWKC 3LSUA 1TA8A 2W6JG 1XMOB 5L3BA 1DF5A 3ETDA 5C8YB 1ZWIC 2B9ZA 4JZ2A 4ZIBA 2JJ2G 5IWAO 5CBFA 3E86A 4NXMO 1N36B 4ZOLA 1BGYH 2WLHA 5CB4A 1K9MW 4JGSA 1K8AW 1KYOF 2ZINA 2HJDA 4FZ1A 5JWPA 2Y69B 1Q6HA 3D3QA 3ZHQA 1SKVA 5GONA 2A7WA 1FXVA 5KUKA 2ZE7A 1AR1B 1AI4A 3CE2A 4GUNA 2ZIOA 5KHHA 4JF3A 2YIBD 4HNAB 1G4YB 3D36A 3SYQA 3T1YB 3CC4V 3U10A 1XMQB 4DV6O 1Y74A 4ZI7A 2E76B 4MTFA 3RWRD 4H37A 5JJJB 1TUEB 2D2CB 2YEVA 4JYAB 2ITDC 4H33A 2JEXA 5FNVB 2LGWA 2Q4PA 1N34O 1WP8A 2XUMA 1SQVH 4O4JB 2R70A 1TVKB 1IVSA 3ASOC 3B09A 1YEWA 3E89A 3H9VA 4KUMA 1VQ8V 3OUFA 4F4LA 2IU0A 2R9AA 1FS0G 3AG4B 5CMUA 3THOA 1K7DA 2GTAA 5IYCO 1VQKV 1SQFA 1L0NH 2K9PA 1NS1A 5B5EZ 1OCCB 4X1KA 4J41A 4O2AB 1FXKC 4DR7B 3WB1A 2QM7A 5IJ0A 2NR5A 2IJHA 1QVFU 4B3MO 2QWQB 1KKDA 5LP6C 3KKYA 2LQTA 1VQNV 3ZHTA 4YY3B 2WLNA 2YDEA 4ICGA 3ZN1A 3JSLA 3JCUZ 5JQGA 1OJHA 4X8AA 2PF4E 4U7OA 4LFBB 2WLIA 4DUYO 5B1OA 1MZFA 4DR1O 4DV3O 3AK2A 4I4TA 1NH2B 3DC6A 1K33A 4I50B 4CS3A 5KHKA 5HFMA 5DM6V 4JI4B 1O9HA 1M56B 2Y4UA 3HPLC 4K8ZA 1V9PA 1UFIA 3VQYA 1JOYA 2H8PC 4JAUA 4H0LB 1E1QG 4TSFG 4RUEA 4BW9A 2UU9O 5B3SB 2CH7A 1AJQA 1SQXH 1M1KW 1VQ7V 1NTMH 3OTOO 3CCSV 1GN2A 2BOBC 3BA8A 2WSSG 3CWBH 1SS3A 5KA6A 2R9IA 1TAEA 3HKBB 3Q4HA 2L6LA 3W7SA 3ZMZA 5KHIA 1VQ5V 2EX3A 2A0LA 1EM1A 4X62B 4HNAA 5FL7G 2IU3A 4LF6B 2PI5A 1VP7A 3ICXA 4PA4A 5KAIZ 1VF7A 4PHZA 3RN4A 3A0HZ 4JTCB 1WP7A 3SYPA 3JSNA 4FM2A 1HDJA 4TV9A 1VARA 1EFRG 2UXDB 2HFEC 3UT5A 4JI5B 4D6TH 1K73W 1HNWO 3JD2A 4X65O 1ZTEA 3ABUA 2LGQA 1JCHA 4B3SO 4BWAA 1K4CC 5BR8O 4GKJB 3UM7A 3VQWA 4MVQA 2BTOA 1WLEA 3WG7B 1H2GA 4MT8A 4OPHA 5H6QA 4I0XA 3HKCA 1NVPD 5D5QA 2QGNA 4CBCA 4OX9B 1EBOA 4F6RA 1QR9A 1VQPV 1JVMA 4IIJA 3FD9A 2CTPA 2YICA 3ZMSA 2AXTZ 3VQXA 1COWG 2AHYA 4B7KA 3FB8C 4UVCA 4EFEA 2DWDC 1JPXA 3SJBC 2QJ1A 3CJHB 4DV7B 5CA0B 1XDCA 3CXCU 4DV5B 4GLXA 1YCIA 4CH3A 3IAYA 5JH7A 5KX5A 4DXWA 2FKXA 4PDMA 2CTWA 4FFBA 4PDRA 3CCMV 2GV9A 4HBNA 4I5SA 3BVOA 1QCEA 4JI3O 4DR3O 3FYIB 3G4SV 4EFBA 2YXLA 2CK3G 1VF6A 1XUQA 4MVMA 3VBBA 1XL4A 4JI0B 1MMMA 4RO2A 1YTFB 3LNMB 1SZTA 2ODMA 5LOVB 1P49A 1Z5VA 4HAMA 4UB6Z 4D7SA 1BT8A 2F95B 1R3JC 3CRQA 1F4NA 2OT5A 5CBHA 2UXBB 2ZCEA 1URFA 3MHSC 3QO7A 2Y4TA 3OAAG 1SQQH 3EHBB 4YHHO 2Q5ZA 1EN4A 3HKDB 1U96A 1T5EA 4FIPC 5D5PA 4MVZA 4LC1A 3G6BA 5B1AC 4JYYA 2YSUB 2DYSB 4LF9O 4J7KA 5EBMC 4YJ3B 3TXSA 1IBMO 1AR4A 3SJQC 3CRRA 3RGBA 4PA3A 2VQEO 1H2NA 4LFAB 2MW2B 1EZJA 5LHHA 1QBZA 3ZN0A 4JASA 3H1HH 2AZ2A 1TUBB 3LSSA 1LNQA 1R3KC 1ORQC 2VWJA 2WLMA 3KZIZ 1YJNV 4LF4O 4J42A 3CYOA 3QVNA 3ZMTA 3RYCA 4JI1B 3K03A 3RYHA 2VS0A 4W4KA 1LUVA 3K9AA 1BQ0A 2HJFC 5H9CA 2LFRA 2DYSC 5BZBA 4BIUA 4O4LA 4E4EA 1XI1A 1VF5B 2JGUA 4P9PA 4B3RO 3AEIA 2EJRA 4PD4F 2F23A 4AI8A 3CSXA 1X4TA 3A0BZ 1WN7A 1JMKC 4B3TB 4NTXA 4DV0O 4P9OA 3X2QC 1F4MA 4I55B 4JI2B 4Q20A 4DUZB 4K35A 2XAJA 4W4LA 4JTAB 2EIMC 4PJ0Z 2ZM6B 3FB7C 3I56V 3CPWU 2B5UA 5IY5B 4PI2A 2OCCC 3EVKA 2CDYA 1IBLB 3ZHRA 3ZJZA 5IJ9B 1SETA 4JI6B 4PI0A 1TGOA 1Y66A 2GTSA 3B4SA 4QE7A 3U11A 5LXTA 2Q0AA 1NH2D 3SYCA 2Y48A 1BZKA 3RYIA 4UXNA 4EB6A 4LBEC 5L3GA 2YI8A 1L8DA 3B8MA 1HNXO 1DK1A 4DV1O 4K0KO 5GTHZ 3G71V 4UV8A 2Q73A 4Z1MG 2XAHA 4WFHA 2BCCH 1SESA 3L71H 4IYHA 4ZOLB 2MK3A 3B2EE 1QNMA 3ZIAG 2UUBO 5CB4B 4X1IA 1AILA 4F6EA 2E5LB 2GBOA 4ZBMA 3T4DA 1S5HC 2KG7A 1Q5OA 2QM4A 1XQ8A 5E1AC 5GTIZ 3EFFK 5GONB 2RQ6A 3O65A 2EIJB 3IJ4A 3L72H 2QWRB 4GX2A 4LFCB 5BMVA 1EN5A 1NR1A 3J7AU 3TJTA 3C3TA 2N04A 2R9RB 2ZT9B 1Y74B 4LF8O 5L3DA 1HW7A 3A0RA 4NXNB 2QTOA 2KSDA 2DQ3A 1VMGA 1P84F 2E75B 2ZR2A 4B7EA 1KP3A 2YEVB 2ZXWC 4TV8A 4RQFA 1I7FA 4J11A 1XOUA 2BTQA 4CH5A 1D5AA 2ATKC 2H94A 4KHPO 4XDKA 1M93A 4OGQB 1WA8A 4TUYA 2EIJC 2QDOA 1B06A 1G6UA 2RNBA 1S72V 5LHIA 3D36C 1NVPB 4DV4O 4X1KB 1K5QA 3UCSC 2A9HA 1ZAUA 4DR6O 2IJIA 5IJ0B 3OEEG 1L0LH 3SYAA 2IM9A 3E8FA 5B1BB 2EINB 1RSOA 1SQBH 1KU9A 1NR7A 2WWWA 2DYRB 3M8AA 4AQYO 3OMNB 1R6TA 3N2GA 1Q81W 4PA9A 2GDSA 1QHTA 4N23A 4X64O 3P32A 4D7TA 1GM8A 5JQGB 1J95A 1N32B 1GAXA 2QE7G 2GSMB 3N2KA 1SRYA 1I94B 2WLIB 2N74A 4K8XA 1H8HG 2PTMA 2JEUA 4G27B 4I4TB 2PY5A 3OTFA 2X6CA 4U3FH 5H2FZ 2ITCC 1PPJH 1SQGA 4GKKO 1YTFD 4LF7B 2EINC 3HKEA 4QIWF 4WFAV 3T1CA 4NTYA 4WCEV 5JVDA 4CC6A 1IBKB 4YJ2A 1S77D 2W0XA 4J7JA 2CH7B 1SZXA 1WJZA 4NR1A 4X20A 5GW7A 4XBFA 2QEXV 4IL6Z 4KP4A 1RM1B 1JQ0A 1MG1A 2WLLB 1V55C 2RJZA 3MAQA 2KB1A 3B8NA 2EILB 2VRZA 3R65A 3K5OA 1P4RA 1R6NA 2PYLA 1D2DA 4UVBA 5B1NA 2JK5C 4E2LA 3Q4HB 1J5EB 5IYDO 1GTOA 3L9DA 1VQ4V 5EZYA 4X66O 4DR5O 1H2LA 4ASUG 3CCUV 4JV5O 3OFNG 2E3CA 1N33O 2F1MA 3P30A 2PUSA 1M9NA 5EC2C 1P7BA 2R72A 3TETA 1VQLV 3GVMA 5C93A 1Q8IA 2P4VA 4TV9B 1KKCA 2DE0X 3BABA 3UT5B 5IYZA 1YF2A 3I55V 5LMUB 1BSMA 3ASNB 3IC9A 4MVUA 4DR4O 2ZDIC 2Y69C 1NI8A 2OYQA 1HR0B 1PNLA 4DR2O 3BRCA 1HP8A 2XHBA 2UUCB 1DTOA 4IHJA 4LF5B 4NB5A 5KUMA 2QWOB 4I0XB 3JAWA 2IH1C 3OEHG 3ZHUA 5JCOA 3HKCB 1OCRB 5E79Z 2P5OA 3CD6V 1SQPH 4F6RB 1NTZH 3G6EV 3ABKB 1MOFA 1XNQB 2XASA 1AP5A 4IIJB 1JFFA 3KCYA 3ZX6A 1W2BU 1HNZO 3QTCA 4RWUA 2F66C 1N0JA 4R8CA 3RYFA 2RN9A 1N4CA 5K1XA 2ARHA 3ASNC 1NZ6A 1MZEA 4DW0A 5J9PC 1ZSPA 2XAQA 5IWAB 3AG3B 1YI2V 4NXMB 4N21A 1WB8A 2ZE8A 3AG4C 4CH6A 4QNHB 1X59A 5JH7B 4X88A 5KX5B 3AG7A 3PJSK 5KLVH 5L3CA 1MSDA 1OCCC 1NJIW 3H1LH 2ZE5A 2KKWA 4FFBB 3CMAV 3SDLA 4K3AA 3JD1A 1OZ0A 2XNDG 1BMFG 3KCXA 1FD9A 3E8GA 5LA6B 2VQFO 3DXRA 5KMGA 4LCUC 1Q6IA 2YIDA 3E8BA 4HZ3A 1FXHA 1K5SA 1Z5WA 3K0DA 1P7GA 4JYBA 1KUQA 3FX7A 1B3QA 3JARA 4DV6B 2WLLA 2FTKA 1ZX3A 1Q90D 2CAZC 1YHQV 1Q82W 1F7YA 3C3SA 1S0VA 1ZLZA 4JTDB 1VEWA 5LGNA 2Q7GA 4PELA 2ADQB 1N34B 2DN9A 1M56C 1U97A 2ZNJA 1AI6A 4J7ZA 3OW2U 1MABG 1ZL8A 2NNUA 4UCRA 1YZBA 3RVZA 5B3SC 2V7QG 3L73H 4PDLA 1S5JA 3LDDA 2A06H 2YS8A 5H6RA 3ABMB 3T4ZA 2BSKA 1KP2A 1FXKA 4B3MB 3RYCB 2AZ0A 3RYHB 1GN6A 4FJCC 2PI4A 2HEPA 1M57B 2YXYA 1KQSU 5LP6A 4DK1A 1WB7A 2JVDA 1AJNA 4O4LB 3LDEA 3K57A 5IT9N 4FZ0A 1Y67A 3BEHA 3ETGA 2PZSA 5KAFZ 1YITV 4DUYB 3JASA 3FB6C 2A79B 4X9QA 2C2AA 4NKGB 4DR1B 4DV3B 1S3JA 4J9YB 2V4DA 3TXQA 1PV0A 2X6BA 3ABMC 1Y76A 5EYPA 3K59A 4WFFA 5LMNO 4FFKA 4QGPA 3STZC 4ABMA 4WF9V 1QLNA 1RP3B 1R73A 4TQFA 1B6QA 3DGEA 3WG7C 3T2MA 1VQ9V 2XAGA 2G38A 1HWYA 4OPAA 2UU9B 1K34A 2B1IA 5LXTB 4FVMA 3OTOB 2PGGA 4JI8O 3RYIB 2PYJA 4PV1B 3RW0A 4EB6B 4PA7A 5LA6A 2HLDG 3T1HO 4X1YA 1BE3H 1MA1A 4BIZA 4RUFA 3W7TA 3CS5A 3CCRV 2P06A 1V54B 1OCZB 2Q9LA 4X1IB 1WNSA 5HFLA 4FMTA 3E2EA 3JATB 2X0LA 3R66A 4UCVA 2KG7B 5EC1C 1UJWB 1AI7A 1O9GA 4X89A 2F43G 3LDCA 2HKOA 2AHZA 1Y6XA 4Z1VA 4JI6O 4PA6A 3K5NA 1HNWB 4X65B 3CC2V 3SGIA 3B77A 4B3SB 5IDJA 5BR8B 3JAMN 3NR7A 4WFEA 3O9OA 5ITZA 2K1EA 5BMVB 5LBQA 3K06A 2HVKC 2P4KA 3FB5C 2UXCO 2EIKB 4L87A 2XTAA 5JJEB 4TV8B 2F4VO 1GN4A 1Y4MA 1GK9A 2BTQB 4Z2WA 3JYCA 3QG5A 1W0KG 1WA8B 3K58A 2QM8A 2BE3A 4TUYB 1OV9A 3JALA 1MNGA 3UQ8A 2QKSA 4WFBV 3BHPA 3DSQA 4XDLA 4P2ZA 4FLXA 2UUAO 4HYOA 1FFXA 2FMLA 2DWEC 1XNRO 2P6JA 5F2VO 2P67A 2HHHO 4KL1A 4RQEA 5LL6Y 1RSOB 2YIAA 3SPIA 2HR3A 3F5TA 3G80A 4JI3B 3N2GB 4DR3B 3BY6A 4NTWA 1I5YA 3C90A 4J80A 1GH6A 1XBLA 4JI7O 4ZHQA 4B08A 1M4UA 3N2KB 3SPGA 3U0ZA 5KHJA 4WFGA 3ABLB 4WBNA 2BOCC 3PN1A 3SJAC 2IJJA 5EK0A 1PL4A 4FK5C 3AG1B 2EZPA 1CPYA 1JX9A 4YHHB 4R7CA 2FB5A 1FJGO 1R3IC 3CEIA 1BCCH 4UCSA 5LYJA 3HKEB 3ML0A 1PM9A 3ZRVA 1CP9A 3J81N 1RPOA 3OGIB 2QSAA 4FLWA 3CCVV 4LF9B 3H1IH 3AG2B 5JVDB 5IY5C 4YJ2B 1W59A 4XDJA 1IBMB 1GRJA 3K08A 3CCQV 2VQEB 3JATA 4LH7A 3W7WA 4I9QA 4X20B 2XAFA 1N32O 5LHGA 1AI5A 4DV2O 1Q3EA 2GUZA 4J9ZB 4LF4B 3WB0A 2M7WA 1R6KA 2RDCA 5EZYB 1R3LC 1XMOO 2X7RB 2JGDA 2Q68A 1KBHA 1UPGA 3TGUH 5J2UA 1H38A 3AG2C 1N36O 1W0JG 2ZQMA 1H2MA 3L74H 1JJOA 4PDVA 4B3RB 1AR5A 2ZD9A 3JD4A 5IYZB 4DV0B 1LR1A 3S3XA 1KMIZ 1IXMA 3GB7C 3JD3A 4MVRA 1FYJA 5AG2A 3IFXA 4AILC 2DJVA 2EJ7A 3FAVA 4IHJB 5CA1A 3CXHF 3JAWB 1A32A 4JYCA 1KD1W 4UVAA 5CBGA 1JA8A 3B40A 3L70H 4C7UA 4GZRB 2ZIMA 3T1YO 4G2KA 4MVOA 3OR7C 1XMQO 1PNMA 3J80N 4MVSA 1OCOB 3K3WA 1JFFB 5A9GA 1ENVA 1QR8A 3BPZA 2RMKB 3RYFB 2NN4A 3RVYA 2OWOA 1SA0A 1HNXB 4DV1B 4JYAO 4K0KB 3CCJV 2YI9A 4G28B 3UKMA 2P22C 1THZA 4LH6A 2ILMA 2UUBB 1IXBA 1G1XB 2DOSA 3OMAB 2Q69A 2H3OA 1BL8A 3OUSA 5FLXN 3CRAA 5BY1A 4ZKIA 3L75H 5B1BC 1GO3F 4DR7O 2DYRC 3DXRB 3CB2A 5KMGB 3DTUB 3N27A 1K92A 4BW5A 3CMEV 4MW8A 4YY3O 2ADPA 1AVMA 2Q8VA 4J10A 1AROP 2Z5UA 1XEQA 1Z2GA 2N05A 4EKWA 5EBLC 3CRCA 3JARB 4LF8B 1WPXA 2L35A 1F23A 1PP9H 5L3EA 4LFBO 4GYCB 1YXBA 1XILA 2JIZG 1IX9A 2JS5A 2XOKG 4UFZA 3H1KH 1N0NA 4KHPB 2D3OW 5B66Z 4JI4O 1LUWA 3EXAA 2Y0IA 3ASOB 3D3IA 2P90A 3K79A 1ZL8B 3VQVA 2IJKA 2UXNA 4UV9A 3A2FA 4QJFB 4FPPA 4DV4B 3ZRWA 4DK0A 3GWOA 1RM1C 2A3QA 4DR6B 2W0FC 2EILC 5FPRA 2BSKB 1FXKB 1WPBA 5DN6G 3WFVA 3IC7A 3G67A 1GKFA 4DRXA 4AQYB 5LP6B 4LWSA 4X64B 3FKSG 3ZCCA 3BFRA 1OHHG 4QPKA 3ZBHA 3OGCC 4X62O 4O2BA 1VQMV 4LF6O 2Q0OC 3JASB 4MSWC 1K4DC 2AW9A 1R1BA 1JR9A 1EN6A 4NVPA 2F93B 4TT3G 5TISZ 1Y76B 3JAKA 5EYPB 3UO3A 2UXDO 4JI5O 4GKKB 3M7MX 2WPDG 4BAYA 2RCVA 3KG2A 4GKJO 2OTLV 3JCZA 4LNUA 4O4IA 1CEZA 5J2TB 1PNKA 1OCRC 2NLJC 4R6ZA 4FLZA 1B04A 5LGUA 5K1PA 3ABKC 4IYIA 1XHZA 1AP6A 3AK3A 4OX9O 2Z3YA 4FLYA 4X1YB 3MDSA 2Y0PA 1US6A 3LSQA 3CHXA 4X66B 4DR5B 3F7VC 4JV5B 3AG3C 3M99B 4JZGA 1N33B 1FKAO 1FPOA 1GN3A 3E22B 5C8YA 1D5NA 1VQOV 2CTRA 4QPJA 4DV7O 2X6AA 5CA3A 1YIJV 1GMGA 4MS2A 4FLVA 2CTQA 3ZRSA 4O4HB 4DV5O 3BCCH 2DQ0A 3A8TA 4FM1A 5DEDA 2YC0A 4H44B 4IT5A 4CS2A 1G8MA 4DR4B 3E83A 1VF6C 2M6YA 4DR2B 5EIBD 1Q43A 2ZDIA 5ITZB 4JI0O 2WA3A 4YIOA 1EZVH 3OR6C 3MHHC 4I9WA 4UCUA 1VQ6V 4U7NA 4JAVA 3BAAA 1AJPA 2UXBO 3ZEDA 2Q6AA 3D8CA 1FAFA 3AK1A 3OMIB 3TK1A 1HNZB 4AHCA 3VOUA 5FNVA 3JALB 2WAMA 4YXWG 2ZR3A 2O57A 2LW1A 4O4JA 4CZZA 1TVKA 5DECA 1E79G 4LFAO 1YVWA 3JD0A 3LNNA 2CGOA 1FFXB 2OIEA 2JDIG 1H2KA 4DYLA 2JRIA 4GX1A 4A5UB 4TWKA 3ZHVA 4CC5A 4MTGA 4O2AA 3ABTA 3LUTB 2P7TC 3SYOA 4KFMA 2VQFB 4GX0A 1GM7A 1KECA 1WAZA 3APQA 3CP1A 3W7UA 1M57C 4JI1O 1NBMG 2LW7A 5L3FA 4ZHQB 5J2TA 1MSWD 2XT9A 1NU1H 4WBNB 2Q67A 1KB9F 3SPHA 3WU2Z 2IBZH 1Q6UA 4FLUA 3WB2A 3W7XA 4B3TO 4UB8Z 1S76D 1IURA 3ZMUA 4JI2O 5LYJB 2HVJC 4DUZO 1BQZA 3RFRA 2ETNA 2ZM6O 4I50A 1M90W 2E74B 3E22A 5B1AB 3H1JH 4O4HA 1H2SB 3QNEA 3HR0A 3OT7A 2V1DA 3SR2C 1IBLO 5FPOA 2HP8A 4JPRA 2GUZB 3IGAC 3CCLV 4GX5A 3OE7G 4U3JB 1K97A 1YSCA 2Q7HA 1AB3A 1PKXA 1I0HA 4P30A 1L1FA 2JGDB 3HKBA 3FYEB 1V54C 5J2UB 1OCZC 3ZMVA 1H8EG 3OM3B 1ROPA 2EULA 2JJ1G 4NYKA 2E5LO 2LFSA 1I5XA 3OD4A 3SPJA 1F51A 4RAIA 1DF4A 3X2QB 4R50A 3CC7V 2QWPB 1SC5B 5LMNB 3K04A 1NTKH 2QWNB 1YJWV 3FAVB 3P3PA 5BXZA 1Q7YW 1YDXA 2EIMB 5CA1B 5KA5A 4TQDA 2YXHA 3ZRXA 2Q7EA 2OIGA 2UXXA 2JS3A 2GHYA 4LFCO 2OCCB 3BA9A 4LP8A 2EIKC 3TCUA 2IW5A 1NQTA 4JI8B 4NXNO 2LJ2A 2AGAA 1CXZB 1SA0B 3APOA 4H13B 3T1HB 3F5WC 1XL6A 1XREA 4UUJC 2LO1A 3HB3B 1NKDA 4L8JA 2ZNIA 5JJNB 1IDSA 4GCZA 3CJHA 3STLC 5CA0A 5IYBO 3QF7A 1QVGU 2CGNA 2QKAA 1NT2B 3FFQA 4MTXA 1BHAA 2CUGA 4KXRA 1KC8W 1PL0A 3I5DA 1SF9A 1Q86W 4CH4A 4UCOA 4MW3A
chains in the Genus database with same CATH topology
4KHPO 1N34O 4X66O 1XMOO 2UUCO 4DR5O 4JV5O 4GKJO 4YY3O 1N33O 2Z0AA 4LF5O 1XEQA 1N36O 4LFAO 1KUQA 2UUAO 4OPAA 1I94O 2E5LO 4DV4O 3RT3C 4LFBO 2JRIA 1XNRO 4JI8O 4DR6O 1NS1A 4A5UB 1XNQO 4OX9O 2HHHO 5LL6Y 4YHHO 1F7YA 4DR4O 3T1HO 1HNXO 4B3MO 1DK1A 1HNWO 3F5TA 4DV1O 4K0KO 1FYJA 4X65O 3M8AA 4AQYO 4B3SO 4LF7O 1R6TA 4JI1O 4DR2O 2DJVA 5BXZA 5BR8O 2LW7A 4LF9O 4JI4O 4X64O 4JI7O 1FKAO 5IWAO 1IBMO 1IBKO 4DV7O 1A32A 4LFCO 4NXMO 2VQEO 2ZKOA 2UUBO 4OPHA 1AILA 4DV5O 1YZBA 3T1YO 2N74A 3R66A 1XMQO 4DUYO 3J80N 4NXNO 4B3TO 4DR1O 4DV3O 1HNZO 2AGAA 5A2QN 4LF4O 4JI2O 4JI6O 4DUZO 1FJGO 4JYAO 5H5NA 4GKKO 1J5EO 3J81N 2ZM6O 3JAMN 3O65A 4JI0O 3J7AU 4X62O 5IT9N 4LF6O 1X59A 1G1XB 2DOSA 1IBLO 2UXBO 2UU9O 4LF8O 4B3RO 1N32O 2UXCO 4DV6O 1R1BA 5FLXN 4DV2O 3OTOO 2FKXA 5BY1A 3SDLA 2F4VO 4DV0O 4DR7O 2UXDO 1D2DA 4JI5O 5LMUO 1AB3A 5LMNO 4JI3O 4DR3O 2VQFO 1HR0O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP O;  1N34 O;  4X66 O;  1XMO O;  2UUC O;  4DR5 O;  4JV5 O;  4GKJ O;  4YY3 O;  1N33 O;  2Z0A A;  4LF5 O;  1XEQ A;  1N36 O;  4LFA O;  1KUQ A;  2UUA O;  4OPA A;  1I94 O;  2E5L O;  4DV4 O;  3RT3 C;  4LFB O;  2JRI A;  1XNR O;  4JI8 O;  4DR6 O;  1NS1 A;  4A5U B;  1XNQ O;  4OX9 O;  2HHH O;  5LL6 Y;  4YHH O;  1F7Y A;  4DR4 O;  3T1H O;  1HNX O;  4B3M O;  1DK1 A;  1HNW O;  3F5T A;  4DV1 O;  4K0K O;  1FYJ A;  4X65 O;  3M8A A;  4AQY O;  4B3S O;  4LF7 O;  1R6T A;  4JI1 O;  4DR2 O;  2DJV A;  5BXZ A;  5BR8 O;  2LW7 A;  4LF9 O;  4JI4 O;  4X64 O;  4JI7 O;  1FKA O;  5IWA O;  1IBM O;  1IBK O;  4DV7 O;  1A32 A;  4LFC O;  4NXM O;  2VQE O;  2ZKO A;  2UUB O;  4OPH A;  1AIL A;  4DV5 O;  1YZB A;  3T1Y O;  2N74 A;  3R66 A;  1XMQ O;  4DUY O;  3J80 N;  4NXN O;  4B3T O;  4DR1 O;  4DV3 O;  1HNZ O;  2AGA A;  5A2Q N;  4LF4 O;  4JI2 O;  4JI6 O;  4DUZ O;  1FJG O;  4JYA O;  5H5N A;  4GKK O;  1J5E O;  3J81 N;  2ZM6 O;  3JAM N;  3O65 A;  4JI0 O;  3J7A U;  4X62 O;  5IT9 N;  4LF6 O;  1X59 A;  1G1X B;  2DOS A;  1IBL O;  2UXB O;  2UU9 O;  4LF8 O;  4B3R O;  1N32 O;  2UXC O;  4DV6 O;  1R1B A;  5FLX N;  4DV2 O;  3OTO O;  2FKX A;  5BY1 A;  3SDL A;  2F4V O;  4DV0 O;  4DR7 O;  2UXD O;  1D2D A;  4JI5 O;  5LMU O;  1AB3 A;  5LMN O;  4JI3 O;  4DR3 O;  2VQF O;  1HR0 O; 
#chains in the Genus database with same CATH topology
 1QU7 A;  1QLE B;  2QA4 V;  2WLJ A;  1N8R W;  3UO2 A;  2Z0A A;  1FFT B;  3SPC A;  1IZ3 A;  5LOV A;  4TOI A;  3ABL C;  3P3N A;  1VIB A;  1I94 O;  2UXC B;  1I08 A;  3RT3 C;  3AG1 C;  3CRM A;  4U3J A;  2F4V B;  1BS3 A;  3K9S A;  1QQC A;  3NXS A;  2ZXW B;  5LGT A;  3HKD A;  1ZUQ A;  4LF7 O;  3ZHS A;  1DGS A;  1PD3 A;  3S3W A;  1IBK O;  2W6I G;  1QLE C;  4OXS A;  2ZKO A;  4YJ3 A;  5KHG A;  2B1G A;  2UUA B;  4JAA A;  1BHB A;  3ZRW B;  2YIB A;  4MTO A;  4IGG A;  2WLK A;  4BR6 A;  1XNR B;  5IE9 A;  4FM0 A;  3CX5 F;  1YJ9 V;  2CE4 A;  2HHH B;  2LP7 A;  4ZI7 B;  1TUB A;  4LR3 A;  5A2Q N;  3ZS8 C;  1RPR A;  4DRX B;  2EZO A;  5H5N A;  1J5E O;  4LWS B;  2VWK A;  2YUA A;  1SER A;  2DMX A;  2DW4 A;  5EIB C;  2WA4 A;  4JI7 B;  4UCT A;  1K3E A;  4O2B B;  4GT1 A;  1GM9 A;  2FL4 A;  4I7Z B;  4EEQ A;  3H01 A;  3E8H A;  1RFY A;  3E35 A;  4QE9 A;  3ETE A;  5EBW C;  3K5L A;  3JAK B;  1FJG B;  3DC5 A;  4I55 A;  3K5M A;  5LMU O;  2QTS A;  3ETQ A;  4CS4 A;  2OTJ V;  1S5L Z;  3MD0 A;  3RBZ A;  2IH3 C;  1HR0 O;  2FYU H;  2EBO A;  2UUC O;  3QO8 A;  3F7Y C;  4LNU B;  1M5I A;  3K0G A;  4DO2 A;  4O4I B;  1XHX A;  5JCO C;  4LF5 O;  4Q6G A;  1E1R G;  1DLB A;  3CCE V;  3QO5 A;  4YIP A;  5CN0 A;  2ZE6 A;  4BIO A;  4FLT A;  2QKC A;  1OCO C;  1JJ2 U;  4DV2 B;  5IJ9 A;  1XNQ O;  2OCH A;  4DW1 A;  1V55 B;  3SJC C;  2KQX A;  2QR4 A;  2HG5 C;  3GWK C;  3LSU A;  1TA8 A;  2W6J G;  1XMO B;  5L3B A;  1DF5 A;  3ETD A;  5C8Y B;  1ZWI C;  2B9Z A;  4JZ2 A;  4ZIB A;  2JJ2 G;  5IWA O;  5CBF A;  3E86 A;  4NXM O;  1N36 B;  4ZOL A;  1BGY H;  2WLH A;  5CB4 A;  1K9M W;  4JGS A;  1K8A W;  1KYO F;  2ZIN A;  2HJD A;  4FZ1 A;  5JWP A;  2Y69 B;  1Q6H A;  3D3Q A;  3ZHQ A;  1SKV A;  5GON A;  2A7W A;  1FXV A;  5KUK A;  2ZE7 A;  1AR1 B;  1AI4 A;  3CE2 A;  4GUN A;  2ZIO A;  5KHH A;  4JF3 A;  2YIB D;  4HNA B;  1G4Y B;  3D36 A;  3SYQ A;  3T1Y B;  3CC4 V;  3U10 A;  1XMQ B;  4DV6 O;  1Y74 A;  4ZI7 A;  2E76 B;  4MTF A;  3RWR D;  4H37 A;  5JJJ B;  1TUE B;  2D2C B;  2YEV A;  4JYA B;  2ITD C;  4H33 A;  2JEX A;  5FNV B;  2LGW A;  2Q4P A;  1N34 O;  1WP8 A;  2XUM A;  1SQV H;  4O4J B;  2R70 A;  1TVK B;  1IVS A;  3ASO C;  3B09 A;  1YEW A;  3E89 A;  3H9V A;  4KUM A;  1VQ8 V;  3OUF A;  4F4L A;  2IU0 A;  2R9A A;  1FS0 G;  3AG4 B;  5CMU A;  3THO A;  1K7D A;  2GTA A;  5IYC O;  1VQK V;  1SQF A;  1L0N H;  2K9P A;  1NS1 A;  5B5E Z;  1OCC B;  4X1K A;  4J41 A;  4O2A B;  1FXK C;  4DR7 B;  3WB1 A;  2QM7 A;  5IJ0 A;  2NR5 A;  2IJH A;  1QVF U;  4B3M O;  2QWQ B;  1KKD A;  5LP6 C;  3KKY A;  2LQT A;  1VQN V;  3ZHT A;  4YY3 B;  2WLN A;  2YDE A;  4ICG A;  3ZN1 A;  3JSL A;  3JCU Z;  5JQG A;  1OJH A;  4X8A A;  2PF4 E;  4U7O A;  4LFB B;  2WLI A;  4DUY O;  5B1O A;  1MZF A;  4DR1 O;  4DV3 O;  3AK2 A;  4I4T A;  1NH2 B;  3DC6 A;  1K33 A;  4I50 B;  4CS3 A;  5KHK A;  5HFM A;  5DM6 V;  4JI4 B;  1O9H A;  1M56 B;  2Y4U A;  3HPL C;  4K8Z A;  1V9P A;  1UFI A;  3VQY A;  1JOY A;  2H8P C;  4JAU A;  4H0L B;  1E1Q G;  4TSF G;  4RUE A;  4BW9 A;  2UU9 O;  5B3S B;  2CH7 A;  1AJQ A;  1SQX H;  1M1K W;  1VQ7 V;  1NTM H;  3OTO O;  3CCS V;  1GN2 A;  2BOB C;  3BA8 A;  2WSS G;  3CWB H;  1SS3 A;  5KA6 A;  2R9I A;  1TAE A;  3HKB B;  3Q4H A;  2L6L A;  3W7S A;  3ZMZ A;  5KHI A;  1VQ5 V;  2EX3 A;  2A0L A;  1EM1 A;  4X62 B;  4HNA A;  5FL7 G;  2IU3 A;  4LF6 B;  2PI5 A;  1VP7 A;  3ICX A;  4PA4 A;  5KAI Z;  1VF7 A;  4PHZ A;  3RN4 A;  3A0H Z;  4JTC B;  1WP7 A;  3SYP A;  3JSN A;  4FM2 A;  1HDJ A;  4TV9 A;  1VAR A;  1EFR G;  2UXD B;  2HFE C;  3UT5 A;  4JI5 B;  4D6T H;  1K73 W;  1HNW O;  3JD2 A;  4X65 O;  1ZTE A;  3ABU A;  2LGQ A;  1JCH A;  4B3S O;  4BWA A;  1K4C C;  5BR8 O;  4GKJ B;  3UM7 A;  3VQW A;  4MVQ A;  2BTO A;  1WLE A;  3WG7 B;  1H2G A;  4MT8 A;  4OPH A;  5H6Q A;  4I0X A;  3HKC A;  1NVP D;  5D5Q A;  2QGN A;  4CBC A;  4OX9 B;  1EBO A;  4F6R A;  1QR9 A;  1VQP V;  1JVM A;  4IIJ A;  3FD9 A;  2CTP A;  2YIC A;  3ZMS A;  2AXT Z;  3VQX A;  1COW G;  2AHY A;  4B7K A;  3FB8 C;  4UVC A;  4EFE A;  2DWD C;  1JPX A;  3SJB C;  2QJ1 A;  3CJH B;  4DV7 B;  5CA0 B;  1XDC A;  3CXC U;  4DV5 B;  4GLX A;  1YCI A;  4CH3 A;  3IAY A;  5JH7 A;  5KX5 A;  4DXW A;  2FKX A;  4PDM A;  2CTW A;  4FFB A;  4PDR A;  3CCM V;  2GV9 A;  4HBN A;  4I5S A;  3BVO A;  1QCE A;  4JI3 O;  4DR3 O;  3FYI B;  3G4S V;  4EFB A;  2YXL A;  2CK3 G;  1VF6 A;  1XUQ A;  4MVM A;  3VBB A;  1XL4 A;  4JI0 B;  1MMM A;  4RO2 A;  1YTF B;  3LNM B;  1SZT A;  2ODM A;  5LOV B;  1P49 A;  1Z5V A;  4HAM A;  4UB6 Z;  4D7S A;  1BT8 A;  2F95 B;  1R3J C;  3CRQ A;  1F4N A;  2OT5 A;  5CBH A;  2UXB B;  2ZCE A;  1URF A;  3MHS C;  3QO7 A;  2Y4T A;  3OAA G;  1SQQ H;  3EHB B;  4YHH O;  2Q5Z A;  1EN4 A;  3HKD B;  1U96 A;  1T5E A;  4FIP C;  5D5P A;  4MVZ A;  4LC1 A;  3G6B A;  5B1A C;  4JYY A;  2YSU B;  2DYS B;  4LF9 O;  4J7K A;  5EBM C;  4YJ3 B;  3TXS A;  1IBM O;  1AR4 A;  3SJQ C;  3CRR A;  3RGB A;  4PA3 A;  2VQE O;  1H2N A;  4LFA B;  2MW2 B;  1EZJ A;  5LHH A;  1QBZ A;  3ZN0 A;  4JAS A;  3H1H H;  2AZ2 A;  1TUB B;  3LSS A;  1LNQ A;  1R3K C;  1ORQ C;  2VWJ A;  2WLM A;  3KZI Z;  1YJN V;  4LF4 O;  4J42 A;  3CYO A;  3QVN A;  3ZMT A;  3RYC A;  4JI1 B;  3K03 A;  3RYH A;  2VS0 A;  4W4K A;  1LUV A;  3K9A A;  1BQ0 A;  2HJF C;  5H9C A;  2LFR A;  2DYS C;  5BZB A;  4BIU A;  4O4L A;  4E4E A;  1XI1 A;  1VF5 B;  2JGU A;  4P9P A;  4B3R O;  3AEI A;  2EJR A;  4PD4 F;  2F23 A;  4AI8 A;  3CSX A;  1X4T A;  3A0B Z;  1WN7 A;  1JMK C;  4B3T B;  4NTX A;  4DV0 O;  4P9O A;  3X2Q C;  1F4M A;  4I55 B;  4JI2 B;  4Q20 A;  4DUZ B;  4K35 A;  2XAJ A;  4W4L A;  4JTA B;  2EIM C;  4PJ0 Z;  2ZM6 B;  3FB7 C;  3I56 V;  3CPW U;  2B5U A;  5IY5 B;  4PI2 A;  2OCC C;  3EVK A;  2CDY A;  1IBL B;  3ZHR A;  3ZJZ A;  5IJ9 B;  1SET A;  4JI6 B;  4PI0 A;  1TGO A;  1Y66 A;  2GTS A;  3B4S A;  4QE7 A;  3U11 A;  5LXT A;  2Q0A A;  1NH2 D;  3SYC A;  2Y48 A;  1BZK A;  3RYI A;  4UXN A;  4EB6 A;  4LBE C;  5L3G A;  2YI8 A;  1L8D A;  3B8M A;  1HNX O;  1DK1 A;  4DV1 O;  4K0K O;  5GTH Z;  3G71 V;  4UV8 A;  2Q73 A;  4Z1M G;  2XAH A;  4WFH A;  2BCC H;  1SES A;  3L71 H;  4IYH A;  4ZOL B;  2MK3 A;  3B2E E;  1QNM A;  3ZIA G;  2UUB O;  5CB4 B;  4X1I A;  1AIL A;  4F6E A;  2E5L B;  2GBO A;  4ZBM A;  3T4D A;  1S5H C;  2KG7 A;  1Q5O A;  2QM4 A;  1XQ8 A;  5E1A C;  5GTI Z;  3EFF K;  5GON B;  2RQ6 A;  3O65 A;  2EIJ B;  3IJ4 A;  3L72 H;  2QWR B;  4GX2 A;  4LFC B;  5BMV A;  1EN5 A;  1NR1 A;  3J7A U;  3TJT A;  3C3T A;  2N04 A;  2R9R B;  2ZT9 B;  1Y74 B;  4LF8 O;  5L3D A;  1HW7 A;  3A0R A;  4NXN B;  2QTO A;  2KSD A;  2DQ3 A;  1VMG A;  1P84 F;  2E75 B;  2ZR2 A;  4B7E A;  1KP3 A;  2YEV B;  2ZXW C;  4TV8 A;  4RQF A;  1I7F A;  4J11 A;  1XOU A;  2BTQ A;  4CH5 A;  1D5A A;  2ATK C;  2H94 A;  4KHP O;  4XDK A;  1M93 A;  4OGQ B;  1WA8 A;  4TUY A;  2EIJ C;  2QDO A;  1B06 A;  1G6U A;  2RNB A;  1S72 V;  5LHI A;  3D36 C;  1NVP B;  4DV4 O;  4X1K B;  1K5Q A;  3UCS C;  2A9H A;  1ZAU A;  4DR6 O;  2IJI A;  5IJ0 B;  3OEE G;  1L0L H;  3SYA A;  2IM9 A;  3E8F A;  5B1B B;  2EIN B;  1RSO A;  1SQB H;  1KU9 A;  1NR7 A;  2WWW A;  2DYR B;  3M8A A;  4AQY O;  3OMN B;  1R6T A;  3N2G A;  1Q81 W;  4PA9 A;  2GDS A;  1QHT A;  4N23 A;  4X64 O;  3P32 A;  4D7T A;  1GM8 A;  5JQG B;  1J95 A;  1N32 B;  1GAX A;  2QE7 G;  2GSM B;  3N2K A;  1SRY A;  1I94 B;  2WLI B;  2N74 A;  4K8X A;  1H8H G;  2PTM A;  2JEU A;  4G27 B;  4I4T B;  2PY5 A;  3OTF A;  2X6C A;  4U3F H;  5H2F Z;  2ITC C;  1PPJ H;  1SQG A;  4GKK O;  1YTF D;  4LF7 B;  2EIN C;  3HKE A;  4QIW F;  4WFA V;  3T1C A;  4NTY A;  4WCE V;  5JVD A;  4CC6 A;  1IBK B;  4YJ2 A;  1S77 D;  2W0X A;  4J7J A;  2CH7 B;  1SZX A;  1WJZ A;  4NR1 A;  4X20 A;  5GW7 A;  4XBF A;  2QEX V;  4IL6 Z;  4KP4 A;  1RM1 B;  1JQ0 A;  1MG1 A;  2WLL B;  1V55 C;  2RJZ A;  3MAQ A;  2KB1 A;  3B8N A;  2EIL B;  2VRZ A;  3R65 A;  3K5O A;  1P4R A;  1R6N A;  2PYL A;  1D2D A;  4UVB A;  5B1N A;  2JK5 C;  4E2L A;  3Q4H B;  1J5E B;  5IYD O;  1GTO A;  3L9D A;  1VQ4 V;  5EZY A;  4X66 O;  4DR5 O;  1H2L A;  4ASU G;  3CCU V;  4JV5 O;  3OFN G;  2E3C A;  1N33 O;  2F1M A;  3P30 A;  2PUS A;  1M9N A;  5EC2 C;  1P7B A;  2R72 A;  3TET A;  1VQL V;  3GVM A;  5C93 A;  1Q8I A;  2P4V A;  4TV9 B;  1KKC A;  2DE0 X;  3BAB A;  3UT5 B;  5IYZ A;  1YF2 A;  3I55 V;  5LMU B;  1BSM A;  3ASN B;  3IC9 A;  4MVU A;  4DR4 O;  2ZDI C;  2Y69 C;  1NI8 A;  2OYQ A;  1HR0 B;  1PNL A;  4DR2 O;  3BRC A;  1HP8 A;  2XHB A;  2UUC B;  1DTO A;  4IHJ A;  4LF5 B;  4NB5 A;  5KUM A;  2QWO B;  4I0X B;  3JAW A;  2IH1 C;  3OEH G;  3ZHU A;  5JCO A;  3HKC B;  1OCR B;  5E79 Z;  2P5O A;  3CD6 V;  1SQP H;  4F6R B;  1NTZ H;  3G6E V;  3ABK B;  1MOF A;  1XNQ B;  2XAS A;  1AP5 A;  4IIJ B;  1JFF A;  3KCY A;  3ZX6 A;  1W2B U;  1HNZ O;  3QTC A;  4RWU A;  2F66 C;  1N0J A;  4R8C A;  3RYF A;  2RN9 A;  1N4C A;  5K1X A;  2ARH A;  3ASN C;  1NZ6 A;  1MZE A;  4DW0 A;  5J9P C;  1ZSP A;  2XAQ A;  5IWA B;  3AG3 B;  1YI2 V;  4NXM B;  4N21 A;  1WB8 A;  2ZE8 A;  3AG4 C;  4CH6 A;  4QNH B;  1X59 A;  5JH7 B;  4X88 A;  5KX5 B;  3AG7 A;  3PJS K;  5KLV H;  5L3C A;  1MSD A;  1OCC C;  1NJI W;  3H1L H;  2ZE5 A;  2KKW A;  4FFB B;  3CMA V;  3SDL A;  4K3A A;  3JD1 A;  1OZ0 A;  2XND G;  1BMF G;  3KCX A;  1FD9 A;  3E8G A;  5LA6 B;  2VQF O;  3DXR A;  5KMG A;  4LCU C;  1Q6I A;  2YID A;  3E8B A;  4HZ3 A;  1FXH A;  1K5S A;  1Z5W A;  3K0D A;  1P7G A;  4JYB A;  1KUQ A;  3FX7 A;  1B3Q A;  3JAR A;  4DV6 B;  2WLL A;  2FTK A;  1ZX3 A;  1Q90 D;  2CAZ C;  1YHQ V;  1Q82 W;  1F7Y A;  3C3S A;  1S0V A;  1ZLZ A;  4JTD B;  1VEW A;  5LGN A;  2Q7G A;  4PEL A;  2ADQ B;  1N34 B;  2DN9 A;  1M56 C;  1U97 A;  2ZNJ A;  1AI6 A;  4J7Z A;  3OW2 U;  1MAB G;  1ZL8 A;  2NNU A;  4UCR A;  1YZB A;  3RVZ A;  5B3S C;  2V7Q G;  3L73 H;  4PDL A;  1S5J A;  3LDD A;  2A06 H;  2YS8 A;  5H6R A;  3ABM B;  3T4Z A;  2BSK A;  1KP2 A;  1FXK A;  4B3M B;  3RYC B;  2AZ0 A;  3RYH B;  1GN6 A;  4FJC C;  2PI4 A;  2HEP A;  1M57 B;  2YXY A;  1KQS U;  5LP6 A;  4DK1 A;  1WB7 A;  2JVD A;  1AJN A;  4O4L B;  3LDE A;  3K57 A;  5IT9 N;  4FZ0 A;  1Y67 A;  3BEH A;  3ETG A;  2PZS A;  5KAF Z;  1YIT V;  4DUY B;  3JAS A;  3FB6 C;  2A79 B;  4X9Q A;  2C2A A;  4NKG B;  4DR1 B;  4DV3 B;  1S3J A;  4J9Y B;  2V4D A;  3TXQ A;  1PV0 A;  2X6B A;  3ABM C;  1Y76 A;  5EYP A;  3K59 A;  4WFF A;  5LMN O;  4FFK A;  4QGP A;  3STZ C;  4ABM A;  4WF9 V;  1QLN A;  1RP3 B;  1R73 A;  4TQF A;  1B6Q A;  3DGE A;  3WG7 C;  3T2M A;  1VQ9 V;  2XAG A;  2G38 A;  1HWY A;  4OPA A;  2UU9 B;  1K34 A;  2B1I A;  5LXT B;  4FVM A;  3OTO B;  2PGG A;  4JI8 O;  3RYI B;  2PYJ A;  4PV1 B;  3RW0 A;  4EB6 B;  4PA7 A;  5LA6 A;  2HLD G;  3T1H O;  4X1Y A;  1BE3 H;  1MA1 A;  4BIZ A;  4RUF A;  3W7T A;  3CS5 A;  3CCR V;  2P06 A;  1V54 B;  1OCZ B;  2Q9L A;  4X1I B;  1WNS A;  5HFL A;  4FMT A;  3E2E A;  3JAT B;  2X0L A;  3R66 A;  4UCV A;  2KG7 B;  5EC1 C;  1UJW B;  1AI7 A;  1O9G A;  4X89 A;  2F43 G;  3LDC A;  2HKO A;  2AHZ A;  1Y6X A;  4Z1V A;  4JI6 O;  4PA6 A;  3K5N A;  1HNW B;  4X65 B;  3CC2 V;  3SGI A;  3B77 A;  4B3S B;  5IDJ A;  5BR8 B;  3JAM N;  3NR7 A;  4WFE A;  3O9O A;  5ITZ A;  2K1E A;  5BMV B;  5LBQ A;  3K06 A;  2HVK C;  2P4K A;  3FB5 C;  2UXC O;  2EIK B;  4L87 A;  2XTA A;  5JJE B;  4TV8 B;  2F4V O;  1GN4 A;  1Y4M A;  1GK9 A;  2BTQ B;  4Z2W A;  3JYC A;  3QG5 A;  1W0K G;  1WA8 B;  3K58 A;  2QM8 A;  2BE3 A;  4TUY B;  1OV9 A;  3JAL A;  1MNG A;  3UQ8 A;  2QKS A;  4WFB V;  3BHP A;  3DSQ A;  4XDL A;  4P2Z A;  4FLX A;  2UUA O;  4HYO A;  1FFX A;  2FML A;  2DWE C;  1XNR O;  2P6J A;  5F2V O;  2P67 A;  2HHH O;  4KL1 A;  4RQE A;  5LL6 Y;  1RSO B;  2YIA A;  3SPI A;  2HR3 A;  3F5T A;  3G80 A;  4JI3 B;  3N2G B;  4DR3 B;  3BY6 A;  4NTW A;  1I5Y A;  3C90 A;  4J80 A;  1GH6 A;  1XBL A;  4JI7 O;  4ZHQ A;  4B08 A;  1M4U A;  3N2K B;  3SPG A;  3U0Z A;  5KHJ A;  4WFG A;  3ABL B;  4WBN A;  2BOC C;  3PN1 A;  3SJA C;  2IJJ A;  5EK0 A;  1PL4 A;  4FK5 C;  3AG1 B;  2EZP A;  1CPY A;  1JX9 A;  4YHH B;  4R7C A;  2FB5 A;  1FJG O;  1R3I C;  3CEI A;  1BCC H;  4UCS A;  5LYJ A;  3HKE B;  3ML0 A;  1PM9 A;  3ZRV A;  1CP9 A;  3J81 N;  1RPO A;  3OGI B;  2QSA A;  4FLW A;  3CCV V;  4LF9 B;  3H1I H;  3AG2 B;  5JVD B;  5IY5 C;  4YJ2 B;  1W59 A;  4XDJ A;  1IBM B;  1GRJ A;  3K08 A;  3CCQ V;  2VQE B;  3JAT A;  4LH7 A;  3W7W A;  4I9Q A;  4X20 B;  2XAF A;  1N32 O;  5LHG A;  1AI5 A;  4DV2 O;  1Q3E A;  2GUZ A;  4J9Z B;  4LF4 B;  3WB0 A;  2M7W A;  1R6K A;  2RDC A;  5EZY B;  1R3L C;  1XMO O;  2X7R B;  2JGD A;  2Q68 A;  1KBH A;  1UPG A;  3TGU H;  5J2U A;  1H38 A;  3AG2 C;  1N36 O;  1W0J G;  2ZQM A;  1H2M A;  3L74 H;  1JJO A;  4PDV A;  4B3R B;  1AR5 A;  2ZD9 A;  3JD4 A;  5IYZ B;  4DV0 B;  1LR1 A;  3S3X A;  1KMI Z;  1IXM A;  3GB7 C;  3JD3 A;  4MVR A;  1FYJ A;  5AG2 A;  3IFX A;  4AIL C;  2DJV A;  2EJ7 A;  3FAV A;  4IHJ B;  5CA1 A;  3CXH F;  3JAW B;  1A32 A;  4JYC A;  1KD1 W;  4UVA A;  5CBG A;  1JA8 A;  3B40 A;  3L70 H;  4C7U A;  4GZR B;  2ZIM A;  3T1Y O;  4G2K A;  4MVO A;  3OR7 C;  1XMQ O;  1PNM A;  3J80 N;  4MVS A;  1OCO B;  3K3W A;  1JFF B;  5A9G A;  1ENV A;  1QR8 A;  3BPZ A;  2RMK B;  3RYF B;  2NN4 A;  3RVY A;  2OWO A;  1SA0 A;  1HNX B;  4DV1 B;  4JYA O;  4K0K B;  3CCJ V;  2YI9 A;  4G28 B;  3UKM A;  2P22 C;  1THZ A;  4LH6 A;  2ILM A;  2UUB B;  1IXB A;  1G1X B;  2DOS A;  3OMA B;  2Q69 A;  2H3O A;  1BL8 A;  3OUS A;  5FLX N;  3CRA A;  5BY1 A;  4ZKI A;  3L75 H;  5B1B C;  1GO3 F;  4DR7 O;  2DYR C;  3DXR B;  3CB2 A;  5KMG B;  3DTU B;  3N27 A;  1K92 A;  4BW5 A;  3CME V;  4MW8 A;  4YY3 O;  2ADP A;  1AVM A;  2Q8V A;  4J10 A;  1ARO P;  2Z5U A;  1XEQ A;  1Z2G A;  2N05 A;  4EKW A;  5EBL C;  3CRC A;  3JAR B;  4LF8 B;  1WPX A;  2L35 A;  1F23 A;  1PP9 H;  5L3E A;  4LFB O;  4GYC B;  1YXB A;  1XIL A;  2JIZ G;  1IX9 A;  2JS5 A;  2XOK G;  4UFZ A;  3H1K H;  1N0N A;  4KHP B;  2D3O W;  5B66 Z;  4JI4 O;  1LUW A;  3EXA A;  2Y0I A;  3ASO B;  3D3I A;  2P90 A;  3K79 A;  1ZL8 B;  3VQV A;  2IJK A;  2UXN A;  4UV9 A;  3A2F A;  4QJF B;  4FPP A;  4DV4 B;  3ZRW A;  4DK0 A;  3GWO A;  1RM1 C;  2A3Q A;  4DR6 B;  2W0F C;  2EIL C;  5FPR A;  2BSK B;  1FXK B;  1WPB A;  5DN6 G;  3WFV A;  3IC7 A;  3G67 A;  1GKF A;  4DRX A;  4AQY B;  5LP6 B;  4LWS A;  4X64 B;  3FKS G;  3ZCC A;  3BFR A;  1OHH G;  4QPK A;  3ZBH A;  3OGC C;  4X62 O;  4O2B A;  1VQM V;  4LF6 O;  2Q0O C;  3JAS B;  4MSW C;  1K4D C;  2AW9 A;  1R1B A;  1JR9 A;  1EN6 A;  4NVP A;  2F93 B;  4TT3 G;  5TIS Z;  1Y76 B;  3JAK A;  5EYP B;  3UO3 A;  2UXD O;  4JI5 O;  4GKK B;  3M7M X;  2WPD G;  4BAY A;  2RCV A;  3KG2 A;  4GKJ O;  2OTL V;  3JCZ A;  4LNU A;  4O4I A;  1CEZ A;  5J2T B;  1PNK A;  1OCR C;  2NLJ C;  4R6Z A;  4FLZ A;  1B04 A;  5LGU A;  5K1P A;  3ABK C;  4IYI A;  1XHZ A;  1AP6 A;  3AK3 A;  4OX9 O;  2Z3Y A;  4FLY A;  4X1Y B;  3MDS A;  2Y0P A;  1US6 A;  3LSQ A;  3CHX A;  4X66 B;  4DR5 B;  3F7V C;  4JV5 B;  3AG3 C;  3M99 B;  4JZG A;  1N33 B;  1FKA O;  1FPO A;  1GN3 A;  3E22 B;  5C8Y A;  1D5N A;  1VQO V;  2CTR A;  4QPJ A;  4DV7 O;  2X6A A;  5CA3 A;  1YIJ V;  1GMG A;  4MS2 A;  4FLV A;  2CTQ A;  3ZRS A;  4O4H B;  4DV5 O;  3BCC H;  2DQ0 A;  3A8T A;  4FM1 A;  5DED A;  2YC0 A;  4H44 B;  4IT5 A;  4CS2 A;  1G8M A;  4DR4 B;  3E83 A;  1VF6 C;  2M6Y A;  4DR2 B;  5EIB D;  1Q43 A;  2ZDI A;  5ITZ B;  4JI0 O;  2WA3 A;  4YIO A;  1EZV H;  3OR6 C;  3MHH C;  4I9W A;  4UCU A;  1VQ6 V;  4U7N A;  4JAV A;  3BAA A;  1AJP A;  2UXB O;  3ZED A;  2Q6A A;  3D8C A;  1FAF A;  3AK1 A;  3OMI B;  3TK1 A;  1HNZ B;  4AHC A;  3VOU A;  5FNV A;  3JAL B;  2WAM A;  4YXW G;  2ZR3 A;  2O57 A;  2LW1 A;  4O4J A;  4CZZ A;  1TVK A;  5DEC A;  1E79 G;  4LFA O;  1YVW A;  3JD0 A;  3LNN A;  2CGO A;  1FFX B;  2OIE A;  2JDI G;  1H2K A;  4DYL A;  2JRI A;  4GX1 A;  4A5U B;  4TWK A;  3ZHV A;  4CC5 A;  4MTG A;  4O2A A;  3ABT A;  3LUT B;  2P7T C;  3SYO A;  4KFM A;  2VQF B;  4GX0 A;  1GM7 A;  1KEC A;  1WAZ A;  3APQ A;  3CP1 A;  3W7U A;  1M57 C;  4JI1 O;  1NBM G;  2LW7 A;  5L3F A;  4ZHQ B;  5J2T A;  1MSW D;  2XT9 A;  1NU1 H;  4WBN B;  2Q67 A;  1KB9 F;  3SPH A;  3WU2 Z;  2IBZ H;  1Q6U A;  4FLU A;  3WB2 A;  3W7X A;  4B3T O;  4UB8 Z;  1S76 D;  1IUR A;  3ZMU A;  4JI2 O;  5LYJ B;  2HVJ C;  4DUZ O;  1BQZ A;  3RFR A;  2ETN A;  2ZM6 O;  4I50 A;  1M90 W;  2E74 B;  3E22 A;  5B1A B;  3H1J H;  4O4H A;  1H2S B;  3QNE A;  3HR0 A;  3OT7 A;  2V1D A;  3SR2 C;  1IBL O;  5FPO A;  2HP8 A;  4JPR A;  2GUZ B;  3IGA C;  3CCL V;  4GX5 A;  3OE7 G;  4U3J B;  1K97 A;  1YSC A;  2Q7H A;  1AB3 A;  1PKX A;  1I0H A;  4P30 A;  1L1F A;  2JGD B;  3HKB A;  3FYE B;  1V54 C;  5J2U B;  1OCZ C;  3ZMV A;  1H8E G;  3OM3 B;  1ROP A;  2EUL A;  2JJ1 G;  4NYK A;  2E5L O;  2LFS A;  1I5X A;  3OD4 A;  3SPJ A;  1F51 A;  4RAI A;  1DF4 A;  3X2Q B;  4R50 A;  3CC7 V;  2QWP B;  1SC5 B;  5LMN B;  3K04 A;  1NTK H;  2QWN B;  1YJW V;  3FAV B;  3P3P A;  5BXZ A;  1Q7Y W;  1YDX A;  2EIM B;  5CA1 B;  5KA5 A;  4TQD A;  2YXH A;  3ZRX A;  2Q7E A;  2OIG A;  2UXX A;  2JS3 A;  2GHY A;  4LFC O;  2OCC B;  3BA9 A;  4LP8 A;  2EIK C;  3TCU A;  2IW5 A;  1NQT A;  4JI8 B;  4NXN O;  2LJ2 A;  2AGA A;  1CXZ B;  1SA0 B;  3APO A;  4H13 B;  3T1H B;  3F5W C;  1XL6 A;  1XRE A;  4UUJ C;  2LO1 A;  3HB3 B;  1NKD A;  4L8J A;  2ZNI A;  5JJN B;  1IDS A;  4GCZ A;  3CJH A;  3STL C;  5CA0 A;  5IYB O;  3QF7 A;  1QVG U;  2CGN A;  2QKA A;  1NT2 B;  3FFQ A;  4MTX A;  1BHA A;  2CUG A;  4KXR A;  1KC8 W;  1PL0 A;  3I5D A;  1SF9 A;  1Q86 W;  4CH4 A;  4UCO A;  4MW3 A; 
#chains in the Genus database with same CATH homology
 4KHP O;  1N34 O;  4X66 O;  1XMO O;  2UUC O;  4DR5 O;  4JV5 O;  4GKJ O;  4YY3 O;  1N33 O;  2Z0A A;  4LF5 O;  1XEQ A;  1N36 O;  4LFA O;  1KUQ A;  2UUA O;  4OPA A;  1I94 O;  2E5L O;  4DV4 O;  3RT3 C;  4LFB O;  2JRI A;  1XNR O;  4JI8 O;  4DR6 O;  1NS1 A;  4A5U B;  1XNQ O;  4OX9 O;  2HHH O;  5LL6 Y;  4YHH O;  1F7Y A;  4DR4 O;  3T1H O;  1HNX O;  4B3M O;  1DK1 A;  1HNW O;  3F5T A;  4DV1 O;  4K0K O;  1FYJ A;  4X65 O;  3M8A A;  4AQY O;  4B3S O;  4LF7 O;  1R6T A;  4JI1 O;  4DR2 O;  2DJV A;  5BXZ A;  5BR8 O;  2LW7 A;  4LF9 O;  4JI4 O;  4X64 O;  4JI7 O;  1FKA O;  5IWA O;  1IBM O;  1IBK O;  4DV7 O;  1A32 A;  4LFC O;  4NXM O;  2VQE O;  2ZKO A;  2UUB O;  4OPH A;  1AIL A;  4DV5 O;  1YZB A;  3T1Y O;  2N74 A;  3R66 A;  1XMQ O;  4DUY O;  3J80 N;  4NXN O;  4B3T O;  4DR1 O;  4DV3 O;  1HNZ O;  2AGA A;  5A2Q N;  4LF4 O;  4JI2 O;  4JI6 O;  4DUZ O;  1FJG O;  4JYA O;  5H5N A;  4GKK O;  1J5E O;  3J81 N;  2ZM6 O;  3JAM N;  3O65 A;  4JI0 O;  3J7A U;  4X62 O;  5IT9 N;  4LF6 O;  1X59 A;  1G1X B;  2DOS A;  1IBL O;  2UXB O;  2UU9 O;  4LF8 O;  4B3R O;  1N32 O;  2UXC O;  4DV6 O;  1R1B A;  5FLX N;  4DV2 O;  3OTO O;  2FKX A;  5BY1 A;  3SDL A;  2F4V O;  4DV0 O;  4DR7 O;  2UXD O;  1D2D A;  4JI5 O;  5LMU O;  1AB3 A;  5LMN O;  4JI3 O;  4DR3 O;  2VQF O;  1HR0 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...