1R1BA

Eprs second repeated element, nmr, minimized average structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
MVYDKIAAQGEVVRKLKAEKAPKAKVTEAVECLLSLKAEYKEKTGKEYVPGLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A recurrent RNA-binding domain is appended to eukaryotic aminoacyl-tRNA synthetases.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Ligase
molecule keywords TRNA SYNTHETASE
total genus 16
structure length 56
sequence length 56
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 1998-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1r1bA00
4JI2O 1J5EO 2F4VO 4B3TO 1HNWO 5LMNO 4DR3O 1YZBA 4OPHA 4JI4O 4DV6O 3RT3C 1HNZO 2HHHO 4DV2O 4JI0O 5IT9N 1IBLO 4JV5O 1R6TA 4JI6O 4DR2O 3SDLA 4X62O 2VQFO 5BY1A 4JI5O 4DV1O 4JYAO 1D2DA 2UXDO 2VQEO 4DV7O 4LF5O 4KHPO 4X64O 2N74A 4B3SO 1A32A 1N36O 1AILA 4DR7O 4A5UB 1X59A 4LFCO 4GKJO 2E5LO 4DUZO 5FLXN 3JAMN 1N32O 1XMOO 1FKAO 4DR1O 2DOSA 1DK1A 1XMQO 2UXCO 1XEQA 5A2QN 3F5TA 4JI8O 1FJGO 5BR8O 4YY3O 2UUBO 4NXMO 4DR6O 4DV5O 1N34O 1F7YA 4B3RO 4LFBO 1XNRO 3J80N 4LF9O 1FYJA 4LF4O 2ZM6O 4DR5O 1R1BA 5H5NA 1KUQA 4GKKO 2UXBO 4YHHO 4LFAO 3M8AA 1HNXO 4X65O 4DV0O 4OX9O 4DR4O 4LF7O 4NXNO 4DV3O 2UU9O 4JI7O 4OPAA 4DV4O 3O65A 4LF8O 5LL6Y 4JI1O 1NS1A 3OTOO 2ZKOA 2JRIA 1I94O 1IBKO 4DUYO 2UUCO 3T1YO 3T1HO 4X66O 5BXZA 3J7AU 2DJVA 4AQYO 5LMUO 3J81N 4JI3O 1XNQO 5IWAO 4K0KO 2LW7A 1HR0O 4B3MO 3R66A 4LF6O 1AB3A 1N33O 1IBMO 2UUAO 1G1XB 2AGAA 2FKXA 2Z0AA
chains in the Genus database with same CATH superfamily
1J5EO 1N33B 5LP6B 4H0LB 3CEIA 2EZPA 3K9AA 4PV1B 1GKFA 3Q4HA 4BW9A 2QA4V 5CA1B 5JQGB 2PF4E 4G2KA 5HFMA 3H01A 3CCUV 2NNUA 3ZX6A 3BAAA 3N2KA 1VEWA 3SPHA 3K03A 4GZRB 4IIJA 4LF8B 4LH7A 4LH6A 1AI7A 2IM9A 4U3FH 2WAMA 1YTFB 3ETGA 2YC0A 2QM8A 4MVUA 4PA3A 2UXNA 4J10A 2F1MA 3JD2A 4KUMA 2W0XA 3THOA 2DOSA 3MDSA 2ADPA 4J7JA 1GN6A 2QWOB 2E3CA 2UXXA 4DR6O 1GRJA 2XAFA 5H6RA 2WLLB 1BZKA 3UCSC 1Q5OA 4DYLA 2XT9A 2VQFB 4XBFA 3FX7A 4OX9O 2ZNJA 5AG2A 5CA0B 3QNEA 5IJ0B 2ZE8A 4OPAA 1N36B 3SJCC 3G80A 1K33A 1N8RW 3HR0A 2VQEB 4CH4A 4GYCB 5EIBD 2CK3G 4U3JA 4FLUA 2DJVA 3ZHRA 3FKSG 4K0KB 2IBZH 3JATB 2OYQA 3BA8A 1BHBA 5JVDA 1OCOB 2P5OA 4OXSA 4X20B 4GX2A 3CJHB 4IIJB 2DYRC 3ABTA 2VS0A 2QTSA 3ZMVA 4Q20A 4UV9A 1QR9A 2OCCC 4FPPA 3JCZA 5LA6B 3UM7A 1XL4A 2OWOA 3C90A 2DMXA 2QKAA 3L70H 3CC4V 1KBHA 4D7TA 5JH7A 1M90W 2DYSC 5DEDA 1N0JA 1S5HC 4FFBA 4J80A 2UXDO 1FFXA 3K58A 1JPXA 1Y6XA 3P32A 2EIKB 5F2VO 5DM6V 1B06A 4H37A 4YJ3B 4JTDB 1GK9A 3HKCB 3K06A 2X6BA 2R70A 2BOBC 2GSMB 2DQ0A 1NTMH 3QF7A 4X89A 1IBKB 2FL4A 3ZRWB 1IDSA 2CTQA 1FKAO 2P22C 1OCZC 4C7UA 4PA7A 4QE9A 4R8CA 1L8DA 1W59A 2RDCA 1N34O 4B3RO 1XQ8A 3OMIB 3RYCA 1XNRO 4LF9O 1GM7A 4U3JB 3FAVA 4I55B 4KFMA 3CCSV 1VARA 2KKWA 3KKYA 2ETNA 1EN6A 5GTIZ 3AG4B 2PZSA 1OCRB 1KMIZ 1PNMA 4NXNO 3FD9A 5EBLC 3CYOA 4UCOA 3ZJZA 4CH6A 1Z2GA 3QVNA 4DV4O 1K9MW 5IY5C 1ZL8A 1I94O 1AI5A 5BZBA 1ZLZA 2JS5A 4ZOLA 1MG1A 3X2QC 4L8JA 3TXQA 5FPOA 1YJNV 3J81N 1XNQO 1AB3A 3K5LA 2ZXWC 2EIMC 1S5JA 4UVCA 3H1IH 2YXYA 3VQVA 1CPYA 3JASA 1DGSA 3HKEB 3CC2V 1B6QA 1K92A 4FLWA 4DV6O 1K7DA 1V54B 5IDJA 1EZJA 3K04A 4UUJC 3SDLA 4LF5B 5EBWC 4I4TB 4BWAA 1S72V 4DV1O 3ABMB 4FM2A 2YI8A 4X1KB 3CRCA 5LHGA 1QNMA 1RM1C 1QR8A 2FMLA 4FJCC 4LWSB 3ZHTA 1HDJA 4BW5A 3FAVB 2QJ1A 1I0HA 3OGCC 3JAMN 1AI6A 2WWWA 1MMMA 1IXMA 1SETA 1WPBA 3BFRA 1XEQA 1AJQA 2F23A 5A2QN 4I4TA 3D36A 1SQGA 2WLIA 1P84F 2GTAA 2HG5C 1CXZB 5B1BC 4GX0A 4B3TB 3MAQA 4O4JA 4DR3B 3WB1A 1XHXA 5IYZA 1AVMA 4YHHB 4GKKO 4DV1B 2GUZA 1JQ0A 1M56C 1IVSA 1BGYH 4P2ZA 4OX9B 3CXHF 1BS3A 4J7ZA 4X64B 4BAYA 1E79G 1NTZH 5EC2C 3AG4C 4LNUA 4ZI7B 2YS8A 2DYSB 1W2BU 2AHZA 2ZDIC 1SKVA 3VOUA 4K0KO 2OCCB 2Q9LA 3CRRA 4FFBB 3ZRSA 4TWKA 4NB5A 4W4LA 3T2MA 4PA9A 3JCUZ 3LDCA 1GN4A 1H2SB 3A0RA 1SQXH 2OCHA 1OJHA 1HNXB 1VIBA 2HVJC 3ASOB 2JGDA 4FZ1A 2PI5A 4JGSA 1WAZA 3CJHA 3SYCA 5B3SC 3ZCCA 2N74A 3K59A 1QLNA 5IY5B 4GKJO 2DWDC 1CEZA 2ZIOA 1NTKH 1PPJH 4FVMA 2OTLV 4TSFG 1GH6A 5DN6G 4X1IB 5KUKA 4G27B 4KL1A 5KA6A 1TUBA 5CN0A 5B1NA 1XMOO 2KG7A 4GT1A 4X1YB 4DXWA 1B04A 4UCTA 4ZHQA 5KAFZ 4NKGB 1FJGO 3OW2U 3RYFA 4RQEA 2ILMA 2GBOA 5LA6A 1PM9A 3RGBA 2B1GA 1VQ6V 1ENVA 3DXRB 1GMGA 4JI2B 3B8NA 3JYCA 4LF9B 2EX3A 1GO3F 4JPRA 4UB6Z 2ZQMA 3SPGA 1TUBB 4N23A 1G8MA 2JGUA 2AXTZ 2LP7A 4DV3O 4GKJB 1NI8A 2WLKA 5B1AC 4O2BB 1H38A 2IJKA 3P3NA 1WB8A 2P7TC 2DE0X 5B1BB 3CMEV 3LNNA 4GUNA 2WLLA 1SQFA 1XL6A 5BXZA 1JX9A 2WSSG 5IWAB 1FJGB 3ETDA 3IC9A 4XDKA 1NVPB 3F7VC 1NT2B 4K35A 1VF6C 1ZAUA 2VRZA 2JVDA 2Z0AA 4LCUC 2A3QA 4I55A 1YZBA 3QG5A 4JI4O 5FL7G 1AJNA 2HR3A 4UVAA 5LHHA 3CCLV 1K5QA 4TT3G 2VQFO 1D2DA 2N04A 2Z3YA 3ZEDA 5BMVA 2X6AA 3CCMV 3DXRA 5E79Z 3CE2A 1VQ8V 3H1JH 5B3SB 1EFRG 3ABUA 1PD3A 3ABKC 3ZMUA 1EN4A 3G4SV 3CMAV 4BIZA 3ASNC 2DYRB 3RFRA 1EN5A 3JASB 3WG7C 2UUBO 4JTAB 1WP8A 2RMKB 2R9AA 2ZM6B 4DR5B 1XI1A 2UXBO 3JATA 4YHHO 4JI6B 4CS2A 4MTGA 5FNVA 2QKSA 4DR2B 2NR5A 3OGIB 4IT5A 1B3QA 1OCZB 1NZ6A 2LJ2A 4K3AA 3RYHA 1G4YB 1H2KA 4RUEA 2B9ZA 1PNKA 3E83A 2HJFC 4B3MB 3MHHC 3CB2A 4TOIA 3CP1A 5LMUO 2LW7A 4P9PA 4TUYA 2Q68A 4O4JB 2P06A 1WP7A 4LNUB 3OT7A 4ZI7A 1Y76A 2F4VO 1Q6UA 1O9HA 2ODMA 4JV5B 4WFHA 1MZFA 2YXHA 3D3IA 2PUSA 4DV2O 4JI0O 4CC6A 4MTOA 2P90A 4H44B 4O4HA 3CRQA 3VQYA 1R6NA 4YJ3A 1YF2A 1A32A 1AILA 3RYFB 4JTCB 1XOUA 3ZHVA 4JI3B 1F51A 2A0LA 4BIUA 4MVZA 5CA3A 2EIJC 4DR1B 3STZC 4ZBMA 1NH2B 4WFEA 3GWOA 1WB7A 4R50A 3CCRV 3A0HZ 3BA9A 3BRCA 4DRXA 1VQ4V 2YDEA 4E4EA 2PI4A 1WPXA 4I9QA 3HB3B 1AP5A 3SYPA 4O2BA 3F7YC 5LMNB 3OFNG 3F5WC 5KHIA 1VF5B 3K5OA 4FLYA 5JCOC 1Y74A 1F4MA 4JI7B 2QE7G 2QR4A 2WA4A 1AR4A 2ITCC 4FM1A 5LGUA 2IJJA 1VF7A 1QVGU 3C3SA 1W0JG 4B3SB 3H1LH 5LGTA 1MSDA 4FLZA 1WA8B 5GTHZ 4UCRA 2KG7B 3STLC 2E5LB 3JALB 5IWAO 2RN9A 3I55V 1U97A 3ABKB 1YEWA 5LMUB 1MOFA 4CS4A 4WFGA 2YEVB 4B3RB 5IE9A 1PP9H 2K9PA 4U7OA 1S77D 3JSLA 4I5SA 3ETEA 4J11A 4PI2A 1Q90D 3ZN1A 2K1EA 4JV5O 4FZ0A 2IH1C 3OMNB 4NXNB 1QCEA 1M93A 3LUTB 4QGPA 4HAMA 4DV4B 3QTCA 3OAAG 2BSKA 4X64O 2EULA 3HKDB 2Q7HA 3CRMA 1CP9A 1DF5A 4ICGA 4TQFA 1PV0A 5IJ9A 4FLTA 1US6A 2E75B 4I50B 2XASA 3A8TA 3UT5A 1SF9A 5H2FZ 4AILC 4B7KA 1Q8IA 5FNVB 3U11A 2QGNA 4MVSA 3B2EE 2D2CB 1YHQV 2Q5ZA 1AJPA 2OIEA 5D5PA 5L3DA 1VQPV 2ZE7A 2ZT9B 4JZ2A 2ZM6O 1YTFD 2WLNA 1FXHA 4FFKA 3T1CA 1S0VA 2PTMA 2YIDA 3ASOC 4WCEV 3AEIA 2EJ7A 4IHJB 4RUFA 4QPKA 2AZ2A 5EC1C 2PYLA 1R6KA 3EFFK 3HKCA 3O65A 1BMFG 4UCSA 3CCQV 1PL0A 5CB4B 4LR3A 1HP8A 1NS1A 5CBGA 1AI4A 5K1PA 2HFEC 1JFFA 1R3IC 3GWKC 3T1YO 5CMUA 4FM0A 5LYJB 3T1HO 4X66O 4DUZB 4AQYB 4PDRA 1Q86W 2Q67A 3OR6C 2H8PC 1FXKB 5HFLA 5LXTA 2Q8VA 1RP3B 5BR8B 1AROP 2X6CA 2XAQA 4CH5A 4AI8A 4QJFB 2WLJA 3FB6C 1ZSPA 3IGAC 4F4LA 1HW7A 2HVKC 4X1IA 1HNZO 2EZOA 4D6TH 2HHHO 1HNWB 4CH3A 1I5XA 1R3KC 2B5UA 1TAEA 3B09A 2JEXA 1R6TA 1ZWIC 2LFRA 1GN2A 2VWJA 3ZBHA 3K3WA 4JYAO 1NJIW 3M99B 3SPIA 4JF3A 1UFIA 4JYYA 1WLEA 2JIZG 3ZHUA 1I7FA 4MTXA 5EK0A 3E8BA 2YXLA 5IJ0A 3IAYA 3BABA 1M56B 3S3WA 2QWPB 1RPOA 3SYQA 1SC5B 3OTFA 2OT5A 4DR1O 2CUGA 2IU3A 3G71V 1K5SA 3H9VA 1BQ0A 3ML0A 1XUQA 1FS0G 5GW7A 2ZD9A 3B40A 2UXCB 1H2NA 1KP3A 1HNZB 1JFFB 3AG2C 2A9HA 1QU7A 3D36C 2JDIG 4AHCA 4JYCA 4QNHB 5JH7B 1LUVA 4N21A 3ZRVA 2OIGA 3AK1A 2L35A 3EHBB 1K8AW 1PKXA 1QVFU 1JA8A 2MK3A 2QEXV 2JJ2G 2ZKOA 4DV7B 4XDJA 1GM9A 5B1AB 3ZRWA 4LBEC 4MVMA 3H1HH 1XMQB 5GONA 5EZYB 2Q73A 1X4TA 5LP6A 4JYBA 3DC5A 1JCHA 1URFA 2B1IA 2GHYA 4X88A 4NXMB 5E1AC 4UB8Z 2BTQA 3RT3C 4UCUA 2EILB 5CA1A 3JAWA 3BEHA 4JI6O 3C3TA 2R72A 2KQXA 4X62O 3SPJA 1LR1A 2YIBA 3I56V 4LC1A 4DV7O 5L3BA 3PJSK 2GDSA 3WB2A 5ITZB 1QBZA 4LFCO 4PDMA 1J95A 1U96A 4X9QA 4P30A 2QWRB 2R9RB 3B4SA 2EINC 2CH7B 4LF6B 4NYKA 1J5EB 1BL8A 3W7XA 2RNBA 4TV9A 1FPOA 4HNAB 1N34B 1ZX3A 4WF9V 4NXMO 2YI9A 4O4LB 1NQTA 4UXNA 4YY3B 3ICXA 1F7YA 5ITZA 1OCCC 1SA0B 3J80N 3JAKA 1FYJA 5L3CA 5KA5A 2NN4A 2EILC 5H5NA 4LF4B 1N4CA 3DSQA 3ZRXA 1Q7YW 4DR4O 4LF7O 2G38A 1EZVH 4TUYB 4X1KA 4D7SA 4MVRA 1SQQH 5JJEB 1R73A 4BIOA 4GLXA 3FYIB 3L75H 3ZHQA 5GONB 2CAZC 5LXTB 4FLXA 2CTPA 2LQTA 1KKCA 1EM1A 1L0LH 3AG3C 3ZIAG 5H9CA 1QHTA 4QIWF 1JVMA 3J7AU 2BTQB 2Y0IA 4HBNA 4IHJA 4ZHQB 1GM8A 3ETQA 2FTKA 2ZCEA 3BVOA 3E86A 1MA1A 2YSUB 3W7WA 2CTRA 2Q6AA 3ZHSA 2IJIA 1NH2D 4RAIA 2X0LA 5LMNO 3MHSC 1QQCA 2P4VA 1IXBA 2DN9A 4MW8A 4EFEA 5IT9N 2HHHB 2Y4UA 3ABLC 3VQWA 4DR2O 4YIPA 1DTOA 4X65B 2H3OA 4CBCA 1SZTA 4PA4A 3E8HA 4WFFA 4WBNB 1FFXB 3U10A 4X62B 2VQEO 1XHZA 2HKOA 3ABMC 5LOVA 4J41A 5BMVB 1YJWV 4DW1A 1H8EG 2LGQA 3CRAA 4LFCB 3IJ4A 1N32O 1I94B 1NR7A 4GX5A 2Y4TA 1ZTEA 3D3QA 2Y69B 5J9PC 3T4ZA 2ITDC 5KAIZ 5KX5A 3W7SA 2V4DA 5IYBO 5KHJA 4NTXA 4MTFA 3LDEA 1Q3EA 4P9OA 5LP6C 5L3FA 3RYCB 5B66Z 4G28B 3Q4HB 2IU0A 2DWEC 3IC7A 4TV8B 5TISZ 4W4KA 1YDXA 3DGEA 5JWPA 3JARB 1D5AA 4PI0A 4DV0O 4PA6A 4DV3B 3KZIZ 5KUMA 2E76B 1VQKV 2EIJB 1NKDA 4DR4B 2ZDIA 4JI1O 3N2KB 3E8FA 1N32B 3CCJV 3WU2Z 4GX1A 3JALA 1H2GA 3PN1A 3CX5F 2MW2B 5C8YA 5FPRA 3ZMSA 1I08A 4CS3A 2EINB 2Z5UA 2EJRA 4CC5A 2WLIB 5J2UB 4Z2WA 1RSOB 1YXBA 1NR1A 4YJ2A 3E89A 2QM4A 4DV0B 1IBLB 2PYJA 1AR1B 5J2TA 3DTUB 1OCRC 1E1QG 2BTOA 3CS5A 5KMGA 5EZYA 1M9NA 1P7BA 4UCVA 4DK1A 2LW1A 5KHKA 2Q4PA 2L6LA 4B3SO 2UXDB 5CBHA 3TCUA 2D3OW 2RJZA 3TGUH 1S5LZ 3OUSA 1V55C 1GTOA 1XDCA 3L73H 3TXSA 3RW0A 3S3XA 1LNQA 2BE3A 3T1YB 3UT5B 3LSSA 1SQBH 1YSCA 2C2AA 1SZXA 1SESA 1DK1A 3G67A 2UUAB 2YIAA 4DV5B 1FXKC 3E35A 4EKWA 4O4IB 1Y76B 2HLDG 3HKBA 4DV6B 4FLVA 1JR9A 1NVPD 2A06H 5IYZB 2Y69C 3RYIB 4ASUG 2NLJC 3BHPA 5C8YB 4RWUA 1OCOC 5A9GA 2FYUH 4HYOA 1YCIA 4EEQA 4UVBA 1Y67A 5L3EA 1R3JC 4TQDA 1F4NA 1KECA 1VQNV 1F23A 1KYOF 1RPRA 3H1KH 3FB8C 3JAKB 1BSMA 1H2MA 1XBLA 2ZR2A 2CGNA 1L1FA 3SGIA 2Q7GA 2IW5A 2WLHA 4PD4F 4ZIBA 4EFBA 3CC7V 3E22A 4IYIA 1YVWA 4JASA 5KMGB 4XDLA 5EYPB 1IBMO 3N2GB 3AG7A 4J9YB 1TUEB 3OM3B 4L87A 4QE7A 2F4VB 2E74B 5LGNA 1JJ2U 1V9PA 1O9GA 2W0FC 3BY6A 4OPHA 4JI0B 4FIPC 1H8HG 1IZ3A 1TVKB 3CHXA 4KHPB 4JAUA 4EB6B 5C93A 1RM1B 4JI5O 2JGDB 3ABLB 5DECA 4RQFA 2JK5C 4LF5O 3LDDA 4IGGA 1S3JA 4ZOLB 4LWSA 4IL6Z 2P67A 4X66B 5FLXN 3G6BA 1WJZA 4MVOA 3L9DA 3HPLC 3N27A 4O2AA 2ZE5A 3OMAB 2ZR3A 3EXAA 3F5TA 4EB6A 4JI8O 5BR8O 2YUAA 3T4DA 5JVDB 2XOKG 1LUWA 2RCVA 3OR7C 3CCVV 4PDVA 4DV5O 5KLVH 3TJTA 3BCCH 4LFBO 1TGOA 3APOA 4NTYA 2XAJA 3E22B 2A79B 1E1RG 4O4HB 2HP8A 1K34A 2H94A 1Q43A 4YXWG 5JJJB 4QPJA 1ZUQA 5LL6Y 4R6ZA 4MVQA 1THZA 2JRIA 2ZIMA 2F43G 4H13B 2UUCO 2OTJV 3JARA 1SS3A 3GVMA 4H33A 3RBZA 4E2LA 1M57B 3UO2A 5KX5B 1XNQB 2ZE6A 4LF6O 1WNSA 4DW0A 4LFBB 2EBOA 1FXKA 4JI2O 1JJOA 4HZ3A 3K08A 4DR6B 1KC8W 4FMTA 2F66C 2UUBB 3CCEV 4I0XB 4Z1MG 2WLMA 1YI2V 2CTWA 1IBLO 1VQOV 2FB5A 3R65A 4HNAA 4PJ0Z 2UXBB 1P7GA 4LFAB 3OUFA 1KD1W 2M6YA 1SQVH 2QDOA 4KHPO 5CBFA 4PHZA 1YIJV 4YIOA 1VF6A 1N36O 1X59A 1G6UA 1UPGA 1NU1H 1VQ9V 2CE4A 3RVYA 3ZMZA 3A2FA 3WB0A 1WA8A 3KG2A 1N0NA 2XAGA 3ASNB 2Q69A 4B08A 3CWBH 1ROPA 1XMQO 4TV9B 2V1DA 5JQGA 2W6IG 1MSWD 1KU9A 2W6JG 1QLEB 3WFVA 3ZS8C 3SYAA 4JI4B 4MW3A 3JD3A 1YJ9V 5JCOA 1BT8A 1XREA 1SRYA 2CDYA 5EIBC 1BHAA 2AHYA 1VMGA 4LFAO 2XTAA 3M8AA 2KSDA 3B8MA 3SYOA 4X8AA 1KB9F 3VQXA 4DV2B 4J9ZB 2BSKB 4OGQB 1AP6A 2PGGA 2YIBD 3RYHB 4KP4A 4LF8O 1MNGA 3QO8A 3OTOO 4DUYB 3FYEB 5D5QA 3FB5C 2P4KA 3I5DA 3AG1B 4AQYO 4JI3O 1Y4MA 4I50A 1HR0B 1HWYA 1RFYA 1H2LA 2QKCA 1K3EA 4CZZA 3L74H 1KP2A 2YEVA 3VBBA 1QLEC 2FKXA 4NTWA 2F93B 4DK0A 4JZGA 3TK1A 1BE3H 2Y0PA 3BPZA 3JD1A 1EBOA 1VQLV 3E2EA 1GN3A 2LGWA 2HEPA 1VP7A 2XUMA 4LF7B 3JAWB 1VQ7V 4JYAB 3SJQC 4DR7B 4JI5B 3KCXA 1SERA 1GAXA 2ATKC 4LP8A 1DLBA 1UJWB 3JSNA 3AG1C 5L3GA 3APQA 3WG7B 1PL4A 5LHIA 5CA0A 1XMOB 3TETA 2Q0AA 3RVZA 2JEUA 1Y66A 1Q82W 2ARHA 1Q6IA 2PY5A 2ZXWB 3U0ZA 2BCCH 3OEEG 3AG2B 1PNLA 2CGOA 3AG3B 1M5IA 4KXRA 4K8ZA 2A7WA 3K5MA 1SQPH 2LO1A 2ZINA 3E8GA 1R1BA 3D8CA 3DC6A 1ORQC 1K4DC 1Y74B 4X65O 2XNDG 3LNMB 3OD4A 4ZKIA 3LSUA 1RSOA 2BOCC 3T1HB 3CXCU 4Z1VA 3AK2A 3KCYA 3UQ8A 1IBKO 4MS2A 2Q7EA 4O2AB 5EBMC 4WFBV 2V7QG 2WA3A 4B3MO 3R66A 5JJNB 4R7CA 2UUAO 3OEHG 2AZ0A 1V55B 1K4CC 1SA0A 1XNRB 4B3TO 1HNWO 3W7TA 4DR3O 3HKEA 1FFTB 2N05A 5B5EZ 3UO3A 4GKKB 3EVKA 3W7UA 3G6EV 3UKMA 4FK5C 2QSAA 4UFZA 4JAAA 5EYPA 1FAFA 1FD9A 4JI1B 3NXSA 4DR7O 4A5UB 3JD4A 5IJ9B 2UU9B 2E5LO 3HKDA 2JS3A 3K0DA 3P30A 5IYDO 4JAVA 4B7EA 1AR5A 3FFQA 2P6JA 3L71H 2F95B 1MABG 2KB1A 1M57C 4J42A 1S76D 2UXCO 2O57A 2WPDG 4GCZA 4YY3O 1ZL8B 3O9OA 4K8XA 4F6EA 3SJAC 2GTSA 1I5YA 4F6RB 1R3LC 4MT8A 4LF4O 4DR5O 1KUQA 1TA8A 1V54C 4X1YA 4TV8A 1HNXO 1Z5WA 3LSQA 1FXVA 4PELA 3JD0A 4MSWC 1OV9A 2UU9O 4JI7O 5LOVB 1YITV 2Q0OC 2R9IA 5CB4A 1JMKC 4NVPA 4X20A 5K1XA 2RQ6A 1WN7A 1MZEA 4BR6A 1Z5VA 2ADQB 5KHGA 4WFAV 1Q6HA 5LYJA 3OTOB 4DUYO 2JJ1G 4F6RA 2QWNB 3OE7G 1OHHG 2CH7A 3ZN0A 3X2QB 4DRXB 1HR0O 4J7KA 1JOYA 4I9WA 1N33O 1G1XB 4PDLA 2AGAA 3ZMTA 1VQMV 3IFXA 2VWKA 5J2UA 1OCCB 3K57A 3M7MX 2X7RB 2EIMB 1NBMG 3K0GA 5H6QA 1IX9A 2DQ3A 2XHBA 1K97A 1TVKA 4YJ2B 4NR1A 1OZ0A 2AW9A 3QO7A 3SPCA 3GB7C 4RO2A 4ABMA 3NR7A 5BY1A 3P3PA 4UV8A 3CD6V 3K5NA 2LFSA 1XILA 2DW4A 3CSXA 2QM7A 4DUZO 1P49A 3RYIA 2GUZB 2UUCB 1BCCH 5B1OA 3SR2C 2HJDA 5IYCO 3CPWU 1W0KG 1IBMB 1BQZA 4Q6GA 1COWG 4O4LA 1D5NA 1M4UA 3SJBC 1VQ5V 2IH3C 1Q81W 1KKDA 2M7WA 5J2TB 4I7ZB 1P4RA 4IYHA 3MD0A 4U7NA 4DO2A 2EIKC 3K9SA 5LBQA 1L0NH 2ZNIA 4WBNA 1T5EA 1K73W 1M1KW 2QWQB 3FB7C 4I0XA 3RN4A 2IJHA 3B77A 3RWRD 2XAHA 3L72H 5KHHA 3K79A 2GV9A 2YICA 4JI8B 3QO5A 1KQSU 4O4IA 1IURA 2QTOA 1DF4A 3HKBB 3AK3A 3A0BZ 3N2GA 2Y48A
chains in the Genus database with same CATH topology
4JI2O 1J5EO 2F4VO 4B3TO 1HNWO 5LMNO 4DR3O 1YZBA 4OPHA 4JI4O 4DV6O 3RT3C 1HNZO 2HHHO 4DV2O 4JI0O 5IT9N 1IBLO 4JV5O 1R6TA 4JI6O 4DR2O 3SDLA 4X62O 2VQFO 5BY1A 4JI5O 4DV1O 4JYAO 1D2DA 2UXDO 2VQEO 4DV7O 4LF5O 4KHPO 4X64O 2N74A 4B3SO 1A32A 1N36O 1AILA 4DR7O 4A5UB 1X59A 4LFCO 4GKJO 2E5LO 4DUZO 5FLXN 3JAMN 1N32O 1XMOO 1FKAO 4DR1O 2DOSA 1DK1A 1XMQO 2UXCO 1XEQA 5A2QN 3F5TA 4JI8O 1FJGO 5BR8O 4YY3O 2UUBO 4NXMO 4DR6O 4DV5O 1N34O 1F7YA 4B3RO 4LFBO 1XNRO 3J80N 4LF9O 1FYJA 4LF4O 2ZM6O 4DR5O 1R1BA 5H5NA 1KUQA 4GKKO 2UXBO 4YHHO 4LFAO 3M8AA 1HNXO 4X65O 4DV0O 4OX9O 4DR4O 4LF7O 4NXNO 4DV3O 2UU9O 4JI7O 4OPAA 4DV4O 3O65A 4LF8O 5LL6Y 4JI1O 1NS1A 3OTOO 2ZKOA 2JRIA 1I94O 1IBKO 4DUYO 2UUCO 3T1YO 3T1HO 4X66O 5BXZA 3J7AU 2DJVA 4AQYO 5LMUO 3J81N 4JI3O 1XNQO 5IWAO 4K0KO 2LW7A 1HR0O 4B3MO 3R66A 4LF6O 1AB3A 1N33O 1IBMO 2UUAO 1G1XB 2AGAA 2FKXA 2Z0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 O;  1J5E O;  2F4V O;  4B3T O;  1HNW O;  5LMN O;  4DR3 O;  1YZB A;  4OPH A;  4JI4 O;  4DV6 O;  3RT3 C;  1HNZ O;  2HHH O;  4DV2 O;  4JI0 O;  5IT9 N;  1IBL O;  4JV5 O;  1R6T A;  4JI6 O;  4DR2 O;  3SDL A;  4X62 O;  2VQF O;  5BY1 A;  4JI5 O;  4DV1 O;  4JYA O;  1D2D A;  2UXD O;  2VQE O;  4DV7 O;  4LF5 O;  4KHP O;  4X64 O;  2N74 A;  4B3S O;  1A32 A;  1N36 O;  1AIL A;  4DR7 O;  4A5U B;  1X59 A;  4LFC O;  4GKJ O;  2E5L O;  4DUZ O;  5FLX N;  3JAM N;  1N32 O;  1XMO O;  1FKA O;  4DR1 O;  2DOS A;  1DK1 A;  1XMQ O;  2UXC O;  1XEQ A;  5A2Q N;  3F5T A;  4JI8 O;  1FJG O;  5BR8 O;  4YY3 O;  2UUB O;  4NXM O;  4DR6 O;  4DV5 O;  1N34 O;  1F7Y A;  4B3R O;  4LFB O;  1XNR O;  3J80 N;  4LF9 O;  1FYJ A;  4LF4 O;  2ZM6 O;  4DR5 O;  1R1B A;  5H5N A;  1KUQ A;  4GKK O;  2UXB O;  4YHH O;  4LFA O;  3M8A A;  1HNX O;  4X65 O;  4DV0 O;  4OX9 O;  4DR4 O;  4LF7 O;  4NXN O;  4DV3 O;  2UU9 O;  4JI7 O;  4OPA A;  4DV4 O;  3O65 A;  4LF8 O;  5LL6 Y;  4JI1 O;  1NS1 A;  3OTO O;  2ZKO A;  2JRI A;  1I94 O;  1IBK O;  4DUY O;  2UUC O;  3T1Y O;  3T1H O;  4X66 O;  5BXZ A;  3J7A U;  2DJV A;  4AQY O;  5LMU O;  3J81 N;  4JI3 O;  1XNQ O;  5IWA O;  4K0K O;  2LW7 A;  1HR0 O;  4B3M O;  3R66 A;  4LF6 O;  1AB3 A;  1N33 O;  1IBM O;  2UUA O;  1G1X B;  2AGA A;  2FKX A;  2Z0A A; 
#chains in the Genus database with same CATH topology
 1J5E O;  1N33 B;  5LP6 B;  4H0L B;  3CEI A;  2EZP A;  3K9A A;  4PV1 B;  1GKF A;  3Q4H A;  4BW9 A;  2QA4 V;  5CA1 B;  5JQG B;  2PF4 E;  4G2K A;  5HFM A;  3H01 A;  3CCU V;  2NNU A;  3ZX6 A;  3BAA A;  3N2K A;  1VEW A;  3SPH A;  3K03 A;  4GZR B;  4IIJ A;  4LF8 B;  4LH7 A;  4LH6 A;  1AI7 A;  2IM9 A;  4U3F H;  2WAM A;  1YTF B;  3ETG A;  2YC0 A;  2QM8 A;  4MVU A;  4PA3 A;  2UXN A;  4J10 A;  2F1M A;  3JD2 A;  4KUM A;  2W0X A;  3THO A;  2DOS A;  3MDS A;  2ADP A;  4J7J A;  1GN6 A;  2QWO B;  2E3C A;  2UXX A;  4DR6 O;  1GRJ A;  2XAF A;  5H6R A;  2WLL B;  1BZK A;  3UCS C;  1Q5O A;  4DYL A;  2XT9 A;  2VQF B;  4XBF A;  3FX7 A;  4OX9 O;  2ZNJ A;  5AG2 A;  5CA0 B;  3QNE A;  5IJ0 B;  2ZE8 A;  4OPA A;  1N36 B;  3SJC C;  3G80 A;  1K33 A;  1N8R W;  3HR0 A;  2VQE B;  4CH4 A;  4GYC B;  5EIB D;  2CK3 G;  4U3J A;  4FLU A;  2DJV A;  3ZHR A;  3FKS G;  4K0K B;  2IBZ H;  3JAT B;  2OYQ A;  3BA8 A;  1BHB A;  5JVD A;  1OCO B;  2P5O A;  4OXS A;  4X20 B;  4GX2 A;  3CJH B;  4IIJ B;  2DYR C;  3ABT A;  2VS0 A;  2QTS A;  3ZMV A;  4Q20 A;  4UV9 A;  1QR9 A;  2OCC C;  4FPP A;  3JCZ A;  5LA6 B;  3UM7 A;  1XL4 A;  2OWO A;  3C90 A;  2DMX A;  2QKA A;  3L70 H;  3CC4 V;  1KBH A;  4D7T A;  5JH7 A;  1M90 W;  2DYS C;  5DED A;  1N0J A;  1S5H C;  4FFB A;  4J80 A;  2UXD O;  1FFX A;  3K58 A;  1JPX A;  1Y6X A;  3P32 A;  2EIK B;  5F2V O;  5DM6 V;  1B06 A;  4H37 A;  4YJ3 B;  4JTD B;  1GK9 A;  3HKC B;  3K06 A;  2X6B A;  2R70 A;  2BOB C;  2GSM B;  2DQ0 A;  1NTM H;  3QF7 A;  4X89 A;  1IBK B;  2FL4 A;  3ZRW B;  1IDS A;  2CTQ A;  1FKA O;  2P22 C;  1OCZ C;  4C7U A;  4PA7 A;  4QE9 A;  4R8C A;  1L8D A;  1W59 A;  2RDC A;  1N34 O;  4B3R O;  1XQ8 A;  3OMI B;  3RYC A;  1XNR O;  4LF9 O;  1GM7 A;  4U3J B;  3FAV A;  4I55 B;  4KFM A;  3CCS V;  1VAR A;  2KKW A;  3KKY A;  2ETN A;  1EN6 A;  5GTI Z;  3AG4 B;  2PZS A;  1OCR B;  1KMI Z;  1PNM A;  4NXN O;  3FD9 A;  5EBL C;  3CYO A;  4UCO A;  3ZJZ A;  4CH6 A;  1Z2G A;  3QVN A;  4DV4 O;  1K9M W;  5IY5 C;  1ZL8 A;  1I94 O;  1AI5 A;  5BZB A;  1ZLZ A;  2JS5 A;  4ZOL A;  1MG1 A;  3X2Q C;  4L8J A;  3TXQ A;  5FPO A;  1YJN V;  3J81 N;  1XNQ O;  1AB3 A;  3K5L A;  2ZXW C;  2EIM C;  1S5J A;  4UVC A;  3H1I H;  2YXY A;  3VQV A;  1CPY A;  3JAS A;  1DGS A;  3HKE B;  3CC2 V;  1B6Q A;  1K92 A;  4FLW A;  4DV6 O;  1K7D A;  1V54 B;  5IDJ A;  1EZJ A;  3K04 A;  4UUJ C;  3SDL A;  4LF5 B;  5EBW C;  4I4T B;  4BWA A;  1S72 V;  4DV1 O;  3ABM B;  4FM2 A;  2YI8 A;  4X1K B;  3CRC A;  5LHG A;  1QNM A;  1RM1 C;  1QR8 A;  2FML A;  4FJC C;  4LWS B;  3ZHT A;  1HDJ A;  4BW5 A;  3FAV B;  2QJ1 A;  1I0H A;  3OGC C;  3JAM N;  1AI6 A;  2WWW A;  1MMM A;  1IXM A;  1SET A;  1WPB A;  3BFR A;  1XEQ A;  1AJQ A;  2F23 A;  5A2Q N;  4I4T A;  3D36 A;  1SQG A;  2WLI A;  1P84 F;  2GTA A;  2HG5 C;  1CXZ B;  5B1B C;  4GX0 A;  4B3T B;  3MAQ A;  4O4J A;  4DR3 B;  3WB1 A;  1XHX A;  5IYZ A;  1AVM A;  4YHH B;  4GKK O;  4DV1 B;  2GUZ A;  1JQ0 A;  1M56 C;  1IVS A;  1BGY H;  4P2Z A;  4OX9 B;  3CXH F;  1BS3 A;  4J7Z A;  4X64 B;  4BAY A;  1E79 G;  1NTZ H;  5EC2 C;  3AG4 C;  4LNU A;  4ZI7 B;  2YS8 A;  2DYS B;  1W2B U;  2AHZ A;  2ZDI C;  1SKV A;  3VOU A;  4K0K O;  2OCC B;  2Q9L A;  3CRR A;  4FFB B;  3ZRS A;  4TWK A;  4NB5 A;  4W4L A;  3T2M A;  4PA9 A;  3JCU Z;  3LDC A;  1GN4 A;  1H2S B;  3A0R A;  1SQX H;  2OCH A;  1OJH A;  1HNX B;  1VIB A;  2HVJ C;  3ASO B;  2JGD A;  4FZ1 A;  2PI5 A;  4JGS A;  1WAZ A;  3CJH A;  3SYC A;  5B3S C;  3ZCC A;  2N74 A;  3K59 A;  1QLN A;  5IY5 B;  4GKJ O;  2DWD C;  1CEZ A;  2ZIO A;  1NTK H;  1PPJ H;  4FVM A;  2OTL V;  4TSF G;  1GH6 A;  5DN6 G;  4X1I B;  5KUK A;  4G27 B;  4KL1 A;  5KA6 A;  1TUB A;  5CN0 A;  5B1N A;  1XMO O;  2KG7 A;  4GT1 A;  4X1Y B;  4DXW A;  1B04 A;  4UCT A;  4ZHQ A;  5KAF Z;  4NKG B;  1FJG O;  3OW2 U;  3RYF A;  4RQE A;  2ILM A;  2GBO A;  5LA6 A;  1PM9 A;  3RGB A;  2B1G A;  1VQ6 V;  1ENV A;  3DXR B;  1GMG A;  4JI2 B;  3B8N A;  3JYC A;  4LF9 B;  2EX3 A;  1GO3 F;  4JPR A;  4UB6 Z;  2ZQM A;  3SPG A;  1TUB B;  4N23 A;  1G8M A;  2JGU A;  2AXT Z;  2LP7 A;  4DV3 O;  4GKJ B;  1NI8 A;  2WLK A;  5B1A C;  4O2B B;  1H38 A;  2IJK A;  3P3N A;  1WB8 A;  2P7T C;  2DE0 X;  5B1B B;  3CME V;  3LNN A;  4GUN A;  2WLL A;  1SQF A;  1XL6 A;  5BXZ A;  1JX9 A;  2WSS G;  5IWA B;  1FJG B;  3ETD A;  3IC9 A;  4XDK A;  1NVP B;  3F7V C;  1NT2 B;  4K35 A;  1VF6 C;  1ZAU A;  2VRZ A;  2JVD A;  2Z0A A;  4LCU C;  2A3Q A;  4I55 A;  1YZB A;  3QG5 A;  4JI4 O;  5FL7 G;  1AJN A;  2HR3 A;  4UVA A;  5LHH A;  3CCL V;  1K5Q A;  4TT3 G;  2VQF O;  1D2D A;  2N04 A;  2Z3Y A;  3ZED A;  5BMV A;  2X6A A;  3CCM V;  3DXR A;  5E79 Z;  3CE2 A;  1VQ8 V;  3H1J H;  5B3S B;  1EFR G;  3ABU A;  1PD3 A;  3ABK C;  3ZMU A;  1EN4 A;  3G4S V;  3CMA V;  4BIZ A;  3ASN C;  2DYR B;  3RFR A;  1EN5 A;  3JAS B;  3WG7 C;  2UUB O;  4JTA B;  1WP8 A;  2RMK B;  2R9A A;  2ZM6 B;  4DR5 B;  1XI1 A;  2UXB O;  3JAT A;  4YHH O;  4JI6 B;  4CS2 A;  4MTG A;  5FNV A;  2QKS A;  4DR2 B;  2NR5 A;  3OGI B;  4IT5 A;  1B3Q A;  1OCZ B;  1NZ6 A;  2LJ2 A;  4K3A A;  3RYH A;  1G4Y B;  1H2K A;  4RUE A;  2B9Z A;  1PNK A;  3E83 A;  2HJF C;  4B3M B;  3MHH C;  3CB2 A;  4TOI A;  3CP1 A;  5LMU O;  2LW7 A;  4P9P A;  4TUY A;  2Q68 A;  4O4J B;  2P06 A;  1WP7 A;  4LNU B;  3OT7 A;  4ZI7 A;  1Y76 A;  2F4V O;  1Q6U A;  1O9H A;  2ODM A;  4JV5 B;  4WFH A;  1MZF A;  2YXH A;  3D3I A;  2PUS A;  4DV2 O;  4JI0 O;  4CC6 A;  4MTO A;  2P90 A;  4H44 B;  4O4H A;  3CRQ A;  3VQY A;  1R6N A;  4YJ3 A;  1YF2 A;  1A32 A;  1AIL A;  3RYF B;  4JTC B;  1XOU A;  3ZHV A;  4JI3 B;  1F51 A;  2A0L A;  4BIU A;  4MVZ A;  5CA3 A;  2EIJ C;  4DR1 B;  3STZ C;  4ZBM A;  1NH2 B;  4WFE A;  3GWO A;  1WB7 A;  4R50 A;  3CCR V;  3A0H Z;  3BA9 A;  3BRC A;  4DRX A;  1VQ4 V;  2YDE A;  4E4E A;  2PI4 A;  1WPX A;  4I9Q A;  3HB3 B;  1AP5 A;  3SYP A;  4O2B A;  3F7Y C;  5LMN B;  3OFN G;  3F5W C;  5KHI A;  1VF5 B;  3K5O A;  4FLY A;  5JCO C;  1Y74 A;  1F4M A;  4JI7 B;  2QE7 G;  2QR4 A;  2WA4 A;  1AR4 A;  2ITC C;  4FM1 A;  5LGU A;  2IJJ A;  1VF7 A;  1QVG U;  3C3S A;  1W0J G;  4B3S B;  3H1L H;  5LGT A;  1MSD A;  4FLZ A;  1WA8 B;  5GTH Z;  4UCR A;  2KG7 B;  3STL C;  2E5L B;  3JAL B;  5IWA O;  2RN9 A;  3I55 V;  1U97 A;  3ABK B;  1YEW A;  5LMU B;  1MOF A;  4CS4 A;  4WFG A;  2YEV B;  4B3R B;  5IE9 A;  1PP9 H;  2K9P A;  4U7O A;  1S77 D;  3JSL A;  4I5S A;  3ETE A;  4J11 A;  4PI2 A;  1Q90 D;  3ZN1 A;  2K1E A;  4JV5 O;  4FZ0 A;  2IH1 C;  3OMN B;  4NXN B;  1QCE A;  1M93 A;  3LUT B;  4QGP A;  4HAM A;  4DV4 B;  3QTC A;  3OAA G;  2BSK A;  4X64 O;  2EUL A;  3HKD B;  2Q7H A;  3CRM A;  1CP9 A;  1DF5 A;  4ICG A;  4TQF A;  1PV0 A;  5IJ9 A;  4FLT A;  1US6 A;  2E75 B;  4I50 B;  2XAS A;  3A8T A;  3UT5 A;  1SF9 A;  5H2F Z;  4AIL C;  4B7K A;  1Q8I A;  5FNV B;  3U11 A;  2QGN A;  4MVS A;  3B2E E;  2D2C B;  1YHQ V;  2Q5Z A;  1AJP A;  2OIE A;  5D5P A;  5L3D A;  1VQP V;  2ZE7 A;  2ZT9 B;  4JZ2 A;  2ZM6 O;  1YTF D;  2WLN A;  1FXH A;  4FFK A;  3T1C A;  1S0V A;  2PTM A;  2YID A;  3ASO C;  4WCE V;  3AEI A;  2EJ7 A;  4IHJ B;  4RUF A;  4QPK A;  2AZ2 A;  5EC1 C;  2PYL A;  1R6K A;  3EFF K;  3HKC A;  3O65 A;  1BMF G;  4UCS A;  3CCQ V;  1PL0 A;  5CB4 B;  4LR3 A;  1HP8 A;  1NS1 A;  5CBG A;  1AI4 A;  5K1P A;  2HFE C;  1JFF A;  1R3I C;  3GWK C;  3T1Y O;  5CMU A;  4FM0 A;  5LYJ B;  3T1H O;  4X66 O;  4DUZ B;  4AQY B;  4PDR A;  1Q86 W;  2Q67 A;  3OR6 C;  2H8P C;  1FXK B;  5HFL A;  5LXT A;  2Q8V A;  1RP3 B;  5BR8 B;  1ARO P;  2X6C A;  2XAQ A;  4CH5 A;  4AI8 A;  4QJF B;  2WLJ A;  3FB6 C;  1ZSP A;  3IGA C;  4F4L A;  1HW7 A;  2HVK C;  4X1I A;  1HNZ O;  2EZO A;  4D6T H;  2HHH O;  1HNW B;  4CH3 A;  1I5X A;  1R3K C;  2B5U A;  1TAE A;  3B09 A;  2JEX A;  1R6T A;  1ZWI C;  2LFR A;  1GN2 A;  2VWJ A;  3ZBH A;  3K3W A;  4JYA O;  1NJI W;  3M99 B;  3SPI A;  4JF3 A;  1UFI A;  4JYY A;  1WLE A;  2JIZ G;  3ZHU A;  1I7F A;  4MTX A;  5EK0 A;  3E8B A;  2YXL A;  5IJ0 A;  3IAY A;  3BAB A;  1M56 B;  3S3W A;  2QWP B;  1RPO A;  3SYQ A;  1SC5 B;  3OTF A;  2OT5 A;  4DR1 O;  2CUG A;  2IU3 A;  3G71 V;  1K5S A;  3H9V A;  1BQ0 A;  3ML0 A;  1XUQ A;  1FS0 G;  5GW7 A;  2ZD9 A;  3B40 A;  2UXC B;  1H2N A;  1KP3 A;  1HNZ B;  1JFF B;  3AG2 C;  2A9H A;  1QU7 A;  3D36 C;  2JDI G;  4AHC A;  4JYC A;  4QNH B;  5JH7 B;  1LUV A;  4N21 A;  3ZRV A;  2OIG A;  3AK1 A;  2L35 A;  3EHB B;  1K8A W;  1PKX A;  1QVF U;  1JA8 A;  2MK3 A;  2QEX V;  2JJ2 G;  2ZKO A;  4DV7 B;  4XDJ A;  1GM9 A;  5B1A B;  3ZRW A;  4LBE C;  4MVM A;  3H1H H;  1XMQ B;  5GON A;  5EZY B;  2Q73 A;  1X4T A;  5LP6 A;  4JYB A;  3DC5 A;  1JCH A;  1URF A;  2B1I A;  2GHY A;  4X88 A;  4NXM B;  5E1A C;  4UB8 Z;  2BTQ A;  3RT3 C;  4UCU A;  2EIL B;  5CA1 A;  3JAW A;  3BEH A;  4JI6 O;  3C3T A;  2R72 A;  2KQX A;  4X62 O;  3SPJ A;  1LR1 A;  2YIB A;  3I56 V;  4LC1 A;  4DV7 O;  5L3B A;  3PJS K;  2GDS A;  3WB2 A;  5ITZ B;  1QBZ A;  4LFC O;  4PDM A;  1J95 A;  1U96 A;  4X9Q A;  4P30 A;  2QWR B;  2R9R B;  3B4S A;  2EIN C;  2CH7 B;  4LF6 B;  4NYK A;  1J5E B;  1BL8 A;  3W7X A;  2RNB A;  4TV9 A;  1FPO A;  4HNA B;  1N34 B;  1ZX3 A;  4WF9 V;  4NXM O;  2YI9 A;  4O4L B;  1NQT A;  4UXN A;  4YY3 B;  3ICX A;  1F7Y A;  5ITZ A;  1OCC C;  1SA0 B;  3J80 N;  3JAK A;  1FYJ A;  5L3C A;  5KA5 A;  2NN4 A;  2EIL C;  5H5N A;  4LF4 B;  1N4C A;  3DSQ A;  3ZRX A;  1Q7Y W;  4DR4 O;  4LF7 O;  2G38 A;  1EZV H;  4TUY B;  4X1K A;  4D7S A;  4MVR A;  1SQQ H;  5JJE B;  1R73 A;  4BIO A;  4GLX A;  3FYI B;  3L75 H;  3ZHQ A;  5GON B;  2CAZ C;  5LXT B;  4FLX A;  2CTP A;  2LQT A;  1KKC A;  1EM1 A;  1L0L H;  3AG3 C;  3ZIA G;  5H9C A;  1QHT A;  4QIW F;  1JVM A;  3J7A U;  2BTQ B;  2Y0I A;  4HBN A;  4IHJ A;  4ZHQ B;  1GM8 A;  3ETQ A;  2FTK A;  2ZCE A;  3BVO A;  3E86 A;  1MA1 A;  2YSU B;  3W7W A;  2CTR A;  2Q6A A;  3ZHS A;  2IJI A;  1NH2 D;  4RAI A;  2X0L A;  5LMN O;  3MHS C;  1QQC A;  2P4V A;  1IXB A;  2DN9 A;  4MW8 A;  4EFE A;  5IT9 N;  2HHH B;  2Y4U A;  3ABL C;  3VQW A;  4DR2 O;  4YIP A;  1DTO A;  4X65 B;  2H3O A;  4CBC A;  1SZT A;  4PA4 A;  3E8H A;  4WFF A;  4WBN B;  1FFX B;  3U10 A;  4X62 B;  2VQE O;  1XHZ A;  2HKO A;  3ABM C;  5LOV A;  4J41 A;  5BMV B;  1YJW V;  4DW1 A;  1H8E G;  2LGQ A;  3CRA A;  4LFC B;  3IJ4 A;  1N32 O;  1I94 B;  1NR7 A;  4GX5 A;  2Y4T A;  1ZTE A;  3D3Q A;  2Y69 B;  5J9P C;  3T4Z A;  2ITD C;  5KAI Z;  5KX5 A;  3W7S A;  2V4D A;  5IYB O;  5KHJ A;  4NTX A;  4MTF A;  3LDE A;  1Q3E A;  4P9O A;  5LP6 C;  5L3F A;  3RYC B;  5B66 Z;  4G28 B;  3Q4H B;  2IU0 A;  2DWE C;  3IC7 A;  4TV8 B;  5TIS Z;  4W4K A;  1YDX A;  3DGE A;  5JWP A;  3JAR B;  1D5A A;  4PI0 A;  4DV0 O;  4PA6 A;  4DV3 B;  3KZI Z;  5KUM A;  2E76 B;  1VQK V;  2EIJ B;  1NKD A;  4DR4 B;  2ZDI A;  4JI1 O;  3N2K B;  3E8F A;  1N32 B;  3CCJ V;  3WU2 Z;  4GX1 A;  3JAL A;  1H2G A;  3PN1 A;  3CX5 F;  2MW2 B;  5C8Y A;  5FPR A;  3ZMS A;  1I08 A;  4CS3 A;  2EIN B;  2Z5U A;  2EJR A;  4CC5 A;  2WLI B;  5J2U B;  4Z2W A;  1RSO B;  1YXB A;  1NR1 A;  4YJ2 A;  3E89 A;  2QM4 A;  4DV0 B;  1IBL B;  2PYJ A;  1AR1 B;  5J2T A;  3DTU B;  1OCR C;  1E1Q G;  2BTO A;  3CS5 A;  5KMG A;  5EZY A;  1M9N A;  1P7B A;  4UCV A;  4DK1 A;  2LW1 A;  5KHK A;  2Q4P A;  2L6L A;  4B3S O;  2UXD B;  5CBH A;  3TCU A;  2D3O W;  2RJZ A;  3TGU H;  1S5L Z;  3OUS A;  1V55 C;  1GTO A;  1XDC A;  3L73 H;  3TXS A;  3RW0 A;  3S3X A;  1LNQ A;  2BE3 A;  3T1Y B;  3UT5 B;  3LSS A;  1SQB H;  1YSC A;  2C2A A;  1SZX A;  1SES A;  1DK1 A;  3G67 A;  2UUA B;  2YIA A;  4DV5 B;  1FXK C;  3E35 A;  4EKW A;  4O4I B;  1Y76 B;  2HLD G;  3HKB A;  4DV6 B;  4FLV A;  1JR9 A;  1NVP D;  2A06 H;  5IYZ B;  2Y69 C;  3RYI B;  4ASU G;  2NLJ C;  3BHP A;  5C8Y B;  4RWU A;  1OCO C;  5A9G A;  2FYU H;  4HYO A;  1YCI A;  4EEQ A;  4UVB A;  1Y67 A;  5L3E A;  1R3J C;  4TQD A;  1F4N A;  1KEC A;  1VQN V;  1F23 A;  1KYO F;  1RPR A;  3H1K H;  3FB8 C;  3JAK B;  1BSM A;  1H2M A;  1XBL A;  2ZR2 A;  2CGN A;  1L1F A;  3SGI A;  2Q7G A;  2IW5 A;  2WLH A;  4PD4 F;  4ZIB A;  4EFB A;  3CC7 V;  3E22 A;  4IYI A;  1YVW A;  4JAS A;  5KMG B;  4XDL A;  5EYP B;  1IBM O;  3N2G B;  3AG7 A;  4J9Y B;  1TUE B;  3OM3 B;  4L87 A;  4QE7 A;  2F4V B;  2E74 B;  5LGN A;  1JJ2 U;  1V9P A;  1O9G A;  2W0F C;  3BY6 A;  4OPH A;  4JI0 B;  4FIP C;  1H8H G;  1IZ3 A;  1TVK B;  3CHX A;  4KHP B;  4JAU A;  4EB6 B;  5C93 A;  1RM1 B;  4JI5 O;  2JGD B;  3ABL B;  5DEC A;  4RQF A;  2JK5 C;  4LF5 O;  3LDD A;  4IGG A;  1S3J A;  4ZOL B;  4LWS A;  4IL6 Z;  2P67 A;  4X66 B;  5FLX N;  3G6B A;  1WJZ A;  4MVO A;  3L9D A;  3HPL C;  3N27 A;  4O2A A;  2ZE5 A;  3OMA B;  2ZR3 A;  3EXA A;  3F5T A;  4EB6 A;  4JI8 O;  5BR8 O;  2YUA A;  3T4D A;  5JVD B;  2XOK G;  1LUW A;  2RCV A;  3OR7 C;  3CCV V;  4PDV A;  4DV5 O;  5KLV H;  3TJT A;  3BCC H;  4LFB O;  1TGO A;  3APO A;  4NTY A;  2XAJ A;  3E22 B;  2A79 B;  1E1R G;  4O4H B;  2HP8 A;  1K34 A;  2H94 A;  1Q43 A;  4YXW G;  5JJJ B;  4QPJ A;  1ZUQ A;  5LL6 Y;  4R6Z A;  4MVQ A;  1THZ A;  2JRI A;  2ZIM A;  2F43 G;  4H13 B;  2UUC O;  2OTJ V;  3JAR A;  1SS3 A;  3GVM A;  4H33 A;  3RBZ A;  4E2L A;  1M57 B;  3UO2 A;  5KX5 B;  1XNQ B;  2ZE6 A;  4LF6 O;  1WNS A;  4DW0 A;  4LFB B;  2EBO A;  1FXK A;  4JI2 O;  1JJO A;  4HZ3 A;  3K08 A;  4DR6 B;  1KC8 W;  4FMT A;  2F66 C;  2UUB B;  3CCE V;  4I0X B;  4Z1M G;  2WLM A;  1YI2 V;  2CTW A;  1IBL O;  1VQO V;  2FB5 A;  3R65 A;  4HNA A;  4PJ0 Z;  2UXB B;  1P7G A;  4LFA B;  3OUF A;  1KD1 W;  2M6Y A;  1SQV H;  2QDO A;  4KHP O;  5CBF A;  4PHZ A;  1YIJ V;  4YIO A;  1VF6 A;  1N36 O;  1X59 A;  1G6U A;  1UPG A;  1NU1 H;  1VQ9 V;  2CE4 A;  3RVY A;  3ZMZ A;  3A2F A;  3WB0 A;  1WA8 A;  3KG2 A;  1N0N A;  2XAG A;  3ASN B;  2Q69 A;  4B08 A;  3CWB H;  1ROP A;  1XMQ O;  4TV9 B;  2V1D A;  5JQG A;  2W6I G;  1MSW D;  1KU9 A;  2W6J G;  1QLE B;  3WFV A;  3ZS8 C;  3SYA A;  4JI4 B;  4MW3 A;  3JD3 A;  1YJ9 V;  5JCO A;  1BT8 A;  1XRE A;  1SRY A;  2CDY A;  5EIB C;  1BHA A;  2AHY A;  1VMG A;  4LFA O;  2XTA A;  3M8A A;  2KSD A;  3B8M A;  3SYO A;  4X8A A;  1KB9 F;  3VQX A;  4DV2 B;  4J9Z B;  2BSK B;  4OGQ B;  1AP6 A;  2PGG A;  2YIB D;  3RYH B;  4KP4 A;  4LF8 O;  1MNG A;  3QO8 A;  3OTO O;  4DUY B;  3FYE B;  5D5Q A;  3FB5 C;  2P4K A;  3I5D A;  3AG1 B;  4AQY O;  4JI3 O;  1Y4M A;  4I50 A;  1HR0 B;  1HWY A;  1RFY A;  1H2L A;  2QKC A;  1K3E A;  4CZZ A;  3L74 H;  1KP2 A;  2YEV A;  3VBB A;  1QLE C;  2FKX A;  4NTW A;  2F93 B;  4DK0 A;  4JZG A;  3TK1 A;  1BE3 H;  2Y0P A;  3BPZ A;  3JD1 A;  1EBO A;  1VQL V;  3E2E A;  1GN3 A;  2LGW A;  2HEP A;  1VP7 A;  2XUM A;  4LF7 B;  3JAW B;  1VQ7 V;  4JYA B;  3SJQ C;  4DR7 B;  4JI5 B;  3KCX A;  1SER A;  1GAX A;  2ATK C;  4LP8 A;  1DLB A;  1UJW B;  3JSN A;  3AG1 C;  5L3G A;  3APQ A;  3WG7 B;  1PL4 A;  5LHI A;  5CA0 A;  1XMO B;  3TET A;  2Q0A A;  3RVZ A;  2JEU A;  1Y66 A;  1Q82 W;  2ARH A;  1Q6I A;  2PY5 A;  2ZXW B;  3U0Z A;  2BCC H;  3OEE G;  3AG2 B;  1PNL A;  2CGO A;  3AG3 B;  1M5I A;  4KXR A;  4K8Z A;  2A7W A;  3K5M A;  1SQP H;  2LO1 A;  2ZIN A;  3E8G A;  1R1B A;  3D8C A;  3DC6 A;  1ORQ C;  1K4D C;  1Y74 B;  4X65 O;  2XND G;  3LNM B;  3OD4 A;  4ZKI A;  3LSU A;  1RSO A;  2BOC C;  3T1H B;  3CXC U;  4Z1V A;  3AK2 A;  3KCY A;  3UQ8 A;  1IBK O;  4MS2 A;  2Q7E A;  4O2A B;  5EBM C;  4WFB V;  2V7Q G;  2WA3 A;  4B3M O;  3R66 A;  5JJN B;  4R7C A;  2UUA O;  3OEH G;  2AZ0 A;  1V55 B;  1K4C C;  1SA0 A;  1XNR B;  4B3T O;  1HNW O;  3W7T A;  4DR3 O;  3HKE A;  1FFT B;  2N05 A;  5B5E Z;  3UO3 A;  4GKK B;  3EVK A;  3W7U A;  3G6E V;  3UKM A;  4FK5 C;  2QSA A;  4UFZ A;  4JAA A;  5EYP A;  1FAF A;  1FD9 A;  4JI1 B;  3NXS A;  4DR7 O;  4A5U B;  3JD4 A;  5IJ9 B;  2UU9 B;  2E5L O;  3HKD A;  2JS3 A;  3K0D A;  3P30 A;  5IYD O;  4JAV A;  4B7E A;  1AR5 A;  3FFQ A;  2P6J A;  3L71 H;  2F95 B;  1MAB G;  2KB1 A;  1M57 C;  4J42 A;  1S76 D;  2UXC O;  2O57 A;  2WPD G;  4GCZ A;  4YY3 O;  1ZL8 B;  3O9O A;  4K8X A;  4F6E A;  3SJA C;  2GTS A;  1I5Y A;  4F6R B;  1R3L C;  4MT8 A;  4LF4 O;  4DR5 O;  1KUQ A;  1TA8 A;  1V54 C;  4X1Y A;  4TV8 A;  1HNX O;  1Z5W A;  3LSQ A;  1FXV A;  4PEL A;  3JD0 A;  4MSW C;  1OV9 A;  2UU9 O;  4JI7 O;  5LOV B;  1YIT V;  2Q0O C;  2R9I A;  5CB4 A;  1JMK C;  4NVP A;  4X20 A;  5K1X A;  2RQ6 A;  1WN7 A;  1MZE A;  4BR6 A;  1Z5V A;  2ADQ B;  5KHG A;  4WFA V;  1Q6H A;  5LYJ A;  3OTO B;  4DUY O;  2JJ1 G;  4F6R A;  2QWN B;  3OE7 G;  1OHH G;  2CH7 A;  3ZN0 A;  3X2Q B;  4DRX B;  1HR0 O;  4J7K A;  1JOY A;  4I9W A;  1N33 O;  1G1X B;  4PDL A;  2AGA A;  3ZMT A;  1VQM V;  3IFX A;  2VWK A;  5J2U A;  1OCC B;  3K57 A;  3M7M X;  2X7R B;  2EIM B;  1NBM G;  3K0G A;  5H6Q A;  1IX9 A;  2DQ3 A;  2XHB A;  1K97 A;  1TVK A;  4YJ2 B;  4NR1 A;  1OZ0 A;  2AW9 A;  3QO7 A;  3SPC A;  3GB7 C;  4RO2 A;  4ABM A;  3NR7 A;  5BY1 A;  3P3P A;  4UV8 A;  3CD6 V;  3K5N A;  2LFS A;  1XIL A;  2DW4 A;  3CSX A;  2QM7 A;  4DUZ O;  1P49 A;  3RYI A;  2GUZ B;  2UUC B;  1BCC H;  5B1O A;  3SR2 C;  2HJD A;  5IYC O;  3CPW U;  1W0K G;  1IBM B;  1BQZ A;  4Q6G A;  1COW G;  4O4L A;  1D5N A;  1M4U A;  3SJB C;  1VQ5 V;  2IH3 C;  1Q81 W;  1KKD A;  2M7W A;  5J2T B;  4I7Z B;  1P4R A;  4IYH A;  3MD0 A;  4U7N A;  4DO2 A;  2EIK C;  3K9S A;  5LBQ A;  1L0N H;  2ZNI A;  4WBN A;  1T5E A;  1K73 W;  1M1K W;  2QWQ B;  3FB7 C;  4I0X A;  3RN4 A;  2IJH A;  3B77 A;  3RWR D;  2XAH A;  3L72 H;  5KHH A;  3K79 A;  2GV9 A;  2YIC A;  4JI8 B;  3QO5 A;  1KQS U;  4O4I A;  1IUR A;  2QTO A;  1DF4 A;  3HKB B;  3AK3 A;  3A0B Z;  3N2G A;  2Y48 A; 
#chains in the Genus database with same CATH homology
 4JI2 O;  1J5E O;  2F4V O;  4B3T O;  1HNW O;  5LMN O;  4DR3 O;  1YZB A;  4OPH A;  4JI4 O;  4DV6 O;  3RT3 C;  1HNZ O;  2HHH O;  4DV2 O;  4JI0 O;  5IT9 N;  1IBL O;  4JV5 O;  1R6T A;  4JI6 O;  4DR2 O;  3SDL A;  4X62 O;  2VQF O;  5BY1 A;  4JI5 O;  4DV1 O;  4JYA O;  1D2D A;  2UXD O;  2VQE O;  4DV7 O;  4LF5 O;  4KHP O;  4X64 O;  2N74 A;  4B3S O;  1A32 A;  1N36 O;  1AIL A;  4DR7 O;  4A5U B;  1X59 A;  4LFC O;  4GKJ O;  2E5L O;  4DUZ O;  5FLX N;  3JAM N;  1N32 O;  1XMO O;  1FKA O;  4DR1 O;  2DOS A;  1DK1 A;  1XMQ O;  2UXC O;  1XEQ A;  5A2Q N;  3F5T A;  4JI8 O;  1FJG O;  5BR8 O;  4YY3 O;  2UUB O;  4NXM O;  4DR6 O;  4DV5 O;  1N34 O;  1F7Y A;  4B3R O;  4LFB O;  1XNR O;  3J80 N;  4LF9 O;  1FYJ A;  4LF4 O;  2ZM6 O;  4DR5 O;  1R1B A;  5H5N A;  1KUQ A;  4GKK O;  2UXB O;  4YHH O;  4LFA O;  3M8A A;  1HNX O;  4X65 O;  4DV0 O;  4OX9 O;  4DR4 O;  4LF7 O;  4NXN O;  4DV3 O;  2UU9 O;  4JI7 O;  4OPA A;  4DV4 O;  3O65 A;  4LF8 O;  5LL6 Y;  4JI1 O;  1NS1 A;  3OTO O;  2ZKO A;  2JRI A;  1I94 O;  1IBK O;  4DUY O;  2UUC O;  3T1Y O;  3T1H O;  4X66 O;  5BXZ A;  3J7A U;  2DJV A;  4AQY O;  5LMU O;  3J81 N;  4JI3 O;  1XNQ O;  5IWA O;  4K0K O;  2LW7 A;  1HR0 O;  4B3M O;  3R66 A;  4LF6 O;  1AB3 A;  1N33 O;  1IBM O;  2UUA O;  1G1X B;  2AGA A;  2FKX A;  2Z0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...