1R1CA

Pseudomonas aeruginosa w48f/y72f/h83q/y108w-azurin re(phen)(co)3(his107)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEHWMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spectroscopy and reactivity of a photogenerated tryptophan radical in a structurally defined protein environment
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 35
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1r1cA00
2FQEA 2PPEA 2VM3A 4A68A 1SFHA 2QPDB 2UX6A 4YL4A 1N68A 1PNDA 5E9NA 8PAZA 3UAAA 4KOBA 1BEXA 2QT6A 2YAQA 1AQ8A 3FPYA 3N55A 1E30A 3ZX1A 5D4HA 2HRGA 3WI9A 3C75A 1NIAA 5I26A 2PCYA 4PCYA 2FNWA 1AZRA 1EZLA 3UABA 2WO2B 1NIBA 1AZNA 1CUOA 5I28A 2HLEB 1SHWA 1ZIAA 3QJTB 3NJKA 4GP5B 5EHFA 3WNIA 4FAAB 1PCSA 3QJSB 2AFNA 1BYPA 1KCBA 3T6ZA 1GS8A 4G7RB 1PNCA 3FPXA 4G72B 2XUWA 1SF5A 1M9WA 4X4KA 3H4HA 4Q8BA 4DPAX 2PPDA 4WKXA 4F2FA 2XV3A 4KO5A 2HZHA 4G70B 1AS7A 3BVDB 4GY4A 3TBCA 2R7EB 1RZPA 5F7BA 2VN3A 3T9WA 5B1BB 2AVFA 3NSDA 1JERA 3NJMA 4KNUA 4HHGA 1L9RA 1PAZA 4BWTA 2XX1A 1NDTA 3BQVA 4DPCX 4E9YA 2YQBA 2I7OA 3G5WA 1PY0A 1NIFA 5I5IA 1FFTB 3NJGA 1MZYA 1NPJA 2FQGA 4A2EA 4BXVA 2GIMA 1AOZA 3SBRA 3CZUB 4HCFA 1ASPA 1AZUA 1L9SA 1NTDA 4A67A 4MFHA 5B7MA 2FT6A 2OJ1A 3CDZB 3FSVA 4E9WA 1ET7A 1ID2A 3S3CB 4BK5C 4CSPA 1KV7A 3MBWB 4BXSV 9PCYA 4DPBX 2UXVA 2FJSA 1FA4A 1F56A 2XWZA 3V9CA 2XVBA 2QPEB 2X87A 4GXFA 2VM4A 2I85A 5TK2A 3EH3B 2TSBA 1WA0X 1ZDQA 1BQKA 1URIA 4PAZA 3ABMB 4F2EA 3QJQB 2EINB 3CVDA 5D4IA 2BW4A 1NZRA 2VSKB 2CUAA 1E5ZA 3FU7B 3GXUB 4ZK8A 1ILUA 3AG4B 2B3IA 1OCRB 4M4RB 2VW4A 3QPKA 3TBBA 1XB6A 4K9JA 6PAZA 2XX0A 4HCIA 1MG3C 5B7EA 1QLEB 3PAVA 3NP3A 4JHUA 2IWFA 2IWKA 3S3DB 3GDCA 1GYCA 1MG2C 4AKPA 2GB2A 1IKOP 4HALA 3NJFA 2CALA 3UADA 1L9TA 3FQ2A 3X1NA 5LDUA 3EH5B 2BW5A 5I6NA 3PXLA 3WIAA 1X9UA 4WTQA 2BP8B 3H4FA 1KBVA 4DP1X 5F7AA 3NT0A 2FT7A 4F7KA 1AACA 3IBOA 1NINA 5B1JC 5I6MA 1V55B 1RZQA 1ETJA 2YAPA 3T6VA 4RH4A 1X9RA 1T5KA 1PLCA 3FYIB 1NPNA 1PLBA 1PZCA 2JFCA 3OQRA 5I5JA 1HAWA 3ABGA 4AKOA 1E65A 2IDSA 5B1AB 3ZBMA 5PCYA 1B3IA 2VMJA 3IEAA 5I5MA 1SHXA 4DP4X 1GR7A 1AG6A 4G7SB 4YSAA 3HB3B 1KDIA 3TA4D 4E9SA 1OE3A 3DKHA 1AAJA 1ASOA 1NWOA 1M56B 1OCZB 3CVCA 1RKRA 2EILB 3NSCA 4YSPA 2XXGA 2BZ7A 3EF4A 4AX3A 2DY2A 3X1BA 2EIJB 4G7QB 2PP8A 3KW7A 3JTBA 1RCYA 2YXVA 2GC4C 3FSWA 3KW8A 1GS7A 6PCYA 2AZUA 3S3BB 2MTAA 1J5DA 3AY2A 1HAUA 3PAUA 5B7FA 4A2GA 1DZ0A 1N70A 3AG3B 3FQYA 3WNJA 1OE1A 4BWUA 1PLAA 2BP0B 3EH4B 4DP7X 2J55A 4JHVA 2RACA 2HRHA 1WS7A 3NYKA 1QHQA 2AZAA 3WKQA 2HXAA 4AKQA 1IUZA 1L9OA 1HFUA 1TKWA 2BP8A 2YAEA 3AW5A 3CVBA 3IE9A 4N8UA 4QKTA 2ZXWB 4AI7A 3PPSA 1PZBA 2VSMB 1ET8A 1QNIA 2GSMB 1NIEA 1TU2A 3QJUB 2YAOA 2J5WA 4TXVB 2GHZA 1NICA 1NIDA 3SQRA 1PF3A 2P80A 3S8FB 1ET5A 1BAWA 3NSFA 2DWSA 4KO9A 3ZIYA 2PLTA 2UXGA 2A3TA 2TSAA 5A7EA 1WA2X 1PZAA 1AZBA 3TU6A 3FSZA 1CC3A 3WG7B 2BWDA 4KOCA 3ABKB 1SNRA 2PP9A 3RYMA 3DTUB 1BQ5A 2IDQA 3AG2B 4A66A 2Q5BA 1A65A 4BDVA 1E67A 1J5CA 2YAFA 1KCWA 2MRYA 3X1FA 1UATA 1ASQA 3TASA 2OV0A 2P80D 3FYEB 4HAKA 2JKWA 4DP0X 4P5RA 1ZIBA 3FU7A 1IC0A 3NP4A 3UACA 1A4BA 4DP8X 4ENZA 2UX7A 2BP0A 4UAHA 4BWWA 1GY1A 3N2JA 1JVOA 1AG0A 1JZGA 4HCGA 5B1JA 5I6LA 1OCOB 2H3XC 1J9QA 1CYXA 3T6WA 1JZEA 1ZV2A 3NJHA 3OMAB 2I7SA 3NJJA 5IY5B 1A4CA 3HEIB 1DYZA 4N4YB 1IBYA 3FU8A 2FWLB 4P5SA 1J9RA 1OCCB 2HX8A 3FSAA 1CYWA 1KDJA 4EF3A 1SDDB 1A4AA 2IH8A 3DIVA 3NJIA 1I53A 1OF0A 1JZIA 4HIPA 3UAEA 1KYAA 3ZDWA 2NRDA 4YVNA 1ILSA 2IH9A 1TEFA 1JOIA 3GYRA 3SBQA 3X1EA 5B1KA 2FT8A 2BZCA 2ZOOA 2AANA 3AZUA 1IBZA 1MZZA 2CJ3A 2XU9A 2EIKB 4DP2X 5AFAA 3ERXA 4JKNA 2BO0A 1MDAA 5I6OA 4GP4B 2YAMA 3OD3A 4DP5X 1WA1X 2N0MA 3PAZA 5I6PA 3PCYA 2UXTA 1JXDA 3PLYA 3UGEA 1EHKB 3SBPA 3S8GB 1NWPA 3OMIB 2W8CA 1PMYA 3ASNB 2XV0A 1A8ZA 1SJMA 5B3SB 2J56A 1BXUA 1JZHA 1CURA 2HX9A 3FS9A 1KBWA 1V54B 2XXFA 2VW7A 1BXVA 1JVLA 1XB3A 2YXWA 1BYOA 4HZ1A 1AZCA 1L9PA 4YSDA 3ASOB 1OV8A 2VW6A 1R1CA 2B08A 5D4JA 2ZONA 2H47C 3OMNB 4E9RA 4DP9X 1AS6A 1V10A 1GY2A 1W6LA 4NERA 2GI0A 1TEGA 2OCCB 4A2DA 4L0PB 2IWEA 4HHWA 2ZWNA 2PPAA 4G71B 2DWTA 4YSOA 1BQRA 3U25A 4YSCA 4W9ZA 3H56A 7PAZA 4QLWA 1WS8A 2IDTA 1YLBB 1XB8A 2BHFA 4NAJA 2YAHA 3ABLB 2YARA 1JXGA 3EHBB 1JXFA 1J9SA 2CBPA 4UF7C 1SF3A 3FU9A 2XYBA 2Y1AA 4YSRA 1A3ZA 4E9TA 1WAEA 2EIMB 3QQXA 3IN2A 1AR1B 3CDZA 1OOWA 2QDVA 3NJNA 4GYBA 3X1GA 2DYRB 4KNSA 2J57A 2IDFA 7PCYA 4KO6A 2UXFA 3JT2A 3D12B 2HX7A 3NSYA 1SFDA 3T6XA 5ANHA 4YSEA 3AG1B 5AZUA 2PPCA 2QDWA 2LLNA 4YSUA 2FTAA 5I6KA 1KGYE 4BDVB 2H5UA 2FQFA 4KO7A 1E5YA 3QJVB 5FC9A 1VLXA 2IDUA 4DP6X 4YSTA 4YVUA 2GC7C 4YSQA 3L45A 3T71A 2JXMA 2W88A 2XV2A 3V9EA 2PPFA 3IN0A 1GW0A 4KNTA 5AKRA 2CCWA 1M57B 1XMEB 4NB7A 2IAAC 2PCFA 3OM3B 2DYSB 4A2HA 1L9QA 1J9TA 3MX0B 2E86A 4UANA 4AZUA 2GBAA 3QJRB 2XLLA 2Y69B 1FWXA 3WKPA 5PAZA 2WO3B 4M3HA 4CSZA 2R7EA 3X2QB 1AANA 4E9XA 4A2FA 1W6WA 1AIZA 3FQ1A 3FT0A 4E9QA 4FA7B 1ADWA 1ZDSA 4W1TA 1GS6X 2PP7A 1GSKA 1JZFA 1SDDA 2DV6A 4Q89A 4E9VA 2CAKA 1AS8A 1OE2A 5TK4A 4YSSA 2Q9OA 4GP8B 1BXAA 3CG8A 1W8EA 2FQDA 2BWIA 2WSDA 3NJLA 2X88A 1ZPUA 1JZJA
chains in the Genus database with same CATH superfamily
4N0UA 2YD4A 1XF5A 5C0EB 4XCYB 2VLME 3CFCL 1PNDA 1G6RL 1IE4A 2HSIA 2V8LA 1DANU 2YAQA 4QHUA 1J1OL 2JB5L 4CN4A 1EANA 2FR4B 4XNBA 3FRPA 4OAWB 3CC5A 4F8NA 3MGTA 1X5XA 4GFXA 4XRCA 4O2CB 1U3NA 1ZTXL 3H2PA 3U4KA 5K9QI 2RHEA 1ETZB 5LN8A 2YRBA 3BE1H 2MQGA 2R9HD 5HVHC 3LQZA 1BIIA 1SY6A 3WXVH 2Q87A 4W6YB 43CAA 1V8HA 3PUUA 2OTWB 2BVOB 3B7UX 5MEPA 1ZIAA 2FRGP 1J10A 2X0VA 2AFNA 2K4WA 2OTUB 1HL4A 3OJDA 5EU7E 5GGVY 2AAAA 4HJ1A 5I1CH 5D7LB 5BZWA 5FM5M 5LQBL 3RPBA 3TT1L 5EUOA 4GBXA 4OLXL 5ILTH 4WKXA 2YZ8A 4ZW8A 3NZHL 3SY0B 2P3YA 2GJ6D 1UUNA 3L4CA 1IKFL 3VXQA 4FQPA 1QUNA 5I2IA 5IZ7A 3T1FA 4FQIH 4H26A 5D93C 4M00A 1JD7A 2FL5A 1OL0A 3NSDA 5I8CB 3OB0H 3EYOA 1KMGA 1NDTA 1UEMA 4PRAA 1QPPA 1VACA 4LP4A 3T65B 2Z31D 3CUPA 3TC9A 1JZ2A 5HGAA 2BOBB 4MLIA 1NOLA 1AYOA 5E6ZA 3QZPA 4DEPB 5I6XB 1BQUA 3ELAT 5HJDA 4EZKA 3H0TB 1DP0A 4PBVC 4M8QA 4LSTH 5JDJA 5BUAA 3W0WD 2QHLA 1WAAA 2WC7A 3QDMA 2LHAA 4OZFH 2EH7H 4F27A 3JV5A 3KPPA 1HHKA 1MCPH 3NRPA 2UXVA 2ATPB 4X6EA 5C3TA 3OKLA 3BUQA 5MEOB 2Q7YB 4NQXA 3V10A 1AOHA 4OT1L 3L5IA 2MKLC 4E0RB 4K94C 4OI7A 5ACZB 4QOKD 5I76B 3QQ3A 3FULA 5JA9A 3RY4A 1YEEH 4LHUG 4YHML 2HTLC 1QRKA 4WSKA 3DROB 4AEFA 3K0WA 5CJXC 2HH0L 5LBVA 3B9AA 1E6OL 4NUJA 1TFHA 2ZUVA 1XVSA 2X6UA 5L4MA 4XCEA 3NZHH 4HCIA 3OBAA 2RMNA 1QTYT 3OKOA 2O5NA 2IWFA 4Y2DC 1IGJB 2JELH 4O5LH 5DFTA 2B3RA 3MREA 4DEPC 2XTJC 1W72B 2VIRA 3MLZL 4PGEB 1LEIB 3SGEI 1MWAH 2W0FA 2OSXA 3P1VA 5LDUA 3EH5B 2CGYA 3CDGB 4DGWC 4MB1A 4J1UA 2RA1A 3IAQA 3FRPG 4UUJB 1RZJC 4XR8C 1Y6MR 2OMUA 3AS1A 4MMXC 4JQVC 3MRKB 4I2XB 4P5TC 1OP5H 4OZIA 4HDIA 4G8EB 5D6DA 1BG9A 2R4SH 3MLXL 1U8QB 3RWIA 3HG5A 5IHWA 4ZO9A 4FERA 4MJ5B 5LAXA 1N5AB 3L2NA 1RZQA 4P5MA 1XAUA 3GM8A 4POZD 2PCXA 4QRPA 1PZCA 3DJZA 1H0DA 3SDYL 4UZGA 4AKOA 3E8UL 1J05A 1EGJL 2YXMA 3UAJC 4O51B 3ZL2A 4IDLA 4UDTB 4Y4HC 4ZODA 5EO1A 5MENE 1S7SA 1T5WB 4N8PA 1AAJA 9CGTA 5IFJA 2V2TA 5F89B 4ZDHA 3DVNA 4XPAL 1KYUA 3CVCA 1PAMA 3NSCA 2ISDA 4MAZA 5L2JA 5AYUL 3BAXA 4AQAB 2EIZB 2BINA 1SJEA 4O2FA 4HS3A 3ZRCC 3KW7A 3V4VA 3WN6A 5FDYA 4NNPH 2W9DH 4RMTA 2AQ3A 3KWWA 1GA2A 1HAUA 3BIAX 3H2WA 4P2QA 4DGVL 4L9LB 4LSQL 5E4OA 2DH3A 4BWUA 3T2OA 2BP0B 3OSKA 2XY2A 4CN1A 5KTEH 5GGUA 1LHZA 1GH7A 2VLKE 3DV4A 2WBJB 2VXUL 4URKA 3L4ZA 5I9QC 1EV2E 1QD0A 1TSHA 4JFPA 2HXAA 4XVOA 1ECYA 4HIHA 2DBJA 3VXMD 4KI5F 5GJSL 5L6YH 2OXHA 3OPZL 3U36B 3VE0A 3VFVA 5LG1A 1J88A 4NBXB 1A8JH 2E9IA 2VKWA 1PZBA 4KWUA 4OGQC 4KVCH 4Y1TA 1ODAA 5DCCA 1GMEA 1O5PA 1EHXA 1NANI 3Q05A 1G4RA 2FB4H 3D2UA 1MCOL 3DPBB 2H8PB 1RK1A 3BGMB 4OZFA 5FWQA 1WK0A 2NCMA 3QHTC 3MAWA 3B1TA 3MRDA 5HYSA 3F7RA 4WHTB 5DQDL 4KZEL 3P77B 1D5IH 1AGEA 3S8FB 2LABA 3JT0A 2TSAA 1X5MA 5JQ6L 3OAUH 1DCLA 4PTUB 4OF3A 2EDOA 2IPUG 5EN3A 2R8SH 1ZEAH 1F4WL 5CR8A 1CC3A 4X8GA 3SQBB 3X14B 2MCMA 2V9TA 3ZUNC 1E9OB 2IBGA 4PV8A 4CDHA 2RB8A 5AZ2H 3WE6A 5GXBB 4L1TA 3BVVA 1NCGA 5HDBB 1E67A 4MNQB 1P4IL 4V1DE 5D7IF 4WDIA 4PGCA 1ZS2A 2UZIL 3QUXA 3TO4B 1FVEA 1UKSA 5JA8B 2BWQA 3GHEL 4XMLH 3V5HA 4NHCH 3UERA 4ENZA 4CSSA 2AXFB 3WIHA 5E8NB 4XBEL 1WWBX 3UBXI 5BUGA 2F7QA 2VO8A 4X83A 4XT1C 1KULA 4WFHD 2XFXB 4PCKA 4XGZA 5E4EC 5IR1B 1UGNA 3LKRB 2X4PA 1UVQA 3MBEB 1ZGLB 3K8LA 1F11A 1U8KA 4LCIL 3EOAA 2VZVA 1QX1A 4XN5A 3UTTD 3V9FA 3OJ2C 4L05A 4KXDA 4E68A 1VRSA 4PB0H 4IEFA 4X7FC 1SZNA 3IKCA 2XETA 1A4AA 2IH8A 5JYLA 4Q52A 4MNQD 4JG1L 3CU7A 3AREB 3D69B 3HS0B 4HPYH 3KYKL 5FA4B 3ZOAA 2K0RA 4XO9A 4PGDA 4OF7A 2H2PC 3VI3E 5HVHB 3E3QE 1Q90A 1WUZA 1FC2D 1DVTA 1J0HA 1SY6H 3L95A 1E7UA 3NCJL 1F4YH 3ULUL 4ZW7A 5D5MA 3VCLA 2AV7A 1MJJA 1AFVH 4GP4B 4L37B 1RIVL 5JXEA 3U48A 1LO0L 3NIGB 1OGAB 1TO5A 1JXDA 1ZLEA 2UXTA 4NC1C 5AAMC 4ZW3A 2CG9X 3B9KB 4U6XB 1IEHA 1YNTA 2H45A 1OANA 1LJMA 3OMIB 4CVXA 3MLTB 5AVXB 3K8MA 2NY4D 4O02L 1JGLH 5KVDH 2P7TA 1A25A 1WFJA 3O3AB 4E9LA 3RGVC 1PG7W 2NY4C 1Z9NA 4NP4H 1QRNA 3F05A 2A1WH 3QIBD 4LCUB 2UV3A 1DCEA 4XVSH 3GZPA 2FGWL 1ZCRA 1I3RA 1NC4D 1KTDB 1RUML 4N26A 4G3YL 3Q5TA 1RXLA 1I7UA 1E27B 2R0WL 5DURD 3VGAC 3OPZH 3QWRA 5FUCE 2ICWB 2HLAB 1OV8A 4AGLA 2AV1A 2EQDA 3QRFM 4Q4EA 1S7UA 8CGTA 4NXKA 4KFMA 3MLUH 1S7VB 3QNYA 4XMTA 2QTEA 4PB0L 1EVTC 3WTXA 1OWRM 3WS3B 3VXUA 1QBBA 3X13B 5CM1A 5DGQA 4FG4A 4NDMB 3O45A 4QLWA 4HKZB 4GAFB 4KRMB 5KJRH 1L7TL 5ID0A 2NY2B 1UACL 4HZLB 3FCSB 4HLJA 4ZNEA 4CJ1A 1IGYB 1VENA 4NQEB 4W4OA 3W1ZA 3LRSB 3QDHA 5IHLB 4MDJB 5E7BA 1SDAB 4B9JA 2I9TB 1T7XA 2VDPH 5FO8B 1UURA 3OZ9H 3ZTNH 1WAEA 3G6JF 1K8DB 1L6PA 3FN3A 1FYTD 4Z7UB 5D7HA 5D6CA 2DLIA 1WC7B 3BKYH 3CVHA 5KBLA 4QRRA 4N1EA 5E0FA 5HDRA 1QO3B 4NQVA 5F3HB 3P73A 5GHWH 4OZIE 3D12B 4YHNB 4WFGD 5T3XD 1A7RL 4C4KO 2OMZB 1WG3A 2Y4SA 3IU3A 5K39A 3HOGA 3EFFB 2J8HA 2WMPB 3N43B 3VX0A 2PPCA 1Z5LA 1AHWA 5FB8B 2EEFA 2OSLA 4HIJB 3N91A 2E6JA 2KQMA 5F9WC 3MRCA 4O58H 3P4NB 4JPIB 2KZWA 3D3VA 4I5BB 4BFFA 1HH6B 3SYQA 5JQIB 4BSWA 4HUMB 3T4YB 4K5PA 4MXWL 4RDQG 5FUZL 4TYUA 4XX1E 4PV1C 1FJ1A 2DRUA 3A23A 2RTTA 4GEJA 3BP5B 3BMVA 2CDFA 1IC5H 5JR1H 1JIBA 1Q94B 2CK0H 1ZXQA 5CEYA 1E42A 3SDDB 5KUMA 2Z8SA 5B8CA 3UOAB 3UFIA 3R1GL 4P49A 3IGLA 4H40A 4PJCE 4FQLH 2EVHA 5DMGC 1NFIA 2X9YA 4JBSA 1T1YB 2XWTA 3ARFC 5E2UH 2Y69B 3O3UN 4XPAH 4QHMA 1AQMA 4O4YL 3TYFB 1MCLA 3EBAA 5IOPA 1FFPA 3MBEC 4E9QA 3BP6B 3CN0A 3BAWA 3RVUC 1YECH 1F45A 2R0LH 1GS6X 1UJ3A 2YRPA 5I1LA 1K4CA 1L5GB 2NXZD 2GBUA 4PJHA 3B34A 2G3XA 1FIEA 3OXRA 2YMXL 3HI6L 4NSKB 5DHDA 5AVQB 1DVZA 4D0BA 1ZLVK 2K7PA 1A7RH 3UIYA 2MCG1 5IM7B 3Q2NA 1WHPA 5INCA 5E6IC 3P4OA 3O0RH 3P2BA 1MCSA 3DRTB 1N3NB 3SDDD 1TYRA 4FTVB 5D4QA 2NW3A 1AQ8A 5D1XD 2Z93B 2N4IA 4G6ML 2WP3T 2C1PB 4Y9BA 5K5YA 4GUQA 2NNFA 5I75C 5D4HA 1VGEL 2XG4A 4O58L 4GQRA 3PP4L 1AKJA 2OK0H 4OLVL 4MQXD 4XP6L 5ESQB 4ZPVB 3WKYA 1MHCA 2Y2YA 4PJIF 4FXKA 4ZXBA 4RGND 1DE4B 4OI9A 4H0GA 4G8IA 1XXDC 2D31B 4F92B 3QJTB 4FAAB 2XZAH 4P99A 2EC9U 4FLSA 5DVNA 2OL3H 4PD4J 1KB9J 1PCSA 2HG5A 3KPRA 1A6PA 4BQ9A 1D5MA 3NRQA 2AQRA 4WTZG 3V2AR 2MMXA 1EO8H 2V8MA 3HE7B 1V5JA 1RZ7H 4H1LG 4GS7B 4Z78B 2J2ZA 2IG2H 1AO7D 4KU1A 1FV1B 2E7BA 4Z7VA 3EYVB 3U7WH 2FSDA 1IGTA 4KPHL 4ZOCA 1G7HA 3MX0A 1FC1A 2QFRA 3KDMB 3WDHA 2WXRA 3UP6A 3QZWB 2YMTA 3GKWH 1SPDA 3DO3A 5I0WA 1NBZB 5ESAA 3T9WA 1UD4A 2BSRB 3FFCD 3HPLB 2JLPA 4AVHA 4HHGA 4XVSL 4F7CA 4OCSL 1RIHH 3QDJA 4RGNB 4YGVB 5IB4A 3OC5A 3P02A 4PVLA 1Y6KR 2VC2L 4JR9L 1P9MA 4NNYB 2VKXA 3CBJB 4Q9QH 2XN9D 2AHIA 2Y7OA 5IB3A 1E7VA 4IGBC 3MLPA 3L3OB 4JVUA 3CN2A 3ZHFA 4HUUA 1I31A 3NJXA 5C6PB 1QBML 1MRCL 1CMOA 1AXIB 4HWBH 5KSAD 2A83B 5TQ2L 3ARDD 5ETUB 3CBRA 2VH5L 3BZFB 3H55A 4GMTH 3BSHA 5A2IH 1WV7T 3ARDC 4JO1H 3ZDZB 3G6DL 4Y16D 2NY5H 1TENA 5DMKB 4QF1B 1E5ZA 5HYJA 3FU7B 3GXUB 4ZK8A 1NEZA 3GSUB 4L3CA 1S5HA 3GJFB 3QR2A 4UQIM 3VWKA 4U1HA 3CZFB 1XR8B 3FUHA 3V6ZB 1FNLA 1O7DC 4N3TA 3HZ3A 2ICEA 1E8ZA 1OB1A 1NFDB 3DGGB 3L08A 4ABUA 3C6LA 5EMYA 3FKUS 5GGVH 1UWEL 1XH3A 1YEGL 3S5LA 2XDHA 3SPVB 5GZOD 2NTFB 2YOAA 1KUMA 4LOFA 4R0LB 3VWJB 1AFVL 3VXSD 1S7RB 3UADA 5AKTA 4KRPD 2H2SC 3QXAB 1XMWA 2YIHA 1WRFA 1CDIA 5I6NA 4BFOA 1Q1PA 2AKRA 3HI1B 2A6IB 4HIIB 2FYVA 3CMOH 2DLGA 4M7JH 3SDCB 3A5VA 4BH7B 2XN0A 1G87A 5KVDL 3KM1A 1YMMB 1UM6H 3KGUA 3V8OA 1I1FA 1V7NL 3NA9H 3QP3A 3DUSB 1A21A 1NCOA 2VQ4A 5D5MF 3E1ZA 4ZD3H 3B3IA 1NPNA 3L3KB 2YXFA 3L2MA 3U1SL 1XBRA 1BD2E 3ZBMA 1MJ7H 2NW2A 3HHRB 1T5XB 3QJOA 4FKHA 3AAZB 3RX9A 1IBGH 1MEXL 1ED3B 4FQLL 2JKSA 5E9DB 2A9NH 3A67L 2A74C 3CFEA 4IOSA 1EEUA 5KYWA 1KTRL 4LLUA 5CJ5A 3KEDA 3O4LA 4ERSH 2ZKHH 3CE1A 2CGZA 4JFFE 5D2LF 3VFPB 4R84A 5IHUH 4UV4H 2F54A 5DK3A 2G5RA 2A4EA 2ZAGA 3FZUC 3O81A 5F71A 1EUUA 1SOXA 2ODIA 4QRRE 5IEHB 2NSMA 5IJVB 1ANUA 1DVFB 3NN8A 4PJCB 5TPWH 4ADIA 3AQXA 4G6KL 1A22B 2XPGA 3JV6A 3WKMH 1GS7A 3NAAL 4PIBA 3RUGB 4Q9CA 5CILH 3W11D 3O2DH 4ZNEE 1J5DA 4EJ1C 4PJGA 4R97C 5EU5B 3EGXB 4B0MM 4BE5A 3U6RA 3IMVA 2YUWA 3SE9H 5FYLH 3CZGA 4PTTB 3US0A 4IS6A 1U21A 4CMHB 3MC0A 5DUBA 4XBPA 1SOQA 1S9VB 5FV2A 3S4SB 2I9LA 1OARL 4P3WA 3UCQA 3N04A 4PJ7E 4F8LA 3UC0L 5EZIL 3GJEB 4QTHB 1HFUA 4MA7H 3EJYC 4J3BA 5DK2A 4XO8A 3WSQH 3EOYG 4JKLA 4A39A 1JUFA 2X4RB 5MEQB 1SXAA 1RP8A 4TXVB 2H3NB 1NPUA 5J1AA 5DEGA 5ANME 1HX0A 2DWYA 1JGIA 3L9RB 3V0WH 2QEJA 4QXGH 2XKUA 3EYFA 3FUJA 3LV3A 4Z95L 4N2HA 5JIDA 5JIIA 3NCFB 1VEOA 4YHPA 1NLDH 5EFIA 3TCXA 4JDTL 1AQDA 1E43A 2ZX6A 1CK0H 2W1NA 1F4XH 2WN3A 5D2LE 5EUOF 3KBPA 1MVUB 3FSZA 4BFRA 4XNQB 4XAKE 3A22A 3ZKNC 1BOYA 4M1GL 1K6QH 2A6JA 5DJAB 3LHPL 3RYMA 5L88L 2IDQA 2KLSA 2FUQA 1I7ZB 1P69B 5AOKA 4PRNA 4RX4A 4B95C 4ETQA 1WP6A 3F58H 1U8LA 2OAAA 2BSSA 2G2RA 3K4DA 1J0YA 2KS0A 4L2LA 5E5LA 3MUUA 4HJEA 3MRNB 3KPSA 4XNYL 5D5ME 4K3HA 4C83B 1JGEB 4UNVA 3UPRA 4WO4A 5BMFH 2LAAA 3IF1A 2BVQA 5C09B 1ZTXE 5G4NA 1O5DT 5CLYA 4FI8A 1QBAA 2ARJB 4LK4A 1AG0A 1MLCB 5FFLA 5I6LA 2AGJL 3MV8E 1X5KA 1UM6L 4NN7C 2IPUK 1T83A 1CE1L 2H0JA 2FWOB 4L1SA 2P8LA 4UMGA 5CR1A 4X9FA 2DMKA 2ITCA 5JPNA 2NY5L 4AMKH 3HEIB 1BJ8A 2KL6A 3KPRE 3BD4A 2OMVA 3CMGA 1KLUB 1RUKL 3ILQD 4M1CC 5FCSH 3Q48A 1YY9D 4P5SA 4HPHA 1PKOA 3MNZA 5F7KC 4ZZKA 4HOXA 4IHBA 1OF0A 3C08L 2AJZB 1SDYA 2ZOTA 3WNPA 4HULB 2KHAA 3PDOA 3NJVA 1D5RA 3O6KL 3FT4B 5EU6A 2HMIC 3AGVA 4OFDA 3X1EA 3GHPA 2VDPL 3N44B 4OZGB 5JPMB 3L3HA 4F37F 1BXXA 4Y5XB 4A7VA 1E3FA 1IBZA 3EZJB 5IB1B 1FG9C 3VM5A 5JORA 3I9IA 3P11H 3OF6A 2Q2EB 5F8QC 1F90L 1T2QL 5B4MD 1G0YR 3MV7E 4AENB 1CFVH 2XKNB 5JLZB 4TSCH 4CADB 4XAWL 3WY1A 3GTNA 1UWGL 5GZOA 4WF7A 3DMMD 3S98A 4YPGB 4FQHA 4EI6B 1NJ9A 2YBRB 3L5XH 2N01B 1CTNA 3QJHB 1N6QL 3BOVA 4Y4FD 5CXPA 4BE6A 3BKJH 5JXAL 2PWFA 2ZSWA 3NDYE 1KBWA 5HPOA 5FIEA 4S10A 1QSED 2X5PA 3ESVF 4L8DA 5F1SA 2J4WH 4NQCA 1JF1B 2VAJA 4WUKL 3RHWF 2B39A 3GIZL 3LMJH 4Z0BL 4YSDA 1PD0A 2YGVA 1BX2A 4WU5B 4K3EH 1T21A 5F7WC 1RK0A 3N40P 1J5IA 3ZLQC 1T1WB 1CLOL 2F1AA 1V10A 4UQEA 3D30A 3MLYL 4FMFA 2OCCB 2VDMB 4EUPH 3IDGA 3PWNB 1TTCA 3ZL1A 3V8CA 5C08B 1J0ZA 4U1JA 1E2WA 1QWNA 4YXHH 1PS3A 4ZNCD 1HJBC 5KN5A 5M7QA 4X9HA 4GG6A 2P24B 2H2PD 3O6FC 3O6KH 2VZSA 1AO7E 4OGZA 1BBDL 1DLHB 1A2YA 1II4E 4URTB 1RZGB 3L6FB 1ZLSL 3QCTL 1IJ9A 3H7BB 4N3UA 5A3ID 1MQKH 1KXTA 4FFZA 2LVEA 2BVEA 1Z3GL 1W0VA 2IMNA 2VR5A 3D0LB 1JRHL 3LHPH 4CU8A 3JVGA 4U2ZA 4E36A 4MJ4A 2CO4A 3NJNA 1XX9C 2EDYA 2OR9L 2ZCZA 1N5YL 3GIVB 1X3DA 5ABZA 5F6IC 3C6SB 5IHZB 3H6AA 4H2CA 5AAWC 4TL5A 3ARSA 2YD7A 4HJ0C 3DYOA 4PYHA 3RUGE 1CTMA 1PSKH 1QOKA 1HH9B 3T0EA 1KXQE 1RSFA 1X5ZA 2ZSVB 5BMFL 2ZG1A 1QEWA 2AVGA 4K7FB 1BMWA 3F01A 4AM0Q 1P4UA 1CBVH 3E6FA 1ID5I 3TBYB 1BCIA 5EV7A 4DT2A 4X4YB 4XE5B 2DQHL 1TTBA 3MUJA 4XBGB 4CNIB 3ZHDA 5MI0B 5J6GB 2ILLA 2R1WA 1D3CA 3TEZA 1IFRA 3U0TB 1ONQA 3A6CL 3WD5H 3L9BA 3PNRB 1L3NA 3KLHD 4JO5A 4JFDA 4YSQA 3RIFF 2Z4QA 3ZDZE 1G7IB 3EO0A 2JXMA 2QADD 1VPOH 5D1XB 3L3IA 2PPFA 1KCLA 2WWKT 1AQKH 1ES0B 1NCWH 1UT1A 2BHZA 5SX4I 4WW2C 2X70B 1WTGT 3JSSA 3T08A 1UWYA 1L9QA 3OLEA 3FFCE 2WUBH 2HVKA 3C5JA 2XLLA 3GKWL 3VI4E 2YPKA 3T3MB 4U1MA 2JMRA 4OV5A 3TN0D 2VDQB 2WWMD 3OC8A 3IJHA 3G7TA 3UG3A 1LO5A 2V37A 3DOSB 4LOUC 4QHKI 5CHNB 2DZEA 5CEZL 1DUYB 1WT5C 3FQ4A 2E56A 3KYAA 3LVTA 3VD3A 1WITA 1CS6A 3DC0A 3FT3B 4KK5D 1DEEA 4AQ1B 4PW3A 1QSFE 1W8EA 2GSGB 1UD2A 5F96L 1RZJH 4LASL 1OAQH 5DZLA 2B1HH 5I24A 2VM3A 3FUEA 3KH3A 5JXAH 4QRSB 3S3SA 4KDVA 1MCIA 1T3FB 3FCTA 3GRBA 3LH2H 3MBED 4AEHL 4AQEB 4TLSA 3FO1B 5I1GH 5GS0C 2MPAH 4APQA 4MXVE 1OPOA 5C09E 3BEVA 3HAEG 1W8NA 1V3LA 4MHHG 4ZSOB 3W56A 2YPLA 4WU7B 2MWCA 4I8DA 5I26A 1ZHKB 3MVSA 5DS8B 2HN7A 3MRPA 1T6WA 4FNSA 4GIAA 5GZNA 1P4BH 1JK8B 3VXTA 3FQUB 1F3DJ 3TWCL 2OI9C 3IE4A 4BEIA 1UASA 4HU2A 3STBA 4ATWA 3I6KB 1WICA 3KPNB 2Z34A 1QZ1A 3LQAL 4I0PC 3RZWA 1AGDA 1NUDA 4RMQA 1F3JA 1JYWA 1BYPA 2DJSA 4LSUH 1JGDA 3FBKA 3TV3L 5C9JB 5I66A 1JYNA 3RZCA 4YXKH 5F7NC 4R96A 4IRSA 4DF9A 1RLWA 1JPGA 2BMKA 3VVVA 2MCAA 1U2YA 5CS7A 4GAAA 3MJWA 3HRZB 3ME0B 4AYSA 2RJMA 3OG4B 2G60H 3ZGHA 3T77B 3OXSA 3RWJB 4OZGE 2A6DA 1QVOB 4Y16B 2R29A 2X3AA 3K6NA 1VKXA 5EOTA 1KPRA 4X98A 4CVZB 1NGQL 2DTMH 3VQ2C 2R15A 4KHXH 2ICEC 1BIHA 1XQ4A 1WAAE 3QQ9D 4UOQA 2DF3A 4P59L 4C4UA 2N3JA 3V6OC 2AC0A 4P48A 4PWGA 1I1YB 3OHXB 2QFPA 4M7JL 2V9UA 2WP3O 4UQ9A 1JHTA 1H5BC 2UY6A 2FLBT 4PJ7B 3IXAA 3G5WA 1NC4B 3K4ZA 4M93C 4N0YL 4ZMVA 4HKXB 4IKJA 4XMKH 3IS0X 1R3KA 1R5IB 2ZP9A 3BZ4A 1TEYA 4H0IA 3WFCH 4HWZA 4H4NA 5AZEH 1QFPA 1AZUA 3GXNA 1MREL 3QCUL 5I19H 2FT6A 2Z7WA 2NY1C 2PO6D 3D18A 2XWRA 4BK5C 1K72A 4PRDA 5SWZA 2UY7A 3ESOA 3U30C 4GQ9L 3TBTA 1G9HA 1M7DB 4K3DH 2OMYB 5I8OL 1FA4A 1WJ3A 4FFTA 5ID1A 3BPOB 4HG4J 3CFTA 1N64H 4MMYA 5B4MC 5C70A 5I17B 5FLUA 3FC8A 1UZGA 3LEYL 3CVDA 1UM5H 1ZJBA 4UT6H 2BW4A 1PX4A 4Y1AA 1KJVA 1EHNA 1GOGA 4PWFA 3B7RL 4L5FE 1YEDA 4M4RB 2NX5B 4P9ML 3MI6A 4PJ5E 2BSBA 3FTGB 4UU9B 5DQ9B 5ERWB 2H6PA 3U6XA 1MVFA 2IXQB 3E6HB 4U4IA 4WZ9A 3ZE2B 5LBSL 2G60L 4MHHI 4CC4C 3OTTA 1L7IL 3SGDI 3L1EA 4XN1A 4YBLC 4S0HA 5EU6E 4KTGA 3CZKA 2JKTM 3VACA 5EU4A 4A6YH 1PFCA 1WE5A 1IQDA 2YLHA 4GB9A 5D2NE 3P2TA 1D9KB 3R4RA 2C3HA 3CSBA 4AC4A 4PJBE 2EKSB 2QHRL 2ZXEB 3WGUB 4PV9A 2CMRH 2X3BA 5EU3A 1MHEB 3VGAB 1BZ9A 2ZXBA 4P4KB 5DC4B 5T3XL 2A73A 3EXJA 4R4NC 2YGNA 4KK5C 4WI2A 1T5KA 2DQMA 5DZAA 2JFCA 3DOIA 3OQRA 3ABGA 1FFNA 3MODH 2ZNWA 5DEFB 3UROR 1GHFH 3CGTA 1AE6L 4RVBA 2BNQA 4R8WH 4P2YA 2O4EA 3T4AC 4JHWL 4EKXA 3GEFA 3CX5K 2WXGA 2ZYSA 1T0MB 1OE3A 2YO3A 2R69L 1P5VA 2D0HA 4QTIH 1M6OA 1WYJA 5DUMH 5A6MA 1NANH 2ADFH 2IWGA 5TDNB 2YSSA 3V6OE 1PPIA 2F08A 2HYMA 1KTCA 3VD7A 2P8MB 4R83A 4XVJL 1F6LL 4G7QB 6FABL 3O6LL 5F2FA 3HS8A 4D0DB 1MCDA 4K07A 2VDML 3C5ZD 4B9CA 3UBHA 4ZUSB 3QWOB 3KG5A 5GGRA 1HSAB 1EEYB 4XP9L 4XZUB 5IFHH 4PI0A 4QCIA 4L3FA 5I8EB 2OMNA 4QHLB 3NFNB 4R26L 4HW6A 2YD8A 4KFZC 1XSOA 2D73A 3UEZA 3WKQA 2F5BH 2IVFC 3OKNA 4HBCH 2XICA 1A9EB 3GD1C 4N8UA 2R39A 4QKTA 5GS0D 2Q6WA 5LN4A 5E56A 2GSMB 4MWFA 1JMZA 3PWUA 2JI3A 5HJGA 4NYLA 1Y18A 2CCVA 1INEL 4WWPA 3V0HA 4M7LL 4U33A 3UG4A 2EDTA 4ONFH 3M6DA 1Q0YH 3RFZB 1OKEA 1OSPH 1QI4A 3ULAB 3ILDA 1AO7B 1BAWA 1EAOA 1E5CA 5BO1L 1H8LA 1FO0A 5BUPA 3MJ9A 3FQXA 1E5AA 5M95B 2DIJA 2EXTA 3QT2A 5L2KA 1RSYA 1BEYL 4NWUH 5EEZA 2PW2B 3BO8B 4M6AA 4KMTL 4KOCA 1Y6NR 1KCSL 4LCCA 4WGVB 2W38A 1H3PL 2VMCA 1A4JB 4V2BA 5C0GA 5JYMA 3PHOA 1NDMA 1VFOA 3UJIL 4ZI8A 2BDNH 1MCFA 2XZCL 2P80D 2ZTBA 1OAKH 3JWDL 4FQ1L 2D3VA 1BGXH 4HFWA 5EIIB 2AJSH 1FQ9C 3FB7B 5IW1A 2YJLA 2FATH 4WEBH 4PI2A 4MA1C 1XAKA 1AGCB 3VMOA 2CJUL 3MCYA 5LUMA 1ZY9A 1IEAB 4PP2A 1NMCC 1RZJL 2AEIT 3F6LA 4J3SA 2J6EL 3REWA 3QXTA 1AIFB 1HU8A 3ARDB 3KVQA 3EDJA 3RWGA 2JJTC 3A6BL 5J3HC 3PUCA 3EFOA 1HQRB 4KKCD 4DVBB 3OJVC 4K5OA 2MTPA 5K9OB 5L6YL 4G11A 1A4CA 1NAML 4LL4A 4DVRL 4ZFGH 1IBYA 3FN0L 1BLNA 3L54A 3L3JB 6CGTA 1J9RA 4KZCA 3DX8A 3MRJA 5FX3A 3FTUA 1TZHB 3AXLB 3O8XA 1B88A 4ANVA 2R23B 1RUQL 5EO9A 1DR9A 5IW6B 1BV8A 1ZLUK 1L3WA 3LRLA 4I77L 2ZAIA 2AANA 4AUUA 5DC0A 2WKLA 4N0UB 4QRAA 1M6UA 4J5VA 1XF5B 4M61B 5C0EA 4DP2X 5I6OA 3BIKA 4GT7A 4M43H 3MOAL 1L0XA 2CSPA 3ZMRA 2ZE0A 4NJAL 2NX5E 4PJ5B 1GKEA 1U8NB 4G6JL 5IT2H 4WSJA 3DO7A 1ZWIB 3FAXA 2VDKH 4NKQB 4OLXH 4G7YH 1M42A 2C3VA 4S1RL 4JHAH 3CFJB 4KAQL 3QEUA 43CAB 4XWGH 1YG9A 3VA6A 2WXKA 5T3XH 2OTWA 4K55A 1SM3L 2E9GA 5MEPB 4A37A 1A7BA 1X4YA 1RI8A 5CKAA 4FZ8H 5J1TC 1FFRA 4E42A 3BJ91 2DI9A 1KIRA 3VXUE 4BA8A 2J8OA 1U36A 5BZWB 1E50A 4PB9H 5C86A 4RMRA 1YEFH 1R1CA 4GBXB 2FHBA 3O3BA 4CW1B 4D9QD 2XZQL 3VG0H 3ULUC 4DH2A 2X1WL 1A66A 4F20A 1W6LA 2GI0A 4BK8A 4A2DA 4AYGA 4L0PB 4JFYA 4J3OD 3ZQXA 4Y1SA 1YUHA 3PHQA 1YYLL 3MMEA 1CFTB 5DYFA 3SPGA 2WLIB 5HDBF 1GTNA 7PAZA 2HKFL 2B4CH 1LDPL 3FUNA 3QUZA 4PRAB 2BSTB 3GLZA 3T65A 5DJ0A 2E7LC 2W0KA 5ILTL 2OMXB 3KYOA 3VFSA 3M07A 2PYEA 1DQKA 4LCWB 3VSVA 1TVHB 2JI2A 2PABA 1DN0A 3AGWA 3HG0A 3IDXL 3NCBB 3QDGE 4ZRGA 4F58H 1XHHA 2V5TA 3FT2B 4BFNA 2Z65C 5FW6A 1WZ1L 5L9DH 4RAVB 4YFLF 4Z0XB 4B41A 1Q9LB 5LBSH 4GYBA 2Q20A 1WEJH 3MV9D 1QSVA 1LO2L 4IBTA 3QUGA 4Z3JA 5IB5A 4X6FA 3W5NA 2FWSA 4NQUA 4BKLA 3IDIA 2HX7A 3HN5A 2HFEA 4XVUC 5AEAA 5HPMA 5ICZB 3HNTL 5J56B 1CL7H 1BYNA 3UIZA 5I76A 1QKZH 1EEZA 5JIKA 1V7MH 4H25B 3M7FB 2VJ8A 3MA7A 1YQVL 4OGYL 4Q74A 3QH3B 2QVKA 4B9ZA 5JQHC 3HG3A 2RQ8A 5I6KA 3EYUH 4RISH 1CFNA 2A9AA 3ETSA 3G6JE 5B8CC 3QJVB 4FG2A 4E41D 4P5TD 1P7HL 3QAQA 3BVNA 5T33H 4LCWD 1JK9A 1OSZB 2C9UA 3ULVF 1NAKH 2X38A 4JQIH 3KXFA 1BQHG 2F74A 1RJCA 2YUXA 4ZUTA 1TZOA 1MCKA 2BY2A 3PGCA 4G6FB 1S3KL 1D2PA 3MRLB 1UFGA 2W0FB 3EJQA 3QEGH 5KOVC 3JQOB 4CA4A 4KQ4H 4S1SL 2WNXA 4JLRA 4UAOC 2NZ9C 1TQTA 3II3A 3ZE2E 1R47A 4OGXL 2GBAA 4UB0H 3CFBA 2Q8AH 3SN6N 3TEXA 3BKCH 3L16A 3TIEA 1DJYA 2VDRL 4QOKA 4OKDA 2COQA 3ZW3A 2O5YH 5HDLA 3PYCA 3EFDH 3BSZA 4ODXB 3WFDL 1AIZA 5LAXB 4TVPH 4XMUA 4FA7B 1P7BA 1VSCA 1C9SA 3INOA 4OD1H 2Q7AA 4M48L 1ZT4A 4Z8FH 3EJUA 4P0DA 1SJHA 1TJMA 4MJ6B 1R19A 1OGTA 3HKZA 3PGDA 2X05A 4E41B 3WIHL 2GJZB 2WSDA 3GO1L 2BWIA 4LDEB 4MJIB 5BXFA 5IG7B 3GUTA 2GIYA 1S7TB 3ZQWA 4OV6F 1J0IA 4YAQB 2FQEA 4Q58C 2PPEA 2N59A 5IFAL 1A6ZB 1MKFA 3TBVA 1TETH 1HILB 1ZVSB 3NIDF 4B5ZA 4YLCA 4BHUA 5D1QC 5F89A 1IBBA 4ZDHB 4KOBA 3DVNB 4NQED 1JPFB 2XN9A 4LSTL 3SKMB 1FLTX 2B1AH 2E7DA 2Z4TA 3TO2A 2WIMA 5JPNC 4TKWA 1S78D 1AY1H 1CYGA 1SQMA 5H4ZA 1OZTG 1FVCA 3EDDA 2WCSA 1K85A 3SE3C 1UOWA 3TIDA 4AQ8A 2AJYL 3IVKA 4GP5B 4WFHE 2D7NA 4KJWC 2TRHA 5AD0A 1BZ7B 2QSQA 3OR6B 5HI3C 1OT1A 1JPST 2X89A 3P0GB 3VU2A 4D8PB 4I87A 3RWHA 3JVFC 1PNCA 3S5YA 5GRZA 3DV4B 4WWKC 1F18A 5HDBE 3TN0A 4G43B 1EXHA 4JFPB 3CPLB 3ZHKA 4X6DA 4P4KC 1R75A 3ULUF 1R3IL 1DFBH 4PJDE 4MNGE 1FZJB 1H15A 2YUVA 1ODUA 2LAGB 5B21A 2IQAB 4N0UE 5F7BA 2X6AA 2VN3A 3JTTA 2VR4A 3T8XA 5B1BB 1CXFA 2BVUA 3CAFA 1HOEA 1FIGL 2DEXX 3FQTB 1H3PH 3SJVD 2QZ5A 4JDVA 1RK1B 3Q44A 1ZT1B 4XN9A 2FX9H 3D0VB 2Z6FA 3WELA 3GUFA 3CLFH 1BG1A 3WNLA 4ELMA 2F18A 4YDNA 2FQGA 4OW6A 1AOZA 1GZQB 4OUUB 4WAFA 1B9KA 5DD0H 1L9SA 5IMOA 2WW8A 4MFHA 1G9NC 1LP9E 3MR9B 5LBGA 1NBQA 4MD4B 3ROLA 2GQHA 2KYIA 4KV5E 4OH2A 3GEWB 4HMDA 4AYDC 1KV7A 1MELA 3MBWB 4YUEL 4AEIL 1HKLH 3AWFA 4PJXF 4AT6A 4JB9H 3ZXAC 1F56A 1AXTL 4IBVA 1RD6A 3VXMA 1PD1A 3T3PB 5C0AB 3I02B 4WI0B 2R4SL 3IS1X 1ZDQA 2R27A 5EH1A 1NC2D 2GEQA 5C8JA 2JNZA 4PGCB 3QJQB 5F3BB 4JN1L 2NY7L 3A4AA 3PRZA 4S2SA 1PZSA 4MCMA 4PJFA 1A6WH 2V7NA 3VJ6A 2Z1PA 4FOMA 4FRWA 4ZJ9A 2DIAA 4HKBA 4A7UA 3KWUA 3KPTA 3TBBA 3LXAA 2H32H 4FFWC 3DIFA 2J5LC 1NGPH 4OT1H 4LOVA 2AITA 2XX0A 4YDVA 2Z3FA 1M05A 3C5XA 3BT2H 3WMQA 4JHUA 1DL7H 3JXAA 5IR1A 2VYRE 3A21A 4J8QA 4B96A 1I85A 1FL5B 1EXUA 4LCWE 3SOBL 3WU1A 2GB2A 4J4PC 1XIWB 1F00I 4WGKA 1DSWA 2VZOA 1B9ZA 4WWNA 1VAHA 3QDME 1YC8A 4X6CA 1RURL 4PJBF 1N19A 3ZE1B 3IKCB 1OSYA 5AVSB 4JM2A 1ZANH 3AJ7A 3SQOH 5CLWA 4WO4C 4GAJL 1ZTMA 4L8BB 5DEZA 1UYWL 4RGMB 4KKLC 4CRPA 2O93L 1KN2H 2WBWB 4YR6B 1E9PA 4OUOA 3D85D 4P4RB 1UXWA 1SYSA 3TNMB 3K2KA 3BXNB 1BHGA 1I9EA 1MCQA 2JJUA 3DHUA 4P2CG 1QTSA 3B5TA 1LXMA 1X6NA 4L1LA 4G7VL 4HUCA 3RIKA 2NUPA 4I0PA 3VCLB 2MOVA 4QXTA 5AUMA 2P47B 1S9KC 4JB9L 3RWDA 5T5FH 3U9PL 1ECZA 5BOZG 2AQNA 3D4ZA 3DTXB 1UB6A 4LPTA 5DQJA 3ULSA 1GIGH 1EJ8A 2JJSC 3PWPA 2JKJA 4IHOB 3PV6B 4CVXB 4N9GA 3PJSB 2BC4B 2VDNH 2WWMC 4CBZA 2QQNH 1N6QH 3CX5J 2CZNA 2OKMA 3QUMA 4QRTB 5T1KA 3IETA 3TCLB 4APQC 1ZKAA 3G6DH 1U2CA 1DJHA 2DY2A 2J21A 2NXZB 4MS8D 5BQDA 4OSUL 4M8UA 3AACA 3UXFA 2ENYA 5IKCB 1CF8L 3KL5A 1E40A 3FQNB 3UJIH 1LO0H 5IQ9B 4RFOH 1U8HB 3K72A 4NO0A 4HH9B 4YHKL 1IKFH 1H6EA 1Q1JL 2AV1B 5L2KE 5B7FA 2GW5A 4MYPA 5IMMA 1IV8A 4BZYA 4NO3A 2ITDB 4XI5D 5GGTL 2MH4A 2DTSA 2XVKA 2BCKB 5B1CA 3Q6GL 1P1VA 3SGJA 1YY8B 5D1QA 2FGWH 3FU0A 3SKNB 1N7ML 3QORA 3BUIA 1CL7L 1KTLB 2R0KL 5FDWA 3LRSA 4FFYA 4NHCL 5J6HB 1JI1A 5FO8A 1LK2A 2W65A 4Y4FA 2YJQA 2IAMB 5HYEA 3CDYA 4Q56A 1Q72H 4Z7QE 3L7EA 5T5FL 2GCYB 3CSYA 2IGLA 1N5YH 1AP2B 3KE0A 1QSEA 1OF2A 1MUJA 4ZT1A 1K3IA 5IV2B 1EIBA 3LCYA 5KJRL 2A3TA 4QOKE 5DRNA 3TVMA 4PJEE 4NRYA 3DWTA 5FUCC 3HG1E 5AOZA 4FLRA 3S8WA 3FUKA 1JWUA 3NCCB 1WCBB 3OKYA 3EYSL 5TE7L 1CJYA 5HHNB 1BQHA 3O8XC 4F2MB 3ZHLA 4LP5A 3OZ9L 5K69A 2ENPA 5FYJD 2FUTA 5IB2A 2R2EB 3DDFA 4G7YL 3RGBA 3QHFH 2XTJB 4NCC2 2GJ6A 2JK5B 1C5CL 3D3VB 4HJTA 4F37K 4F7PB 1HH6A 1A7NL 3C60B 5IIEA 1UZ6F 1BECA 4AGPA 2R4RH 1G1YA 1AHMA 4TLUA 5TPWL 1BLIA 4DGVH 5KANG 4DP0X 1FJ1B 4MNGB 1CLVA 3MACL 3KLDA 1JP5A 3UACA 1BQSA 4Z8FL 3DBSA 4X8CA 2IANB 4AMXA 3GJFK 4HCRL 1CGUA 2H3XC 4FCHA 4KKBD 1FI8C 2CHDA 5DHVA 5JW4N 1MWAA 4YZFE 3BLPX 3NJHA 3BP7A 1B3JA 2GIXA 1CDJA 2ZNXA 5FYKE 4Z5RA 3IFOB 1VEPA 3CDCA 1KXHA 1H8NA 1HKFA 2Y5QA 2R56H 1A6WL 3VUAA 2PR4H 2Y06L 3WXWH 2PNDA 3GSRA 2XACC 5I1LB 3NJIA 4MA8L 2A9CA 3SPHA 5A3IC 3C60D 3OLDA 4X9BA 3BUDA 3IXTA 3NCYP 4TUOB 2IH9A 4YNYA 3OLIA 1JOIA 5CZXD 5FECB 3O11B 4LIQH 4HJSA 4PJDA 5LCVL 4ABQA 3WTSA 4TTDC 5TGBA 2R8SL 3DO4A 3P3YA 2HJLA 1JNLH 3MFFA 2CJ3A 4KHTH 2XIBA 3DRTA 1BDYA 3QEHA 4UDUB 2B7DT 2NW3B 2X6CA 5JZ7C 2JKNA 2EDRA 4LLYA 1UB5B 2WZ0A 4OD2A 5A2CA 4UIKL 5CIPB 4XC3H 5BQ7A 3BIBX 3UBXG 4R0LC 3VWJC 2OYMA 5FGBA 4ZPVA 4KI1A 2X4SB 4KJWD 4ZAKB 1MHCB 2GTQA 3QIBC 1CGTA 3NPZB 1DE4A 1SJMA 3IJ9A 4UIMA 1V7ML 3QDGA 4E5XB 5CD5D 2D31A 3S96B 4YHIA 3T3MF 2B20A 5DSCA 3GSNL 4ALAC 2HX9A 2B9BA 4NFBA 5LGJB 4G8FA 2BIQA 5I1HL 4Y4FC 5FO9B 3X3GL 1KJ2H 2NY0B 4XPGH 4B53A 4LBEA 7FABL 2J2ZB 3LN4B 1SLUA 2YSTA 4Z7VB 2VW6A 4BRVA 4JNXA 3S37H 1JGUH 1IGTB 1YNLL 1TQBB 2W91A 2ZCLL 1GY2A 2ZYIA 1QPKA 3SE8L 1NMAH 4ISVA 4HHWA 4MRCA 4NM4L 5E03A 5LKNA 3IU4H 4YSOA 3DX3A 4H8QA 3BKMH 3HBZA 4FN0A 2ZKWA 4QHNA 2XSKA 3G6JA 3HPLA 1DQQB 2NQDA 4W9ZA 4NQCE 3CHPA 2OW7A 5CGMA 1R6VA 5D7LE 4ZUVB 3VFUB 3N1FC 1TJIH 2DICA 4Y5YB 5FFOA 4RETB 4YGVA 2NY3C 1UA7A 1OAJA 4POYA 3ABLB 3EHBB 3QNFA 4XVTL 3WY2A 1F6AB 5MEND 2Q76A 3Q1SH 5SX5K 2FWUA 1GGUA 2VITB 5IB3B 3HUJA 3LNFA 4XCCL 3T0BA 1E8XA 3Q7JA 3B6SA 2VE6B 3O9WA 1AR1B 3S48A 3BFQG 3WIHH 3NIFE 2CO2A 4HC1A 4HUUB 1VFUA 3D51A 2B77A 2V2WB 2VLLB 2SEBB 1RFDL 3M1BA 5F7DB 3UTSE 1DZBA 1Z1WA 4I2XE 5DJDA 1UGKA 1YMME 3TBSB 3UX9B 2MEJB 1NCNA 2Z31B 2O61A 1JCVA 3CZSA 3ZR6A 3GLEA 4TUJA 2P43B 3AG1B 2EABA 3O41A 2WQUA 3DYMA 3SKOB 2IOIA 4JDEB 1HIMH 5DZJA 5EO0B 2HKHH 2J44A 3LAFA 1LGVA 4XB7A 3NABH 1VEMA 3DJTA 5MENB 1T0OA 1EMTL 3OKEA 3T0EE 2ED7A 3I6LE 1QR4A 2FJGA 4OM1H 3GPEA 2VLRD 4GG8B 3SD5A 1U95A 3TPUA 1F2QA 2NTFA 5BV7H 4MVBC 4MMZC 4LLMA 2HJFB 5TE7H 4UM9B 3HS0C 1VGEH 1HHJA 2XBDA 2WUCH 2ZX8A 1FZMB 4IBUA 1KPVA 1AC6A 4BFIA 1A9BB 2PCFA 4BYHA 1U8PA 3BHBB 2KUTA 3VM7A 3EO1B 3HMXH 2CM6A 3RZCD 2IV9A 4DCQA 3TGXA 3LN5A 1F8TH 4K94L 4OIAA 1UXSA 2OPCA 1CE6A 3APMA 4PJEB 5IK3B 4P46B 5CUSH 2E4FA 3S3JA 1B4JL 4PJ9A 4ZAKC 3ZTNL 4PLKC 5FGBC 1FDLL 5J7CC 2IPKA 1D7FA 4FABH 1JV5B 2HP4A 5EZLB 4YHZL 4H20L 3E0GA 3L3KA 4KKZA 2Q9OA 3EUDA 5G4MA 3I85A 5HI4D 3B7SA 3WTUA 1JZ7A 1ZE3H 3NACL 3JUYA 4YEFA 1E5BA 1A7OL 3RDTA 2X88A 5CLXA 1U8JA 4TS6A 3GXMA 3CMOL 3TH4T 2O6DA 5LGKA 1JZJA 1F1GA 4GKOA 1QLEL 3NFPB 3TO4C 2LVCA 4LLUB 4BV1A 2YPVL 4DKTA 2XTSA 8PAZA 2WCGA 4AM0B 1A5FL 2QT6A 3MRGB 3V4VH 1H5BA 4LLVB 2FD6H 3ZX1A 1YUKB 4AK2A 4L8CB 4WFGE 3WI9A 4N20A 3HR5B 4L1BA 1KY6A 1CFQA 3WHXB 2QPFA 4I3SH 5CD3B 2EEAA 1Y0LA 4IJ3B 5DZOA 3GI9L 3F84A 3LB6C 3KXFD 4XNZB 1CLZL 3S37L 1WFMA 4PJCA 3VXPA 4P46D 1JZ4A 3QI9B 3WAKA 2D3NA 4PRPD 3P0VH 1HDMB 1M71A 4FFWD 5CP7A 5AW6B 3WCYA 2JCCE 1JYVA 5CMAA 5D2LB 3WNIA 5HHQB 1XDTT 2CIKB 4P04A 3ARUA 4XXWC 1S8DB 3VNZA 4ZTPL 3AITA 3FB6B 4I1NB 3US1A 3BP4B 2HRPL 4R7NA 5IWLA 3U7AA 4J4PD 2I9LB 3DRQA 2VXTL 1SHSA 2ROYA 4V1DB 1DANT 3AWGA 2PPDA 5HI3D 4K94H 3I50H 3FO9B 3OX8B 2H32B 5J5EA 1B4JH 3TBCA 3LRHA 2GKIA 1DVSA 3J07A 1SGKA 4FQJL 3WLWC 3DK2A 4HKJA 1OM3L 3NJMA 3GSNA 5K93A 4TRPH 2X4UB 2QADB 3ZIMA 1WFIA 1QBLL 1UYWH 4U6TA 2Y3AA 4ADGA 4M6OH 4N2AA 3L9RA 4PS3A 1P4LA 2R4RL 4N2NA 4EZLA 4QMEA 4PRPB 1QABA 2DDQL 2WBJD 3GMPA 5EZPA 3TT3L 2ZF8A 3C5ZA 5IJKA 5ALBH 5IROA 3CZUB 2F9BT 1JSYA 2G3ZA 1IAIH 2IV8A 2YPVH 4Y4KA 1KSRA 2E47A 3MFGB 2RH0A 1HIML 2A7BA 4MXQD 2MPAL 2EZ0D 3LZFH 3QWRD 4DPBX 3ZKSD 5ELIA 3WUWB 1MVYA 2X53A 3MGTB 4MXVF 5F0LB 4XRCB 4MAYC 2LU3A 1F4HA 4Y7MA 1V05A 4AG4H 5KBKA 1N4XH 2C7FA 5DRZA 2ZUSA 4WW2A 4UM8B 1YYMH 4FS0A 3C5SB 2C3WA 4UV7L 3F6IA 2GT9B 4FKEA 4J8RA 3V55A 3VXOB 5KYYB 1R3LA 2VSCA 4IM8A 3S6CA 1OGAE 2ALAA 1IBGL 1MEXH 4B9FA 3FBQA 1HZHH 2RGSA 5C0CE 2G9KA 4MNQE 1RJYA 4X7SL 1AD0A 3IFLH 3MV9B 2FWOA 3W2DH 1TYEB 2IWKA 3EYQC 4K71C 4XH2A 2ZUTA 3WIFB 3UZEC 3DSNB 1M7IB 4HALA 3GSWB 5KSUB 4JPSA 3SE9L 4QDGA 1KLUA 3D0AA 3FQ2A 4H2AA 3H1ZA 5EORH 1B0WA 4GFTB 4L18A 3PXLA 2EUZA 4AYFB 3WS6A 1QA9A 3IBEA 2VDQH 3UDWA 2AJZA 2V5SA 3UTSB 4MXWH 1V3JA 4ODSH 5FUZH 2FNBA 5HGAB 3BWUC 3O0RL 4F33B 4UTCA 3IBOA 1DO6A 4W68A 3S37X 1W15A 4J3VA 5I6MA 5GRJH 3VGBA 1U58B 4Y5XA 1Z6JT 15C8H 4IIQB 4RMWA 2DMBA 4W9EC 4BZ2H 5I5JA 1P7QA 1U3ZA 3V6OA 5GSVB 1M7UA 2WLHA 5B1AB 2IDSA 1GVIA 4NKMB 1NC2A 3FL7A 3TFKC 2ATPA 4X6EB 5MEOA 3M7OA 4XWOC 3VDBA 4YZWA 1DBJL 4XBMA 3DKHA 4YPGA 1KLFA 1UT2A 1IKNC 5A16A 3ABZA 2V5RA 3CZJA 4FZEH 2YBRA 4XXCA 2AQ2A 5MHSD 1PVHA 3BFWA 1OT4A 3O6FA 3BZDA 12E8H 4EN3A 4IOFC 4AGQA 3UYRL 1CIUA 3BW9B 1MCWM 2ROXA 1QFWL 3KJ6H 4ZMLA 1J12A 2CO3A 4UNIA 3DX6B 1A7QL 3QJZA 3GMNA 3TBWA 2F58L 4HU8A 2QPUA 5FKPA 3QNZA 4HIEA 3V4PH 5JHMA 4XC1H 4XNMB 3ATFA 5FKAA 3BWZA 1LYQA 3V0JA 4DP7X 2E7CA 2AK4B 4YDIH 3FU3A 3R7QA 1SEBB 1PFOA 4NWTH 4IBQA 2XTJD 5IHBA 4UT6A 3QUMH 3MBXH 1FNEA 5KN5B 4GXUM 1D5XA 1EGJH 2XG5B 4HV8B 2P24A 2JSFA 2YAEA 1OAUL 5DD6B 4XN7A 3KR3H 4AI7A 4QWWD 3UMNA 4A63A 3O6ML 3RVXC 1RIUL 1KXTB 1CLYH 4P23D 3D25B 2IAND 2HTKD 3UCRA 1FFOB 1W0VB 3P0YH 3UPAA 5F70A 3PWLB 1EO8L 2K1MA 4UOW1 4D2NA 2BHUA 4YDJA 2A77H 3PHAA 5DVOA 2EYSA 3GJFH 2C9VA 3K2UL 3RFRA 5LDSA 4K15A 4EI5B 4OM1L 3ARBB 3C60C 5T1DL 1Z5YD 1AE6H 1E6JL 1S46A 4KHTL 1PZAA 5GRXG 1S7SB 1T5WA 1GW6A 4X6DF 2F7PA 1OVZA 3WFBH 5FR3A 1DVXA 3GSQA 2ZSVA 2V2XA 5EBWB 4ONHA 2VMFA 3KYMA 1IGFH 3KHQA 1J5OH 1SEQL 3FF8A 3V0WL 3E6FB 1SNRA 1UQSA 5KTEL 1ZS8A 4IBZA 1S5IL 1QSFB 1NCCL 4O2FB 4TVPE 4G6KH 2Q5BA 1J5CA 5J6GA 1UATA 4LQ1A 1QP1A 1I8MB 2Y7MA 5FEBA 4P23B 4X99B 3LSOB 3OAYK 3OG6B 5IJBC 3ULVD 1EERB 2BP0A 4UAHA 2J8UE 3CH1A 3MHZA 3VRIA 4BWWA 2J72A 5CJQL 1HQ4A 2BOCA 4RSYA 4PG9B 4AYID 1UWGH 1JGUL 5GGSY 5CGYC 2DMCA 2X70A 4QRUB 3EYQD 1MH5B 3ES6B 3F00A 3U6XS 3QFJB 4JPWH 2ESVE 2ZOKA 1XD0A 2DJUA 3QPQC 1DDTA 2K4AA 1KJ2B 1LM8V 2I60H 3O6MH 3TA3A 3WLBA 5TE6H 4JCLA 4N85A 1DUYA 1VPOL 2GPZA 1AGBA 4K5MA 1QSFD 1KDJA 1U3HC 3ZJAA 3AM8A 3BAYA 4JAMA 5CN2A 4K9EH 2DLHA 2V9QA 4WI4A 2R1YB 1TXKA 2KI6A 1H9DA 1P4IH 3P77A 1AGEB 3N1PC 4AJ0A 1K4DB 2EO1A 5B1KA 4GXVH 1YEGH 4G1MA 2FT8A 5KVFE 5I0ZA 5AOMA 3U4BH 3R06B 4PQXA 2UZPA 4LAQL 2EDQA 1KCRH 2D4FA 1J5OL 1FPTH 2X4TA 1KJMA 3EBHA 5G4OA 1T4KA 5AENA 2WVSA 5EORL 4MDIA 3SQBA 4APQB 5I75B 2UZXA 1CFSA 1RAMA 3L1OL 1HE8A 2FBJH 1AY1L 4MGXA 2DWEA 2EYRA 3FO0H 4J6RL 1C8QA 4M8VA 2DQCH 4Q6IC 1RZKC 2WQWA 3I2CH 5AWNL 1PMYA 2VABB 1JK8A 1OAZH 1W16A 3V7AG 1DFXA 3VXTB 3VD5A 4P07A 4OZHA 3ARRA 1BXUA 3QUXB 3DV6A 3GXPA 1JRHH 1U91A 1WDAA 2DBLL 3RNKA 3ESPA 2XXFA 2OCJA 1XGZA 2CO6A 4TL4A 3MA9L 5EZIH 1SMOA 5FA3A 5E8NA 4KJPC 2R2CA 2ADJB 4XXDB 3LKOB 2AJ3B 3MNWA 3PWVB 4ODTH 1DBKL 1TJGH 2AS5M 2GHWB 32C2A 3RTQD 4EIZC 3LKRA 5J13B 1IAIM 4N8CL 4OM0L 1P7QD 1Q0XL 1U8KB 4APXA 4CKVX 3CFNA 4APQD 4KZDH 3IDJA 2BY0A 3NIDE 2DPKA 1J1XL 1FNAA 2L04A 5EU7C 3US9A 4A04A 2HRLA 3OHXA 1QLRB 3QZOA 4K3EL 4XCNA 3IJYB 4WKZA 5CP3H 5A6IA 1YLBB 3B9DA 3MJ9L 4MX7A 5ISZE 3AS0A 4YC2B 5I6XC 3D69A 3HS0A 1HEZA 4AJYV 5BCAA 5DZNA 5HHXH 3VW3L 2J5LB 1OTUD 4FABL 3KCPA 2V7HB 1ZHBA 1N8ZA 3GGWA 4YSRA 5CEXA 1L0PA 3MRQB 3NZ8B 2EE0A 1INQB 4EO5A 3CDZA 4LHUA 4NZDA 4P9MH 4LEXL 1MCPL 3EJTA 4JFQA 1OGAA 1WGVA 3U9UB 4GLRH 4U49A 3MJ8A 2AMGA 4N90D 3VNYA 4OQTH 5CFAA 4WJ5A 4QKXB 1NBCA 1EAQA 1FCGA 1QFUH 2OW6A 1X6LA 1HINL 2X0WA 3K8KA 2E4TA 2FJUB 3A0OA 4KGJA 4WWKB 2YD2A 3O3AA 4FG6D 4B3VA 3N41B 2FH8A 2H1PH 2EXWC 1RULH 4PJXB 4LEOA 1AR2A 4JKWA 5DMIH 4BDVB 3KL0A 3MTRA 2VMEA 3H9HA 2WXQA 3HNSL 4RRPM 5DQ9A 2H6PB 5ERWA 1VLXA 5KOMC 5C0DA 5C0IB 5HGBB 4U1SB 5F3FA 1UKQA 1TYJA 3O0LA 3AM8C 3R18A 4PCSA 4N6RA 1GGTA 2GABA 4KZDL 1KYOK 3IN0A 4AIOA 5CEZD 1MWAL 1LD9B 5AKRA 3QULA 5B39B 2CCWA 2X4OB 3UTTA 4WLCA 1RK7A 1D9KA 2A9NL 3A67H 1IVLA 2VL5A 5KJ7E 4EUPA 2B4CL 4KROC 1Q0EA 2F8XC 1FBIH 4E9XA 4JY5L 2BVPB 3DI2B 4LZKA 4MD0A 4CAGA 1MFCL 2DKUA 4Y4HB 3H6JA 2CBMA 5EDSA 1GSKA 2BVTA 1Z66A 1LTXA 4PGZA 3T09A 4F9PC 4EI0A 1XF1A 2FBJL 5DK0B 3OKDA 3LH8A 4F58L 1CGXA 2I27N 1WC7A 3I2CL 3CVHB 3QFDB 3F04A 1GIGL 1QO3A 4NQVB 2E9JA 5IESL 5DDHB 3IFPA 3QS3A 4R3SA 4YL4A 1P5VB 2XVLA 2K45A 3OB8A 1MNNA 4JY4B 1ML0A 4L29B 1D7CA 5TDNA 2IGTA 5I19L 4JRYA 3UC0H 1BD2B 1WZKA 1AHWB 3CHSA 4UQ3A 1VF5C 3QPQD 5GGRY 1HZKA 3QJXA 1J8KA 2EH8H 2FNWA 1VZGA 3ZO0A 4RZCA 2OZ4L 4HJJL 4D0DA 4P9HC 4QXVA 1XF2B 2ED6A 2J6WA 4DQOH 1EGJA 2IO5A 35C8H 4D3CL 4ZUSA 4JE0A 1WF5A 4J27A 5C2UB 5LWYH 1C5BH 1VFBA 4HK3N 4MCZB 5GS2D 1DQTA 4HISA 5CEYB 3SDDA 5MP6L 2FH6A 5CAYB 1QYGL 1HXMA 5B3JF 2DQDL 3E2HC 5DD5L 1GYAA 3LNEA 4J6IA 5E99H 1EDYA 5FS5A 4ZMXA 2DQJL 2VWEE 4IU3B 4KO5A 4NLHA 4QD2E 4HS6B 3OKNB 1TJXA 2EKJA 3EUUA 4QHMB 3BWUF 1KLGB 1XF4B 3Q01A 4P5TB 2W95A 4N2OA 3DXAA 2VDRH 4LSUL 4WI7A 4UOJA 3GRWL 5EUKB 2OQJB 1XCTA 2P5WB 2AK4E 3PWUB 2W81C 2WBKA 1T22B 3MCLL 4M6NH 2IH1B 1HI6B 5AW0B 2Z0BA 5KS9F 3K6SA 3BSZL 4AEEA 2V2TB 2FLMA 2I7OA 5DQDH 3MLWL 3V0IA 1RZIB 3OXRB 5FHBL 3U2JA 2DQFB 3IGAB 1CT8A 3ZUCA 4IK6A 3D39B 5KSBB 5C3LD 5C1MB 1C16A 2AJSL 1MW3A 2A9BA 4A67A 2CKBL 1F13A 1B0RA 5IVZA 2QLVB 4CSPA 3DSFL 1USZA 1OK8A 4ODVL 4X4MA 4ONFL 1KGIA 3A4FA 5DI8B 5L4IA 4M3JA 3HLAB 1A14L 4HYTB 4X7TB 4GUPA 1MJ8H 3W11C 4G6AD 5SWSE 5C0GB 4Y0GA 4AMKL 3I75A 2TSBA 1OOAA 3K7UA 4MJID 3HFMH 3ESNA 3UZQB 2R2HA 3JV4B 1AQKL 1T2JA 1UCBL 3KYNA 4J3XA 4TQIA 2LLGA 5EIIA 2CA3A 4EMZA 1OCRB 3FFDB 3VSQA 2HG5B 5KJ4A 2JTYA 2NNXA 1PEWA 2ENSA 5CBAA 1YJDH 4KK8C 3LKSA 4X6CE 4Q97A 5BS0E 2YD5A 1FH5L 1MG3C 2E75C 2VZ1A 2QMJA 1AIFA 3ARDA 1VERA 4C56B 4ELKB 2NR6D 4B3EA 4QRQA 3NFSL 1KT2A 4PJEF 1NSNL 3UAFA 4XP9H 1V7NH 3AT0A 1CBVL 4HK0A 2VDOH 4X7CC 4S1DC 1NBZA 5ESAB 4PGBB 3MGOB 1ND0A 4FYSA 1FIGH 1PZ5B 1X9UA 4PWEA 1H9VA 1TZHA 3AXLA 4KUZL 3CHQA 3A6CH 3PL6B 5K59F 4GBXC 5IESH 4NX0A 4PSRA 1ICTA 3EXLA 5CGBA 4F5CA 4LSRL 4F7KA 5CJ8A 1AMYA 3FRUA 4BGLA 4NNYA 2VXSL 2NY2D 1BWWA 4NPYA 4P2RE 2W07A 4IIZA 5IJCC 4H13C 4U0RB 1T0PB 2G75A 1RHFA 5E8OA 4R5TA 2K6WA 5GRYA 5I73C 4M62L 2WZ5A 3MJGX 2IFFH 3L9YA 4MMZA 5E6RB 5ETUA 3ZDYE 3BZFA 4WFFD 5E2VH 4OJEH 2E9WA 4X8JB 4ZX3A 3K5SA 3HBPA 1JWSA 1NWOA 3FHQA 1WLHA 2CR6A 1OTSD 2EUWA 2WQAA 5F9DC 5HHMD 4Z76A 2JJSA 1P1ZA 2NZ9D 4L3CB 4BH8B 2O6CA 2PP8A 2G30A 3NIGE 4NNXA 1TPXC 4U1HB 1H3TA 3FB8A 1OLZA 5E1AA 3V6ZA 3GBLA 2AW2A 2NYYC 2Q1EA 3TLRA 3EGDB 4U1GB 4FI7A 2CLRB 3O3BB 4MMXA 4A2GA 2C4FT 3EIFA 5GQBA 5DYOA 5C0AD 2FX7L 1PLAA 5I1GL 3QISA 3MCLH 3SPIA 1EFXA 1QZNA 4XVJH 4CC0A 2L8AA 4DO5A 1PIGA 5CCGE 2D03H 2CCLA 3SDAA 2WLIA 4AGNA 2N1KA 5KS9B 1CR9L 3SDXF 3CVBA 2DMHA 3KVPA 1H6TA 4J23A 3ESUF 4KKAC 2GHZA 1P6AB 4JZNA 4LVNC 2DQIL 1TQCB 4GAYA 2Y23A 5IUCA 5TE4H 1DJIA 3CZEA 5D1QE 1T1XB 2PTTA 3IGKA 2B15A 1XTLA 3MYZA 4O9HL 4Y2LA 1NCDL 1U8CB 2WVVB 4F1ZA 3QFJD 3CJJA 4DTGL 4JG0H 1ED3A 1CZ8H 4KKLD 5CJBA 5E9DA 1NAKL 5C07A 1NFKA 4MVBD 3ECBB 3QEQE 3S0PA 2F0CA 1FVDA 5KYWB 3LVEA 1MXGA 3IGUA 3S34H 4M02A 1JPTH 1J5HA 3WG7B 1WBXA 2CGRH 3KWXA 3O2VL 2X9XA 3FHAA 5D55A 4HWBA 5E94B 2DQCL 3WJJC 4E41E 4JRWA 3UJTL 1HHIA 2F5AL 3P4MB 3WGVB 3RVWC 2YAFA 2R1XA 1DVFA 3MXWH 5EBMB 1AZZC 1W0YT 3BVNB 1MFCH 4EVNB 5H35A 5KG9A 3F7YA 4LSDA 1DDHA 1X5FA 1JS4A 2JKWA 3LTVA 4YHKH 3RVWD 3U0PB 4U1IA 3RFZC 5C0JB 4HSCX 4NKOB 4RCAA 4H5SA 3BFOA 3MA9H 2KQNA 4XBPB 1JZ3A 4R2GD 5B1JA 4QJ4B 4LVOC 3IAPA 3GO1H 4KGLA 5T3ZD 4LQFH 1VADB 4U6HB 5KVGE 4PJAE 1ZV2A 3ATDA 4KMQA 1IBFA 4PRIB 3ZT5A 2XT1B 3T4AB 1TQWA 5AYQA 2FO4B 5CUSL 5DK2B 4XHJC 1N59A 2XN1A 2QELA 5HI4C 4K73A 2JKXA 4R4BA 5C2BH 1A6UH 1CGSL 3RBGA 1K6QL 1OO2A 1UCTA 4IDJH 3UAEA 2DYPA 5C0BB 4FXTA 4MJ6A 4DTGH 1EWHA 2BSEA 4Y5VA 3TWCH 5HHXL 3VU1A 3VW3H 2APTA 3FFCB 5F1NA 1IIKA 3MJ7A 4YHPB 3RTQB 3OB0K 3VI4B 3PQYB 2WOBA 1CG9B 1A1NB 1I8IB 1X44A 1F58H 3DXAE 3OMZA 1TLKA 1AQDB 3OL2A 4MTMA 2IGFH 2XU9A 5FOJA 1P2CB 3TBVB 4U1NA 4XCYA 5BRZD 3QRGH 3L17A 4R5XA 3HBQA 5C7XH 4R2GB 2NQ3A 1FGVL 1SXBA 3CXFA 1W91A 3EYSH 2WWNA 3SKMA 4ZX5A 1F4WH 3ZE0F 2A6JB 4GQQA 2NY6C 4KY2A 4OQTL 2D0GA 3QXVA 4J7RA 1FG2A 1OP3H 4ESKA 3V5KB 3AY4C 2VDLB 3IRCA 1IC4H 2X7LB 4C56E 3MLSL 3W39A 4PS4L 3HC4L 3O3DA 3KPSB 4L4TD 4WEBL 4NZFA 4AITA 1CURA 4MBRA 1XB3A 3PXJA 3OJDB 1KB5L 2IG2L 1AZCA 2IFFL 1U9KA 3ZVVA 4P05A 4XO5A 3D06A 3T3PE 4G43A 5JNYB 5EUOB 3CPLA 4RWHA 5FM4A 3BDBA 3KHOA 1UJTA 4FE9A 3J2PA 5BRZB 1IJNA 3SE4C 1T80A 4ZYKA 5JPNB 4DGYH 3VRLF 3W3BA 5CFHA 5JHAA 2ZWNA 2PPAA 3RL1A 4S0TD 2ADGA 1NKOA 2VLRA 3Q6FA 5I8CA 5DHXB 1ERNA 3FQTA 3NCEB 3EYOB 4A2MA 5TJWK 1AKJD 4R4ND 1XO8A 1OAXH 3MDJA 4NOBA 3D0VA 1ZLWH 1LE9B 4KRPB 4G5ZH 3BCDA 2BHFA 5L7XH 2WTPA 1J1PL 4F91B 1GGBL 2HFFB 4ANUA 1U8OA 4KV5F 4NO2B 3FHEA 4LRNH 3T2NH 4P57B 1X5JA 3WFDH 3OHXC 5J9PB 1YO4A 5DRXB 5I16B 1Z0NA 3QQXA 5DVKA 1UH4A 1OOWA 5EIIG 3U83A 3QDMB 5E6UB 3ROLB 2LW3A 2ZPKH 1FH5H 1SOSA 3KPPB 1NUFA 3BEWB 4PHXA 3V79C 1YJDC 3IDNA 4WHYG 4OLUH 1RL1A 3HC0A 2C1OA 5DEJA 4CADA 2UXFA 2YRZA 4KH2A 5LAPA 4DUXA 5C0AA 5CSZA 2J25A 3T6XA 2Q8BL 1YPZB 5C8JB 1JHLH 3QQ3B 3TZVB 3QJHA 5F72S 4TM9A 4GW5B 5F93C 5AB9A 3UYPB 4LGPB 2F68X 4HOWA 4UOW0 3ZGIA 4UINH 3N42F 1KGYE 1IIIA 3LEVH 1S7XA 2BXYA 4KO7A 1E3ZA 1KN2L 1N8OE 4HGKC 1KJ2L 2YC1B 4XPGL 1H8OA 2OI9B 1U0QA 1RP9A 3VG0L 3WO3B 3EBGA 1VIWA 3OKOB 5AL8A 1AQHA 4JREC 2XBTA 2YEZB 2C4FU 3S34L 2WGXA 3QDMD 4HWUA 5FUOH 1MWOA 4F93B 4OTXH 3W38A 3IDGB 4YHYC 1TTAA 5GZNC 3Q1EA 4C4KT 4ODUB 1MAML 2WHVA 5C08A 1RUQH 4JPQA 2A2QT 1XL4A 5ICYA 1QWUA 1S9YA 2Y2TA 3ZKXC 5DA0B 2X4NA 3AMKA 3CU1A 4L8BA 5DRWA 3VI3A 5I1DA 2P4AB 1JHKL 3HFFA 5AOJA 2X6VA 1OEZW 3I6SA 3QXUA 2B1HL 2BRRL 4X0NA 1D7BA 1KACB 1C1EH 1YVLA 4P5MB 3SGEH 3TTSA 4NBYB 2PP7A 1XFPA 2NUPB 4QRPB 3QUYB 2CBOA 3HG2A 3RKPA 1XL6A 5DWUH 4N87A 5B38G 4M5YL 1CU4H 3GIVA 1ZHNB 4YHOH 3C6SA 5IHZA 3ZZSA 4RFEA 4X4XA 3AFLA 1X7QA 2D2OA 1G7QA 4OGAD 1U8IB 4ZOEA 3AXIA 5IFJB 1L9NA 4QO1B 2QQQA 2C26A 5CIPH 4K7FA 5IROD 3QUMB 4QRTA 2RD0A 2OMTA 1NCAH 3BMWA 4BFJA 1R5WB 3OR7A 1U92B 1NIAA 2VXUH 2H0FA 2WN2A 4BJLA 4IDJL 3QYMA 1B4RA 1BW8A 4XBGA 3ARQA 4RNRA 1U8HA 3U0TA 1EZLA 2WO2B 3HVDA 4FFZH 4HH9A 4NO0B 3B9VA 3H9SD 8FABA 5I1IL 5JIMA 5I28A 1KV3A 2OR7A 2SODB 4NQCD 3IDMB 3JZ7A 2Z4QB 1B6UA 1BFVL 1BOGB 2GTWA 4QRPD 1ETA1 3O4OC 3OAWA 1UENA 4FHJA 5HXMA 1U4EA 1OARH 3RWCB 3AQYA 2BSED 3ML8A 4QIRA 2WUCL 1RUMH 3FPXA 4G72B 5L8JB 3WTTA 4X9YA 1DSYA 4RDQF 1DBMH 1YY8A 3CH8A 3D08A 4A7TA 3QRLA 1OAUH 1YDPB 3QORB 1G9EA 3WMSA 1KTLA 5F88B 1JF6A 2RR3A 3LN9A 5D72H 5E2UL 5C07E 1TZIA 3T0EC 4YIQB 1RZPA 3VSUA 5KAQF 1G0DA 1T20A 1JERA 4KKRA 1QW8A 3O6FD 2G3NA 4NJ9H 1X4ZA 2X12A 2EDKA 1D9KC 1TNMA 2H8PA 3GZQA 3LKPA 4OZFB 4PY8I 3B83A 5GS1C 2HPTA 2QKIA 5CU9A 4DZ8B 4E9YA 4AQ1A 4UOZA 5I1AB 5C7ZA 3ETBF 3MRDB 5HYSB 1OGPA 3BT2L 4OCMC 1IL1A 3DUHA 5I5IA 4LLQA 2EADA 3SBRA 1VESA 4HCFA 3MLXH 2NLJB 1XGYL 3X17A 5B7MA 1UEYA 1JWUB 2OJ1A 4LKCA 4XOAA 2IDCA 5HHNA 3S3CB 4WK2B 2AEPH 1KXVA 1XCQB 2EEXA 3V4VL 3BEVB 2N1TE 5E1IA 4AV5A 1SUJA 2EIEA 2YPLB 3TWYA 4H1LB 5H37H 5DS8A 1GOFA 2QPEB 1JV2A 4JANA 2LLLA 4GXUN 5IIEB 2AXJA 4YWGL 4O00A 1FNGB 2CHXA 2VCOA 4X8XA 1NUNB 4XI5C 2YGOA 4YS4A 3ECWA 1FVEB 1MCBA 2CUAA 2NDFA 5DT1H 2QVFB 4MNHA 1AR1D 1X5LA 2DTML 3VB9A 2DM2A 4NKIH 3BUYB 4LDCA 5ABAA 1JGDB 2E8YA 5I66B 5CJQH 1ZT7B 4KVNH 3CFIC 4A7GA 3BKCL 5B7EA 4X6CF 3KYKH 3NP3A 3GMOA 2ZZUT 2YWZA 5LCVH 5GGSB 1ZMYA 4DESA 4KPHH 3HHSB 2X4PB 3T77A 4BSJA 2Y2WA 3HPJA 5TFSH 1QI5A 3TXAA 3N3EA 1TCRB 2MHAA 4NIYE 2ZOUA 2X1PA 2IADB 4F57L 3GSRB 4U1KA 1LL1A 4UBDC 4YHOL 2AAVA 4JG5A 4ZQKA 4LGRB 1KBVA 3K5RA 4CDGC 4OCSH 2ZJSH 1TIUA 2JELL 1I3VA 4Z7VE 5F1KC 4XMXA 4PRIE 1SUHA 4BKSC 1R3KB 5T5NG 3BZ4B 4IKLA 4JQXA 3V0GA 5E8PA 1I82A 4HWZB 3F64A 4MQTB 2VISA 4UM9D 3L95B 1AKPA 1MF2L 1PLBA 2WXIA 4XPBL 3WLWD 2WLKA 3QEHB 4UDUA 5EPMA 1KG0A 4NC0B 2YGPA 5D1ZA 4ZUUB 1YEKL 2UY7B 5D7JA 4DP4X 2OMYA 1SLXA 3NPSC 2XV6B 3QJFB 4WI9A 3HB3B 3LPFA 5ID1B 2YN5A 3WEBA 3BD3A 4A7SA 3MLTA 1OAZL 4KVCL 3AROA 1BVKA 2H9GA 1YC7A 3EFDL 3QDGB 5CNHA 2P7TB 3L5WA 2DWDA 4PJ8C 5IFHL 3GSOA 1R3JA 4OCWH 4TULH 4XPFH 3NIFB 3ILPA 4HT1H 2CIIB 1YEDB 2DQEL 2VLRE 1TJIL 3QHFL 4WK0B 3AT8A 4Z7QF 3LYRA 2ZOWA 1E27A 2ICWA 3X3FL 5IBLD 4GRWB 1IZJ<