1R1CA

Pseudomonas aeruginosa w48f/y72f/h83q/y108w-azurin re(phen)(co)3(his107)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEHWMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Spectroscopy and reactivity of a photogenerated tryptophan radical in a structurally defined protein environment
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 35
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1r1cA00
2PP9A 4NB7A 1AZRA 1N70A 4A2FA 1ILUA 3WI9A 4X4KA 2BW5A 1DZ0A 2HX7A 2BP8A 1BYOA 3DKHA 4KNSA 4F2FA 1XB3A 2BW4A 4AKOA 2Y69B 1WA1X 2WO2B 4AX3A 2PPEA 2UXFA 4DP8X 2J56A 3SBRA 4EF3A 3X1FA 1W6WA 1L9SA 3CVDA 1T5KA 3GDCA 1L9TA 4GYBA 1V54B 4CSPA 2OCCB 1SDDA 2PCYA 1BXUA 2GC4C 4DPBX 1TKWA 1B3IA 3ASNB 4NAJA 3T6VA 3X2QB 3D12B 2AVFA 2DYRB 1J5CA 3OMIB 1SHXA 2BWDA 2EIKB 3MX0B 6PAZA 4HAKA 3UAEA 1R1CA 3JT2A 1A4AA 1IKOP 5I5JA 4WTQA 5TK4A 2HRHA 2Y1AA 1TEGA 3NJLA 3U25A 1HAUA 4YSQA 1ZDQA 2YARA 1L9OA 3N2JA 1E5ZA 1PZBA 2W88A 1AZBA 1PNDA 2UXVA 7PAZA 2VW4A 1JZGA 1SNRA 3BVDB 1J9TA 1IBYA 1JXDA 6PCYA 2IAAC 2ZOOA 5FC9A 3SBPA 2XLLA 2CUAA 1KBVA 3EF4A 2H47C 2FQDA 1ASOA 4YSSA 4N4YB 3SQRA 2QT6A 1ET7A 1ASPA 2DWTA 4GY4A 5ANHA 3TASA 1IUZA 2YAQA 4YVNA 3UACA 2I7SA 3ZX1A 1AS6A 4PCYA 4W9ZA 4DP1X 3PAZA 1BEXA 2XV3A 4NERA 1DYZA 5I6OA 5I6PA 3ASOB 4BWTA 4KO6A 1WAEA 2VSKB 3IE9A 4YSDA 2W8CA 3CDZA 3IEAA 4Q89A 3TU6A 1AQ8A 1SF3A 1AS8A 2RACA 3EH5B 4YSUA 1OE1A 2BP0A 5I6KA 1NPJA 2EIMB 2XUWA 1OCCB 4P5SA 1AANA 1WS8A 5B7EA 1PF3A 3ERXA 2DWSA 3AG4B 1AIZA 2IDFA 2VW7A 4E9VA 1JZFA 3T71A 4QLWA 1J9QA 1QNIA 2FTAA 5I6LA 1JZJA 3AY2A 3X1NA 3T6XA 4DP4X 5B1JA 5I26A 1W8EA 2J55A 4W1TA 2QDWA 3C75A 2GIMA 2JKWA 4JHVA 3FU7A 2IWKA 2HZHA 1GY1A 1NIEA 2EIJB 3V9EA 4CSZA 4BWWA 2UXGA 3EH4B 1OCOB 3BQVA 3FS9A 1AR1B 3N55A 4HCFA 5B7MA 3AG2B 1AZNA 2HX8A 3UADA 4G72B 3QJTB 2GI0A 4DP6X 1CC3A 1N68A 1CYWA 3FSAA 4GXFA 1ZIBA 2VMJA 5B1AB 3FSWA 1AOZA 3NJNA 1PCSA 3T6ZA 3PAVA 2BWIA 3WG7B 1JXGA 1KV7A 1FWXA 1GYCA 5A7EA 4JKNA 3HEIB 1ETJA 5AZUA 2XXFA 3WNIA 4GP5B 2JXMA 2PP7A 2XXGA 5F7BA 1KYAA 5B1BB 1JVOA 4A2HA 3QJQB 3FU9A 4YVUA 3X1EA 2LLNA 1JERA 4E9YA 3EH3B 1X9UA 1NPNA 2AZAA 2IH8A 2QPDB 2X87A 3WKQA 3H56A 2FQEA 4YSOA 2AZUA 2IWEA 2YAHA 2CBPA 1ASQA 2XYBA 4DP2X 3H4HA 4YSCA 3KW8A 2XX0A 4HALA 2TSBA 1J5DA 5I6NA 3X1GA 4AKQA 4YSPA 1QHQA 4E9SA 5E9NA 1XMEB 3QPKA 3FU8A 2CCWA 3FPYA 5EHFA 3NT0A 2R7EA 9PCYA 1MDAA 2PPFA 3PXLA 3FPXA 4KO9A 2CALA 4KOCA 1ET5A 4DP0X 3OQRA 1A65A 2IWFA 1ILSA 2IDUA 2CJ3A 5B3SB 4TXVB 3NSCA 1TEFA 2Q9OA 4L0PB 4ZK8A 1KDIA 2XV2A 4MFHA 7PCYA 5PAZA 4YSTA 1WS7A 1JZEA 1NIAA 3NJIA 1AS7A 5F7AA 1QLEB 4F2EA 1BXVA 1AG0A 3ABLB 4DP9X 1ZDSA 2P80D 2FT6A 2CAKA 2B08A 1JZHA 1M56B 4P5RA 3FQ2A 4E9QA 4G7QB 3CVBA 2EILB 1NICA 3NJHA 3NP4A 3RYMA 2H3XC 4K9JA 1L9RA 1UATA 3OM3B 4BK5C 1SF5A 5I28A 1VLXA 2DV6A 1PZAA 3MBWB 2EINB 2YAPA 4HHGA 2WO3B 4YSEA 3IN0A 2BZ7A 3NSDA 3WKPA 3FSZA 2BP8B 1PLBA 1PLAA 2YAEA 5D4JA 2I85A 4A2GA 3NSFA 1NTDA 2FT7A 4BDVB 8PAZA 1IBZA 1M9WA 4DP7X 2OJ1A 4E9WA 3UAAA 2VW6A 1J9RA 1JOIA 2IH9A 2GC7C 2FJSA 1A4BA 2VM3A 2VSMB 3IBOA 3AW5A 3FT0A 1SDDB 3PPSA 1OE2A 3OMNB 4QKTA 3H4FA 3UABA 1KCBA 2YAFA 2ZONA 1F56A 4G7SB 4UAHA 3DIVA 4BXVA 3V9CA 2PPDA 3G5WA 1JVLA 2GBAA 4A68A 3EHBB 4HIPA 1PZCA 1BQRA 4HZ1A 1X9RA 3NJJA 1HFUA 3QJRB 2BHFA 1URIA 3HB3B 4FAAB 2PCFA 4YSAA 2ZXWB 1A8ZA 5AFAA 4A2DA 3CZUB 3FSVA 3S3DB 3L45A 2AFNA 5LDUA 2XVBA 3OD3A 4GP8B 1ZIAA 4DPAX 2PPAA 2IDSA 2PPCA 3NSYA 1AZCA 3CG8A 4G7RB 4F7KA 1BYPA 3GXUB 1EZLA 1SFHA 1WA0X 1OOWA 2XU9A 3PLYA 2PLTA 2HXAA 1V10A 1KGYE 1GR7A 1ZV2A 3NJKA 1HAWA 2MTAA 1YLBB 2P80A 3WNJA 1JZIA 1RKRA 1A3ZA 1ZPUA 2NRDA 3DTUB 5IY5B 2J5WA 3S8FB 2FQFA 2H5UA 1BQKA 3ZIYA 5PCYA 4BXSV 2QPEB 4G70B 4BDVA 2A3TA 1KCWA 2DY2A 2PP8A 5I5MA 1AACA 2OV0A 4AZUA 1GS6X 3TBBA 1MG2C 2HX9A 2Q5BA 2FT8A 1I53A 3X1BA 5I6MA 1ET8A 5D4HA 1ID2A 4E9RA 2VM4A 3CDZB 3OMAB 4M3HA 5AKRA 2JFCA 1RZQA 3NJGA 4RH4A 1GW0A 2E86A 4KO7A 2B3IA 3FYEB 1PAZA 2BP0B 1MZYA 3QJSB 3S3CB 3TBCA 1W6LA 3NYKA 5B1KA 2IDQA 2GB2A 1GS7A 2QDVA 2YXWA 1NDTA 1E30A 1ADWA 3FQYA 4E9TA 1NIDA 1IC0A 4N8UA 1GS8A 1SHWA 2FWLB 3KW7A 4YSRA 1XB6A 1OE3A 1NINA 2BO0A 1NWOA 3AG3B 1OCRB 1CYXA 1MG3C 3T9WA 1SJMA 1OCZB 3T6WA 2UX7A 3FU7B 4AKPA 3NP3A 2HLEB 3FYIB 1JXFA 3PAUA 4DP5X 2YAOA 2XV0A 4G71B 4E9XA 4FA7B 1L9PA 4HHWA 1KBWA 2YAMA 1AG6A 1NZRA 4A66A 2TSAA 4A2EA 1V55B 1AZUA 2MRYA 4YL4A 1TU2A 4DPCX 2XWZA 1PNCA 2GHZA 1MZZA 3NJFA 1RCYA 5B1JC 2AANA 2VN3A 3ABMB 4ENZA 1RZPA 2ZWNA 3JTBA 4KNTA 5B7FA 2GSMB 1EHKB 3NJMA 3GYRA 2UXTA 1SFDA 3IN2A 2WSDA 3ABKB 3TA4D 4HCGA 1GSKA 1E67A 1E5YA 1XB8A 3QJUB 4UANA 4BWUA 2J57A 1J9SA 4M4RB 1FA4A 1AAJA 1PLCA 4A67A 3AG1B 1NWPA 1M57B 1BXAA 1PMYA 2N0MA 4HCIA 1NIBA 3CVCA 5D4IA 4JHUA 1KDJA 1GY2A 5TK2A 1NIFA 2BZCA 4KO5A 3WIAA 2DYSB 2HRGA 3S3BB 2X88A 2I7OA 1BAWA 3FQ1A 4UF7C 3SBQA 3QJVB 4PAZA 1E65A 1FFTB 1WA2X 5I5IA 1BQ5A 2YQBA 1OF0A 3PCYA 3UGEA 3ZDWA 3ABGA 2FNWA 1OV8A 4GP4B 3ZBMA 2UX6A 3AZUA 1CUOA 1PY0A 4WKXA 2XX1A 4KNUA 3QQXA 2FQGA 2R7EB 4AI7A 3S8GB 2IDTA 1A4CA 2YXVA 1CURA 4KOBA 1L9QA 4Q8BA
chains in the Genus database with same CATH superfamily
2ZOWA 4L1HA 5I1HH 4OCWH 3BO8B 2ZXEB 1MFEL 3KVQA 3RL1B 2B5IC 1XSIA 1KB9J 2CGRH 2QMJA 4EN3B 1AHMA 2XWRA 3ZDZB 1FIGH 4KZDL 2FO4B 3RJDA 43C9B 4ZYKB 4H0GA 2I5YL 2NTFA 1MREL 2OM5A 4JRYD 4RIRA 3SGKC 1QWNA 1W0WB 3ESPA 4TULH 5F9AC 4P23D 4TNGA 1WUNT 4XVSH 1L9NA 1NUGA 4E68A 4K55A 3RPBA 4DFHA 3HMXL 4QY8A 5CHNB 4ZUTB 3IJ9A 3MLYH 4FYSA 4XMZA 5H35B 1X7SA 2ZXGA 3VD7A 5HI5D 4X4YB 3C5JB 5K93A 2PCYA 3ILPB 5DD3L 5ESVB 4A7SA 2NY0D 2Z93A 5E2WL 3QISA 3ESOA 3BJ91 4OSUL 2O5NA 4LSSH 4NAJA 3AACA 3LYRA 4S1SH 3X2QB 2NX5A 1ZLVK 3N6YA 4GG8A 5FM8A 3CHSA 5JTWA 3JT2A 4BSWB 1LWJA 1UM5H 1A4AA 1MCWM 4PJFF 4APQB 4QHMB 1NBCA 3OAZK 5EZLA 4ZMYA 1K5WA 2DL2A 3K74B 1UT9A 4PJGB 4X50A 1PD6A 3SE4A 4HPHA 4GRLB 3O9WB 1UUSA 1A6VL 4G6MH 2DM4A 4LEXH 4ZJ9A 2F53D 2HVBA 3L13A 4PIRF 5CSZB 7PAZA 4TLSA 5IQ9B 2NUPA 3H55A 4FL4B 4PRHB 4X42A 1CQKA 2IAAC 2BY0A 3ARWA 5F7UA 1ORQA 3BRFA 4FQQA 4N20A 4XMKH 1WWBX 1NA8A 1M1XB 1E6OH 4MA8H 2C3VB 4WJ5A 5DJ0A 1Q4NX 5AWNL 4YSSA 5ACZB 2FO4A 3S6CA 4PY7A 1F00I 3JQOB 3GTTA 2QT6A 3FTGB 1F1AA 1A9EA 4EDXB 4PJDF 1NL0L 3UACA 3SDAB 4MAUL 3WNMA 3HR6A 2YSTA 1U3HB 5JQ6L 1FCCA 1N64H 5K5YA 4JQVA 1Q72H 1H6UA 4G8FB 4OIFA 4X4YA 1ONQB 3MBEB 1AYOA 3DV4A 3RLSA 4Q89A 1I7TB 1NCCH 1QX1A 5ID1B 5F0MB 1AGDB 3GJEA 4Q9RH 3JZ7A 3UGXA 3FU0A 4OF8A 2HLFD 3RY5A 5BQ7B 1NPJA 2XUWA 4KGJA 2QFRA 1PF3A 2Y6TE 3LV3A 1JZ8A 4G7VL 3ECUA 3BUBA 1P5VA 4MVBC 4QHMA 2EUVA 5CFHA 4KNQA 3V4PL 5D7KD 5DD0H 1BSIA 2EH7H 4PJGA 1A1OA 3HZKA 2CA3A 4HJ0D 2F7IA 4PUBH 2GK0B 5B1JA 5J0BA 1YYLH 4MMYA 4YFLF 3OKDB 5CSZA 5I0ZA 2HZHA 4M3JA 3G6JF 3B2MA 1T83C 4I5BA 1WRFA 1DEEA 1RUPL 2EIJB 1G9MC 2I60H 4NJ9H 3JV4A 4YAQB 2NNAB 5BUGA 2K9UA 4KK6C 1ZT7A 2ATKB 5LAPA 1IKFH 1MVUA 4HCFA 1M1XA 5EF3A 5HDBB 2FLRT 3DLQR 4PJEA 2EKSB 3CSGA 3VG9C 2R27A 3WIHH 4H20H 32C2A 3ALWA 4LZKA 1AFVH 3IDIB 4EDXA 2EVGA 1CDGA 2IPUG 3UL4A 4PTUB 4X8JA 3D18A 4QRBA 2P8PA 4URTB 4EI6B 3T6ZA 3OG4B 3VXRB 1DJHA 4KK9D 1L0XA 1Z0NA 4HWEL 4JKNA 4JQIA 1E9QA 4OVVA 2MPAL 1QTPA 3CVIL 1N8ZA 4Q6KA 3HZYA 5KUMA 1JGUH 3BSZH 2VRKA 4OZFG 1AGDA 3IETB 5GGSA 2CPCA 3EXJA 1DQKA 3US1A 4JDZB 3KPRE 3HI1B 2VDML 3IU3B 4A2HA 2DQUH 3B2DC 4YVUA 2W65B 4BK4A 3VXSB 4NHUB 4NKMA 5I8OH 2YPKB 1FL6B 2X87A 5IFAH 3H56A 1N0XL 1U41A 3GBEA 4QXWA 4AC4A 1VADA 4GW5A 2ZE0A 5A40E 4NQDD 3CZLA 4NO5A 2H7WA 4MJJA 2BSSB 2QPUA 4YSCA 3OKDA 3U0WH 3GRBA 2IAMC 2X4SA 5IJKC 4FFYA 1NAKL 5EIVA 3V52L 4PP2A 4YAQA 3MPCA 3QK0A 4E9SA 1XMEB 4JY5L 1OP3K 3L4CA 2BMKB 1QSEB 1CVRA 1ITBB 4JKLA 4P07A 4PRPD 4DEPC 2R2HB 3PQYE 1N2RA 3N85H 2X6BA 2EKSA 1TNNA 4JFFB 5DU7A 3P30L 1J8HB 5A2IH 2IDUA 3DO3A 2AAAA 4G6JL 2O6CA 4PTUA 5B3SB 1P6WA 1OB1A 4DUXA 4NLAA 1KYFA 2ZUVA 3DVNB 3KBEA 4OBRA 4GBXD 2VE6B 3MYJB 4JDTH 1KDIA 2AMGA 3BAKA 4MFHA 4UDTB 5D4QA 4N90D 1EHNA 4KITB 1CLOH 1MCEA 5FO7B 5DF0A 1QLEB 2JCCB 4AGNA 5JXEC 3DGCR 5J5EA 4WHYG 4Z7WB 2D3NA 4YHOH 1RPQA 4Y16B 5A2FA 3IDUA 1X7TA 3DX1A 4JDZA 4PRBA 3C6SB 2XCMC 4E9QA 4ODWB 4MNQB 5E94B 3RWCB 2X1WL 3PL6C 4QHLB 3DWTA 3TZVC 2OMUB 3BAEH 4UNIA 4QXUH 1VGEH 4GKZB 1MCHA 1WAAE 5IR1A 2R8SL 1NBQA 1MOEA 1GYVA 4NENB 5C1MB 2Q3AA 1EEYB 3K8LA 4UT6L 2X70A 2A0LC 3D0LA 4ZMVA 5HD8C 2X4UB 2Q7AA 3OKMB 3WKPA 2AP2A 5I19L 1QO3A 4HBCH 2H26A 2EDRA 1T1WA 1JNNL 3BAIA 4L23A 4AEIL 1SYVA 3KPPA 3LZFH 3BT2H 4QPEA 4FQIH 2PCPB 2FT7A 4DP7X 2OJ1A 3QXUA 5CLYA 5ID0A 1VACA 2XWBA 1JPFB 1Z9OA 5KS9E 1O0VA 1SLUA 4PY8I 2D7MA 1QP1A 3CLWA 3MAWA 1PD1A 2XT1B 2EKJA 1D5IL 3FFCE 3VG0L 1AZVA 1QFUL 3CMGA 3UABA 3FUDA 2R1WA 2IPTL 2YAFA 2LE9A 3H9SB 1F56A 2BIOA 4C4KO 1P9MA 2JJTC 1MCSA 3ENEA 3EGXB 4P46C 5KSAC 3QQNA 1DVSA 1IGFH 2CJUL 2XQBL 3A6OA 5E9DB 5FO7A 3DRTA 1ROWA 3EHBB 3QT2A 5MP6H 1T3FB 2CDFB 3L95B 5HJ3A 5T5FL 1HFUA 4X6DB 4NUJA 3HB3B 4GQQA 15C8H 3TA3B 4LBEB 5DR5L 1AKPA 3JVGA 5E94A 4Z3EA 3BYYA 3G6DH 4JFYA 3V0HA 5LDUA 2VJXA 4MS6A 2A6IA 4TQEL 1ZLUK 3PWUB 1ADQA 3H9YA 4F7KA 1F41A 4I13B 1CLZH 4N28A 1SFHA 2PMZA 4OJEH 3NFNB 3HR5B 4Q2ZA 1EPFA 4RMBA 4YWGH 2DWDB 3CC1A 1A3ZA 5KVFL 1J1OL 3DTUB 3FFOA 2ZCKL 3GSRA 1XX9C 4OLUH 2VERN 1ZY9A 1TJGL 5CINH 2HVKA 4M7LT 5EU3B 4G2AA 1JV2A 2V33A 2FSEB 2X0WA 3OZ9L 1SXNA 5CLXA 3LKRA 3BPCA 1H6EA 1ET8A 1MFVA 2YBRA 5AD0B 2NNFA 5IK3B 1VRSA 4KX7A 2VM4A 1QSEE 3ARUA 3OMAB 4M3HA 5AVUB 1OXYA 3BZFA 3OKNB 1A3LL 2E86A 4X4ME 3UTQB 4DN4H 4RFOH 3I2CH 3MGOA 5I1DA 2RFXB 1W72H 3ZQWA 4XNYH 1L7TH 5E9DA 3NA9L 2QHLA 4HWBL 4JFVA 1J5HA 2OPCA 3TNNA 1DO5A 4PJ8B 4K3EL 3QNXB 1V3MA 4TLKA 4V2CB 4K5MA 3FU6A 3LKQA 1M71A 2FJHA 1S9WA 4E9TA 3FAWA 4UOQA 4LBEA 4EAEA 5J6HA 3C2AL 1ED3A 2G3ZA 1JNHA 5TE7L 2CLZB 4I8DA 2HN7B 1T7VA 4K3GA 4N8VB 4MTMA 3PWUA 1WJ3A 3T0EB 1A3RH 3HMXA 1E28B 5CZKA 1LEKA 3CDFA 1FYHB 5GS2D 5C07A 1PEWA 1OLLA 1RZJL 3AU1B 4YZFF 3D07A 4O9HL 2B2XH 3KR3L 2HG5B 3GMRB 4D7BA 3P9MB 1E8XA 1Q0YH 2W80C 4G9DB 4DAGL 2WXQA 1BCIA 3KJ4C 5C6WH 3GMNA 3BN9C 4B5ZA 2ZWNA 5TF1L 2VLJB 1SY6H 5EOQL 4JO3L 3ULUD 3O8XB 4FFTA 4KJPC 2J1ZA 4FYTA 5J06A 1MY5A 3QPXH 4POUB 4PW3A 1GSKA 2QSTA 1A1MB 1WICA 4EUPB 3G5VA 3W56A 4BWUA 5J1AA 5HDWA 3EG9A 5IMKB 4DCQB 4UDUB 5FYKD 4HMDA 1XR9B 1FDLH 1RZ8A 2YIHA 2WV3A 1BXAA 1PMYA 3K81A 3NIGB 3O0RH 2RFXA 4XZUB 4HCIA 1NIBA 1PG7H 1UADC 4FFVC 5SV4A 1Z32X 1BM3H 1OM9A 3SE8H 4HIQA 5FOJA 4XP9L 2WXJA 4QRSB 3FQ1A 4H1LG 4KTEH 5E24E 1LGVA 2A1WL 1ZV9A 4NAMA 4F9PC 3GTVA 1N7ML 4NQXA 4G3YH 3MJ7B 2IANA 2OL3B 3T2LA 1BQ5A 2V8MA 2RQ8A 2HFEB 3PFQA 3CLFL 2D31B 4HHAA 4QMEA 4APXB 1ZLVH 5CBEB 2OMTB 3AAZB 3NCBB 4N8VA 2I26N 3ZBMA 3BDBA 5IEKB 2Q86B 2GABA 4Z3JA 3RAJH 2CPUA 3U2IA 1GOFA 2HAZA 3OAZH 4ZTPH 2P47B 3BHBB 3CMOL 3G08B 3IWUA 1UD6A 2GJJA 1CZ8H 4D0DA 3QHFH 4F9LC 1I7UA 4IGBA 3QQ3B 3ZHNA 3EH2A 2V17H 3A6BL 5MENB 4HIHB 2VLJA 3LPFA 4KJWC 1WZKA 1R3JB 3KHOA 2YXFA 4H13C 2NNXA 1MCFA 2NR6C 4FERA 2RB8A 4MZRA 1AQDA 4YMPA 2DM3A 3TXAA 2Y6SC 3L7EB 4JKPL 3V4PA 1GYAA 2FB4L 1RK7A 1XR9A 5D2LB 3QCUH 4P57B 4L9LC 2J56A 4ZODA 1S9KC 2K7PA 1ZKAA 3FQ4A 1PSKL 3DUUA 1L9TA 4IIQB 5ELIA 4FQXB 3WNOA 1H3PL 2MOGA 1BFTA 3SQBA 4Z7NF 3D3VE 5TPWH 1PCXA 4QRSA 5FCSH 4KZCA 3BI9X 3ASNB 4I2XA 3T6VA 5HGAB 2FHFA 1TZIB 2CRZA 1TIUA 1YNKL 2IPUK 3DYOA 4O2CB 4OGQC 1AGFA 1YAIA 2BFVH 2CHXA 4BBWA 2K3TA 4APXA 3HNSL 5I5JA 4BZ1H 5LCVL 4ZT1A 3RDTC 3V0WH 2EE3A 2AJUH 2APTA 4JO2L 5C08B 3WN5C 5J7CC 3VFVB 2HRPL 3RX7A 3TEZA 3N2JA 1E5ZA 1HYRC 3G08A 3S5LG 4KXZH 1PNDA 4GMTH 4ADIA 4UOJA 2FYVA 5ANMB 1YAZA 4PJ6A 1HHJA 5IHZA 5IVNA 3V0FA 1FFNB 3VRJA 2VDNH 3SPCA 1R3JA 4NNPH 4B9YA 1U6AL 1GHFL 4PCKA 2FLBT 1IM3D 5C0ND 3I3EA 2D7TL 3P0YL 5HY9B 4P2OB 1J87A 3GBML 1M05A 1XF5A 1WP6A 4P57A 1TZHA 4X9IA 3PAZA 5ICZB 5E8DL 4O5LH 2PN5A 5JLZA 1RXLA 3T2NH 5DMYA 1UWGL 2HUEA 3L08A 4OB5L 4LT7A 1YEIH 5B1CA 3FT4A 2HWZL 5DUMH 2EH8H 1HJBC 3HVNA 1A6WH 1WZMA 3BE1H 3Q8AA 5TE4H 4WO4A 1DQDL 4H8HA 4OD3L 3RWIB 1F6AB 1U8QA 2C9AA 3QW9A 4O2CA 4XO8A 4DUVA 3QH3B 4Q97A 3MV8E 1XF3B 2XN2A 2BSTA 1II4E 1DUYA 3CBRA 3K6DA 3MV7B 1F4HA 2XNAA 5KG9A 3LIZH 3IFOA 5IBTH 2NXZD 3LIUA 5I26A 3BP7B 3VI3E 3KEHA 1XTLA 2UVEA 2MQCA 3FT3B 1IB5A 4XODA 3B34A 4X5WB 3MRQB 3SDYL 4L37A 4WI5A 1THCA 3Q7JA 3FB7B 2OZ4L 3KPSE 4Z0XA 2YFNA 2J5LB 4JM2B 4LCIH 3ECWA 1UACL 3QJTB 4QHNB 4WZ9A 5E1IA 4EI5C 1EAPB 4ZZFA 5I15L 2GCYA 5GGRA 3HKFA 5C6TH 1CYWA 2DEWX 3D5OF 5C07D 1OP3H 1KWGA 1XIWA 1HL4A 2P5PA 5D70H 2VMJA 2NY3B 4X4XA 3FSWA 3LKNB 1Q0XH 3A6CL 4UT6A 3GS4A 2AW2A 2EO1A 5EU4A 1S7QA 2EYRA 4G5ZL 5FX3A 5HHMB 4ZAKB 3L3GB 5T3XE 4BFKA 3WTSA 1Q1JH 4ZX3A 4DKTA 4B9IA 4BRJA 4DGWC 4PJAA 5K59E 1B2WH 5IY5B 1RVFL 2V3FA 5AZEL 1MNUL 2Z7ZA 4PD4K 4Y2LA 3WJLC 1N12A 2R0KL 5FM5M 3U7WH 2B0SH 1VF5C 2YUWA 3DBXB 3HG5A 3CU7A 1VPOL 3QJQB 4XX1E 4N25A 4WEMB 3CIAA 2W0PA 4QXVA 3WOVA 3CSBA 2WLKA 1BVNT 4MSWB 1TU2B 4NNXA 4R7NB 3ZE2B 3MGTA 3ZGIA 3C6LB 4YSOA 2Y1ZA 3QHZL 4FG4A 3KPNB 3MLSL 2H3NB 3GJFH 1IEBA 4D8PA 1INDH 3B9AA 3DX7B 3LRKA 2C9SA 1QRKA 3RVXD 3UTOA 5E4OA 1CFTB 1MFCL 5LBSL 5T5FA 4UB0H 1U58A 4YBHA 4NQVA 2IAND 3FB7A 2DLEA 3N04A 4ZPVB 5B3JE 2VAJA 3DV6B 4I3SL 2R7EA 3O6ML 5HYJA 5FUZH 2P5EA 4CDHA 5CP3A 2XZQH 4XAKE 5DK0B 1ET5A 1WO2A 1ILSA 4JJ5A 1CIUA 3FQXA 5D71H 4A04A 3FQTB 4NQQA 5IJVB 4FDWA 3IT8D 2QQNH 4S1DD 3MRMB 4FZ8L 4IGBD 4HV8A 4N87A 5BV7C 3MNDA 4N0FB 4IJ3B 4ZO9A 3HC3L 3AY4C 2O5ZL 2VLJD 2I9TA 1NIAA 5EMYA 4L3EA 1N6QH 1FBIH 4PS3A 4AEHL 2AMUA 4ZSOB 1M7DA 3D4GA 3U79A 1IKNC 4TRPL 4U6TA 1U8OB 4YDIL 4JZNA 5C3LD 4GKNA 5EEYA 4OLWL 4ZW6A 3AU0A 2JKXA 2ICWI 4G59C 4RMWA 4XP4H 3LRSB 3FCTA 2MWCA 4NQEA 2Q6WB 2Y72A 4M8VA 3RPKA 1EERB 2XTJC 3B7RL 4L3FA 2DDQL 3NP4A 3B8SA 4K9JA 4FABL 2AI0H 5DHXB 1UA6H 3W39B 3QFJE 4NN6C 3CFCH 2ZIDA 3JWOC 4HHGA 3FUFA 4UTAL 4HIJA 2WKOF 2R1YA 2DIAA 4PWJA 3K8KA 3ZZQA 2H3NA 1YNTF 2VJ8A 1ZLUH 3CJJA 1PD0A 4HWBA 4XVTH 1PLBA 4Y5XC 4LPVA 3CZSA 4XO4A 1WIOA 3M1BB 4HW6A 3GIVB 4MBOA 2YAEA 4ZUWA 1CDCA 3BKCL 2KH2B 1RJZB 4Q6IC 3DV6A 2X7LB 1FV1B 3UAAA 4OI7A 5DK0A 5F2FA 4ZMWA 3REVA 1T89A 1E27B 4LAQL 1N26A 3Q2LA 5I1JL 5EN2A 2KLSA 5IJVA 1ND0A 3LEXB 5DRNA 4ELMB 2G75A 1KIQA 1LD9B 2JKTM 2VAAA 2FZ3B 2WYIA 4X6CF 3MLUH 3ES6A 2JKSA 4UAHA 2G5UA 1E2WA 1X44A 4XCFL 7TAAA 2Y2WA 4C56E 4NN7B 1UVQA 3QUMB 2LGNA 2YD9A 3CZFB 3QXAB 4KUZL 3FCSA 2UZXA 3O3EA 1EJ8A 5C3TA 1GCYA 2MNWA 3LQAH 5D7SL 1HZHH 5TFSL 2H0JA 5C0EB 4XE0A 2Q6WA 4K15A 3W57A 3Q8EA 4LQFL 2CIIB 1DVFC 4KQ4H 5CBAA 1X5LA 4UU9B 1F02I 3CZUB 3RKDD 3U0PA 3PDOB 1XZ0B 4KKCD 4GP8B 3RTQA 3L3IB 5KYNA 5I1CH 5D7IB 1S78C 4J39A 4ODTL 1W9XA 3PWPB 3DXAB 2OX5B 1T1ZB 4YPGB 2JQMA 1R19A 3ABZA 2CO7A 1HAWA 1MHPL 5FV1L 3ZE2E 1CT8A 1JZIA 1MJ7L 4KKBD 4WO4D 4ZI8A 3APNA 4PGBB 1ZCRA 3TO4A 3FONA 1OT4A 1N67A 3DGDA 3M6DA 1NMAH 5LXGL 1WWWX 3VQ1C 4GUCA 2BP3A 2JCWA 3TPUB 1MCQA 1ZHNB 1VFAB 5H37A 3STBA 3VXOA 1BOGA 3TEYA 4HFUH 1SYSA 3ARTA 1I9EA 2AXGB 3MNVA 4XPHL 2EDMA 4EDWL 2FYYB 1YVLA 1OPGH 1QPKA 4OVUA 4WWID 5AYUH 5MERA 1QSFB 4WU7A 4XXCA 3NEEA 1FVCB 4NC1E 4OFIA 4BHUI 2JV6A 2V3DA 4AQ1C 3RZCC 3TBCA 1Y6MR 2HTKC 3SOBH 4WTZG 4NN5B 2X2YA 1P1ZA 2XI9A 3F12A 1JGEA 3L7FA 3V0VB 2GIYA 3UTTE 1ADWA 5DVPA 4KVPA 3VSUA 3NCXA 2Y7MA 3RNKA 3TVMC 2PW1A 1LO3H 4LHUG 3KW7A 5C0EA 1XIWD 4MZ2A 1OE3A 1XCXA 1SLXA 5IMMA 4DUWA 3L3DA 3BKMH 2MJWA 2BVPA 3N43B 3Q3GB 3SYQA 2PTTB 3U4BH 4B9GA 2GEQA 3KAAA 3MRKB 2DQHL 2PR4L 5GS3A 1B3JA 1TMCB 3V4UH 1R5IA 4K9EH 5FO9A 4N9OB 3HI5L 3F64A 1QLFA 5GGUB 3MJ6A 3NCEB 4AITA 2IGFL 1MH5B 2Q8AL 2CBTA 2F5AL 4U6VL 4RWYL 2PO6B 3HC4H 3QA3A 3ZKSD 3VRIA 4NKQB 1INQB 2QADB 2X4NB 3JTBA 3GSXA 3H8NA 3NJMA 3AXLB 5EU7C 1UD4A 1S8DA 1CU4H 1F3DH 3L3JA 2F74B 2XA8L 1ZHNA 3H2WA 2HFGH 3ZL2A 1YNLH 4YHPB 5F1OB 4CNIA 5LCVA 4ZD3H 4BH7A 3ORJA 2V5RA 5FUOL 4JPVH 4A67A 3POCA 2VZ1A 1Z3GL 3GK8H 3TNMB 3KH3A 2ADFL 3DVFA 2ARWA 3BEWB 4UYPA 2V2WA 5HPOA 5DDHA 1UM6H 4ETQB 4G43A 5C9JB 3SPVA 1T0MA 3TL5A 4Q9QL 4L3CB 5HYJD 3TS8A 4JG5A 4LGRB 1OTUD 2GI7A 2P5ED 4OQ1A 1O5PA 4HEPA 1U8IB 1XSKA 4FJ6A 4U2ZA 4PAZA 4RISH 3WXVH 5E8PB 1H6TA 2A9DA 2X4TB 1TJMA 1WA2X 4Z7UA 5SX4H 2K8QA 4KXAA 1ZWIB 3SKNA 7CGTA 3IFPB 3MHZA 5EUOF 2NT1A 4J8RA 5I5IA 2UY7A 4XPAL 3TH2T 1FPTL 1NC4B 3P0GB 3MSPA 4NZTH 5I66B 1ZHBA 3KLQA 1KTRL 5DFWH 4I3GA 5DRZB 1CDYA 1USZA 4L3ED 1FO0B 5G55A 1BQLL 2DQEH 4MA3A 4JM4L 4KV5F 3QIUB 1RJLB 5T1KB 3QQXA 4PJDE 3WTTA 5GGUA 1HHKA 4I9WE 1FYTA 3L1FA 2K70A 3NJXA 2PO6A 3FFDB 4NQED 2AQ3A 3BQUB 1E9OA 1IBBA 2GJZA 4OZFH 4R2GC 3K6OA 4XAWH 5KZCB 4Y19E 4E41A 1UG9A 1MFDL 1ILUA 1OAZH 2P8MA 3WDHA 1T1YA 1RMFL 3AXLA 1AHWC 1M4KA 3FB8B 1JGIA 1CG9B 1BLNB 5E56A 4YHPA 12E8H 2AJSH 4O51B 3KXFA 3NIDF 3IF1B 2BW4A 5EOTB 3NK4A 3ATBA 3LHPL 3WSQL 2YSSB 4AX3A 5I1GL 5I73C 2XN9B 1KXTB 4ZXBC 3CK0L 3QDGE 1BIIA 3A47A 1CK0L 3BEWA 5ICYB 2DQCH 1DVTA 2ATPA 3CVDA 3NG5A 4EBQL 4EF3A 4FHBD 3WKML 3BVWA 1LE9A 5C0CE 2DD8L 5F7FA 4ETQA 5KYXA 4I88A 2IG2H 2X0VA 2OTUA 4PLKC 2OZ4A 4AH2B 5K1JA 4QJ4B 3ZU8A 1J05A 1Q9KA 3W9EA 1LWHA 2GYSA 3ARBB 3G6JE 3FRPG 3I9GL 5GGTH 4D2NA 2EIKB 1HH6B 4FKHA 3UAJC 1RK0A 4OF7A 2BSRB 4JFEE 2CJSA 4BFIA 1KXQA 1OK0A 4QOKE 3L5WB 5I66A 2QSCL 3PWNA 1KEML 3AM8A 3WFHB 3VD5A 3FTVA 4O4YL 5AVYB 1W72B 3FN3A 4I4WA 1BZ9B 1BVZA 3C60C 1IGML 4RGNC 5EFIA 3ESNA 4YSQA 3RWJA 3RGVA 1GZHC 3U82B 1F4WL 4FQ1L 2H0PA 3NZHL 5HYSB 1C7SA 3FQNB 3KYMA 4F1SA 5A2BA 1ECZA 1ETA1 5I9QC 3KJ6H 3SGJA 4WHYH 1NSNL 5AKSA 1T03H 2ZX8A 2XLLA 4K5NA 5JDSB 4K4KA 4IBYA 4F8TA 3R0NA 2H47C 5T1LB 1MF2H 3X14B 1V5JA 4ERSH 3AROA 3OZLA 3RTQD 1UD3A 2AV7B 2VN5A 4JE4B 3QO0B 3VQMA 3WD5H 2Q8BH 2ZOLB 2DWTA 3MRPB 4GY4A 4AGPA 1YPZB 3GIZH 1ZS8A 4B96A 5BVJA 5F93C 4IEFA 1GGIL 2N59A 4BUQA 3DDGA 3S37X 3UX9B 3FOMA 4DQAA 3R7QA 2YD0A 1BEXA 5BZZA 1EFXB 1TCRA 3H6AA 4NERA 1TVHB 3AT0A 3TO4D 5FYJH 5I6PA 5EH1A 1A5FH 4NO3A 1X9QA 4OCRL 4FKEA 5DZOA 3UC0L 3IE9A 5LBSA 3IFLH 1WV7T 2Q2LA 4QWWD 1PKQE 1OAUL 1LHZA 2NPLX 3L9RB 2EDNA 1JCVA 1UH3A 4LL4A 5I1EL 2NQCA 3OKKB 1Z9MA 4J2QA 1AD9A 3MMEA 1PYWB 1CFVL 1UCBH 3GLZA 1L4IA 3N0PB 3ISWA 4QTHA 4YBQC 2MCMA 4Z76A 1BWMA 3UZVA 3PUCA 2X1XR 1SN0A 5KJRL 2IDFA 4MB1A 4E9VA 5DO2C 3N9GH 4XBPA 4KH9A 4MNHA 3QP3A 1HQRA 2FR4B 4LLMB 4PJCF 2NY6B 1T7ZA 2BNUA 5IOPA 1BZ9A 2VDKL 2J55A 5JPMB 2ED8A 1FRGL 1P5UA 4N3UA 5I6XB 3KG5A 2CG9X 3CVHB 4LCUB 3SJVA 3QPQD 4CSZA 3MTXA 1UQSB 4LU5H 5SWZA 2UXGA 2AS5M 4YL9A 2ICWB 1AR1B 4GFXA 4LVEA 4GUQA 1Q9LB 2SODB 5T1LA 3WKYA 2YK1L 5JR1H 3KZ8A 5DJYB 1I1RA 4X2UA 5CD5D 3AUVA 4I18C 3MRPA 2JWYA 3HPLA 1UCTA 3QDJA 1GTFA 2HT4C 4UTAA 2IBZY 5B1AB 3UTSE 3VA2C 1NFIB 4XBGB 1ZT1B 2JKRM 2QHRL 5FXCH 4GAGL 4PJ7A 5GSVB 4P48A 1XF2B 4ADGA 4PEEA 1J18A 1IGIL 2JXMA 2PP7A 3WBDA 1KJ2L 3AUWB 4OJDH 3EBHA 2Z4QB 1U8LB 3QIWD 4DGYL 5K39B 4OZHF 4TTDC 4WV1C 1RQ5A 1KY6A 4LEOA 3S97C 2B1OA 4XNUL 2AK4A 2EDEA 5IHUL 4WIQA 1CYGA 5HHOE 4LLMA 4WU5A 2Y07H 1V7MH 2CCVA 8FABB 2YAHA 5JXAH 5EPMA 1M6UA 4QRUB 1I8LA 3ISYA 3EOBB 4YDMA 2A6DA 1B4JH 5CMAA 4NS0A 3BEVB 4XZ4A 5IM7B 5DLMH 1TJHL 4DN3H 1RFDH 2IADA 5KSVB 1J5DA 3B56A 2X9XA 1BYNA 4JANB 5HJGA 2OW7A 2WLHA 5EIIB 5IGXL 1M9SA 1BBDL 4YQXL 3VFPB 4D9LH 1MCKA 3CFDB 3TJEL 4Y2DA 5JHBA 1CDIA 5I1LB 3MCKA 1FORL 1Y7VA 5ICUA 3VWJA 2DS4A 1RPUA 5SV3A 3OQRA 4ODHL 1FYTD 1RUKL 1QI5A 1FNHA 1U4EA 4MXWL 2PO6D 3M8OH 1FNEA 1JGLH 1YPZE 3E6HA 4E41D 3WHXB 4FE9A 4ZW8A 3MLXL 5BUAA 5LLIC 3HS0B 4F2EA 4MAZA 3FQWB 4Z3IA 3GMMB 4MB5A 4MMZB 4OZIF 4QR7A 4AE1A 4OR1A 3KYOA 3BKYL 1M1SA 3A3YB 4XC3H 4AQAA 3KXFD 3FN0H 1BFVL 4QXGL 4N26A 3X17A 4X80H 3S8WA 4X99B 2K8MA 2WSPA 3VFGH 1A8JH 4WI9A 4XTRC 5JO5B 2JI2A 3VXMD 4AY0A 5DRXA 5EUKA 8FABA 1C5CH 5C6PB 2J2ZA 3MROB 2F0CA 3MA9H 3S98A 4IMKA 1FG2A 1TR7A 3I6LD 3BEVA 4ZW5A 3BESR 1ZLDA 3DHJA 3FSZA 1MWAL 2QKIC 4RAVA 5JIDA 3M1CA 1M3JA 2VMFA 1GH7A 3VE0A 5HXMA 3LN5A 5D4JA 4U7KA 1KC5H 1FGVH 4H1LH 5DQ9A 5E08H 3ETSA 4MD4A 1M9WA 5DEGB 1OGTB 3M17B 4MDRA 3WUWA 5KYWA 4JY6A 1KCUL 4MQSB 4J27A 3DJZA 4JW3A 4QCIA 2HTLC 1I9IH 3RGVD 4FF9A 3NCMA 1A22B 1YN7B 2ZKHL 3CH1A 1JHTB 5L4FA 3ZE1F 4GI9A 2DLTA 3EO9L 1UB5B 3FSOA 1F2XK 1NCJA 4Y8AA 3T0XA 2G2NA 3C5SA 1C5BL 3CDGB 3G5WA 4XN1A 3QO1A 2F2HA 5DFTA 5GXBB 2DW5A 4F15B 4IRJC 3FQWA 1ANUA 3GMMA 1ACCA 4ZFOB 4M1GL 5E99H 1FH5H 3MUHL 4ENEC 2AJ3A 3ZXAC 3MRHB 5A1AA 4WNQB 3HZVB 2BERA 4NEHB 4X6BB 5GGVH 5CJXA 2C1PB 2YJQA 5JPNB 1X5KA 2Z35B 1KLUB 1TDQA 2A83B 3KBPA 3F5WB 5HI3C 5JOPD 1SDYA 2XTLA 1MRCL 1K9TA 1QLRB 2BOCA 2BVUA 1IAOB 5ES4B 1OSEA 4G8GD 4MQ7B 3WXWH 1IQDB 2ZCHH 4NZUL 4DPAX 3CG8A 3CFJB 4HK0A 4CGTA 1BYPA 4QRAA 4BHUA 2B4CH 2XU9A 4ZFGH 4RQQA 3U2SB 1Q94A 4NYLB 5IW6A 1MIMH 3RNQA 2WWMD 5F9WC 2WINB 1RKRA 2IOOA 4J5VA 3FO0H 3RPIB 1BQKA 4C4KT 4PJEF 2A3TA 2YQ3A 1MRFL 2VR7A 2EO9A 5GJSL 3K4AA 3OKEB 3P54A 4QHUB 4K7PY 3RB5A 4AMWA 5FB8B 2ZG2A 2OR9L 4QDGA 5FHAH 2UWEB 4L4VE 3HUJB 3X1BA 3QQ4B 2VGLM 2FATH 1ID2A 3HRZC 5F3BB 3HI6L 4PGEB 1KGCE 4RAHA 2CCLA 3E8VA 3GJFB 1RZQA 3INUL 4RH4A 4G82A 1T4WA 3OXRB 1F4XH 1T04B 3EOTH 4JHBA 3SJVD 3HCVB 5FYLH 1SBSL 5SWZD 3DSFH 3LEVH 3TN0C 2KL6A 5EEUA 3TT1H 5T1LD 5CCKH 4WW2F 4ZFOA 1FAKT 5J6GB 4S2SA 3NAAL 1F97A 4FFZH 3RJQB 4FOMA 3BH8B 1FN4A 3QDJD 3NTCL 5DMIL 3HE7C 3KMDA 3VCLB 2FLMA 2Z35A 1IC7L 2YOAA 5EU7E 4HZLA 3MC0A 3N1MC 5AW8B 2VLME 4R90L 5DMGD 3FU7B 1KN4L 2CKBB 2K6WA 5DD5H 5F21B 4UAOC 4LP8A 3A67L 1CCZA 3KPRA 1NFKA 1KYOK 2OXHB 3MUZ1 5IVZB 3UXFA 4KHTL 2WXMA 1AG6A 4W9KC 4P3DA 4CADB 3QYCA 3RWGA 4OZGF 4XXDB 3OG6B 2OMNA 3B3BA 3U6RA 4H40A 2DWEA 1JZ6A 2AANA 1NAMB 4WSGA 4PRAA 2AK4D 3OGCB 5CZXD 4ENZA 5HJBA 2XZCH 4D9QD 1ICTA 4RRPG 9CGTA 4OQTA 2W95A 4QHUA 1KBKA 4JL2A 3HUJA 3NN8A 4PJXF 1B0RA 3GQFA 3MACH 1KB5B 1WITA 3DMMC 4FQ2L 3TFKC 2OMXB 5F3BA 5EZJB 1J9SA 4IRZL 3ZO9A 4PGEA 3KLLA 4HIIB 3U36A 4OT1H 5E51A 4CRPA 1JPTL 3FO2B 2XWTB 3PHQA 4LPUA 1G9ML 3UBFA 2X4RA 3PQYA 3UBXA 1ZLSH 2AJYL 2VXQL 5EU5B 4FXKC 2FHCA 4JHUA 1WWCA 4WTXA 3CPLB 4OH2A 2E9IA 3WE6B 1F4YH 1C1EL 4Y2DD 4MXVE 3WIAA 4KRPB 5DT1H 2XKSA 3VJ6A 3S3BB 4DGVL 3LDBB 1E4JA 1U8JA 4Y9BA 3VWJD 2AQNA 2F8IA 2D7OA 3BH8A 5DZNA 3U1SL 4WFHE 4IRSA 3MFGB 3VYNA 1YMME 2VXTL 3DURB 4UOW1 5F0JB 4P3CH 3SN6N 3HE6C 2GTWA 2B1HH 1AO7E 1USQA 2H6OA 2CKBA 2LLGA 3MRBB 3VI4B 4J1UA 3MV9B 2JKIS 4BUHA 3IPEA 3WJMB 3DX6A 1PY0A 2ARJB 2B77A 4NAQA 1WD8A 5D6CB 3LXAA 4NUMA 1O5DT 5EEZA 5FR3A 1T80A 1D5BA 4WUUB 3B3IB 1T5WB 5ITFB 4ZOAA 5FK9B 1MFUA 1SLVA 2BS71 2GBUA 1L9QA 5E6IA 1WAAA 3QCTH 4GIOA 2VDPH 4HVBA 1N70A 3QI9C 3OPZH 3TBYA 3TTYA 3ESUF 4X4KA 2ZNXA 2FGWL 2ZAGA 3G9AB 4XCYA 2ZCLH 2RCSH 5F0PB 1S7XA 3S37L 1BWWA 7FABH 2HLFC 2CJTA 3II1A 2A9NH 4MB3A 5AAWC 2OMXA 5C8JB 1J8KA 3L3OA 1IQWH 2WO2B 3JV5A 1EUTA 3B2PA 1AC6A 1MVYA 4LF3B 4DZ8A 2R4SL 2UWEE 5EU5A 5EO0B 3S0PA 4K23H 5I8CB 5KS9A 1RURH 2DBLH 3VGGA 1NM4A 2O6FA 4HLZG 2VC2B 3ZPDA 5CEXB 2FX9L 4HWZA 5GZNA 3ARDB 2VN4A 3AMLA 3L6FB 2CZNA 3DI2B 2DYRB 3SCMA 2XZAL 3RQ3A 4IK6A 3DURA 1T7WA 3L1OL 3UAEA 2F19H 1A9BA 1G7QA 2YEVB 5IB2B 5DHEA 2BS9A 5CLZA 3MV9A 5LGHL 1JUFB 5IB5A 3S9DB 2DI8A 4KKAD 1HAUA 2W9EL 2EYSA 2Y24A 3EFDH 3QIBB 3RGBA 3THML 4WUUA 5IMOB 4DKFH 5F7EH 1ZRUA 4PMFA 5ITFA 3UJJH 4F93B 1KJ2A 1AGEB 4DOHB 6PCYA 4OFYA 1S7VB 1J10A 5CCGE 3N41B 1JWSB 4UOZA 4PG2C 1ZE3H 2Y25A 4FKKA 3SDDC 1SOQA 1VJSA 4YGAB 2ZUSA 3QC5X 3VYPA 2HB0A 3HFMH 5F96L 1XQ4A 1I1AB 1IAMA 3IYLW 1KIRA 1R3KB 3V0GA 1PVHA 4GSDH 3GFUA 5ACLA 1I8MB 3EJJX 3MRIB 2ETWA 1YUHB 3ET9F 2XA3A 3MNWB 3B1TA 5INDA 4N85A 4PGDB 4Y2OA 4DP1X 3QUYC 2OKMA 1GMEA 1BA9A 3GPEA 4PJIB 4WF7A 2HT2C 4CN1A 3K91A 3P4OA 4I85A 1FLTX 2VWEC 1PLGL 3IEAA 5E2JA 1LO0L 2GUOA 2K6YA 3ZKND 4X4MA 4U3CA 1NGQH 2OMYA 2XY1A 4JFZL 3ATDA 4NQSB 4PJ5B 1URZA 1I8IA 2QLYA 3BZ4B 3V7AG 2WMPB 2G0LA 2EXYD 1YHPA 4P5TB 2NT0A 4LPXA 4LSTL 5CO1A 2O5YH 4UQAA 4HJSA 3DO7B 3WGVB 5D5MF 4CVZB 4QYOA 5KYUA 4FEMA 5JYMA 1R3IH 5KJ7E 2ZOKB 3T6XA 4WWKC 4JHZA 5FM4A 5ESAB 4UMSA 3SE9L 2DKSA 1G4RA 5IF0B 4LHQB 5IMOA 3NFSL 2GJ6B 4HKBB 2A2QT 5DJCA 3CZGA 3NZUA 5I18L 2LV4A 4WI3A 4NRZB 5ADOL 5F3HB 2FWOB 2B1AL 2HX8A 3QJOA 2Y22A 1OAKH 4LSPL 1UH2A 1ETB1 2DMBA 1IM9B 1MY7A 3GI9H 3SPJA 3KPRD 3ARFA 4PJBB 4HG4K 3U46A 3ZE0E 2L7EA 4HPYH 2NW2B 1WQVT 1J1XL 1HXYA 1ORSA 4PSRA 2ESVE 4DW2L 5CSBA 1MSPA 1SHSA 5DQJA 4J28A 2ZKYA 4OCWL 3VGHA 2KZKA 1MWAA 1N59A 4QI3A 5IV2B 4HJIA 1BJMA 2CGRL 2XXFA 3GDBA 1FIGL 4AYMC 2OSXA 4TULL 1XGRB 4XVSL 3BZ4A 4WENB 2WMPA 5E00B 4DETA 1WT5C 3MLZH 43CAB 4JAMA 1XEUA 5LGJB 3T2QA 3MLYL 4K7PH 5M95B 2WLZA 3MR9B 3PQYD 4FXGA 4TMPA 1A6ZB 4X5XA 4XVOA 2IH8A 3FB6B 4N2FA 3HN5A 2VR8A 2WLIA 4N0RA 5DJAA 2BIHA 2BCKB 4OI8A 1F4AA 1PG7X 3L5XH 4PLJC 2XYBA 4N0UE 2B4CC 5KWYC 2XWDA 5BW7C 1OAJA 4YUEH 2X44D 2QZQA 3BFOA 4GINA 4LSSL 2FJFB 5H94A 1OPOA 2YPLB 4S1SL 4OCXL 2TSBA 4IRSD 2X41A 1NDGA 5KSBF 4Z0BL 1JN6A 4NKDB 4POZD 4XOAA 3SGKA 4NRZA 3QPKA 5E9NA 1UM5L 2B14A 3RBGA 1YY9C 5B39G 1KBPA 4KKLD 4PVLA 3L48A 4Z7VB 1IM9A 2VLRA 4P5MB 4ZUVB 5EF2A 5C0GB 3O2WH 4DOHE 3UMNA 4G6ML 4XPBH 5G4NA 4JRLA 2HH0H 1SN5A 2E6PA 4Y4FD 2P46B 4LEXL 5E1AB 2CJ3A 2IBGA 4D94A 4F8NA 1KYDA 4CC1A 5E6ID 1X4XA 3G5YB 3O45B 2R83A 4XMKL 4WK2B 1E6OL 1LEGB 4MA8L 5DHYB 2NW3A 1BXVA 4FQPA 1YEDB 3TCTA 3MREA 2DTML 4PS8A 4LLQA 1FL5A 3UIYA 3VSQA 2P28B 3UJIH 2OULB 3H2QA 43CAA 4PR5B 3SGEH 1BEYH 4R5TA 3RYMA 2RGSA 1N64L 4HS8H 1Q72L 3L3HA 4IKLA 2X1PA 1CFNB 1MCOH 2WO3B 1MJJB 1L5GB 1I4FB 1NCCL 3EYVB 3F2LA 3IDYB 1S7TA 4U3SB 2MSPA 4Q9RL 3NPZB 4N6RB 5GZND 1SGKA 3UFIA 3SCMD 4I9XA 4X5RA 2W60B 2DQGH 2QQKH 4R97B 3IDMA 2BIIA 4BDVB 2EDLA 3O6FA 4Z7VA 3MV9D 5DD0L 2EH7L 1UA3A 3VSVA 3T3PB 4PUBL 1YEGH 4YGVA 2VM3A 5C7XH 3AW5A 1YYLL 1R24B 1OL0A 2LW3A 4WUUD 5E1AA 2GSIB 4GG6B 4YFLI 4GUPB 1TKWB 3JBG7 4YUEL 2NXYD 4NJ9L 2I60L 2OJEA 5FGSA 4OFYD 4PJBE 1NOFA 2VLKB 1IKFL 2EE2A 3ECBA 3DX3A 1FFOB 1MEXH 3K72A 3WIHL 4H20L 3T8XB 2OJZH 1CGSH 4ZFQA 1AFVL 2PNDA 2OXGB 4P2QB 4BCZA 3F65A 4EQ2A 1Y1UA 1GPOH 4Z1PA 1K8IA 4BA8A 2CR0A 3VXNB 1QG3A 4IRZA 4EVNB 2OMVA 4N2DA 5SWSB 4F80A 1VFMA 2ED6A 2PPCA 1L5GA 5L4IA 5HBBA 3NZ8B 4QXTB 3AQYA 1JGUL 3GXUB 3BSZL 2VXQA 1OOWA 1RULH 3K80A 5I74B 5JW5A 2HXAA 3P3RA 3QZOA 1KGYE 4WI6A 2EEXA 1YUKB 3MV8A 4A6YH 4L8CB 2P80A 4DEPB 3L4TA 2DQUL 2VDOB 4GPVA 3NCYP 2ZJSH 3E1F1 4BUGA 2XWJA 3HHRB 3QZPA 5I8OL 1AGBA 1R3HB 4BDVA 1KCWA 4B41A 2PP8A 2ADIA 3UGUA 3VI3A 5IFAL 2YRLA 4UOW0 2Y23A 4NT6B 1QBAA 2YPLE 3VRLE 1NKGA 2HJFA 4MYWB 1NANH 1YY8A 4UI2A 1Z5HA 2WKLA 1KCSH 1KCLA 3AADB 1OEZW 1R24A 5ILTH 3K6SA 1VIWA 5EUOE 3KPSA 5CP7B 4ZUUA 3NJGA 4GUPA 3U0WL 4J6RH 1KWKA 4J3TA 4IM8A 4D7PA 5D7JC 2YA0A 2FIRT 1CD9B 4Y4KA 1WHPA 3HG1E 2Q10A 3RDJA 1B9ZA 1IJNA 5AG8A 1MPAL 1GKOA 2X3CA 3N85L 4N8PA 3WS3A 1YYMH 4MA7H 1EJFA 5ABDE 4HIEB 5CJQH 3ARFD 5IQNA 3S3PA 3TZVB 1IC0A 4UM8B 2BNQB 2XQ0A 4MXQD 5E6SB 1FNGA 5DJ2B 5IEHB 1A1NA 3WNNA 1LDPH 1D7FA 2LOEA 3D9AH 4JGUA 4LLDA 3ZTJG 1OKEA 1PJWA 1TEYA 4JDTL 2DMCA 5DD1H 4EVNA 3KE0A 2IAMA 2FECI 2ZSWA 4QT5B 1CLOL 1O6VA 4HFWA 1Y07A 4QRPB 5JIQA 5A2KH 1BFOA 3VMNA 3NIDE 4BKTC 1B0GB 4YHOL 4BIKA 3SDCC 1A7RH 4A2EA 3F7RA 1DJYA 3OV6A 5FYJE 2DLIA 2GHZA 2N7SA 5F9JB 1RCYA 3APDA 2IF7A 5BZWB 4CDGC 1ZE3C 1TVBB 4PWEA 5FV2A 3BAEL 4PJ9B 4QXUL 1VGEL 1IGJA 4ACTA 3AREC 4UV7H 1HOCA 5EBGA 1UB6A 3TA4D 1E67A 1XB8A 4DSYA 5KSAB 4W6XB 3PV6B 2J57A 1B88A 4ZX6A 3WHE1 3L4XA 1RHFA 4HBCL 4WGKA 4QF1B 4RZCB 5JA8B 5AZ2H 1F3RB 4JVPA 2XBZA 5KBNC 3MXWH 1ZT4B 3GSOA 3LZFL 3BT2L 4FQIL 3BC9A 2AKRB 5F6IC 1NFDE 4F7EA 4A63A 1Q9OB 4AUUA 5MI0B 3Q9QA 1WFUA 1IM9D 2VLRD 3O0LA 3U7YH 3PL6A 1D6EA 1OF2A 3KNBB 3LPGA 1KUMA 5MEPB 5I76B 2VMEA 4TPRH 3BZDA 3HPJB 4F7PA 1NEPA 3OLDA 4B0MM 2C7UA 4EKXA 4JJOA 1S9YB 2DIJA 2FECL 1IGFL 2O6DA 3QVAA 5CWSA 3L2LA 4NKOA 5F89A 5MP6L 4M93C 4E5XB 5DHVB 4IS6A 4WKXA 4EPSA 4S1RH 3EADA 2EE0A 1TQWA 4N1EA 3ATFA 3QRFM 3S8GB 4ZUSB 1IX2A 15C8L 3QFJA 4NOFA 3MNMA 2I07B 1JGDB 3PDDA 5LJYH 2EXWD 3KL0A 3VNZA 5AW1B 3G6DL 4HKJA 3D3VD 5DZPA 2BW5A 3KHQA 3IRCA 2E27H 4DPRA 5EC2A 1KF9B 5A16A 2OK0H 1CLZL 2YC1B 3TYFA 2JJTA 4P46A 2CR3A 4F2FA 3QORA 4OCLC 3B9KC 2ZSVB 2C34A 3SYAA 4YWGL 5IB1A 4DP8X 3AABA 4Z7IA 3LZPA 4JRXE 4OLUL 2J1WA 3S34H 4PJCE 4A7GF 3VXUB 4OF0A 5CINL 3O6FD 3T4AB 4ZO6A 4JPWH 1H0DB 1BXUA 1BF2A 2X6MA 5GS1C 1RH8A 5HHVH 4D0BB 1NMBH 5D8JH 1QQDA 4Z78B 3S48A 4KRNA 3QE5A 3TEUA 3MJ8A 3IJSA 4NBZB 1S46A 3HG4A 1HL9A 2HJLB 3TF4A 3TO2B 1WG3A 3UG4A 4YXKH 1CD1A 4C56A 3BXNB 4DN4L 3PJLA 5C0RL 4P49A 4K94C 4NKIH 3I2CL 1M7XA 3M86A 4RFOL 5L2KB 1IKOP 4E42A 2DLFH 2C3XA 5TK4A 4QRFA 4BD4A 3WCYA 4XNYL 1L7TL 4PWKA 2XWEA 4MHHI 4LSVH 3M7FB 1JWUA 4ZBJA 3W2DH 1ZGLP 3SD5A 4N2IA 4R9HA 3K2MC 1XVSA 4MVBD 4JKWA 2EEBA 5C0AE 3ZT5A 1EA9C 3K6FA 2E76C 1W16A 5B8CA 5G2NA 5HVHC 2O61B 1C08B 2DWYA 2GITA 3SOTA 1FFPB 5TDOB 3O4OC 1WTGT 3IJHA 4AMKH 1YEHH 2VWEE 2WYHA 4HAGA 3GMLA 2YUVA 1CXFA 5K9QG 3QRGH 1CL7I 4ZMAT 1LE5A 4FQHB 3SQRA 1I3GH 2L4OA 1K8DA 3NCJH 1H19A 4KK6D 2YAQA 5DXWA 1JYXA 2B2XL 2ZSVA 3MV8D 5E8EB 3RWDB 5F88A 3CN0A 4F7CB 1GA2A 4ZOBA 3V4VH 3ASOB 2QKSA 3Q2CA 2VNCA 1SY6L 1B9KA 3BD4A 5J11C 3VXUA 4XMPH 4HZAA 5FECB 3CDZA 5FF6B 1PGRB 3QPXL 1AKJB 5JHLH 1MW0A 2DICA 1XEDA 3EH5B 2Y4SA 1G7IA 2BP5M 4PJFB 4XMLH 5DS1A 1KGXA 1VZIA 3W3BA 3KPSD 1CQYA 1FDLL 2JQAA 2XJLA 4WFFE 1P2CB 3O0RL 3K46A 5BZDB 1PG7L 4Y4KD 3UTTA 1N6VA 2C4FT 1BM3L 1QNIA 2FTAA 3CN4A 4V11A 3SE8L 1T0OA 4JPSA 4AVJA 2P5WB 2FE0A 3IB4A 4S1DC 4KTEL 1EBPA 5GRYA 5AOJA 1ZHLA 1LEIB 5DC9B 4G3YL 1XO8A 2LAGB 4X8CA 4CMMB 4RMVA 3V5KA 1B4RA 1GMIA 3Q9PA 1J0KA 3IXTA 2BIQA 1HK6A 2OLDA 3KWVA 4OZIE 1OTTC 2GI0A 2IAMD 2PUQT 3WO4B 4WY7H 4L9LB 2R23A 2PYFA 1AZZC 4CU8A 2VABB 3S4SB 4PBWD 4ZTPL 3QEHB 4G9FE 2MFNA 1KFAL 1CZ8L 4KXZI 1CS6A 2QELA 3QHFL 4XO5A 1CGUA 3RWDA 3ZDYB 2BWIA 1TJIH 3EJUA 2V17L 2BVEA 2ZAHA 5AW9B 3FT9A 5D1ZI 4F9PA 3HNVH 5MEQA 1JHKH 1KN2H 4IHOA 4M4RA 2XC8A 1T2XA 2ZCZA 3Q6GH 1H8LA 1YEFH 3Q2WA 3QRLA 3V0DA 5DHMC 3A4EA 2X28A 4PV9A 5MHSE 4PJFA 1IVLA 5J9PB 1J0IA 3H3PH 4HYTB 3WMPA 3EO1A 3RDTB 3KLSA 2R29H 1K4DA 3APMA 4PB0H 4JG0H 1RAMA 2Y0SA 3QCUL 3WN5B 1JERA 1X5HA 2EDFA 4UM9A 3EH3B 3MA7B 2K7QA 5I75C 2QPDB 2CDEA 4XAKD 2VDLB 3Q6FB 3WKQA 4F9LA 3V79C 4FX5A 3CFEA 4EEEA 5F7YC 1T1XA 4R3SA 1Q0EA 5TPWL 1UA7A 5D2NC 3QYNA 4WI4A 3ARXA 4OUOA 3SZ6A 3PL6D 4CMHC 3ZE1E 1DN0B 2UVFA 4J3OG 1ZXQA 2NR6A 4L1BA 3D0AA 5FYLE 5I6NA 3WIHA 1QTSA 3BDYH 3WV0A 4N2NA 2BFVL 2YEZA 5LO7A 1IIIA 3FTYA 5HD8D 2A0LD 1OAXH 2CCWA 3S96A 4BZ1L 1M7IB 3OAWA 4PJDA 1IV8A 1U8PA 3ULSB 2Z4TA 3V0WL 3FPXA 1UFGA 2AJUL 1SOSA 4U3HA 1MCJA 5E95B 3IXAA 4KI5E 5LQBH 2BOBA 2FO8A 3S4SA 4KROC 1U42A 1A6AA 4N86A 4Y19A 4GMTL 1WPCA 4KBPA 3S88H 3QFJD 4MRBA 3BSZA 3EDKA 1I8KB 1D6VL 2D7PA 5DJ6B 1DJGA 4I48B 4XN5A 3WGUB 1IEHA 1WF5A 2VDNL 2VIRB 3U9UB 1WEJH 4LLYB 2F8XC 1N9PA 4NNPL 4ATTA 1AG0A 3ARYA 2ADJA 2BLFA 2EDTA 2OYMA 3S2AA 4DP9X 2CAKA 1JAEA 2EYTA 2XFGB 3ISRA 3QDGA 3K4ZA 3QXDA 4KKBC 4NWUL 4OD2B 2ED9A 4P46D 4PM1A 3QORD 4WO4C 3RDTA 2LR4A 4N8VG 3R8BB 2F68X 3KPLA 1E2VA 5C0CA 4MAYA 4L1LA 1AXTH 3ZVVA 1L9RA 1CLVA 3MA7A 4O5LL 1CTMA 3TH3T 3H7BB 5I1KH 3Q8CA 3T2NL 3U4EB 2YAPA 1VSCA 1RZ7H 1FG9C 1OB0A 1YEIL 2YQ2A 3G6JA 4MJIA 5DUML 2EH8L 1EHXA 3RU8H 1H3GA 1A6WL 3SDXE 1G7PA 3BE1L 1DN0A 4JFEA 3GSNB 4QOKA 1JFQH 5J56B 5TE4L 4Z95H 3RA7H 4TTGA 2N01B 2XN0A 3IJ8A 4C56D 5AENA 5AOLA 3WFEH 1U8NA 1HWWA 1KLFA 3HBZA 3KPMB 4HK3N 5EORH 4EUPG 1U8KB 4NLHA 2O6EA 4L4TB 5C09E 3ULSA 2VW6A 2Y7OA 4HKXB 4U1NB 1XGQB 2JTYA 2VZVA 3BJLA 1JOIA 2PXYC 3LIZL 3NFPB 4I0PA 1W0VB 2HYMA 4LSQH 5D1QE 5IBTL 4PJHE 1XIWC 4AYFB 3LZRA 5EO1B 1BBJB 1ZTMA 3FT1A 2GY5A 2XFXA 3E2HC 1J1PH 1MCCA 3AJ7A 4PG9A 5CEYB 4QTIL 2WCSA 1I8KA 3DTXB 3FQRA 4Y1AE 5B21A 2P9RA 2F7RA 4H0HB 3LPPA 1C8QA 1KT2B 4LCIL 4LLYA 5KBDA 3VXTB 4AZ8B 4M7ZC 2CO6B 4MRCA 1LJMA 4G1MA 1GGCH 1D3CA 1EDYA 3R1GH 4JFSA 3ZK0A 1TYEB 1MHHB 5D70L 3EUUA 5FA4B 3EJYC 3VD3A 1X9LA 1IBDA 1Q0XL 3OZKA 5EZPA 1PKQA 4GLRH 4ESKA 3GMPA 4U31A 3WHE0 3H7BA 3U4EA 4GKSB 5D55A 1Q1JL 1XT5A 3QDMB 2ZQKA 3DX2A 4DGIH 3BWSA 2VKXA 4PJXE 4HK3J 1RZIB 1B2WL 3X3GH 4M61A 1RLBA 3U7WL 2NOYA 2B0SL 2P24B 1B6DA 2MTAA 3B5GA 1EZVY 4PVMA 4CN4A 1Z7JA 4AE0A 4EI5A 4Y9CA 2XETA 5G5DB 4HLZH 3VD4A 3VWKB 5BRQA 5I1AB 1JF6A 2FQFA 4IBSA 4KPHH 2R2EA 3CUPB 5J12C 1FAIH 1XH0A 5HDRA 4CW1A 2YMXH 3UTTD 3UROR 3KH4A 5DZJA 5BV7B 3L4VA 5E4EC 2FT8A 1D5RA 4A55A 4RBPK 3FZUD 4XRCA 3WTUA 5DWUH 4FULA 4UINH 2BX5A 4A2MA 4KJPD 1MFAH 4NDMA 4U1JB 2IH3A 4YBLB 4UB0L 4LOUC 3AXIA 4W9CC 3EJZC 3WJLA 1UTDA 1XGTA 1Z1WA 2R0ZH 1TQSA 1AVAA 1MJ8H 2M2DA 3D50A 4HPOH 2XTJB 3QZBA 5FUZL 3NYKA 1MAMH 3UTSA 2XZQL 2QZ5A 3HAEB 4YO0B 4N8UA 5D71L 1MHHA 4D3CH 5AVSB 4MDJA 3RRQA 3NGBC 2QQNL 3ZTDC 5FGBC 1LP9B 3T9WA 2ERJC 4LCWB 4U1KA 3VM7A 4HUNB 2YQGA 3FYIB 4ZMPA 3H9HA 1N6QL 5ESQA 1FBIL 3F85A 4ZZKA 5ADPH 2Y5TB 3FB5B 5J13C 1BECA 4X6EB 1CD8A 1JK9A 2VISB 4XP4L 4LKXB 1E4XH 3PGFH 1PNCA 4ZTEA 2I24N 5HHOA 5I1AA 2JB5H 5A2LH 3BH4A 3ABMB 4JQXA 4UM9D 2Y7QB 3J07A 2AI0L 3QXWA 4AVIA 1UA6L 2ITDA 4ZQKB 4CGUB 2D4DA 4JN2A 4L8DA 2QGCA 3CFCL 1IC4H 1KGWA 1NBZB 1NDMA 2H8PA 2UXTA 3IMVA 3H7LA 4GRWB 4GAYA 4AM0A 2ITEA 1UKSA 2Y7LA 5FYJU 2XXMB 1MI5B 2DRUA 2FJGB 3AY4A 3GLDA 3QUXC 1XCTB 2X40A 5KVGH 4KJWD 4RDQF 4TUJB 4XVTL 3LRHA 1RZJC 4PRIE 2NR6D 3N0AA 2FBOJ 4L4TE 4NO2A 1IKNA 4XGZA 2Z91B 4G5AA 3WE1A 2DI7A 2Y6SD 4UMGA 2BSEA 4X0KA 2E46A 4LL1A 4GIAA 3FHQA 4HKZB 1RZGB 3R19A 4YHYB 4I9WD 4F7MA 5EO9B 2A77H 4TQ8A 5I23A 1Y6NR 3F6IA 1GOHA 4BFNA 4OCYH 4TN9A 4Y19D 3AWGA 3W0WB 3PCYA 1J8SA 3ABGA 1D9KC 3MLUL 4Y5VC 3IJEB 1PX4A 2LVEA 2QL1A 4LCWA 3U30C 3LMJH 5CAYB 4Y5XA 1WCBA 2BDNH 3BCDA 4KI1A 3QFDA 4UYQA 4X8GA 4GXUM 1OT1A 2H0EA 4K3JH 4GW4A 1OT2A 5FW7A 2FQGA 2WIIA 3LQAL 4Q6IA 3CBKB 1HZHL 3QDGD 5I2IB 1XCQA 5D7LE 3MLVH 2BVQA 2A74C 4KQ3H 3RDTD 1CICC 1BVLB 4PQXA 3TO4C 5BJTB 1E0OB 4I77H 5C0CD 4KQ4L 1HI6B 3V0IA 4MAYD 3VFWB 1N18A 3BGFC 4HDIB 4LLAA 3MV01 4JDVB 3V6ZB 5AYQA 3JWDH 5L8KB 3OHXC 2BP8A 5I1CL 1HVXA 3EDFA 2BRRH 1JZ4A 1H5BC 3FDWA 4MJID 2J6EH 3IPBA 3DKHA 1OZTG 5D9SA 3UDWA 3OF6A 1NGXA 3EUDA 1BHGA 4JFED 4ORGA 4LDOB 5A6LA 4QOKD 5DHDA 3SEPA 4DH2A 4Y88A 1B4TA 3S3SA 3C6EA 4ECNA 5D5ME 1HL8A 1NMAL 4LCYB 1U21A 1A2YA 1G7LA 1S2EA 2MQ0A 5KSUB 4K7FB 3JZYA 1RZGA 1JYVA 1DVFA 5HHNB 3KLHC 4X7CC 2R15A 2R2BB 4HFUL 4I0PD 3AQDA 1G1OA 4UQ2A 3VFOA 5LGYA 2TAAA 1HYSC 1QTYT 4JFOB 2BWDA 4QAMB 3PWVA 1OPGL 3LD8C 4OU3A 5A2CA 1W8OA 5AYUL 4JPIA 1SDAB 1O7SA 4WCYH 4LPWA 1LNUB 1SXCA 2KT6A 4QRQA 4H7VA 1CXIA 2XKNA 3SOBL 3C9NA 5F71A 4HP5A 4X0NA 3B9VA 1FSKC 2BVYA 4ZDHB 1ES0B 5D1ZB 4TUOB 5CJOH 4UV4H 3VFUB 1N0LA 1LO3L 1Z5LB 3BVDB 4I1PA 4PB9H 1BG1A 5JW4M 1JXDA 2VLLA 1KPVB 1HI6A 2ZXQA 5CIPH 3D6GA 5TGBB 5JQHC 1T0NA 1KTDB 3ZHKA 3CHQA 3BKML 4JDVA 2W07B 4NXKA 3U4BL 3FTZA 1G0YR 2M83A 1HDMB 3UJTL 3V4UL 3APFA 5C7ZA 3QIWC 4K9EL 5ANHA 3QEQE 2P7TB 3KWXA 4AQ1A 5D72H 3RZCA 1NMCC 4O2EB 1S7SA 4YVNA 6CGTA 4J12A 4AJWA 3GSQB 1FNFA 4B9CA 4KDWA 4EI5D 4M7JL 3HC4L 2DJSA 3C5ZC 4FP8H 2WXNA 1J5IA 4F58H 1HSAA 4L4VA 4U0RC 4R4BB 3TVMA 3P2TA 4KO6A 3B7TA 4ZW7A 1Q90A 4JFXA 5GGQH 1CU4L 4ZFZB 3ZDZF 3UH8A 2NDFA 1WIUA 2JH2A 5C0JA 5LN8A 2HFGL 1YDPB 1YNLL 2XG5B 4MA1C 5C0BE 4RMSA 4BZ1A 5A3ID 4FMKA 5GZOA 2ZP0T 4ZD3L 2NY7H 4LLWA 2JJVA 2VB5A 3SBWC 4KDTC 4JPVL 1EVUA 4P5SA 1OCCB 2ENYA 3GK8L 3VGFA 1BZQK 1RSYA 5LAXB 2ZPKL 3QULA 2Y1YA 2HLAB 3QZWA 5IVXB 4NRXB 1LNUA 3MLTB 3QJXA 4QLWA 5DSCB 5E0FA 1UM6L 1G7HA 3LX9A 1BVKA 3NUKA 1KCKA 4Q74A 4R2GB 3NESA 3PGDB 3P0VH 3GXTA 3S36H 3UTSD 3JTSA 5BMFH 3X12A 1FZKA 3MDJA 1RIHH 1AIFB 4ABQA 1JP5A 4DO4A 1F3DJ 4RISL 3WXVL 2Q87A 3B1UA 1F45A 4BWWA 5IIEB 1QRNB 3EH4B 1G6VK 4XB8A 3FS9A 2D4FA 1U36A 3GI8H 4H8WH 4NZTL 2NY4D 3AG2B 1DBMH 1NLDH 1AHKA 5EU6E 4JG1L 2FIKB 4Q58C 2IOIA 4ZXBB 5BRZB 2DQEL 3QJHB 1G0DA 4LNVA 2GKIA 2IXQB 2VN7A 3DUSA 5INCA 3GSQA 5CN2A 2Y9RT 4XAWL 1S5IH 3OJDB 5HHOD 1G7JB 1A6TB 4UTBH 2JLLA 3CTTA 1OAZL 3F6JA 3HEIB 4M00A 4X7DC 2GSGA 2ITCA 2BHYA 3ALPA 4X6FA 3TLRA 5D2NE 4ZFZA 2JJUA 3ZUNC 2WQ8A 2WBJB 3BRGC 12E8L 2AJSL 1NGZB 2AQRA 2CU9A 1G9NH 4N2BA 4I3RH 3LIZA 2FL5B 3C60B 2Z31C 2FEEI 2L0DA 4EZLA 5LAXA 1FE8H 2F15A 4BFJA 2IV9A 2DQCL 4LQ1A 3AM8C 3MLTA 5DSCA 5IG7A 2NY2D 2Z1PA 1JPGB 2BSED 1JRHH 1CFSA 4NWTH 1HWHB 2IG2L 4H5SB 4WFGE 5I9QB 3T0AA 3U7AA 2OBGA 3PAYA 1YMMA 4BSVA 3H4HA 5HHPA 2XX0A 1AO7A 3R4RA 1AHWA 4HALA 1HEZB 4EOWH 3SGJC 3OJ2C 5GGTL 4AT6A 2P4AB 3D09A 1QRNA 2C8NA 3Q2NA 1MDTA 2WVVB 1PZ3A 1DLHB 2F54B 3LZLA 4Q6YA 5E23A 4LCWD 4DF9A 1MDAA 2PPFA 2WC7A 3BIKA 1SVCP 2R1XB 3GMOA 3J8F7 3VA6A 2AQPA 5LBGA 2YUXA 4M43H 1TTAA 3K2UH 1ZA3B 4HU8A 2ODIA 3QJHA 1GKEA 2ZUUA 3ZTJH 2D7QA 3MRGB 4QIRA 5KUKA 3L4YA 1I85C 3GM8A 3MRFB 1XGPB 1TEFA 2BJMH 5LG6A 2XIDA 2UZYA 4M5SA 2QGBA 3KJ6L 1G7JA 3EJQA 1ZSDB 1T03L 1PZ2A 4U6XB 3QS2A 4YSTA 1PIFA 1XH1A 3SPGA 3HC2A 1BP3B 1MF2L 3GBNH 3QAZC 5HDBF 3ZZLA 1KBBA 4ERSL 3WD5L 3MRCA 4FTVB 3UAJA 2YKKA 4G8EA 2Q8BL 2H1PH 3GIZL 2B08A 2WWMC 3OF6D 1RP8A 4KRLB 4WO0A 3RWEB 1HHGB 4YDLB 3EYQC 5I17B 1I3RA 5L4JA 1GZHA 1OW0C 4S1QL 5FYJL 1A5FL 1VLXA 1HKFA 2YGNA 4JQIH 1EUUA 3LNFA 3IFLL 4LOEA 2HMIC 1DVFD 1BJ8A 3BLKA 4ZMLA 1HH9B 3IKCB 4JHWH 4P59H 4I1RA 2IJ0C 4PP1C 1DVXA 3EW3B 5MEOB 1UCBL 4G83A 1QA9B 2V5TA 1DJWA 2CMRH 4AW7A 2VITA 4HUVA 3DC0A 1P4LB 2J8UB 4NZDA 3N9GL 1CVSC 2XOTA 2YKLH 5JORA 2OTPA 4OV5B 4E9WA 2BIMA 2Y7NA 4JNXA 1XAKA 2J88H 3DUHA 2QVTA 1KJVB 2IV8A 1DANT 4L2LA 4FXLA 5IROC 3SY0B 1ZMYA 4YK4B 2FUTA 2JK5A 3E6FB 3BGMA 1DFBH 1SDDB 4UQ9A 1LQBC 1MFNA 1P4UA 4FNTA 3GSWB 1F58H 1LDSA 1XGPA 3K0YA 4R0LB 5FYKH 1BVNP 3KPQB 2WP3O 5F6HJ 1BQHA 4RBPH 4RGOH 1OWWA 1GXEA 4LU5L 2VSCA 3DIVA 2ZKMX 2CLVB 3LQZA 3OLIA 2YN3A 3VQ2C 5DMJB 5T3ZD 1JVLA 2QV4A 5JHDB 5JR1L 2ZYIA 3O6LH 2OMWB 2G30A 3AB0C 2MHAA 4PD4J 3DARA 2NLJB 3MVSA 4GFTB 3BVVA 3FMGH 4FQJH 4XNQB 4M7LH 2F9BT 2LAAA 1KYUA 3RZCD 5E5UB 4FAAB 5LVEA 1I8UA 3RWEA 1MW2A 5L0QB 2XRAH 4A1RA 3E0GA 1TZ8A 1K2DB 1YNTB 1NCOA 4JCMA 2C3GA 4QRRE 3STZA 4L4VD 3TVMD 2A99A 2IDSA 4F8OA 2AHIA 4XCNA 2X5PA 3A22A 2JCCF 2UUDH 5IB3A 4YDJA 2PYEE 3O3AB 1KGCD 3EO0B 4NPYB 1V10A 2L04A 1IGTB 3VFNB 2V2TB 5GZOD 3BVNB 3WNJA 4LKCA 1MAKA 3BFWA 4I18A 5TDNA 2NY1C 1MW3A 2PF6A 1DBJH 3FUJA 1REIA 4LVNC 4Y2DC 5H2BA 3KM1A 2Z3FA 4V1DB 1HHHA 5ALCH 4Y4HB 1JWMB 2OV0A 2Y07L 4F27A 1V7ML 5JXAL 1KJVA 1XHHA 3A4FA 2H9GB 3O3DB 5FAAA 3WEXB 2WBWB 1I53A 4X6CB 5F9DC 5DEFA 1BZEA 3HIZA 1ZEAH 2NY5H 4P4RA 1B4JL 5DD6B 4E9RA 2D8KA 1S4IA 5DLML 1CF1A 1RFDL 4JFDE 1Z9NA 2VLMD 3KPQA 4ATWA 4ZMQA 2E7MA 1DJXA 4UIMA 4WHCA 5AOZA 3MRNB 4MCZA 4D9LL 4D9RE 2WCGA 3D69B 1AQMA 2VZOA 2ILLA 4WV1A 2P3YA 4TOYH 2OMWA 1DHKA 3JTTB 3CXDH 4KKPA 3D48R 1P4BH 1I82A 4QRTA 2ESVA 1TSHA 2V2XA 1RI8A 5EBLB 4P5KA 2FWLB 1WLHA 4NUGH 1Z9LA 1MCRA 3LKSB 5IBUB 3RP1A 1BG9A 1I7RA 5H8DA 2WKOA 1Y18A 1OCRB 3M8OL 3QNZA 4P99A 3T4YA 1JGLL 1ZJAA 5I0WA 1R5WB 4YDVA 2QKIB 3I6SA 2J4WH 4UUJA 5BO1H 5HYSG 1U92A 4AGMA 5AUMB 1QLEH 1MUJA 1X6LA 2BVOB 1O6SA 4H8UA 4IMKC 4JVWA 4G11A 2WANA 3O11B 4NPYA 1OGAB 5ERWA 3HS9A 1JZ7A 3BLPX 1NZRA 4XC3L 5AB0A 5KN5B 2KERA 3FN0L 4JZOB 4G6FD 4OFVA 1MLCA 2XVKA 1GZQA 4X80L 4NBXB 2BNRB 1UJ3B 2JELH 3VFGL 4N0UA 4H26B 2BINA 3PE9A 1BAFH 3AT9A 4K7PX 3TCLB 5JPMC 1ADQH 4WFHD 2CM5A 5JA9A 1G5GA 1AQKH 1CD0A 1EEQA 3MA9L 4M02A 1YMMD 4KMQA 3PWLB 3Q13A 2J8UE 4PPTA 3VH8B 3UTPE 5I71C 1FA4A 1J12A 1AO7D 1CLYH 1FNSH 2ZKWA 6FABL 4BQ6A 2OFQA 4WGWB 3ZDXB 1QRND 5F7DB 5D1XC 3TTSA 1FGVL 3PFUA 3Q5YA 3V7MA 4Y8DC 2OI9C 4IBTA 4J3OF 5E08L 4KKAC 2YPVA 1JK8B 1HU8A 1KPUB 1LILA 3JTTA 4MJ6B 1QACA 4BFFA 3T65B 4PBVC 3D30A 3ELQA 3H54A 5TTRA 2G5BA 1U95B 1I9IL 3GMQB 5TDPA 1Q9WB 2KZBA 3GHPA 4PLKD 2GAZA 1KZYA 1UXWA 3U0TB 1BZ7A 1N5AA 2QR0B 3Q8BA 4X7TB 1CUOA 1TETH 3RIFF 5ITBH 3D4CA 4RFEB 4LMQE 3T3MB 2FDBP 1NGYA 3O11A 4NHCH 5E99L 3UAJD 1FH5L 3OKLB 3TGXA 4AI7A 5ETUB 2AK1H 3TBTA 1EXGA 4AM0Q 4KOBA 5GGVL 4LOFA 5CU5A 2P45B 4ZPTB 4RGND 4F2ME 3OAYH 1T22A 2C1OB 4HUXA 5D6DC 3O4LB 3AFLA 3HRZB 3CSTA 3SQOH 2HX7A 3WXWL 2ZCHL 5I8KH 5I1IH 3MJGX 3FQUB 4FG2A 2G5RA 4YHKH 2MOQA 2B4CL 4AIXA 2R59A 4ZFGL 4C58B 4XMTA 3L3KB 1MIML 2CGYA 2C7FA 5I0DA 4IRJA 5ECJE 1EEZB 5T1DH 3Q1EA 1IGCH 1MN4A 3FO0L 5F7DA 3FL7A 3PY9A 2APXA 3DX9B 2E56A 4PI0A 2YZ8A 2QLVB 3OJMB 1QZ1A 4J3OH 3L9YA 2OCCB 3NSJA 5DYOA 1XTMA 2H32B 4MJ6A 2PWGA 1F11A 5FHAL 4NO0A 4ANXA 1M6OB 4YIQA 4AGQA 1YEKH 3PUUA 1Y6KR 2FATL 4R6UA 4ZO8A 5M7QA 1WYJA 1J5CA 4KY1H 5F1NA 1G9NC 4JLRB 4JRYB 3RUGB 3G5ZA 4HAKA 3OQ3B 4P23B 1F4XL 4KX8A 3EOTL 2E74C 5DRWB 5FYLL 3DBSA 5C0DB 3IAQA 3DSFL 3LEVL 4NSKA 4F7TB 4X7TA 3TT1L 2EUZA 5CCKL 1KTLB 4GS7C 4JZJB 4NQCE 1PZ5B 4OZFA 4WHTB 4YBQD 2MCAA 5HYIA 5JW3H 3MOAH 5EIIG 3L17A 1MXGA 1PZBA 2W88A 2WLLA 4FFZL 4XR8C 5DO2D 2NY0B 4IBLT 4ETYA 4OKVB 3LB6C 3GNMH 4YJZL 3MO1B 3PXHA 3GC3A 5CKGA 2G2RB 5AW6B 3FK3A 3HRZA 4WLCA 1QPPA 4APQC 5DD5L 1I9JH 1WC7B 3BPNB 3R06B 4LCCA 1ODUA 1WBZA 2VDQL 4N4YB 4W9IC 2CIKA 5BOPA 1T0PB 1ET7A 3KBHE 4FXKB 4GRLC 3O9WC 3TN0A 4E0RA 3D05A 1HIMH 1TYRA 3ASWA 1DUZB 5ISZA 1HILB 4LO9A 1QMUA 3CFIC 4FL4C 2AJZA 4JFPA 3ARGA 2B59A 3JV6A 4BWTA 2V4LA 2DJMA 3ZY7A 2XZCL 4JMXA 3HE7A 2HT4D 5GGTA 2KMWA 5EUOA 4JDEA 3WUZA 1UGNA 3GXMA 4CVUA 4HIXH 1D5XB 4EUPH 4XCEB 2BP0A 3IBEA 4QAWA 4OT1L 5D2LF 3SDAC 4M1CC 5K59F 1VHPA 4KKLC 1ZLSL 5FKAB 1YMHB 3TEXA 4ANKA 1F4YL 5I6LA 3MBEC 2AXJA 4Y4FC 5DT1L 3DK2A 1SJEA 3MUUA 1NGWA 4NC0B 4RA3A 3REWA 2CUMA 2VMCA 2ESVD 4B60A 3F8UB 3AS0A 2TRYA 1RUMH 5E6IC 1MCLA 5I5RA 3MO1A 3T3ME 2V7HB 4P3CL 2OL3H 3FTXA 3SGDI 2B1HL 1I1YA 3DMMA 4Z7OB 1QI4A 2Q3XA 4U0QB 3TC9A 1GGYA 1WC7A 1TTGA 3UADA 3ARQA 5BS0E 4EIGB 1AY1H 5HYQB 5JW4Q 2HFFB 5B38B 2UY6B 2EIEA 4GXFA 3L3OC 1MHCB 1MHEA 4KUCD 1DDHA 4FHJA 2DJUA 3HTLX 1K3ZA 1MCWW 3PHOB 2VR3A 3QCTL 4NM4H 2VDPL 1D5ZB 3OPZL 1NBYA 2ALAA 2BH0A 1UXSB