1R1CA

Pseudomonas aeruginosa w48f/y72f/h83q/y108w-azurin re(phen)(co)3(his107)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEHWMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spectroscopy and reactivity of a photogenerated tryptophan radical in a structurally defined protein environment
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 35
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1r1cA00
1W8EA 5B1BB 1F56A 1GR7A 1GS8A 4JHVA 5ANHA 2IWKA 4KOCA 3RYMA 2FT8A 2J57A 1V55B 4K9JA 1ZPUA 3PAUA 2BP8B 3DKHA 3GDCA 4E9XA 2FT7A 1CURA 3G5WA 4UANA 4GP4B 3DTUB 4DP7X 2XX1A 3NSFA 4DP6X 3NT0A 4HCGA 1OCZB 4UAHA 1BXUA 4YSDA 1NPJA 3NJFA 3NJMA 1XMEB 2XUWA 2ZWNA 1WA1X 4YSTA 1NDTA 5I6PA 4A67A 1RZPA 2XWZA 1BAWA 2A3TA 3WIAA 3MX0B 4W9ZA 3AY2A 3EH4B 2UXFA 2UXGA 1PLBA 4GXFA 2VSMB 2GI0A 2RACA 1NIDA 5B1JC 1SHXA 5AFAA 5I6OA 3TBCA 1SDDB 3BQVA 2NRDA 2HRHA 1JXGA 5I5MA 2H5UA 3FU7B 4KO5A 4BXVA 1I53A 4BWUA 3T6XA 5PCYA 3AG3B 3S8GB 2VM3A 1IC0A 1KGYE 1MDAA 1WS7A 3UABA 1JXFA 1W6LA 5B3SB 1PNDA 2BW5A 1N70A 4YSUA 1R1CA 3HB3B 2QPEB 1IBYA 1RKRA 3FYEB 3AG1B 2VM4A 4NB7A 1L9OA 4BK5C 1ASQA 4YSPA 4FA7B 2DYSB 3L45A 4WTQA 1B3IA 2GSMB 1KDJA 2DY2A 3NSDA 2IDFA 2I85A 4BDVA 3HEIB 3QJSB 2PCFA 2MTAA 3S3CB 2PCYA 3X1EA 2TSBA 3X1BA 1PLCA 2FQDA 1L9SA 4KO7A 2XX0A 2HX8A 4AI7A 3IN2A 1M56B 3PXLA 1MZYA 3UAEA 2I7OA 3V9EA 5I5IA 3QQXA 2CBPA 2YAEA 1TEFA 3NJKA 1GY1A 3IE9A 2PP8A 3NJGA 2OV0A 5I5JA 2GC7C 1X9UA 6PCYA 1EZLA 1AQ8A 3OMAB 1J5CA 4HHWA 1N68A 1PZBA 1JVOA 3KW7A 2DWTA 2DYRB 2XV2A 3PAVA 8PAZA 4MFHA 5I6KA 1ZDSA 1J9SA 3WNJA 1OCOB 2QPDB 4E9WA 3ASOB 2PP9A 2GC4C 1OV8A 2BW4A 3NYKA 1EHKB 1AACA 3X1NA 1PZAA 3OD3A 4YSAA 4YSCA 4KO9A 4N8UA 3EH5B 3QJUB 3CG8A 4A2DA 1BEXA 2WSDA 1E67A 1PNCA 3X1GA 4E9VA 5LDUA 3IN0A 2YARA 5D4IA 4ENZA 1BXVA 1E5YA 2FT6A 1J9TA 1JZEA 1JZHA 3QJRB 2EIKB 3NSCA 2W8CA 1V10A 3T6WA 3GYRA 1AS7A 4E9YA 5TK4A 2OCCB 2YXWA 3SBPA 2BWDA 5AKRA 1BQKA 3OMIB 4AKQA 1W6WA 4JHUA 3X1FA 4NERA 1GSKA 3FQ1A 2H3XC 1AG6A 3AG4B 3NJIA 3NJJA 2VW4A 4L0PB 2FQEA 1AR1B 2PPAA 2J5WA 3FQYA 2DV6A 5B7EA 1L9QA 3ABLB 2FTAA 3FSVA 1PF3A 1SHWA 2XXGA 3NSYA 3JTBA 4BWWA 3PLYA 1ET7A 2Q5BA 3QJVB 2TSAA 2FWLB 1OCCB 3FU8A 1CYXA 4TXVB 1IUZA 3DIVA 2X87A 1WAEA 2X88A 1ET8A 1ETJA 2IWEA 5EHFA 2HX9A 1PAZA 2JFCA 3TBBA 1KDIA 1IKOP 1L9PA 3QJQB 2YAOA 4A68A 2EILB 3FYIB 2AVFA 4DP5X 2JXMA 3S3BB 2XYBA 2EINB 1XB3A 3TASA 4HHGA 2GBAA 3SQRA 5B1AB 1GS6X 1A4CA 1KCWA 3H56A 3ABGA 5I6LA 4BXSV 1J9RA 1TKWA 3AG2B 1IBZA 4RH4A 1NPNA 3T6ZA 1DYZA 3H4FA 1AS8A 2HZHA 3UGEA 1ASPA 2CALA 3ABMB 3FQ2A 3GXUB 2XV0A 2GHZA 4PCYA 5B1KA 3UAAA 4GYBA 4YSEA 1TEGA 4AKPA 1HFUA 2Y1AA 1E5ZA 5IY5B 3FPYA 7PCYA 4Q89A 5PAZA 4W1TA 3NJLA 1AZRA 2ZXWB 1ADWA 3FS9A 4YSRA 1FA4A 2ZONA 4JKNA 1XB6A 2BP0B 3V9CA 2XXFA 5E9NA 3NJHA 2JKWA 3D12B 1A4AA 2AZAA 1HAUA 1URIA 4A66A 5F7BA 3ZDWA 4DPAX 2UXVA 1JZIA 1BQRA 2HLEB 2YAHA 2PPEA 2UX7A 1ET5A 4P5RA 3FPXA 4M3HA 1WA0X 3S3DB 2YAFA 1SJMA 3IBOA 4HAKA 3WI9A 1SF3A 2YQBA 3IEAA 2YAQA 1OF0A 4AZUA 1X9RA 1ILUA 2EIJB 2QT6A 3WKPA 3BVDB 4KO6A 2VW6A 3EHBB 1ILSA 4A2GA 3MBWB 1AZUA 2BP8A 1KCBA 1E65A 4YVNA 5I28A 3NJNA 1E30A 1GS7A 1XB8A 1TU2A 2YAMA 4AX3A 1L9TA 1J9QA 3FSAA 1NIAA 4CSZA 1NINA 5AZUA 4N4YB 5I6MA 1PCSA 2Q9OA 4YL4A 1NICA 1A65A 2H47C 3ZBMA 2IDTA 3CVBA 1CYWA 2QDWA 1DZ0A 2FJSA 2BP0A 4GP5B 3T9WA 2IDUA 3EH3B 2MRYA 4A2EA 1RCYA 5B7FA 1CUOA 3PCYA 4F7KA 3N55A 2PPCA 2PPFA 3PPSA 4HCIA 2UX6A 2HXAA 4PAZA 2XVBA 1AZBA 2EIMB 5D4JA 5I6NA 3WNIA 3S8FB 2XU9A 1AZCA 2IH9A 4G7QB 1JZJA 3AZUA 1SF5A 2IH8A 4HALA 1OOWA 1PZCA 4A2FA 4F2FA 2GB2A 1QNIA 1WS8A 2BZCA 1BXAA 1AIZA 2B08A 1HAWA 2B3IA 2CJ3A 3T6VA 3CDZB 3KW8A 1ZDQA 1ASOA 4QLWA 4HCFA 2DWSA 4M4RB 2XLLA 4BDVB 1YLBB 3SBQA 1T5KA 1AOZA 2PLTA 2UXTA 1SFDA 3WG7B 1WA2X 3T71A 4DP4X 3JT2A 4KNUA 2OJ1A 3QPKA 4YSQA 1V54B 1NZRA 4DP1X 1KBWA 5A7EA 1A8ZA 3TU6A 3CVCA 4KNTA 4DP8X 3UACA 2IDQA 4YSOA 3FT0A 5F7AA 3FSWA 1AZNA 2LLNA 3CVDA 5FC9A 1NWPA 1ZIAA 4GP8B 2FQFA 2IWFA 1FFTB 2QDVA 3OM3B 4DPCX 2BHFA 2Y69B 1QHQA 4CSPA 4DP9X 2BZ7A 4YSSA 1OE2A 2BWIA 1OE1A 2YAPA 4G7RB 1A4BA 2VW7A 2P80A 2FNWA 3AW5A 4E9QA 4DP0X 4HZ1A 1BYOA 2VMJA 2PP7A 1KYAA 2AANA 4G7SB 2E86A 2R7EB 2AZUA 5B1JA 1MG2C 3PAZA 5I26A 4Q8BA 4YVUA 1ID2A 4G71B 4BWTA 1MZZA 4AKOA 1JERA 2W88A 4NAJA 2P80D 1GYCA 1OCRB 3C75A 3ASNB 1L9RA 1AG0A 2IDSA 3OMNB 2HRGA 2YXVA 2GIMA 4UF7C 6PAZA 1PLAA 1AAJA 1VLXA 1ZIBA 3H4HA 4G72B 7PAZA 2WO2B 1M57B 5D4HA 3OQRA 1AANA 1QLEB 1ZV2A 3ABKB 2VN3A 1SNRA 3SBRA 3N2JA 2IAAC 4X4KA 1JZGA 2HX7A 2PPDA 4FAAB 1GW0A 4WKXA 4A2HA 3U25A 3FU9A 1JOIA 1SDDA 3ZIYA 1NIFA 1NWOA 2CAKA 5B7MA 1JZFA 1AS6A 1CC3A 1JVLA 2CCWA 2N0MA 2I7SA 4KOBA 3EF4A 3FSZA 2FQGA 4EF3A 4GY4A 1JXDA 3CDZA 4KNSA 5TK2A 2R7EA 1BYPA 4E9RA 1BQ5A 4E9SA 3NP3A 4G70B 1NIBA 4E9TA 2CUAA 9PCYA 4F2EA 3TA4D 1J5DA 2J55A 2J56A 3ZX1A 3QJTB 1NTDA 3NP4A 4DP2X 2BO0A 1M9WA 3CZUB 4ZK8A 2WO3B 1OE3A 3ERXA 2XV3A 1SFHA 1UATA 1RZQA 1KBVA 1MG3C 4HIPA 1NIEA 4DPBX 2AFNA 1PMYA 3WKQA 1A3ZA 2ZOOA 3X2QB 2VSKB 1KV7A 1PY0A 1GY2A 3FU7A 3UADA 4P5SA 1FWXA 4QKTA
chains in the Genus database with same CATH superfamily
4PY8J 4TUJA 2BCKB 2BP3A 3MC0A 3TBYB 5D71H 1I1RA 3W9DB 3QUYA 5L2KB 5F7WC 5T5FA 3NQKA 3OX8B 3TBSB 1O9ZA 1ZPUA 3IM1A 4IHOA 4PWIA 4Z7WE 4I48A 1XSIA 2VSCA 4BHUA 4CVWA 5DUBB 1L6PA 1U92B 2HJLA 4ZX3A 4YHKH 1I1AD 1KTLA 4WCYH 1F3DH 3ZZLA 1IQDB 3KBFA 4JM2B 3UTQA 1NFDE 2B1AL 4JS7A 4WFEE 2VR9A 1D2OA 1DN0B 3DIFA 4MDJA 3TNMA 2BP5M 4J28A 2A3TA 5B1CA 1CVSC 2XTJE 4P5TD 2IF7A 3WMPA 4E42B 3PHOA 2UXGA 1M4KA 1KLGB 2Y06L 2GI0A 4NFDA 2MOQA 4XP1H 1H3TA 1UWXH 2PCPA 1FZKA 2Y5TA 3EGDB 1E9PB 4Z23A 2F54E 4N9OB 1RFDL 4R96A 4FNLL 2AXGB 3WJLC 1XEDA 1BOGB 4FTVE 4HXBH 3OQ3B 4OUUB 4WW2B 1XCTB 4GRLD 3OJ2C 4P2RA 3U2JA 4CGTA 4UB0H 4NZFA 1I7RB 2G5BA 5L8KB 1T22B 5F7EL 4M9OA 5F89B 2P24B 5M7QA 2YWZA 3ULUD 1TLMA 1MREH 1A9VA 3I9GL 2DWEB 3ARUA 1I1AC 4N0YL 4KZDL 4M7LH 4K23H 1ODUA 3KYMA 2R39A 5J6HB 4ZNCD 4TSAH 3NTCH 1ZK5A 4UDTB 1MIEH 1RJZB 4DO5A 4JM2F 5C7XH 2I85A 2YA0A 4NQEB 3L13A 1AP2A 2MTAA 2ARJB 2EDYA 2PCFA 2VKWA 3LKSA 4XCEB 2X0VA 3UTTB 1PZ5B 4HOWA 1A3QA 1CD1B 4DKDC 1CD0A 1UACL 2C9PA 1JUFB 1E9QA 2NNCA 1S9KC 4XP9L 2QGEA 3NAAH 3OZ9L 4BJLA 2HX8A 3ULVH 4POZC 4J3VA 4G8IA 1EVTC 1H6EA 4P2OB 1JV2A 3N42B 4PJ5E 1EJ8A 5GGRA 4X7TA 4ETYA 4CVUA 2PN5A 1UM6H 3K4ZA 2DLIA 2EXTA 4Y9EA 4L37A 1QYGH 2XV2A 2DYRB 4FZ8L 4IMLA 5DRNA 4WHYG 4PRBA 3PWLB 1PKOA 2IANB 3TV3H 3FUHA 1S7QB 2X9ZA 5EUKA 3KPQA 3PL6D 2PYFA 4QHNA 1J12A 1ADQL 1JF5A 3JV4A 2IGFH 3EHBC 3U4AA 3R4RA 4H40A 4OH2A 5D72L 3CX2A 1CFSA 4PRDA 5J57B 4G1EB 4W9EC 4A2DA 3GUTB 1R24A 3EJUA 4HK3J 5CIPB 5LDUA 2FEDD 2BVOB 4HS3B 5KYUA 4ALAH 4F1ZA 1A21A 2YARA 4J3OC 4J3OH 1SJVA 4HWEL 4JFHD 4KI1A 2E7LC 4MKMA 1OAQL 2WINB 1QWUA 3KXFE 3GK8H 1WGOA 3WHXB 3U2SB 2A77L 4GW1A 4ZW6A 3FC8A 3Q2LA 4NQED 4YN3A 3T0AA 2LFEA 1CGXA 3CFBA 3NSCA 3TJEL 4FLSA 5EFIB 5A6LA 3EFFB 3L5WA 3RWCA 1PZ5A 2EICA 3JTSB 3M1CA 2XJLA 3KE0A 4ORZC 4UOZA 3O4LE 3WLBB 4Q0XH 1WICA 5CHNB 2R8SL 5HHXL 4XC3L 4MXWH 1UZGA 5KG9B 4JZOA 1F42A 2XWJA 4PJXE 1XV8A 4F3FB 5B7EA 2O93L 4FP8H 3OLIA 4L9LC 3KLHC 3QNFA 3QRLA 1YG9A 3LKPB 3L8QA 3MLXL 4BA0A 2UY6A 2PR4H 4EIZC 5F3FA 4BWWA 3Q6GL 4O2CB 3OKNA 2Q2EB 4V2CB 2I27N 3PABA 1M1XB 3ARFD 4Z7NF 5A3IC 1AMYA 1QLFA 4QGYA 4OTXL 5F9OH 1N26A 2LR4A 2YGQA 5DI8A 3N1FC 2B5IC 4FQQB 2YAOA 1OWRM 2WB7A 4N5ED 1GMIA 4MXQD 2B1AH 3P3YA 2AVFA 2OMTA 4PGBB 5EA0H 2WYIA 3HKZA 5IB1A 1M7IA 1XB3A 1CFQA 1FFQA 3JWDH 5HGDB 3SQRA 4XMTA 2MHAA 1SLWA 4UB0L 1BGXH 2H2PC 3DWTA 1RJZA 3IKCB 1UOKA 5DRXB 2VABB 4EN3B 3WEAA 2NW2B 12E8H 1U92A 3CWGA 2GY5A 1EAJA 5I8OH 4U3XA 3HE7D 5ACLA 3AFLA 1C5DB 4J23A 3APDA 4JVUA 5DCCA 4QRPA 1TEGA 2ESVA 3GXFA 4AJ0A 3QRFM 1WAAA 1HL4A 4GAJH 3CVIL 1IGCH 5FYKH 3NN8B 3QZMA 5ENWA 3UBXI 4OLUH 4Z7UE 2XXFA 2ZXCA 5EN2A 1ZV9A 5IB4B 1NCCH 1YC8A 1FC2D 2ITDB 4RAUA 5F7BA 1CXKA 3SDAB 3ZYOA 3ARBC 3BRDA 4GSXA 3VX1A 4LKCA 2CLZB 3JWOL 4HKJA 4TQ8A 2ATPB 4XHJC 5IW6B 4MBOA 1MCEA 4EXKA 2IXQA 3LKOB 3PGFH 3O6KL 4JO8A 3HMWL 4GBXD 3DSFH 3LN5B 1NSNL 4B5ZA 1XR8A 1KYUA 4G6JL 3CFIC 2QT6A 4A04A 1QHOA 2YA2A 4LESA 2BPBA 2VN4A 4KO6A 4LPVA 3VXOA 1ROCA 3KEHA 1QBMH 1KTCA 2VLKA 1QZNA 1H8SA 2EYTB 1A4JA 3AUWB 1BFVL 3N06B 1BFSA 3GI8H 4AVHA 3VXNA 3QDJE 5MEQB 3B7SA 1W91A 1WRFA 4G43B 3MCKB 3ZBMA 4QR7A 5JW4N 1NOAA 2HLAB 4P9HH 2YWYA 2J6WA 2A83A 4GP5B 3T9WA 2IDUA 4R7LA 3BP4B 3C2AH 2C3GA 3BAEH 5B7FA 2D0HA 1NDGA 4NM4H 4P2QE 2CD0A 4JO1L 3BKCL 4MLSA 3UPRA 1SMOA 5DUMH 1ZJAA 3TX4A 4PB0L 2J5LB 4WEUD 1DVFC 1GGIL 5JIKA 4ZMOA 2X0WA 1AQMA 1E4XL 2XWJB 3OF6D 4L3CB 3MLWH 1Y6NR 4Y16A 3U83A 4P2OC 4WK2B 3T8XA 3WFBL 5BS0A 3GKWL 3WFEH 4TKWA 3L95A 4G9DA 1DL7L 1LE5B 3ZYZA 1A6UL 4RISH 2YKLH 4TLTA 1T83C 1KJ3H 2RB8A 3Q7JA 5D7LA 1A2YB 4IRZH 1KB3A 1CB4A 3VDCA 1IIKA 1U8QB 3QORC 1XBDA 4OZ4B 5FYJE 1HHIA 2BIPA 1FZOA 3LKOA 4ABUA 1AQKL 4LLMA 1Q9OA 1HHKA 1NH6A 2AMUA 1F8TH 2E9GA 3SJVD 1MF2L 4KQ4H 2DJMA 2XN9B 3JXAA 1WK0A 2QMJA 3W9EB 4UDUA 3KPRE 2NY2C 1QD0A 3KLAB 1SXZA 2NNAB 4HDIA 4MQ7B 3U6XS 1UM5H 3ATBA 1R5VA 1SY6A 2WANA 1BW8A 2DLFL 3ESOA 1M2VB 4LSVL 5FOBA 5EU3A 5HJ3A 4G8EB 4TUUA 4TNFA 2HLAA 4HXAH 3I6LD 1ZIAA 3ZHFA 2ALAA 4RAVB 3HUJB 4GP8B 1DBBL 4LXFA 3OM3B 3RVXC 3BSZL 4HQQH 4G6JH 3WY4A 2Y69B 4X4YA 1U0QA 3FO9B 4PV9B 4Y9CA 3STLB 2BZ7A 4ZUWA 5KOMC 1OE1A 1Z5LB 2LQRA 5AAWA 5DTFB 4E9QA 5K9JH 3H3PH 1W72A 3WDIA 1KCRH 2K7PA 1YYMH 3FT3A 2XA3A 1EK3A 5IOPB 1JWSA 4XOEA 2AANA 4LVNB 4EI6A 1DJHA 2R7EB 1NCCL 1MG2C 2BMKA 5H2BA 2F68X 4XZUB 4NZTL 4F7TA 2RJMA 3O2DA 4L2LA 4C4KO 1S78C 1LP9E 5K9JL 1TQWA 1B2WH 2XZCH 4AEIH 5C3LD 3F3HA 2EDQA 3N85L 4XCCL 2DMKA 4XMPL 4AWJC 2IDSA 4RFOL 2ZCHL 4MNGB 5CZXC 1W15A 1XFPA 3ZT7A 2W92A 4M02A 2YD2A 1MFCL 3SKUD 5D7KD 4L8BA 2WO2B 1G1OA 3HZVA 3SOBH 4PJHF 4R7VA 2I25N 1I7RA 2G5BB 3ZDZE 1GZPB 2E9JA 1T4KA 3N2JA 5DD5L 3NDYE 5CEXA 2LLGA 3ALWA 2AP2A 2RTTA 3QR2A 4UT7H 3GTNA 2MTPA 2QJDA 2C7UA 1DP0A 3TTYA 2OTUA 1TYRA 1BSIA 1VHPA 3OVUB 5D93C 3QCUL 4K3DL 2DQDL 3CH8A 5INCA 3T1FA 4GY4A 4KKNA 2QSVA 3UAJD 3SQBB 2D7MA 3HTLX 1SXAA 2J8HA 3O3EA 4QRSB 3GZOA 4GIPD 3REWA 4ONOA 5KJ4A 3P9MB 1CN4A 4EXPX 2QADC 3VDBA 3CCHA 4JKMA 1F11B 1NIBA 3PWVA 3FQXA 2CUAA 3GSOA 2ILLA 1ZGLA 2YD5A 4H25B 3AGVA 4YFDB 1DBBH 3O6ML 4H8HA 5KJ7E 1NCDL 3HUJF 1XT5A 4IJTA 4XMZA 2VCOA 2VZ1A 1NBQA 1HQ4A 1DL7H 2DQTH 3HS0C 4NWUL 1KF9B 1MNUL 5DQJB 4V2BA 2FRGP 2G3NA 5I1EH 4JPIB 1FGVL 3KR3L 4WO0A 3GEWB 4FKKA 4XC3H 1JXKA 2ZOOA 1J0IA 1HJBC 4JFEA 4N20A 3SKOB 2WNGA 2F1AA 2BRRL 1CG9A 1MRFL 1PZSA 4I5BB 3LHAA 1FSKC 5EO0B 1NLBH 2UVEA 3DX7A 3MCG1 1IKNA 3CGTA 4KJYB 1YMMA 3LVTA 2ICWB 4X6FB 3HC3L 4X6BA 1CFBA 1REIA 4L18A 3EIFA 3DUUA 5T3ZL 5CBEA 4DZBB 1A6UH 3LB6D 4M48H 5CWSB 4U1KA 5DMGD 5M94B 5D7JD 3DUSA 4OCRL 2R29A 4DTGH 2EIZA 3DX6B 3S88L 1LK3L 3WHXA 5LG6A 4BUQA 3B9KC 3FRUA 1N4XH 1MI5D 3V6ZA 1OGSA 2G9KA 4OUOA 2F74B 4HMEA 1RUKL 3MX0B 3F83A 3MOAL 1BVZA 3DARA 1RUPL 2R4RL 1IM3B 1BQHG 3RX7A 4AIZB 3OAWA 1X9LA 1TQCB 2R23A 1JXGA 1UH2A 2YFNA 3HZYA 4FQCL 3DRTA 1MWAL 4NC1E 5TQ2L 4F9LC 4BXVA 5JLZA 3T6XA 5I1IL 2ZKHH 3WEBA 3KCWA 4WNJA 3MRNA 3O8XB 1JXFA 4F15C 4W9KC 3ASWA 4HUKB 2C4XA 1GZQB 2BHZA 2X4PA 3SDYH 3V5HA 1RKRA 2UZXA 3BCDA 4XE0A 1Y1UA 1NC4B 1K8IA 4Z8FH 3ML9A 4OSUH 4HG4J 4NYLA 1Q9LA 3Q3GB 5E56A 1H3VA 1A7QH 4PJCA 4BFEA 4OM0H 1TU2B 3D3VB 3RUGB 1SXSA 1J0JA 5JO5A 2YZ1A 2ZTBA 4I7ZC 4M7KL 2Y2TA 3QAZB 5E2TL 4J27A 5IQLA 3CFJA 2XKUA 5FGCE 4P4KC 5EOTB 1GA2A 3UTQB 1M56B 1T7WA 2DM7A 3HC0B 2OTUB 1MREL 4G42B 3FXIC 5BQ7B 4KQ0A 4QRRB 4RMSA 4N8CL 4FXGC 5SWQB 4ZFOB 4B9CA 1YJDC 1G6RH 1KCKA 5AW7B 3HE6D 5F8QC 4N8PA 1KCSL 2TRHA 1CI3M 1E0OB 2GK0B 4NO0D 4F7MA 1CD8A 3ZMNA 1VB9A 2ZWKA 1K2DA 4JDZA 2ICWJ 1HINL 1M9SA 4DW2H 1K4DA 1XCTA 3PWUA 1RZFL 1J1PL 3FQNA 2EH8H 3SE4A 3T0EC 2PP9A 5FHAH 4AXWA 3ZKMC 1JRHI 4ELMA 3HN3A 3UFIA 4EIBA 4N85A 4WUUE 4JUSA 3ZTJH 4B27A 4OZIB 1ZA6B 2A0LC 1LWJA 5D8JL 3WU1A 4JRYB 5FYLD 1C12B 3QJUB 4LMQI 5EOQL 1M2OA 3LB6C 1K4CA 4P5KB 3BZDA 5HVHC 1V8HA 3FMGH 5KTEH 3BVTA 3ME0A 4NNPH 1DJWA 2Q76B 1TZHB 3MRMB 4RAHA 2KC0A 4R4NC 3UGXA 1E90A 1QEXA 1X5FA 3QORA 1D5ZB 2MHAB 2XTJD 2IAMA 4Y4KB 5FFGA 2EIKB 4AUUA 2CSPA 4HWBL 4J3BA 4DW2L 3QDMB 4E9YA 5ITFA 2OCCB 4UYPA 3VYOA 3K5RA 4QXWA 2G2RA 5F21B 5FO7A 2YQGA 2V2TB 2H0PA 4JHUA 4LK4A 3QG7L 4HKBA 5AW8B 1QSZA 5D96B 2X6AA 5C0DB 5GXBB 1ETB1 3IDIA 4L8SA 5JW3L 3IKKA 4L0PB 4U7KA 1IEBB 3LDBC 3QJHB 3LSOB 1C7SA 4Q6YA 3ABLB 1JNLL 1U6AH 4MMZC 2ATAA 1T0NB 2DIEA 2YSSA 4GRWB 4X7DC 2FVNA 5DUJA 1OANA 5BS0D 2K6YA 2P5WD 4CVZB 1UD5A 2Q3XA 3JTBA 2R1YB 4LLQB 1EBAA 3QJVB 4B9FA 3MRHA 3UAFA 4FD0A 1CE1L 1X5HA 4IIQB 4CMHC 3X13B 2D2CC 3N42F 4MB4A 2OX5B 2QHLA 3NCBB 4NN5B 5T8IA 4ODTH 4P3WA 4ANKA 2ZCLL 5ALBL 1G9MH 5F1IB 2OS7A 2EILB 1V27A 2K70A 1T4WA 1A47A 1WIUA 3FONB 5DD1H 4DP5X 1JG9A 1VGKA 2P7TA 2O26U 3KYNB 4IJ3B 4WI7A 3TASA 3RTQD 1FIGL 2R1XA 4Z95H 4H5SB 1AZZC 4M48L 3VD7A 3NDZE 4Z76B 4H8QA 2OXHB 1J9RA 1KXVA 1AXTL 4UV7L 4RH4A 5HYQA 2QVMA 1TXKA 4GEIA 4O02B 1YNKL 2HT2C 4HSQA 5EZJB 2QSTA 3C09B 4ACTA 4XPHL 5DHVH 3MGOB 4YSEA 2JKXA 3DOIA 1E5ZA 3APFA 2FSEA 1JNHB 4F7PB 1PG7L 3BP4A 1W0YT 1N0XL 2RR3A 5CJQH 1J5OL 5JZ7C 1EXGA 2VDQH 5ESAA 3TTSA 4E68A 3QG6A 4GO8A 2H0FA 2MFNA 3ECQA 5GJTL 5GS2D 5TDOA 1ZWIB 2BZDA 4R5TA 3KHOA 1OP3K 1QNZL 3GRGA 2E47A 5LN4A 4QNPE 1F02I 4HUVA 1UZ6F 3AC0A 3P9WB 4JFHE 1JZIA 3B2VL 2HLEB 3RTLA 2YMTA 3FF8A 1OZUA 2BHUA 1K5NB 4MLIA 4XNUL 2BSDA 5E5MA 1NFAA 3Q5YA 3T0EE 2I69A 4AG4L 5AENA 4M4PA 4IW4C 1YNTF 3MXVL 4H20H 2BRQA 2Q6WB 1FFNA 2ZYIA 3RVXD 3CCHB 4Z0XB 4RFEB 2B2XH 2CPUA 4HC1A 4XCYB 3PWPE 1DQKA 4JZJA 4B96A 1MCQA 2DLEA 1FAKT 4Y5VB 1M7IB 4ENEC 2JKRM 4HJJH 1ILSA 1R33A 1P4LA 2X44D 4PWJA 5H8DA 4KZDH 1OT4A 2XFGB 3NEXA 1DTUA 1QG3A 4UT9H 3RY5A 5IROC 1KGIA 1DQML 5TE6H 1ZD6A 4CN6A 5G2NA 4ZQKB 3QCVL 2C3VA 1BD2D 3BUBA 3DLQR 4NO5B 1OCWH 1XCWA 3WL9A 2JIXA 3BKJL 3WXVH 1NBVL 5ISZA 2GK2A 3PNWA 3T4AB 3GDBA 5EZPA 4NI6A 5FAAA 4PRIB 3WIFA 1MOEA 3IJEB 5JIMA 4PJFE 5E4OA 3FZUD 3ZTJG 5A43C 4P2OD 1HSBA 4PRPD 5E1GA 2D4DA 4HT1H 3ECVA 2OR9L 1T2JA 4XMLL 1U3NA 2HXAA 2PXYA 2JELL 5C07E 3HFML 5CUSL 1EZUA 2K4AA 1JD9A 5D7JC 2Y7QA 3GIVA 3RWIB 4YBQC 5DD0L 1VADB 4ZSOA 4OFDA 4H44C 2FCBA 5E2UL 4TN9A 2APWA 4UT7L 3V5KB 1N5AB 2JJUA 4U7MA 4JFSA 2FYVA 5F9WB 2HWZL 5IT2L 2Y1ZA 1MFEL 1FVEB 5CN3A 5DD6A 2J2ZA 4NS0A 4GRMA 1Z3GH 3GIZH 5AL8A 1YUHA 4QLWA 1RZGA 1BFOA 1IGMH 5F0MB 5IMOB 1E27A 1UG9A 4BDVB 4Z5RB 5H35A 2L04A 3OB0K 1B9ZA 2EXYD 3MLTB 1LP9B 4RETB 1QLFB 2XQYK 5C0CB 1MNNA 4QF1A 3ZYJA 5DEFA 5HHNA 2IGTA 2IALA 4X99A 1X5IA 1B4JH 4PRDB 3IDUA 3C5SB 3V4LA 1OZTG 4Z78B 4L5FH 2VZSA 2PYEE 1VKXB 5DQ9A 3JV4B 1GC1C 3MRNB 2P8MB 2IIJA 2YOAA 1U8PB 4KNTA 4M6NH 2XWRA 1NANH 3QUZC 4Z7VB 3UACA 5C9JA 5I1KL 4OCRH 2D7TL 1R5VB 4HUUB 1Q9KB 3BD4A 4WWOA 4ZW5A 4LFHD 2LLNA 3CN1A 4MMZB 4YWGL 1I82A 5FM5O 4Y1AE 5C07A 4A7VA 2IFFL 5KYXB 1XL4A 3AS2A 5JMRA 2BERA 1U41A 2ZSVB 4PRHB 5CR1A 3HG2A 2CXGA 3FU6A 1RUPH 4KY2A 1JPTH 1T0OA 4X7CC 3AJ7A 3FULA 2RA1A 4QTIH 5F6IB 1G9MC 4X0KA 1OAUL 1A7OH 3DJ9A 4DEPB 1JHTB 4LCCC 5DJZA 2W07A 2DLFH 4LSVH 5HVWA 1LE5A 1T66C 4TQIA 3NZSA 5SV3A 3OXSA 1JERA 4W9LC 5HYIA 1DLHA 2H2SD 1CDYA 3WD5H 5FCUH 3BH4A 4MD5A 1OPGH 4OY9A 4PJEF 2P52A 4HISA 5IBLC 4OCXL 4XMVA 4D2NA 5CCKL 4PG2C 6PAZA 3CU1A 4ZDHA 7PAZA 3FDWA 5EULV 3K2UH 2XQYG 1GZHA 1RZ8A 2AERT 3I02A 2XWTA 4G3YH 4G9FD 5ID0B 2NZ9D 2NY3B 1XSOA 1L3WA 3H9ZA 4NKIH 1VKXA 2R1WB 2Z93A 2L3BA 2CIIA 3DMMB 3E80A 3HAEA 1YSOA 3SBRA 3DPBB 4EDXA 1RERA 3MXWL 3BVXA 3ULVE 3BUDA 3QWRD 3KWUA 4MWFA 1X5LA 1VRSA 2Y6SC 1MLCB 5IJVA 2EYSB 5IVOA 4GRWH 4N6RB 5B7MA 1O6SA 4X7TB 4W93A 4NN7B 3PDOA 4Y2DB 2CO2A 1OAUH 4X7EC 4KOBA 3FB5A 1U36A 5F88A 5CEZD 1XHHA 3KEDA 4MCZA 2F18A 3KD4A 3EG9B 4X5PA 4KVNH 4HIHB 1TJGH 1FFPA 1JXDA 1YQVH 5ITFB 5E70A 4FXKC 3TH3T 3C5ZC 2C26A 4PRAA 1YJDL 1JV5A 2E75C 1BZEA 1XO8A 2MNWA 3HG0A 4S1DD 3O8XD 5L2JA 2F15A 4NPKA 4PCKA 1RL1A 1VADA 1W9XA 3CDGB 4WFHD 3JVGC 2H3NA 1OK8A 2D7TH 2IH3A 3KJ4C 4MNHA 1WZKA 4QHKJ 5IJBC 2WO3B 4KI5F 1SFHA 2NXZB 1BZ7A 5EN2B 1AC6A 4TVSa 1ZVYA 3VI3F 4IBSA 2ZWZA 3KH4A 2RCSL 3LQAL 4FS0A 3BPLC 2JKNA 2Y07H 3RE0A 3PWUB 4TPRH 5HDBB 1N0LA 5C0ND 4LAQH 1F56A 4JHVA 4XVUD 1S3KH 3NESA 1XF5B 4KOCA 1TVHA 3GTTA 5EB9A 5CP3H 5J1AB 3EJJX 4FLRA 2UY7A 1SN0A 5JXED 2NQCA 3LQAC 4LL4A 2HKFH 4YAQA 2ENYA 4LQFH 3RA7L 5TF1H 1KCUH 3SCMB 3O3DA 3AQXA 3CHPA 4Y5XB 2FJFA 3W3BA 4NLAA 5GGTL 1NAMH 1ML0A 4JHZA 1E9OA 3T1WA 3F6IA 5IMKB 2XWBB 2XVKA 4U3SA 2F5BL 3AQYA 2OLDA 1RAMA 3QORB 2IADB 3JZ7A 2VQ4A 4YHNA 4NJAL 2OMUA 5DLMH 1BAWA 2Y7SA 1KXTA 4NWTL 5ICZB 4HWZA 2EDBA 4QHKI 1U8LB 5A16A 3WNKA 4X4YB 3TJPA 5DT1L 4DQAA 3I3EA 1HHHB 2MNUA 3BJLA 1DQQB 1ZHNA 1AO7E 5HY9A 4TSBH 2D3NA 1A1OA 3G5VA 4M5TA 5B3NA 3IFOB 1P2CB 4OKDA 3MMEB 1UA3A 4XN1A 3LN4B 4O2CA 4HKXB 4M1DL 5IQNA 1PCXA 3RGVD 4AGNA 1IZKA 1BQHB 1KGCE 2ORBH 1Z0MA 5C0EB 2EDTA 3R0NA 2OYLA 3PQYD 5E99H 3PDDA 5EU6E 3H9HA 2VM3A 5CEZL 1MDAA 1KGYE 5TE6L 1NM9A 2Z1PA 3LKNB 3ARYA 4D8OA 3L16A 1KJ2B 4HCRL 3S5LB 1ZT4B 1MF2H 3EYQD 1N0XH 4N2DA 3ARGB 3MBED 3GMMA 4YSPA 3QZWG 3UZEA 5HHOB 2XBTA 3MNWA 1C08B 4FYQA 2A5UA 4PPTA 5HHMB 3B34A 1QRNB 1P5VA 2E27L 3M8OL 2GCYA 4XO8A 5KBMA 4YFEA 5T5NF 4OI9A 1KJ3L 2AAAA 4PJGA 1JHKH 3QDGA 4OD1H 3RHWF 1E8YA 2DQGL 2WYHA 3GLEA 1RQ5A 4RZKA 4GW1B 4AGOA 5EF3A 1UC6A 2YAEA 5FA3A 1XEUA 2FH6A 3IE9A 3HHRB 4HPHA 1ACXA 3CXHJ 4HS6A 1I4FB 2OV0A 2DQUL 2GC7C 2YUWA 1J5CA 1G9ML 4N9GA 4NKQB 3L3GA 4KXZI 4AZ8A 5JHDE 1SN2A 3LKQB 3WY2A 1XF3B 4UM9A 3WENA 4PJGF 4UNVA 3VI4A 3V6OA 1QUNB 4F2ME 4HHAA 4I4WB 4XMUA 1CE1H 3BP5B 4W6WB 4AE1A 4HOZA 1IZJA 4D0CA 2FYYB 2JKSA 3MMEA 3L2NA 5FDWA 3VXRB 4P9HL 5GGVY 5H4ZA 3V8CA 2VMDA 4OJEH 4ZX5A 4Z78A 2ETWA 3BE1H 1WISA 3Q8FA 1F58L 3VI4F 5DWPA 1XH2A 2ZXQA 1SXBA 3GHEL 3KYKH 2IO5A 2GUOA 5D7SL 5IEKB 5GS0C 3LJ3A 4ZO8A 2APXA 3BFWA 1JGVH 5EU5A 3F7KA 4A7SA 1TO4A 5TJWK 4LDOB 3EJTA 4OF7A 2JCWA 4OFYA 1D5ZA 4TVUA 4GAAA 1HVXA 3WCYA 4BSWB 2NY5L 4QRAA 4HUWA 3T6WA 3VH8G 1E3ZA 4FQHB 2Q8BL 4XI5D 2DJUA 4PJIA 4QCIA 4PGEA 1HWGB 2DQIH 4IOFD 5I1HH 4UI2A 1J0YA 4DH2A 2X4OB 3RWHA 3HOGA 1XR9B 4MJID 4AKQA 4N0CC 1JPFB 1F13A 3GIZL 4IRJA 1OGTA 1FHNA 1RJLA 2O30A 4L8SC 5D1ZC 3FQ1A 3UZVB 3ZE2F 3GSVB 4Q9RL 3QQ9C 3NJIA 4B9GA 2CGZA 3AY4C 3O2DH 4S11A 1LP9F 1Q9KA 4NKOA 4D0BB 4MDIA 3P3UA 4UU9A 2MQCA 4X4XB 3PGDB 3CVHB 3J2PA 4HUMB 4F8OA 1I1CA 4MDRA 1L0YA 4LVHB 2DL9A 3NSYA 2H0EA 4P23A 5DD3L 4A6YB 5AW2B 2QGDA 3ZTDC 4M3JA 2A6KA 2X2HA 3HCVA 4FCHA 1H0DB 2XV6B 3BKYH 4J3OD 4XP1L 2H1PH 5C09D 3RUGE 1OHZA 2ZXGA 4P2QD 1WAEA 3GS7A 4PU2A 3ZZ1A 2IG2L 4JG0H 4QRPE 2DJSA 4Z5RA 3IRZA 4M7LL 3F6JA 1NBVH 3H55A 3I50H 3UO1H 2ZF8A 3D39B 3DJTA 1YUHB 1NGQH 4LAJH 4NNPL 5IV2A 4N6QA 3BWUF 4FGMA 4AK2A 4XNQA 2DW5A 3T2LA 4AMWA 4XVTH 1E5AA 5L4IA 4ZXBA 2P43B 2WMPB 1A4CA 3TBWB 5ABZA 3BXNA 3FU0A 3PDOB 4H8WH 4KTEH 4Y2DA 5CJXC 2EUZA 4KPHH 1IM9D 4ONHB 3ULVF 1TPXC 3O11B 4Q0XL 4M6AA 4LARL 4L9LA 4LLVA 5E23A 4FFVC 3ABMB 3L4VA 3GXUB 1HYSC 5FYLL 5FW6A 1SEQL 3GQFA 4ZYKA 2FECL 1XWVA 2EADA 4WUKL 4LOUD 1MEXH 5BRZB 4PRIA 4QRUB 4W1TA 5T1LB 3SE3A 4OIBA 3G7TA 2YMOA 4FOMA 1HEJC 4HEPG 3FQWB 4JKNA 1OAQH 3GSNH 2QADD 2NNXA 2NX5A 1U8MB 5DYFA 1XCXA 1IU1A 1LO0L 4GMTH 5LGJA 1EHLL 3UZVA 5FGSA 2EDNA 1AQHA 1XF3A 5DWUH 4C83A 1N6VA 2QKIB 1OP5H 4AZ8B 3ULUL 1MCWW 2YAHA 2FEEL 1J10A 2CJSA 4LHUD 3STZA 2F8IA 3TA3B 5DF0A 2IGFL 4XX1E 3SOTA 1A1NA 2AQ3A 2HTLD 2IAND 4M7KH 1CGVA 5T1KA 2VT0A 1AKJD 1G7MA 4Y5VA 4X6CF 5DJZB 5FYKE 2GEQA 4ZNEA 1FZJB 3TIEA 1MRDL 5E00B 3TV3L 1OTTC 4RFEA 1YDPB 3UJTH 1B6DA 4PRNA 3FZUC 4FMFA 1VGKB 2G4GA 3EHBB 3T77A 3T09A 3FH7A 4XX1G 1QYGL 1J48A 2R0ZL 2PW2B 2GUOB 3CZNA 5G4OA 1K3IA 2EDWA 1E30A 2MPAH 3IJHB 5J89A 4U1MA 5CBAB 3RL2A 2A1WH 1MJUL 5F3BA 5EOCJ 4M7JH 4CSZA 4ES8A 2APVA 3FUEA 4X6CA 1MI5A 1YPZA 3S5LG 1EJOL 1AGDB 5D1ZI 3UBFA 3WS6A 2EIDA 1Q72H 3EJQA 4IBUA 2LAAA 5CR8A 1UUSA 4KQ3H 4OCLC 1A7PL 1OARL 4N1EA 3I2CH 4S1DC 1G7IB 3VG9B 1CUOA 4R8WL 1ZEAL 3WTUA 2JB6A 2CRIA 3N40P 3RVWC 4V1DB 1GIGH 4TSAL 4IU3B 1Z9OA 2R0WL 2ICEC 5I6NA 1F4YH 4CN4A 2BCMA 2W81C 2JJTC 4E5XG 4N1HB 1JRHH 3RRQA 1G1YA 4IM8A 3AZUA 3FQXB 1ZGLB 5F3HB 3HG5A 1E4WL 5A40E 5EDSA 2EACA 1FCCA 1BPVA 1RZGB 3E8UH 3VFNA 3ZHLA 4NFCA 2BINA 2D7QA 2J2ZB 4FNTA 5C0CD 4K94L 35C8H 1QI5A 3GXDA 2VR4A 4M1DH 4G9DB 1DJXA 1IGJB 5K69A 4TLKA 4H26A 1RFDH 2ZX8A 4OZGB 4APXB 3FKUS 4W4OC 1BZ8A 4MXVF 4JM2C 2NR6A 2EEBA 4P3DA 4UQEA 4NBYB 4P4RB 3H0TB 3RZCA 1LE9A 4KROD 4KNUA 5AYTA 3FCUB 4DQOH 3SDXB 3ZRSA 5FX3A 1FFRA 1HKLL 5F44A 3MVSA 4FNRA 5KVDE 1XGQA 4LF3A 4O9HL 2CLVA 1B4TA 2P24A 1XF5A 5J1SC 1UWYA 3QFJA 1CF8H 5FECB 1N0LB 1UEYA 4AUYA 4M9PA 3ARBA 1U8CB 4AY0A 2NYKA 4W6XB 1PG7W 5I0VA 4FG2A 1WV7T 2CDEA 3GMNA 4X9GA 2GAZA 4NQDE 1FFOB 4YDMA 2QDVA 4QRPB 1DBMH 2XQBH 4ANUA 1JPFA 1KFAL 1RVFH 3EHBD 3MLYH 1OALA 4PJ7A 4H1LH 3QRGL 4TULL 1L5GA 3QXTA 3NA9L 2QV2A 4M7LT 2BNUB 4YSSA 4G7RB 2J8UE 6FABH 5KBLA 1MFAH 1WEJH 2VLRE 2EE6A 1T03H 5L4JA 3CDFA 4ZPVA 1NJ9A 1WWBX 3Q2NA 1OXYA 2OXGA 2XWBA 4U3SB 4WWID 1MH5A 1DVZA 4G7SB 5CFHA 4S0SD 5BQDA 1KJVA 1LDPH 3MV7E 2VZ3A 3PAZA 5AW6B 2P5WB 3HFFA 2VE6B 3VE0A 4ZUWB 2Z35B 2BM3A 4QEGA 3VFVA 4G71B 3US1A 1ZLDA 4LCVA 3U6RB 3BAIA 4LKCB 2W88A 4QXUH 5TF1L 4NQSA 5LN8A 1AD9B 1OF2A 2A4ZA 4HH9A 1L9RA 1H15A 3OL2A 5GGVH 1J0KA 5L8LB 4XNXL 5F1NA 1AHWA 3IDJB 2FJHA 2YXVA 3TFBA 3ZKNC 2UZXB 3RGBA 2VDLH 1RI8A 5DEJA 5DEGA 1WDAA 2XRAL 4KAQH 3AABA 4UILH 2OL3H 1YY9C 3JYCA 2KQNA 3A21A 4KHTL 4ZMVA 5ID0A 2FHFA 1UFGA 3ULVC 4PP1C 4WI6A 4Z7VE 1CBVL 2ODIA 2CBTA 5GRUL 3ATFA 4WKXA 3FU9A 2V7HB 4LVOC 1A0QL 1B0GA 5EPMA 4ZTPH 3SB3A 1KEGH 1IEHA 4M5YL 2WWKO 4NUGL 1JZ5A 4DK6A 4OLZH 3DXAB 1EGJA 2EH7H 4FJZA 1U3ZA 1GC1L 1T04A 2HKHL 1P7KA 3EF4A 4ZD3L 2FQGA 4Y19D 2BSRA 5EWIL 1GTNA 3BH9B 2H32H 1BZ9B 3HHSB 3IE4A 3K6SA 3QIUA 3FTWA 4P2QB 5SWZA 2AJXH 2P5EE 3RFZC 3IFLL 5FGBC 1NC4D 3DX8B 4WWKC 4D9QD 5BV7H 2H0JA 5T1KB 3QR1A 1A5FH 3SGJA 4KVCH 3FW6A 2DWDB 3ETBJ 2JKLA 1QSFD 5IMLA 3SO3B 4WFFE 1QBLH 2YD4A 3MRBB 3MRPB 4HPOL 3W0WA 4CVZA 4YHPA 1OE3A 1QVOA 3DJRA 1I1AB 1MHEB 4GLRI 2W9EH 2KZBA 4KQ4L 2N4IA 5GGSB 2H4EA 4KK9D 3RILA 3PFUA 2ICWI 4Z3JA 2LGNA 1S7QA 3T65B 3HZYB 2X6VA 4ZS7H 4G7YL 4QRRD 4S1SH 5LCVH 4Z7VA 4I0PA 2FJHB 3D4ZA 4LE8A 3DO7A 4JO1H 2HFEA 2VO5A 1ZT1A 2XA8H 1GR7A 3MCKA 5E9DA 4EI5C 3QQDA 5HHOE 2H7WA 2XZQH 1F4AA 3B7YA 4K94C 4R6UA 1S4IA 3QUGA 5FO7B 3ZN6A 3EH2A 1RXLA 3KR3H 4JQXC 3VQ2C 2ZG3A 1RK0B 3IMRA 3G04B 1U3YA 4PV8B 5JPNB 1CICB 4U31A 3S3SA 1IM3D 4MMYA 3ZUNC 4WWKA 1D7BA 2I5YL 1S7TA 3R7QA 3NRPA 2PO6D 1BXUA 4YDIL 3C5ZA 3LXBA 4KUZH 1BBDH 4EZMA 3MKGA 2CNYA 1NDTA 4EIUA 2ATKA 2CJUH 4TVPD 3MA7B 4PD4J 3NK4A 2QQNH 4YH6A 1CFVH 2IPKB 4EUPB 5CJXA 1P84K 2W9DH 3F7YA 4GXFA 1NFDF 3STZB 3BVVA 2Q0ZX 2D03H 1KPVA 2OMBA 3WHE0 5ID1B 2GJPA 4YHIB 3PGFL 5DK2A 3R06B 5F7DB 3A4EA 1IC7L 4K2UL 5GGTA 5AW4B 2B9AA 1FL3A 2FBJL 2FJGB 3FRPA 2N7SA 4WUUD 3HG1D 4BWUA 3V52L 3ZT6A 5HD8D 4YXHL 2FEDC 2OBGA 5D5MB 3VFSA 4YBQD 1FL3B 2FJGA 3STBA 2EDLA 3WO4B 5E1AB 4OLUL 3ATAA 5CEYB 5CEZE 1D5BA 1T3FB 4HKZA 1L9OA 3FTXA 4W9FC 3VB8A 2DF3A 1FNGB 1B0RA 2DEWX 2DYSB 4AYFA 4GG6B 1IMHC 4OVVA 5K1VA 2DWXA 1E27B 1KTBA 3D7PA 4BDVA 1OSPL 4JB9H 4QRTA 1NMCB 2TAAA 1N5YL 3AAZB 5CP7B 4Y5VC 3LRLA 4R26H 2VR7A 3EF7A 2WXHA 5HGAA 1MFMA 1D9KC 4JDTH 3SEPA 1VEOA 3DK2A 3UAEA 2M2DA 3QQXA 2YLHA 3CC5B 5DJDA 3H8NA 3SBWC 3GS4A 1UA6H 4K9EH 1KYDA 1O6SB 1T0PB 5IROD 1TTBA 2J1YA 2VXQA 2IBGA 4YHZH 2YD6A 4PJXB 1DUYB 3OX8A 2FIKB 1PSKL 4L8CA 4LGRB 2AC0A 1JXJA 4QOKD 4A63A 3F12B 3BP6A 4OD2A 5GS1A 1SQMA 4BK4A 2B59A 3VSTA 1Z3RA 4RAVA 3ZDZB 5I6KA 5JPNC 3M17A 1HN1A 1JF6A 2NY4C 1DBKH 4RCAA 2BW4A 4IYKA 5I66A 3DK0A 4AG4H 4DESA 1FPTH 4KX8A 5J11C 1FZKB 2Y5TB 3ET9F 2NYYC 3QHZH 2I9TA 1E42A 4KMTH 3EH5B 3OJMB 1TF4A 3NFNB 1EAPA 3ARZA 3SE8H 5FV1L 4TVPL 4HIJA 3R4DA 2JCCB 3UCQA 3OSKA 1S7VA 3G9AB 5LAXA 4HZLA 1HQRB 5DDHA 3MLZH 4M1CC 4N8VA 4JY4A 4Z76A 3OKDA 4FLQA 2VDQL 1G1KA 3U4KA 4Y4HD 3ZE0E 3BQUA 4IKLA 1WJ3A 4FG4A 2N1KA 4TLSA 2ZWYA 5I8KH 4YHYC 3QIWB 3GYRA 2OMNA 4N8VB 5TDNA 2Q86B 1OY3B 4F27A 1PZ2A 3Q6GH 1I8AA 3VVWA 3RFZB 4Q97A 1T04B 4U3HA 5A6MA 3QHFH 1ES0A 4FABH 5ADPH 4X7SH 1QTSA 3UG4A 5KYWB 1RP9A 5D7JB 3L1OH 5C07B 4U1HA 2ZOTA 1WT5A 3RTQA 5KZCD 4BZ1A 1PIGA 4G8EA 4PS8A 3IJ8A 3UYOD 5DD1L 4MQ7A 4ZFZB 2B1HL 3LN9A 4MXWL 3C87A 3H1ZA 4HS8L 4KMLB 3PU7A 3B8YA 3LV3B 3QIWD 5FO8B 4GOSA 4P5MB 1MCOL 3APCA 1U8NB 4Y4HC 3ZE1F 3MRQB 3EGXA 3GWJA 3S35H 1OCCB 4AVIA 1I8KB 4U49A 3WS3B 4DWHA 5T5FH 3IDIB 4LEBA 4GBXB 3US0A 3DHMA 2X88A 1CZ8L 2IWEA 3W39B 2NY1C 3FO0H 4R5VA 1E8WA 2XWEA 5D1QA 4BSVA 5JPMC 2KZWA 3BUQA 2P5WA 2YS4A 2BS9A 1ZE3H 4MYWB 2WZPA 3C12A 5IV2B 4HHGA 3VSUA 3VJ6A 2RAMA 3IDNA 3VFOB 4FQ1L 1SOQA 3OZ9H 5ALCL 4YLCA 1IBZA 4ZTEA 2H3KA 3ISRA 3MV9B 1HL9A 4QHMA 2YD1A 2LVCA 3S5LA 3VXRE 5I1LA 2H41A 5JOFB 4NCC2 2DAVA 3UAAA 3IAGC 1GJWA 3VG0L 3OWEA 5T3XL 3HBGA 3HZVB 1FA4A 1EPFA 4WVRA 2WLKA 2FWUA 5JHDB 4GAGH 2VZVA 4BV1A 4N86A 4I8DA 1KN2L 1KXQE 2JKWA 4LP8A 3WKYA 2GIYA 3AQDA 2A38A 2F9BT 3EYOA 2OYPA 4DKAA 4DPAX 4O51B 1KLGA 3C9NB 1UUNA 3W81A 5KBKA 3NH7L 1RLWA 4WI2A 2JNZA 1SEQH 1AXSB 4YIQA 2YQBA 1MH5B 5J4MA 1DVFD 1OF0A 4MCYA 2AHIA 1HJCA 3F00A 1SBSL 4QAWA 2J25A 3K1DA 5E9DD 1DUZB 4ZPVB 4G83A 3I75B 4HV8B 3WKPA 4Q58C 3K6OA 5I8OL 2Q7NA 4W4OA 4BD4A 4YHLH 1VENA 5D1QB 5TE4H 4ANVA 1AZUA 2FX9H 1ZTXE 4DZ8A 4Y5XC 3MUHL 3DOHA 1K4CB 4P5KA 3W39A 2V8LA 3IJSA 5A2CA 1J9QA 2Z34A 1OD7A 3RVVC 1A02N 4YHKL 4PS3A 3M1BA 2C3WA 3ZTNL 1NICA 3LNGA 3SD2A 3QDGD 3E2HC 4TOYL 1ORSB 3EOTH 2G0KA 3WMSA 4L8DB 3OZLA 3AXLB 3EDEA 1SYVB 2EH8L 2E9IA 2IPTH 3QPXL 5BZWA 3WO3B 2PW1B 5E8NA 2K7QA 1WAAF 2COVD 3DYMA 1JP5A 4HIIB 1KB5B 1U3HD 5GRVL 4JHWH 4OCYL 3X12B 2BSSA 1KIPB 2F7IA 2YRBA 3EH1A 4FDWA 1C5DA 1U2CA 1F2XK 2UX6A 5GISL 3IXAA 4PBVC 4FTVD 1ZANH 3B8SA 5D4JA 5DK2B 5E4IA 4U1HB 4YR6A 2ZE0A 5HHVL 2WYTA 3EFDH 4GI6A 1RUAH 2CHNA 5I0ZA 2V3FA 2C4FU 4ONGH 1JZ7A 4QTFA 5DRXA 2AQNA 4QY8B 5H37H 2DTMH 2OYKA 4U6HB 1OAXL 3HE7B 3SJVB 3QDME 3VYPA 2WVSA 2GJ6A 1N12A 5I1IH 2VWEC 3Q2WA 5C8JB 1QSEA 4JY5L 5CNHA 1YDPA 4IEFB 4X0KB 3CTTA 3SBQA 2XPGB 1OB0A 2XCMC 4JW3A 1RZ7H 4BEIA 2WNXA 1VFBA 1NGZB 4OSUL 4JKLA 3HMXL 2OJ1A 1AKPA 5HDQH 2WLIB 1QFOA 3WIIL 4F93B 1V54B 3OKLB 1OLLA 2JI2A 5I1CH 2ENSA 2V7NB 1MVYA 2P46B 4I0PB 1DN2A 3QQ4B 5DVOA 2OP4L 5EBGA 3AM8C 4YC2C 3QA3A 5H4YA 1T89C 2CK2A 2MIZA 3JBG7 4FQ2H 5D7EA 4YHML 5CN2A 2ZWLT 1ETA1 5TE4L 4G9FA 3OAUL 3K71B 2XY1A 3RIKA 4EDWH 5CHNA 3B5GA 3OTTA 4K71C 4HWUA 2NXZC 2I9LB 3MQIA 4OZHF 1NBZB 3O4LB 1J8KA 1XGUA 3A47A 2BRRH 5E5UB 1KXTB 2VLJD 4Y7MA 1RZKC 4FNQA 3EFOB 1OSYA 1UWXK 4MMXA 4XO5A 1QA9A 1PFOA 3GSOB 2A9MH 3KPMA 4IBTA 4TUOA 5DVPA 4PHZA 3E6FA 2V37A 3DX6A 1NJ9B 3CZKA 1HEZA 3BYYA 3H9SB 5JW4R 4WFHE 2E86A 2AK4A 3QIUB 1X4XA 4YNYA 1C5CL 3MLUL 4PJ5A 5IB5A 1YN6B 1N10A 2G60L 2X4SB 3MRCB 3SJVA 2WVVB 4YVUA 1HE7A 4PS4H 1CD9B 1KNOB 3MO1A 4XPBL 1EAPB 1CFSB 2E7BA 4C83B 1SZNA 1MFDL 1MJJB 4LEOB 2VR3A 2PYEA 2V2XB 3D34A 4FFVD 1AG0A 3A6CH 3DVNA 1HOEA 1MIEL 1AAJA 2G75A 3B7TA 4G72B 2ZX7A 1PX4A 3FN0H 4U6XA 3V4VA 2VLJA 4PJ8B 4JGJA 1AANA 1FE8H 3ELQA 3MRFA 4ODWB 4MRBA 4FQXA 1FN4A 4W9HC 1W0VB 3WJLA 2G75B 4Y16D 1CGTA 5KUMA 3Q44A 2L4OA 1NWOA 1P7QB 5HP5A 3UC0L 2W95A 1CCZA 4N0UA 5MHSD 2WXIA 3ZL4L 4M00A 5CINL 3RPIB 4PJHA 5F1SA 3O3EB 4QRSA 3SO3C 1WF5A 5BXFB 2WW8A 1SXCA 2AK1H 1HL5A 2GIXA 4N0FB 4NDMB 5L0QC 3MNMA 1CLVA 4MCZB 3F7VB 4KTYA 2HTKD 3OPZH 1CLZH 3V5KA 1AO7D 3CFDB 3ZRFC 4UTBL 4U1SB 4AEFA 1RJYB 5E1QA 5TTRA 4PJ8D 4Y19A 3OKEA 3LXAA 3UTTD 1AH1A 1UCTA 4GQ9L 4PUBL 1NC2A 1KFGA 3CZFA 4F20A 5I8CA 2VDOB 4XVSH 1XGPB 1FDLH 3KGRA 4XB8A 4PJDE 2LV4A 2XPYA 4WEBH 3CFEB 2YMXL 1ZLVH 3TF7C 1JTOA 1UXWA 3FRPB 1IE5A 3UDWC 3VXMB 4PGCA 4WW2C 4BUHA 3OV6A 5EO9A 1KV3A 3DVNB 1U33A 4PFEA 2DMHA 5B1BB 5EC1A 5ANHA 5EU4B 3X3GH 3H54A 3UBGA 3EGDA 2DKSA 2Z0UA 4AC4A 4ZQKA 3C5JB 2FT8A 3WAKA 3H3KA 3IWVA 3QEQE 4NQDB 1B2WL 1JGEB 3ETBF 3IJHA 4AJWA 5I1LB 5JOFA 3GDCA 3P3TA 1JZ4A 3JTSA 1MCNA 1DDTA 1U8QA 4HJUA 3L3DB 1MW3A 2ICEA 5BUAA 1WWWX 4S0HA 3P77B 3IDNB 3VFOA 4HCGA 1UD3A 1QKZH 4XPGL 4YSDA 5DJ8A 5ILTL 1YYML 4G82A 3NJMA 4XRCA 3H85A 4P2QA 5IBLD 1G9NL 4GEJA 5AVUB 5LNGA 1WCBA 3LRHA 3L3OB 2V5YA 5EUOB 1P5VB 4LVHC 3PWNB 4Z7WB 1NBCA 4QY8A 1AQKH 2UXFA 2QQKL 3DNKA 4KJYA 3VWJB 5C0GA 3GHBH 1BAFL 3MJ7A 3NMEA 3MCLL 4NRZB 4AM0Q 1NUDA 3VXSA 2D31A 3HUJA 3KPLA 1UCBH 1MRCL 3HNSH 3TBCA 4IRZL 4NBZB 2AV7A 1MCJA 3G6DH 2LT9A 1PY4A 4V1DA 2H5UA 1ONQA 2FL5B 3OKKA 5FYLE 2V8MA 2K9UA 5I82A 1I3VA 1WBZB 4M1CD 4JJOA 2BC4A 3F8UB 5IM7A 3ZXAC 3SE9L 1IC0A 3US9A 4FC3E 4OZHB 1NA8A 1F97A 2WTOA 4KROB 1NFIB 4JFDA 4KKLC 3R8BB 4DOHE 5B3SB 2HFFA 2DZEA 4C58B 1ONQB 1L9NA 2FL5A 2XZAL 2R51A 3JTTA 2NCMA 1FNHA 3OKKB 1IGYB 4EI5A 2VUKA 3A6OA 4WSJA 3SKJH 1QO3A 3KBEA 3VH8B 4ZOBA 3DBSA 5HY9B 3MYZA 1JF1B 2EDMA 4PI0A 3Q8CA 3AADB 1TZGH 3JUYA 1PL3A 3HLAB 3ISWA 4LNRB 1J87A 4X6DE 3QXAB 3N0AA 2P7TB 3CZEA 3QIWA 2BSRB 3QW9A 4F37F 1TTUA 2JIXD 3NCCB 2VDMB 3HG4A 2B0SH 1TTAA 3GSNB 1GYWA 2B77A 1S5HA 4JHAH 4RMUA 4XC1L 4WI8A 1H5BA 3U46A 3ES6B 2OFQA 3GMMB 3HZKA 1GH7A 4F8QA 1A6AB 5I5JA 3VXSE 3X11A 2V7HA 4JMXA 2YUZA 4ES9A 1WQVT 4TRPH 4Z7QB 2X4RB 4ZX6A 5CJ5A 1PZBA 3TNNB 5GS1C 4EQ2A 2AK4D 4WFED 3EBAA 3T3ME 5IB4A 5DUML 3TEWA 3BWZA 4HC1H 3RZWA 5E4AA 4CADB 2YK1L 4KY1H 1TJHH 1C7TA 2XG5A 4JRXD 43CAB 1TZIB 1MAMH 3TCXA 3EXLA 4NKOB 3RIAF 2GQHA 2XG4B 4L4VD 4WI0B 2A2QT 1EEQA 4JDZB 3KPRB 4G5ZH 2A7BA 5ACZB 2YJQA 4YSCA 1MFNA 5HYSB 4OV5B 4EVNB 1C5BH 1I1FB 1FAIH 1U8OA 1WFOA 4GB9A 1E67A 4YUEL 2D3JA 1BFVH 3VFMA 4BE6A 2BVPA 2CO4A 2NY6D 1BWMA 4GAJL 1NANI 4ESKA 2EZ0D 3IXTA 5DJ0A 3KJ4B 1XF1A 3QJRB 3M45A 4JHBA 4OIIL 5C08D 3GSQA 3HS9A 1U8HB 4AL8C 1UYWL 4B97A 3QXAA 3VXQB 4G7VL 1SVBA 2WXNA 5E6RB 5CFAA 3LNHA 4PJCB 5DI8B 2JWYA 1DVTA 5IEHA 1THCA 3BHBA 3DHPA 2BOLA 1MCIA 1H3GA 1OTUC 4XT1C 3AWEA 2JCCE 3BAKA 2VW4A 1P4BH 5I1GL 3CNKA 2WWNA 4JPQA 3WJJC 3IS1X 1QBLL 2VDOL 5LBSH 1L9QA 1WIPA 3DUHA 1YNLH 3D39E 4XWOD 3FSVA 2A9DA 3TA3C 4DGUA 3LRSB 1DR9A 1CYGA 2WJ7A 4YHOL 2CXKA 3Q5OA 4O2FB 1ZV5A 3MGTA 2IAMD 3DMMC 1CDJA 1VGEH 3UAJA 3BPNC 4X98A 2E6JA 3RGVB 4P3DB 3X14A 1S9YA 3B9KB 4W81A 1Y6KR 2PWEA 4Q9CA 4JFDD 1WZAA 2JFCA 4QRFA 1KDIA 1L9PA 2F53B 2A74B 4OJYA 2CH8A 3WEOA 4PJ5B 1IM9A 3TS8A 3L81A 3S3BB 1J0ZA 5T1DH 2W07B 3HMXA 3VQMA 4JO3L 3UYPB 5D1XC 3SPGA 4D9LH 4APQA 3TIEB 1HCZA 1N67A 5AKTA 1YPZF 3CN2A 4U4BA 1KG0A 1MCPH 4LRNH 4YGAB 5KYUB 4IIQA 4LCCB 5T1LD 4NQEE 1JHLL 2XRAH 3UGEA 2X4PB 1T1XA 2UYLB 3HS0A 3TJEH 1CFMA 4AKPA 2ZCKL 3LPPA 2BVEA 5I9QB 2ITCB 3MLXH 4Q89A 5PAZA 1MQ8A 4A1RA 1RZ8B 1S3RA 3A5VA 3OB0H 5LGKA 1DQDH 3FS9A 4X8JB 4Y2DD 4F5CA 1XB6A 1CDCA 5JR1H 5AWNH 4QRUA 5L6YH 4NT6A 1I9IH 3IYLW 5E9NA 3NJHA 3MBEC 3VXSB 2BXYA 3ZE1B 3Q8BA 2WGXA 2EC8A 2V0AA 4AVKA 1FQ9C 3QUXD 5GQBA 3TVMB 5E9AA 4GS7C 1SHMA 1X3DA 2BDNL 4UTBH 3FTZA 3SGKA 4GT7A 4UNTA 5EO1B 3EXJA 1K3ZA 1VEMA 3QUZD 2RALA 2QKSA 2AW2A 5I0XA 1JHTA 2Z7WA 3V7AG 3L5XL 4NN7C 5SWZE 2F1EA 4IEFA 2AJVL 5CZVL 2VM9A 3PV6A 2XQBL 4RSVA 4E36A 2LTQB 2WUBL 1U21A 2YMXH 1U8KB 2ISDA 2EUVA 1KJ2L 1WO2A 1SLXA 5L9DH 2WKOF 3HRZB 1GJIA 4UM8A 4LSTH 5AKSA 3W38A 1J7VR 1HWWA 4JRYA 4UIMA 4PUBH 3DURB 4M8VA 2IEPA 4ZAKA 5D72H 4OZIA 1T3FA 2CMRH 2HMIC 2KPWA 4QHNB 4UZGA 1OM3L 1BECA 3SKOA 2WIMA 4PGCB 2KI6A 3FCBA 4DGYL 1IC4L 5DVLA 4AT6A 2KS0A 3CPUA 3OGCB 3QJXA 4D3CL 3KDMA 1J1XH 3S5YA 1EAQA 3GZQA 3TGXA 3VTTA 1YY8B 3IMSA 2WBJB 4IOIA 3ECBB 3EYSH 1Q8MA 1MCWM 1LTXA 1P69B 4DERA 2LAGB 4DEPC 4JE4B 4Y9BA 2FB4H 4QRRA 3ZW3A 1PG7X 2HFGH 2BHYA 1G0XA 3QDJA 1UD6A 2G60H 3QFJE 3U1QA 3L3JA 3GSXA 4HP5A 4PRAB 1G9EA 3L2LA 1DN0A 1HL8A 4YHNB 3OC8A 4F9PC 1F4YL 3H9SA 3U0TA 1YLBB 1CICC 4LVOB 4D7BA 1RZJC 4H1LB 1LK2B 4LL9A 3U48A 1NC4A 1A3LL 5E6IC 3FCTA 1UTDA 3O3AB 2H1LM 4JRXB 3QPKA 3RQ3A 5DS8A 1WC7A 3QXDA 2ZXAA 5I6XB 1U93B 4PGDA 5A7EA 5FO9B 5JHBA 2NY2B 3QQDB 3X3FL 3QUXB 3FFDB 4P5TA 4XNYH 5FS5A 3I02B 1FZMA 1MLBB 1S46A 1FNEA 1TYJA 3QA3B 1F1AA 2IPUK 3RKDD 1UENA 3BDXA 1BA9A 4FXLA 2Z4TA 4N22A 5AOKA 5CCJA 1VCBC 4N25A 5JXEA 5C08B 2CLVB 1VZIA 2UYLA 1KY7A 3HBQA 1BHGA 5KJRL 3L7EA 2DIJA 4MKTA 4ZJ9A 2IPKA 3OHXA 5CILL 4AQ1A 3FT4A 4CSPA 4QHMB 3O9WC 4X80L 3SDDD 2R56H 2BWIA 3NABH 4JCMA 2VW7A 5CS7A 3CFBB 4XP6H 2X09A 1A9EA 3P73A 4WLCA 1KTLB 2EIZB 5IBTL 2F8XC 1IILE 1TLKA 3P9LA 4X5WB 5DK0B 3IS0X 5E2WL 3VTAA 5C6TH 4I3RH 5C8JA 3MRKB 4WCYL 1MJ7L 2FX8L 3I6GA 5C0IA 1F6AA 1P7KB 4CW1B 2OYMA 3FUJA 4DGWC 4MS8C 3U1PA 2GITA 3PE9A 3HR5B 2VYRE 3BFOA 4GXUM 5E2TH 1S9YB 1GYCA 3QUHA 4UV4L 5LXGH 2YD8A 2HB0A 5I8EB 4JFFA 5GISH 5L88H 3ULSB 4IRSB 3MRHB 3LPWA 3IMWA 3O6FC 3CAFA 1AMXA 4WI4A 1MUJA 1IGYA 1H9VA 2CUMA 2NR6D 4NO2B 5IHZB 1BREA 1PLAA 3A22A 1V7NH 2YIHA 4BSJA 4U33A 4WI9A 1XF2B 4K3GA 4GKLA 4DHLA 3C60B 3H9HB 4UV4H 1DDHA 1XCQB 4KPHL 2ZOWA 2UVFA 2QHRH 1T89A 4KRNA 1IC1A 3W0WB 4YQXL 3PHAA 4X99B 1O7SA 2WXFA 4Y4FC 3VCLB 1RUQL 1JOIA 4OD3H 5D2LA 1FF5A 2F54B 2FUQA 1MJ7H 2VO8A 2X6BA 3B7UX 1YEFL 3CN0A 3ZIYA 4HIXH 1A9BB 1DANU 3CMGA 3W0WE 5C0DA 4CC4C 1ES0B 7CGTA 4JL1A 3MDJA 2E9WA 3D25A 3I6LE 4A7TA 4JQVA 2VLKB 4Q2ZB 2QPUA 3VXOB 4XXWC 1VFAA 3FAXA 3TO4A 2VDLB 3B6SA 2VL5A 5AOIA 1EWHA 3O3BA 4AGLA 5C97A 2VLLB 2OL3B 3ARFB 3E9TA 3ESUF 1GXEA 4ODVL 1EEZB 4WTZG 2ZZUT 1S6NA 1QABA 1KXVC 4ZFOL 3HI6H 1IJNA 4X98B 3ZKND 3ZTNH 3ORJA 2EDHA 4Y4KC 4DP2X 4OLXL 2CBMA 2CJTA 2O5YH 4FXKB 5DMIL 4O51A 4N2KA 3F04A 3FB6A 3UPRB 5KSBF 5I1GH 5JUEH 3BT2H 2JI1A 3LRSA 2K6ZA 4OZFA 1FCGA 5F7HA 4HIPA 4JKPL 4P04A 2VDKH 1GGCH 4WW2A 1QSVA 1ZKAA 5IBUG 4DFHA 4OB5H 4JL2A 4OT1H 4R2GB 5K5YA 2ZYHA 3FU3A 4Y4FB 4EUPH 4B95C 1W8EA 2I32A 3N50A 2YRZA 3VQ1C 3L9YA 2BY0A 5I0WA 1NGWA 1HZKA 4RBPH 3ISYA 5MERB 4PLJC 4B3VA 1EMTH 2DQHH 3C60C 4HWBA 3F7RA 5BV7B 1V55B 4YGVA 5I15L 4IMKC 1KZQA 3BVNA 4GXVL 1U8JB 3FUFA 4UANA 3LX9A 3CUPA 5GGSY 1NKRA 2X3AA 2CZNA 3NT0A 2J20A 2ESVE 1YUKB 3QC5X 2OMXB 4IIQC 2NY7H 1IARB 2C9VA 1U8IB 4XH2A 3QZBA 4H8UA 1WCQA 1XXDC 3PY9A 5D1XA 1ZVHA 3IETA 2VJ8A 3QI9D 2NUPA 3H7BB 4CDHA 3T0ED 2JQAA 4PRID 2NY3D 4QRTB 2WTRA 4TNGA 4U2ZA 3AY2A 1WVZA 2WXGA 5T5FL 2YK1H 4FNPA 1RUML 4NM8H 4TLUA 3UTPD 1SHXA 5HDRA 3D2TA 3EBGA 3KPPA 5K1JA 2JTYA 3CQPA 3MLVH 4HLZG 3LS5H 3I6KB 2NYZA 2XWCA 4L4TA 2Y36L 1QWHA 3KWTA 4JPVH 3V4VB 2HVKA 4D0DB 3S37X 4JRYD 3MGAA 4F7MB 4K3HA 3VWJD 5L6YL 1PYWB 1P53A 4ODSH 5HJBA 5AL0A 1YEGL 4UTAA 2VXTL 3ZKSD 1IBFA 1I75A 1RHHA 5L8JB 4U1GC 4BK5C 1XQ4A 4XOCA 3SOBL 1ASQA 3TP4A 1R3LB 3W2DL 3WN5C 3UTSE 1ZA3B 4GMSL 4OLWH 3TBVA 2DY2A 5AW1B 2AEWA 2PCYA 1WBYA 5AZ2H 3LD8B 4PGEB 4XCCH 4XMPH 2VAAA 1CMOA 1USZA 2A6DB 4PBXA 5I16A 2GJRA 4I9XA 5ICXB 4RIRB 3D69B 1ETZB 3PREA 4RGNC 3O2VH 4YK4B 2OR8A 5AVQB 4YDLB 3G5XA 4W9CC 3V0VB 1NBYA 2F8OA 3GBLA 1I7TA 4AQ1B 4WHYH 5DRWA 2E76C 3BAWA 3LV3A 5FO8A 2DWTA 3PAVA 5E8PB 1WH0A 1X5ZA 3PWPB 3MLSL 1O6VA 1I8LC 1TVBA 1NOFA 1UB6A 1NMAH 1WFNA 1NFKA 4C4KT 3ZGHA 4OVUA 3HE6A 5A2JH 2GW5A 2R23B 5FA4B 4HHAB 1MCPL 4LRNL 3RTQB 2WBWB 5MEND 2FSEB 2CIKB 2X2JA 1IT9H 4ZQTA 4XN8A 3FNKA 4URKA 5E08H 3L1EA 2CNZA 2GITB 4E41D 4RWYL 1S7RB 4UAOB 5DO2C 5I8CB 4L8CB 4KUCF 1QQDA 4XPFH 1IRAY 1QATA 3OKEB 1CLOH 4KZCA 4NI3A 5FFLA 1ZHLA 5D6DC 3IDGA 4FL4C 4PW4A 3NCJH 3RNQB 4K7FB 3TBWA 5H35B 3CMOL 3UOAB 3VTMA 1JZHA 4KMQA 3S0PA 3ZPDA 4N2NA 5J13C 5LAPA 3OKDB 5BZXA 1R3HA 3MRMA 1P7QD 1IFGA 3NFPB 3UP6A 1OSPH 4JB9L 4AIOA 4K7PH 3LEVL 4M62L 4X9YA 5KN5B 5F1IA 1G6VK 4XZ4A 4NN6B 4DZBA 3M88A 4HMDA 4FTDA 1KB5H 4NQDA 1M7XA 4S1QH 4G1EA 4UM9D 5AKRA 5ISZD 3LOWA 4K4KA 3WXWH 1YRKA 3JV6B 3CX5K 2HT3C 3D3VD 3U1SH 3V4PL 1IKFL 2YPLA 1ZT4A 1NGPL 3MZGB 1J1OH 2P8PB 2NX5B 4G8FB 4PWGA 1D3CA 1YY8A 4K9EL 5HI4C 5IROA 4EPSA 2FO4A 5IUSA 3WKMH 5KVGL 1SVZA 3PGCB 4YXHH 3MV7B 2ENJA 5CJBA 4AENA 3TVMC 3LPGA 1JPGB 5LG1A 5EZOH 1OSZA 4LLDB 4XOAA 5GS1B 5ITBL 1M3JA 4H8WC 4QJ3B 3RDTC 5AZ2L 2ZOLA 4UWQB 4XAKD 1R19A 4BK8A 4LLYA 3BUYA 3WV0A 2BJMH 4O02L 1ZLUK 4IRJB 2GSGB 3FFCD 3NRQA 4U1SA 4U7SA 4A6YL 1TJGL 1YQVL 1MCBA 4P4KA 1PAZA 3TBBA 4A68A 4ZOEA 1MFVA 5CINH 1KNOA 3TZVA 3QEGL 2P5EB 4NKDA 2ZUSA 3REWB 2VE6A 4H88L 3QIUC 3HAEG 3TBTA 4PJ9D 1EO8H 4YDIH 3AACA 2EINB 2XIIA 3L4TA 4G6KH 3U36A 3IRPX 1JGDB 1SUHA 4MA1B 3Q6FA 4UOW0 1Q9LB 4MNQE 2X10A 2Q76A 3LRMA 2FWSA 5HHPB 2X1XR 4PTTB 4RMQA 4WW1A 3FH8A 4HJ0D 2XXCB 2WXPA 2D03L 2V9TA 3L08A 5KW9H 4KROC 5D1XD 3WO4C 1JCVA 3W9DA 2Y1AA 4FXGA 4F37K 5J5EA 4OB5L 3FUDA 1ZT1B 5IY5B 4FULA 1VJSA 4O00A 4MXQC 1BVLA 2CDFA 2PTTA 3AU0A 1ADWA 4PS7A 5AUMB 3SKJL 3RDTB 1MW1A 3LYRA 5GRXG 2H6PA 5LWYH 1EO7A 4AOFA 3GJEA 5IHWA 1BZDA 3IDXL 3JV6A 2C3VB 2XWXA 1HAUA 4H4NA 3NOIA 3A6BL 3WFHB 3VO0A 3SKMA 2WSPA 3QDMD 1DLFH 1SUJA 2XSKA 2IH3B 1JWUB 3FPXA 5CLZA 5LGHL 1A6AA 2WWMD 2D3LA 3TESA 4OGQC 1RZKL 2P5WE 4KI5E 2K3HA 4M93B 5L2JB 3SGEH 3E0GA 2NY2D 1TZGL 4HF5L 1YAZA 1A2YA 1ILUA 4EI5D 3Q43A 3Q13A 4PJFA 4UQ9A 1VPOH 3B3IA 3UBHA 3ZTEA 2ZPKL 3QAZC 4UNUA 3S4SA 3MBWB 1URZA 2DEXX 5I28A 5FWQA 4FQ2L 4P2CG 5C0BB 4XCNA 3OMZA 2X1QA 5BVPL 1MCFA 3T8XB 1YEFH 2EE2A 2GBVA 3RU8L 3DTXB 4AC2A 4KVCL 2J88H 1XVSA 3HW7A 4KRPC 5DFTA 4MWFB 2AITA 3IPBA 1CYWA 2QDWA 1N64L 4KV5E 3QARA 2FK9A 3CLFL 4FTVB 4PY7A 5C70A 3MBXL 2YD0A 1KTDA 2OL3L 3GLZA 4X6DB 5HVHB 5JHLH 2UZIH 1SOSA 4B0MB 3GHBL 3UTPE 1INDL 3HS0B 3PWPA 3AT9A 4FNUA 5EEWA 3LPFA 1JAEA 1YEJL 2EZ0C 2PPFA 5EZJA 3LS4L 1IGML 3WFCL 1FHGA 1V7MH 2Q7AA 3OC5A 1KWGA 3FUIA 3C6SA 5KVFL 3PL6C 4OLZL 5FA3B 2F58L 2NY0B 3L3IB 1I1YB 3TWYA 3PWVB 3G5YA 1OOWA 3R7RA 3PWNA 3MV01 4ZZKA 1WS8A 2CKBH 1BXAA 1W80A 4AVJA 4ZOAA 3MRKA 2CJ3A 5GJSH 2J12B 3SQBA 3T6VA 3KW8A 2Z64C 3LS5L 4M1GL 2B4CL 1CIUA 2HT3D 5AB0A 5KSAB 3POCA 1TQBB 1ZA3A 1Z9SB 5E7FA 5F97E 5DDHB 3QCTH 1BMGA 3M86A 3P54A 1QUPA 2WBXA 3SDCC 2EXYC 3QISA 1UWGH 4NBXB 5IF0B 4Z77B 4ZUTA 3QI9A 2W1NA 4HFWB 4XN9A 2CLRB 1I1FA 1U8OB 2VXTH 4ISVB 1NZRA 4DP1X 3C6LA 3FL7A 2VL4A 3HKFA 4OGAD 3U6XA 4NRXB 2CDGA 2YPKB 5FKAB 3LQMA 1RZIA 4KH2A 4WNSA 2GPZA 3GNML 4YSOA 4IBWA 3EOAA 1MY7A 2NZ1A 1DQMH 5FLVA 3WN5A 5SWSD 2Y3AA 1NWPA 1ADQH 3VU1A 4X5XB 4B3EA 3HHMA 1XIWB 3BZ4A 4KJPC 3KNBB 2ZKWA 3OPZL 5I76A 4G6AC 3FN0L 2MCAA 2YD3A 2EYTA 3GT6A 2AEQH 2NUPB 3QDMA 1LHZA 3ARVA 2J71A 1H5BB 3NZHL 1IJ9A 4JN1L 4N2IA 1A4BA 1AGFA 1F3RB 2SODB 5TGBB 2MQ3A 4F8PA 3DVGB 3V4PA 2VDKL 2OXGB 2N56A 2G9HA 3L5JA 4JGNA 4KXBA 4Y7OC 5CZXD 4ZAKD 2HJLB 5JOPD 1ZVSB 3C6LC 1JWUA 5GJTH 3ULVL 3HI6L 2IC2A 3ZHDA 2VWEE 4EVNA 4KRPD 4RAUB 4POYA 4HGWA 1BVKB 3WSQL 1LEGB 4MTMA 1V3KA 1UOVA 4IBQA 1M6UA 4AGMA 4YC2B 2ALWA 3CZLA 1OB1A 2DEYX 4DN4L 2PWGA 3A6CL 2N01B 2A6IA 2AJ3A 3IMTA 4HBCL 3NZ8A 2WCSA 1U3JA 3Q1SH 4N2FA 4AT6B 5LGYA 2K8QA 1CXLA 1KY6A 1SNRA 4YXLH 1CGUA 3RY6C 1QR1B 4X4KA 1TQTA 2ZP0T 2PPDA 3SDXA 3EO9L 4MNHB 1U91A 2VDMH 5KWYC 4WHTA 5F6HI 1FBIH 1SDDA 4DCQB 4ZAKB 2PYEB 2V2XA 4ECNA 3S34H 1I8UA 1AS6A 3ES6A 3V6BR 3FSOA 3O9WD 1I8IB 1QBAA 1TETH 2N0MA 3N1QC 4NGHL 1XR9A 3LHPL 1E4JA 3JQOB 3O3BB 3CFJB 4QCIB 5F7DA 2BVTA 4HETA 1AGBB 3RKDC 5EIIG 4ZFFB 4KXZH 2FHBA 5C0BD 3U2SA 1TNMA 3V0AC 3D6GA 1MCOH 3EJCA 9PCYA 1I7ZB 3HC4H 1TMQA 4MJ2A 3WY3A 4Z3EA 1W8OA 5FYJH 2J1XA 1RK7A 4LLYB 4NZRL 5EH1A 1KT2B 3CZUB 2EECA 1PKQA 2QTEA 1MN4A 4LSTL 5J3HC 3BPCA 3P69A 3ERXA 4PG9A 5HDWA 5AEAA 3FQRB 3D2UA 4PBWD 4RVBA 4DPBX 1LO3H 4ZFZA 2AGJL 2WUBH 4U2YA 1AHKA 3N40F 2A73A 4UMSA 4XP5H 1XF2A 3T65A 3X2QB 1PY0A 3LS4H 3II3A 5GGSA 4PRBB 1ZTXL 4OAWA 5B8CA 3D05A 1XGPA 1A4KB 1COBA 1R6VA 4A7GA 3C5SA 4J3OF 4QHLB 3CLFH 2VDQB 3RDTD 3HUJE 5AB2A 1R9FA 3PAUA 3QS3A 4LCCA 5CGYC 5D96C 5E4EC 1IVTA 3TH2T 4ZSOE 4UQDA 1OAXH 2NTSP 4EZLA 4H0HB 4XTRD 4J6RL 2WLHA 5TE7L 2VR8A 5IMOA 3RDJA 5BVPH 5I30L 5KZCB 1NPJA 3QJFA 2PF6A 2R27A 2P48B 3KPSE 4Y5YA 4YSTA 1HXMA 1RZPA 5D9SA 3VD5A 2VC2H 4FFTA 4YDKH 4HIEA 1RY7B 4PJHB 4XN5A 2ARJA 2OULB 3T2NL 2LOEA 2ICWA 5C6WH 2J73A 4FKHA 5E94A 2FGWH 3TT3H 2AV1A 2RACA 5KAQF 5IG7B 3DX7B 4X9HA 4IDJH 4L9DA 5JDSA 1Q0EA 3LHPH 1NCNA 4HUUA 5LGHH 2LVEA 3WS6C 1I53A 3GXTA 4ELDA 2HAZA 3S34L 4CBPA 1XSKA 2L7UA 2Y9RT 4JO3H 1T0NA 2ESVB 4X4XA 5K39B 3HIZA 3R18A 5L4MA 4F33B 4D0BA 3T0DA 3HI1B 2AXGA 4XTRC 4O4YH 2VM4A 1BLNA 1EA9C 4R4ND 4TNEA 4CKVX 1E9PA 3N44F 1PTZA 1TKWB 1KBBA 1MCSA 2AMGA 3VG0H 3MJ8B 2DYPD 4NJ9H 5C08E 5FV2A 3BKYL 3DROB 4D3CH 5KW9L 5DO2D 3P2TA 1XH3A 3ZHNA 4E0RB 4QXTB 4PJ6A 5HDBE 4BIKA 4FJ6A 4YHOH 3K6DA 3KXFA 2VOTA 5I16B 1NDMB 4HV8A 5AYQA 3THMH 2IV9A 2IAMB 4PD4K 4FG0A 1T6BX 1UJTA 4IKKA 3U9UB 4RMVA 1E9OB 2B15A 3ZKXC 2ZUUA 1ZT7A 4ELMF 4HEME 4Y5XA 3G04A 4J4PD 1MI5E 1NBZA 3AQZA 3O4LA 4FFZA 3N43B 3VSQA 2GSIB 4E5XB 5HYSG 2ZX6A 1N68A 2B39A 1P4IL 1VFOA 4MJJA 2O4EA 3SGDH 2FZ3A 3KW7A 4R4BA 4L3FA 1CDHA 3QUYB 4XNZB 4G5ZL 1I9RH 5KS9B 4FQJH 4HJEA 8PAZA 4HJGB 4OLYL 3HPLB 3O0RL 2AJZB 5AZEL 4YXKL 1EO5A 3OKOA 4S1RL 5TDOB 3TOPA 3ARED 5EN3A 4XXCC 1OAKH 1QSEE 3N44B 3W56A 3AGWA 5LKNA 4MJ6B 4I1NB 1PLGL 1OTSC 3H7LA 3LZRA 1RJLB 4KGJA 1CQKA 2X4RA 1LQBC 3HRZA 5EUOF 1BEXA 3WKML 3V4VL 3CIAA 4ICXA 2AXJA 1KJ2H 1YY9D 4ENZA 2DQGH 5A2IH 3SE6A 3K3QA 3SYOA 2R1XB 1UWGL 4CC4A 2PETA 3MJ9A 3B1UA 3L5XH 3PJLA 2ZNWA 3VFGH 1PW3A 4GSDL 4JDVA 1X44A 1M1SA 2RFXA 3QSKB 4H8VA 2AQPA 4MD4B 1KTKE 3AITA 4YGVB 4GQZA 4BGDA 2OI9B 3JVFC 2WIIB 1KGCD 1LO5A 3E9UA 1LEIA 4N28A 3WAJA 4MB5A 4APQD 3RVVD 4IU3A 4PG2A 1RIHH 1UWEH 1FSKB 5ESAB 4LSSL 5DSCB 2NNAA 3QVAA 3GI9H 4RWYH 5F0PB 4AQOA 2H45A 5I75C 5TH2A 4NZUL 4UM9B 2E6QA 3MRLB 3N1PC 1INDH 2MPVA 2TSAA 5JHLA 1Y7VA 3FU8A 3G5VB 3CFNA 4JZOB 3LIUA 3OSVA 3BGFC 2F7PA 3HR5A 3IDMB 2WLZA 3N41B 3DHUA 2A6JA 5BJTA 5DFAA 4LMQE 4RQQB 2CHW<