1R1VA

Crystal structure of the metal-sensing transcriptional repressor czra from staphylococcus aureus in the zn2-form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A metal-ligand-mediated intersubunit allosteric switch in related SmtB/ArsR zinc sensor proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription repressor
molecule keywords repressor protein
total genus 34
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r1vA00
3LQRA 5HS7A 1T0FA 1DUXC 1YTYA 1OYWA 2H09A 4ZYGA 3EYYA 3BJAA 4TV7A 2EK5A 2HKXA 1B59A 1BI0A 3R60A 5LHGA 1O3QA 1IUYA 4OIRF 2HR3A 4RAZA 4PCQA 3KFWX 3D5LA 3HRTA 2HYGD 2VONA 3DV8A 3T8TA 5F1RA 4KNYA 1TQIA 2P7VB 2A6EF 2HGCA 4K2EA 2P5VA 2IPQX 3C18A 4DNCA 2P5LC 1OR7A 2GIVA 4G7ZF 2O61A 2FU4A 3SQNA 4GXOA 1FY7A 1B4AA 4WX9A 2EFWA 1WWXA 2YR2A 4EJTA 3QRFF 2DK8A 3JTHA 2A69F 2EFNA 4YG2F 3I0TA 4BHBA 5K5OA 1R1UA 2UWMA 2CWEA 1UHWA 2XAQA 1SD7A 4HZFA 3WGHA 2FQ3A 4I0BA 1OMIA 5ED4A 2FSWA 4ON0A 2PMHA 2H94A 4ESJA 1HSJA 1IW7F 2EFQA 3OV8A 4L5JA 3IRRA 1O7LA 4HLXA 2MA3A 4EQQA 2DT5A 5E20A 3RPUA 3L09A 2EB7A 3HRMA 1PP8F 4Y13A 4HF1A 3W6JB 3F8CA 2J5PA 3KCCA 5FGMA 4P9FA 2CGPA 5E1WA 4ETSA 4EV0A 2FBIA 1T38A 4MGRA 2Z5UA 3U9GA 1RIOH 4XSZF 3K69A 3WTUC 2VT3A 1YLFA 4M6XA 4N9HA 2KJBA 4BXUA 2XKPA 2DPUA 5EEGA 1Z91A 5JI6A 1D8JA 3RKXA 5HLIA 1IZ1A 1P4WA 1U3EM 5FFZA 2FMYA 4M72A 4MEYF 2LNBA 3G3ZA 1SD4A 2EA2A 4S05A 3EQLF 3I64A 4MQ9F 3CO6C 1FT9A 5CVJA 3JSPA 2EFOA 3TO9A 3L2CA 1ZARA 2ACJA 3WTVC 2R3SA 1USTA 4UNOA 3ZMUA 2BBYA 3FM3A 2HQNA 3FMQA 4MTDA 5K1YA 1K79A 2V79A 2JPCA 3BZ6A 5J8FA 5K5RA 1XMKA 4LK0F 2VC1A 1J2XA 2FF4A 1YG2A 2PFBA 4NHJA 3PFIA 3F3XA 3T1BA 3HSRA 4XLNF 4HQEA 1WKMA 4IVNA 4PGGA 1BC7C 3V7CA 5ICGA 4EJVA 2H27A 2DLLA 1LVAA 2STTA 3NRVA 1MJAA 4UVAA 2NNYA 3I58A 4Z2YA 2XRNA 5D4RA 3F6VA 3E6BA 4JBAA 5JFRA 1FC3A 2W57A 3ZN1A 1XGNA 1HQCA 3FM5A 5CYVA 3BP8A 1FOKA 3I4PA 1BIAA 2JZYA 4UXNA 2IRFG 1T39A 3ZMZA 2G7UA 2DK5A 3T5XA 4R8HA 1ZLKA 2HEOA 4IHSA 2O6GE 4HOBA 1R23A 2W84A 2Q0OA 2DTRA 4LJZF 4QLCU 2FNAA 1C0WA 1FBQA 1SFXA 4BAYA 3R4KA 3BJOA 4L18B 1ONVA 4JQFA 3ZPLA 4UVCA 4L9VA 4Q48A 4CDGA 5J6XA 4UV9A 4EM2A 1ULYA 1MZBA 5DD4A 2FNPA 4GYGA 1W5TA 3RKYA 2LKPA 3IKVA 3L00A 5TJJA 3HOSA 1FYMA 3MQ0A 1HKSA 2FMLA 3U1DA 2IJLA 3U2RA 4DQ2A 4IRGA 4ZYEA 2V1UA 4BHPA 4O6JA 2P5KA 4HDUA 3K1PA 3MZHA 3GYHX 4IRHA 5IT3A 1ZHFA 1PUEE 2Y48A 1TQMA 3CUQC 1G3YA 3FF5A 1DPRA 2GA1A 5L3EA 4ENMA 5FO5A 4IRIA 1SAXA 5LEJA 3R0JA 1O3RA 1QGPA 3BWGA 2QWWA 4L0ZB 2C6YA 1IN8A 4IHTA 2J5OA 1KU7A 2QQ9A 1FYLA 4B8XA 2MD5A 4L9TA 5BPDA 2RGVA 1BN5A 2KIFA 4L0YB 1GXPA 5HS9A 1YO5C 5HLHA 5BPIA 4A5NA 2Q2EA 3E6CC 3K1MA 2XAJA 3GFLA 2RVCA 2FXAA 3TDZC 1BIBA 2QQBA 2LSOA 5HDNA 1OYIA 1TBXA 1B9MA 1LNWA 2Y75A 3E97A 2CSOA 4RGUA 2LF7A 4LD5A 4R1HA 2QBYB 4LK1F 5HDKA 4XLPF 5DCMB 4LFUA 3VEPA 3WTSC 4KA4A 1G3TA 1KU9A 3HHHA 2HKOA 4QWQA 4ESBA 2DW4A 1BI3A 3TDUC 1HW1A 2CYYA 4ENNA 2O8XA 3GF2A 5BMZA 1ZAOA 2OZ6A 1R1TA 1MGTA 1EH7A 4U88A 2DBBA 5LGUA 3WGIA 3HOTA 1KU2A 3IL2A 3J80Z 5L3GA 1BC8C 1RZ4A 4RB2C 5DD8A 1P4XA 3JW4A 2EJRA 2M87A 1MD0A 1KYZA 1JHFA 4D0PA 4YFKF 4CO8A 2M30A 1Z6TA 1R1VA 5E18F 3MEXA 4G6QA 3R6SA 4EGYA 4HDVA 2H6CA 3QP5A 3M1EA 2JTVA 2OA4A 4YIFA 2G9WA 4N0BA 2ZNZA 3DXJF 2ZXJA 5J8CA 2FOKA 1BBYA 3KP7A 4XSXF 2L4MA 1QO0D 2YSRA 1QZYA 2KRFA 3I59B 4IPAA 3J81Z 3TOBA 1KQ9A 3OOPA 3HTSB 4Q4ZF 5FLXZ 4U0YA 2A3SA 2JT1A 4FX4A 3IWZA 1Y0UA 2VXZA 2EWNA 3FMRA 1QPMA 2RKHA 4OIQF 1HKTA 4GO1A 2OQGA 4LB6B 4GYIA 1Z9CA 2A6HF 2Z9OA 2UXXA 1CF7A 2L3DA 1SMTA 1R36A 1AWCA 2XUBA 3I59A 4MQVA 5E17F 2QYOA 1JXSA 3ISPA 3LAPA 3LQQA 1JGSA 1JE8A 3KP5A 4AIHA 3WTWC 1KGSA 3QP6A 1IN6A 4A5MA 2HTJA 4HX7A 3VODA 1PP7U 1HKQA 5F64A 5D8KB 4WXHA 1O3SA 3REOA 5HS8A 2ZJ2A 4RB1A 2Z99A 3KZYA 2OU2A 3LAJA 2VT2A 5D8LB 2E7WA 3O3KA 1T6SA 4AIJA 1U5TC 3FXRA 3BJ6A 4KIGA 1J0RA 2YU3A 1XDSA 4RB3C 1OPCA 2WV0A 4ASNA 1WSUA 4MTEA 5KK1A 1K7AA 2W24A 4WWCA 5CVVA 4M73A 1FLIA 5LRRA 3ZN0A 4I98B 2DFIA 3TGNA 5D5WB 1FZPB 2E1NA 5IT9K 2A61A 2FBHA 3WTXC 2EA4A 4HW0A 3H3UA 1MKMA 5L3CA 2XV4S 1H9GA 2EV0A 2GA2A 4LLNA 3ZP5A 3TQNA 2XROA 2QZ8A 3E5UA 1NHAA 3ULQB 3EUHA 3GX4X 2EV6A 1V4RA 2PBIA 1LDKB 3HYIA 1W4MA 4U0VA 4AWXB 2PN6A 4OMZA 1ZREA 2EFPA 5JR3A 1ZGJA 4P96A 2VE9A 3SHFA 1Z6RA 2ADUA 4HQMA 4ESFA 4L9NA 3FXUA 1YYVA 4E70A 2W85A 3COAC 4PZJA 3KETA 4WXCA 4RGRA 3BPXA 3LA7A 4P9UA 4CZZA 1IAWA 4ENJA 2P7CB 1V3FA 2B0LA 2HYFA 2F5EA 1I27A 4YFXF 3V7RA 5DCMA 5KVRA 4OIPF 4G7HF 1R7JA 1RI7A 3B73A 1G6NA 1FBUA 4A2UA 1F9NA 1ZLJA 2V6CA 5D5XB 4I02A 2K4BA 2HDCA 3F23A 2PQ8A 1H0MA 4HV6A 3DF8A 1U5TB 1B1BA 3S2WA 1UCRA 4ZZLA 1XGOA 3RKWA 2RDPA 2LF8A 4XBFA 1XGMA 3NQOA 5DDGA 2NYXA 2QLZA 1TLHB 1ZG5A 2E7XA 4EM1A 3F6OA 2RNJA 3JAMK 3DFGA 4OOIA 6PAXA 1O7FA 4RGXA 4HF2A 2R7DA 3BDDA 4Q47A 1OYYA 2ESHA 5JHUA 1E17A 4A0XA 5HLGA 4KIBA 5LHIA 3ABTA 1MJBA 3I5UA 1YFHA 3LA2A 3V8LA 3M7GA 2DI3A 3HSFA 5L3BA 2P4WA 1FBSA 3SZPA 5E1XA 3ECOA 2MLGA 3WTTC 1ZG1A 2UXNA 2M1BA 4M9ZA 1S29A 4RAYA 5DV5A 4LG0B 3MCZA 1GHCA 4KIFA 2RN7A 2YX7A 3HHGA 2BE5F 3RI4A 3ABUA 3LWFA 2VBWA 4LLGF 2BYVE 1EH6A 4HV5A 4WK8F 2ZKZA 2HZTA 1P92A 3KEQA 3N97A 1TTYA 3DQVC 1R5GA 2X4HA 1HW5A 2KKOA 1SFEA 3ELKA 2MC3A 4I0AA 1Z1DA 1USSA 2F5CA 2QVOA 4HAMA 2HFHA 2K4JA 4KYWA 2QQAA 3IRQA 3GLXA 3VB2A 5LRSA 1QZZA 5LGNA 2K7LA 4F7ZA 1L3LA 2XAHA 1IXCA 1EV7A 2ZO4A 5BS6A 1YW8A 1MJ9A 1YS6A 1KQ8A 3E5QA 5H20A 3IHUA 1XB4A 1XMAA 4PDKA 5L3FA 3J80K 2ESNA 1XN7A 4BHCA 2DO7A 1YIOA 3L9FA 2OQRA 4KMUX 5BOXA 1P2FA 3KEOA 2H6BA 3SFZA 3QOPA 3E5XA 1F5TA 5F6FA 1H9TA 1VTNC 1CF7B 3O2PE 3JTGA 1T2KA 3WG9A 1X3UA 4LMYA 1EH8A 2D1HA 4YFNF 3RDIA 3GW2A 4OINF 3FX3A 3FHZA 5E8GA 1IN7A 1F4KA 5LBQA 2Z3YA 2IT0A 1BI2A 4WXDA 3TKYA 3I54A 2L01A 1TW3A 2F5FA 4HLYA 4O3MA 2MH2A 4LLLA 4ZYDA 1WQ2A 3WU0A 1WI9A 2EV5A 3GXOA 4I01A 4UV8A 5DEQA 1IXSB 1RNLA 1Z05A 2G7HA 4WCGA 5TRDA 4A0YA 2CW0F 1B9NA 2P6TA 2DQRA 1XCVA 4ZZDA 3PQKA 4Y17A 1ZG3A 2K86A 4MEXF 3R61A 4FX0A 2BEOA 1FYKA 4RB0A 3MFKA 3ERED 1O57A 2CQKA 3F22A 2IW5A 2Y0MA 4EVIA 3BOQA 3RPQA 3CO7C 2VBYA 5H6RA 4R79A 3TOAA 2QUFA 1LJ9A 5DUIA 5DUKA 1T98A 4IF4A 2YPRA 4PGHA 3KLNA 3QPTA 1XSDA 2QBYA 3G73A 2JSCA 3FMSA 4AVPA 5E1ZB 4BNCA 2MBFA 1IRFA 1QQIA 1TNSA 2GQQA 2FBKA 4B09A 1QBJA 1GVJA 3DPLC 2AS5F 3H92A 1U78A 2X0LA 5CLSA 1R58A 4NQWA 3KP3A 1UB9A 2FA5A 5A2QZ 5HDGA 4GCVA 4CGZA 1I6XA 2IVMA 2XASA 2PEXA 1KYWA 1U6GA 3F8FA 1LQ1A 3DPTA 2QM3A 2K27A 2VBZA 1S3JA 3E3VA 2VE8A 5IT9Z 4HX8A 1J7KA 3BPVA 2F2EA 2XIGA 2PI0A 5AIQA 2VC0A 3QU6A 4UUVA 5ERIA 3RYRA 2KJCA 3GWZA 1SD5A 4EJUA 4HF0A 3EETA 1XD7A 3B02A 3GUDA 4CYDA 4I09A 1IN4A 1HBXG 4L9JA 4S04A 1D5VA 2XGXA 2RQPA 2D45A 2HTSA 5D6FA 4ZH4F 1D3YA 1I1SA 2YX4A 1RUNA 2FRHA 3HSEA 5ICEA 1FSHA 2M5WA 2CG4A 4CHUA 5EEHA 2R7FA 2XAFA 3HRSA 4WF2A 4G7OF 3PQJA 2HQRA 3LFKA 4MHGA 5ICCA 1ZRCA 2WWYA 2E1CA 2NNNA 1S6LA 3WE3A 1KU3A 4P5OA 1IN5A 3K9TA 1GXQA 3ZQ7A 3Q5FA 1FP1D 2Q8KA 2VOPA 3I53A 3KLOA 3LSTA 4AD9A 4EMSA 4HBLA 4CXFA 1MDMB 3M8FA 2M8EA 1XSXA 4HA8A 3MAJA 1YW9A 3CUOA 1ON2A 3IWFA 1LDJA 3SZTA 2ISYA 2ZNYA 4A12A 1IRGA 4IXAA 1W5SA 4M9XA 1A04A 4M6YA 3NEUA 2ZMEA 2MH9A 2OD5A 2Z33A 1W7PA 3H3ZA 2GAUA 2KIUA 2HS5A 5ICFA 2D2WA 4HYEA 1LB2A 2ZCWA 2O03A 1K6OA 3HUGA 4U7DA 4U7BA 1YQAA 3D0SA 2HWVA 3JAMZ 2V9VA 5HOOA 2D1VA 4BH9A 1XSVA 4UHTA 4G94A 3AAFA 3GEZA 2P8TA 3K0LA 3K1NA 3MZYA 5FFXA 2L54A 4Q5SF 5CJ9A 1BM9A 3J81K 1AOYA 4I7HA 3HIFA 1SFUA 1W7PB 1LEBA 1Q1HA 2A68F 4HX4A 3RTRA 5D5VB 2L02A 3RJPA 5LHHA 1TW2A 4N9IA 2LDUA 3I71A 4G6DA 5HVQC 2DU9A 3K2ZA 4EJOA 4U0WA 2K02A 1U8RA 2RV8A 4FT8A 4M71A 2IA2A 1BOAA 1YS7A 1O3TA 4JK1X 4LG0A 3V7SA 4OU0A 3P9IA 4NB5A 1DPUA 3E6MA 4CICA 1R00A 5L3DA 2XAGA 2COMA 1ZN2A 2ETHA 2WTEA 1CGPA 2GXGA 1XDUA 3GFIA 1D8KA 1R5HA 2PG4A 1G3SA 4EJWA 3C3WA 5LLQA 3ML6A 3N4MA 3MWMA 4ENKA 2L4AA 2IA0A 1S8NA 2OAZA 3BY6A 3KP6A 1Z7UA 1FPQA 1LDDA 4MNUA 2XHKA 2ZMEB 5ILVA 5FD6A 3IC7A 2ZBKA 1FNNA 4UVBA 3QPHA 1G4DA 1ZRFA 3WGGA 1HSTA 2CFXA 3L7WA 5DYMA 4OIOF 3R0AA 3KP2A 3LA3A 3C7JA 2WC2A 3CTAA 4Y15A 1QNTA 1SMYF 1XCBA 2A5YB 1DP7P 2CO5A 3P7NA 3IKTA 3WODF 3EDPA 2IP2A 1I1GA 5AIPA 1S7AA 2M45A 4BQAA 3WTZA 2PJPA 1SD6A 4A0ZA 1K78A 3ECHA 4M74A 4GGGA 3EYIA 3HRUA 3F8MA 1KQ0A 3GZ5A 1WRJA 2UZKA 5LEKA 1IXRC 5CVIA 4KN7X 3RYPA 2DPDA 5H6QA 3F21A 1XGSA 4EM0B 5BQTA 3E6DA 1JHHA 3SXYA 1E2XA 2GXBA 1I5ZA 1FWZA 2OBPA 3CUQA 3JSOA 3ZMSA 5K5QA 3P9KA 3CUQB 2O0YA 1J59A 4EGZA 4IJAA 1TNTA 3FWEA 2RC4A 2BV6A 2V1XA 2W25A 2GZWA 3GZ6A 2FE3A 4KUMA 1IF1A 1J9IA 4ZYHA 2DAOA 3ROUA 2QENA 1ZRDA 1REPC 5FD5A 5AONA 3C1DA 3DEUA 4L5IA 2O3FA 2FEZA 4LGWA 3GO5A 3V8KA 4AIKA 1B6AA 1KA8A 2JPBA 4KMFA 5D4SA 3F72A 1P6RA 3TO7A 5CVRA 1LEAA 3T0YA 4BYYA 4A6EA 3FXQA 5FB2A 3T8RA 2GWRA 3Q9VA 4M9SA 3GVAA 2ISZA 1J5YA 2JRTA 2OZUA 1G3WA 2BGCA 1FP2A 4KICA 1UHMA 4RGSA 5D5UB 3QAHA 3GFMA 3ZMTA 1ZYRF 2VBXA 1HXDA 1R22A 3VFZA 3FZVA 1DDNA 1U2WA 1RUOA 3KZZA 1U5TA 4RS8A 4LB5A 5A2QK 2ELHA 1STZA 1BI1A 3CJNA 4OMYA 4I2OA 2F5DA 1HW2A 3HTUA 2NAZA 2HOEA 3ZMDA 1J75A 3M9AA 5CVUA 4KT5C 2NRAC 4H0EA 1ON1A 2P6SA 3M8EA 3CDHA 2PLYA 1BJAA 5ILUA 1OKRA 2TDXA 2VN2A 3J7AO 2KIMA 1W7PD 1ODDA 3BROA 4P55A 3ZMVA 3V4GA 3WU1B 4FHTA 1PDNC 1MDMA 2ZFWA 5FLXK 2DQLA 3KP4A 1FSEA 4KDPA 5D6EA 3TO6A 1TQPA 3F8NA 4G9YA 3Q9SA 4YIIA 4O5VA 3GFJA 3DKWA 4A6DA 1P4AA 1ZGAA 1YW7A 3CLOA 2STWA 2A07F 3V8JA 3RIRA 2MLKA 3O6BB 1K78B 3WTYC 5DCFA 2VODA 4KN4X 2AXLA 2IA1A 1UFMA 2PMUA 1S7OA 5JVTA 5ILSA 3P9CA 2XKOA 3QU3A 3W6KB 2NS0A 3VOEA 4KFCA 3F8BA 5E8IA 2XVCA 3DP7A 2V1DA 3WE2A 3KE2A 2VOOA 1L0OC 5LGTA 1FX7A 4XRFA 4G8XA 1ZH5A 1F1ZA
chains in the Genus database with same CATH superfamily
2X6YA 2VJIA 2CU7A 3LQRA 3W2VA 5HS7A 2JA8J 1ITYA 1T0FA 1DUXC 4NC8A 5GAHJ 1YTYA 1OYWA 2H09A 3F9KA 4ZYGA 3TBIA 2DFFA 1X1AA 3W6VA 2HNHA 3EYYA 3BJAA 4TV7A 4BY7J 4PSWA 1VI0A 2EK5A 4E7HA 2HKXA 1B59A 2X6WA 1BI0A 3R60A 5LHGA 1O3QA 4A3LJ 2VJJA 3I9V2 1OR7C 1IUYA 3ONQA 2HR3A 1MBFA 4OIRF 4RAZA 1GDTA 1ETYA 4ZTJA 3TW6A 1T33A 4PCQA 2OV7A 2ZJPF 2HVQA 3KFWX 3D5LA 3HRTA 1OJLA 4CH7A 5EEAA 1R49A 2HYGD 3MVPA 5F27A 2VONA 3DV8A 4PJNA 3T8TA 5F1RA 4KNYA 5DTDA 3BTLA 1H8AC 2DT7B 3NAUA 1UMQA 3B6CA 2KISA 1IDYA 1TQIA 2VLAA 2P7VB 2A6EF 3GTGJ 2HGCA 4BXXJ 4K2EA 1M1EB 2P5VA 2IPQX 3C18A 4HG2A 4ITVA 4DNCA 2P5LC 3JRCA 1OR7A 4XNFA 2GIVA 1S9HA 4G7ZF 2O61A 2M4GA 2OCEA 2FU4A 1UG2A 2QQ8A 1J09A 3SQNA 2B63J 1QHGA 4GXOA 1HOMA 3VSKA 3M3YJ 3S1MJ 1FY7A 1B4AA 4WX9A 1ERDA 2EFWA 1WWXA 3OIPA 2YR2A 4XRSG 4EJTA 2M3AA 4E7ZA 3QRFF 2DK8A 1WJBA 3JTHA 2A69F 2LVSA 1T0FC 2I8DA 2EFNA 2XF7A 1E3HA 4YG2F 1JKRC 1GV5A 1U0JA 3I0TA 4LG3A 4BHBA 5K5OA 1A6IA 2XGCA 4J19A 2WA0A 2JJ7A 1QVUA 1R1UA 3H0GJ 3K4MA 2UWMA 2EZHA 2E2HJ 3SZGA 2CWEA 1UHWA 2XAQA 1SD7A 4HZFA 3WGHA 3RZDJ 1ETOA 1YJ9I 2FQ3A 4I0BA 3OS2A 3V42A 1OMIA 5ED4A 4ZC3A 1DU6A 4C2TA 2FSWA 4ON0A 3RQ4A 1K4SA 3L2WA 2PMHA 2H94A 4ESJA 1HSJA 1OQYA 1WFXA 3G71I 1HF0A 4UUTA 2L2OA 1IW7F 2EFQA 3OV8A 4L5JA 4JX5A 3IRRA 1O7LA 2R7QA 4HLXA 4MLOA 2ME6A 1TT5B 2MA3A 3BCBA 4EQQA 4E7KA 2DT5A 4U87A 1VQNI 5E20A 1SEUA 2VI6A 3RPUA 3L09A 2EB7A 4QPQA 3HRMA 2V9KA 5IP6A 1WPKA 4XK4A 1VQKI 1PP8F 4Y13A 4HF1A 3CCEI 3W6JB 3F8CA 5M5XJ 2J5PA 3KPHA 3KCCA 5FGMA 4A3KJ 4RAFA 3ABKH 4P9FA 2CGPA 5E1WA 4ETSA 4EV0A 2FBIA 4IOAF 1T38A 2H8RA 1IG7A 4MGRA 4HSTA 3RSNA 2Z5UA 3U9GA 2JN6A 1RIOH 3NWSA 4XSZF 3K69A 3Q0WA 3WTUC 2JRMA 1YLFA 2VT3A 4M6XA 4IL6C 1JKQC 4N9HA 2KJBA 4OAYA 4BXUA 2XKPA 5GTHC 2DPUA 5EEGA 1Z91A 3FXKA 4ABZA 2D5VA 2IGOA 3OMYA 4A69C 5JI6A 1D8JA 3PNTA 2JA5J 3RKXA 4HSRA 5HLIA 1IO2A 1IZ1A 1P4WA 1U3EM 3H36A 5FFZA 2R7UA 2FMYA 4M72A 4MEYF 2DA4A 2LNBA 3G3ZA 3DTEA 1SD4A 2R5ZB 2EA2A 4S05A 3EQLF 3S8PA 3I64A 3ZQCA 4MQ9F 3H9JA 3CO6C 1FT9A 4IOCF 5CVJA 3JSPA 2EFOA 3TO9A 3L2CA 1ZARA 3LSKA 2ACJA 3WTVC 2R3SA 2K3FA 2MD0A 1USTA 4UNOA 2EZLA 3ZMUA 1QRYA 2BBYA 1FTZA 5M5YJ 3FM3A 2HQNA 3FMQA 4MFEA 4BEHB 1T95A 4MTDA 5K1YA 1K79A 2V79A 2JPCA 3BZ6A 4D5FA 1OCRH 5J8FA 3IAM2 3DEEA 4PUSA 3VYTB 5K5RA 1XMKA 2DJIA 4LK0F 1SVLA 4CYCB 2VC1A 1J2XA 2FF4A 1YG2A 2PFBA 4GRIA 2E60A 4NHJA 3PFIA 3F3XA 4NC6A 4XOPA 4C3IJ 3VSLA 4M6VA 3T1BA 3HSRA 4XLNF 4HNTA 4RM2A 4HQEA 2P81A 1WKMA 4IVNA 4PGGA 1G59A 2ZSIB 3V7CA 1BC7C 2K5CA 2G0EA 5ICGA 3CF2A 4EJVA 2H27A 1OCOH 4LOCA 3BR3A 2DLLA 1LVAA 3A01A 2STTA 1ZGWA 3NRVA 1MJAA 4UVAA 3PNYA 2NNYA 1MW7A 2FUG2 3I58A 4Z2YA 3HL2A 4J00A 2E2JJ 2VPRA 1XC5A 2XRNA 5D4RA 3F6VA 3E6BA 4JBAA 3OR1C 2WAQN 3ZQLA 3FISA 5JFRA 1UAAA 2DMQA 5FRNA 1FC3A 2DDAA 2X1EA 1AU7A 3S3NA 1D0ZA 2W57A 3CLQA 3ZN1A 1XGNA 3MN2A 3OYAA 1HQCA 1P7IA 1I3AA 1MIJA 3FM5A 5CYVA 3BP8A 5J4YA 5F1JA 1FOKA 3I4PA 1BIAA 2JZYA 1VNDA 4UXNA 4AUXA 4XN3A 1MBJA 2IRFG 1T39A 3ZMZA 1MBHA 2G7UA 2W1OA 1PUFA 2IEKA 4FCYA 4Y7NJ 2DK5A 3T5XA 4R8HA 1SANA 4UB6C 1ZLKA 4YIRX 2HEOA 4IHSA 2O6GE 4HOBA 1R23A 2TCTA 2W84A 2Q0OA 2DTRA 1G2HA 4LJZF 4QLCU 1Y0NA 2FNAA 4D1QA 3LSMA 1C0WA 1FBQA 2ZJRF 1SFXA 4BAYA 3R4KA 2ID6A 3BJOA 4L18B 2MABA 1VF9A 3OSGA 3CJTB 4RBOA 1ONVA 1X3ZB 4JQFA 2E71A 3ZPLA 1E3PA 2OC6A 4UVCA 4L9VA 4FQGA 4Q48A 4CDGA 5J6XA 2ICWG 4UV9A 4PJJA 1ULYA 4EM2A 2F5VA 1MZBA 4CCJA 2WAFA 3FXJA 5DD4A 2FNPA 4GYGA 1JTXA 3PM1A 3CCMI 1W5TA 3RKYA 1XS9A 2LKPA 3IKVA 3L00A 4ZYAA 1FEXA 5TJJA 1ACIA 1EKEA 3HOSA 1FYMA 3MQ0A 1POGA 2VIXA 1HKSA 2FMLA 2X51A 3U1DA 3ERMA 2IJLA 1A5JA 2KMUA 3U2RA 3BZKA 2MC4A 4DQ2A 4IRGA 3H5NA 4ZYEA 2V1UA 2WBMA 4O6JA 4BHPA 2P5KA 2DTZA 5KAFC 4HDUA 3K1PA 4XQFA 3MZHA 3S16J 3GYHX 4IRHA 1FOXA 5IT3A 1ZHFA 1PUEE 2Y48A 3FDYA 3AG4H 2EQRA 1TQMA 3CUQC 1G3YA 2B9SA 3FF5A 1DPRA 3ZXSA 2GA1A 5L3EA 4ENMA 4AYBA 1QZEA 2K9MA 4XICA 4E7SA 5J3LA 3WU2C 5FO5A 4IRIA 1SAXA 1Z3XA 3DBLB 2EH3A 3PO3J 5LEJA 5EGOB 4AU7A 3R0JA 2K40A 1O3RA 1QGPA 3ABMH 3BWGA 2QWWA 4L0ZB 2VQLA 2C6YA 1IN8A 2DA6A 1K6YA 3OYGA 2XF5A 4HNUA 4IHTA 5J40A 2PJRB 2WY8Q 2KFDA 3S93A 2J5OA 1KU7A 5F0CA 1MH3A 2QQ9A 4BDYA 1FYLA 1V55H 4B8XA 3HOUJ 1FTTA 4UUSB 4E7LA 2MD5A 2KHMA 1GLNA 4L9TA 4XN0A 2CUFA 5BPDA 2GLOA 2RGVA 5EZGA 3JRDA 1BN5A 2KIFA 4L0YB 1GXPA 5HS9A 2HZDA 3QQAA 1YO5C 1MMNA 1R9TJ 5HLHA 1X1PA 5BPIA 3HBLA 4A5NA 1YJNI 3DU6A 2Q2EA 3E6CC 4IQJA 3K1MA 1WJ5A 3BG7A 1ETQA 3GFLA 2QKLB 2XAJA 1FMWA 2RVCA 2FXAA 4OAZA 1LFPA 3TDZC 4BE2A 5JHFA 3W3CA 1VQMI 1BIBA 3B6AA 5EF6A 2QQBA 2LSOA 4BGDA 5HDNA 1OYIA 1TBXA 2Q1ZB 1B9MA 1LNWA 2Y2ZA 2Y75A 3E97A 2CSOA 1OLTA 2CW8A 5EDNA 4RGUA 2LF7A 4LD5A 4R1HA 2QBYB 4LK1F 4II3A 1T56A 5HDKA 2CQQA 2E5NA 4XLPF 3BT9A 5DCMB 3P5JA 1JTYA 2JWTA 4LFUA 1MBGA 3VEPA 4AC0A 3VDXA 3WTSC 5JVGF 4KA4A 1G3TA 2WB1N 1QVTA 4RAGA 3BCAA 2OTJI 1KU9A 1Y56A 4YRVA 3BTIA 1VQPI 3IH2A 3HHHA 2HKOA 1U9NA 1WH7A 1YJWI 4G12A 2DA7A 4QWQA 4ESBA 3LFUA 4PK4A 3JRIA 2DW4A 1BI3A 1BR4A 2BXYA 2Y31A 3TDUC 1HW1A 3H5RA 2CYYA 4F91B 1N75A 4ENNA 2O8XA 3GF2A 5BMZA 1ZAOA 2OZ6A 3O8HA 4BL0B 4XM3A 1R1TA 2O5RA 1MGTA 2GM4A 1EH7A 1X3WB 4U88A 4F3QA 3CMYA 1VQ4I 2DBBA 5LGUA 3WGIA 5GP9A 3HOTA 3A1YA 1KU2A 1E0EA 2DJNA 3DLLF 3J7YJ 3IL2A 3J80Z 4DZJA 4B43A 1MSEC 5EZHA 5L3GA 3UKGA 1BC8C 1VQLI 5HLTA 1RZ4A 1TL8A 4RB2C 1I6HJ 2F48A 4BQQA 5DD8A 1P4XA 3JW4A 4IHXA 4Y33A 2EJRA 2M87A 2YU9J 1MD0A 1OCCH 2OF7A 2HPIA 1HDDC 1KYZA 1JHFA 2R7WA 4X1EA 4D0PA 4YFKF 2R7VA 4CO8A 1Y8RB 2X1DA 1YRNA 1LE8A 3TMOA 2KZGA 3AG2H 1EJ9A 1NG6A 2M30A 3FBNB 1R1VA 1Z6TA 2I5UA 5E18F 5HNHA 2BZTA 5CPRB 2DDBA 4KITB 3MEXA 1V5GA 2DOFA 4G6QA 3R6SA 3RPUD 1R5ID 4EGYA 2MGQA 3NWTA 2H6CA 4HDVA 2Q2EB 2DA3A 1AKHB 3QP5A 3M1EA 2I10A 2ECCA 2JTVA 2OA4A 2KP6A 3CDIA 4YIFA 2G9WA 3PSFA 3A02A 4N0BA 2ZNZA 1Z21A 3DXJF 2HYJA 2ZXJA 2CV0A 5J8CA 2FOKA 1BBYA 3KP7A 1X2MA 4XSXF 2LBFA 2L4MA 4JOMA 1QO0D 2YSRA 1QZYA 2F4IA 2KRFA 3I59B 4IPAA 3J81Z 3TOBA 2L7FP 1TZLA 1S72I 1KQ9A 3OOPA 2PJRA 1TWHJ 3HTSB 4CUGA 4Q4ZF 3DBHB 1IDZA 2DYSH 4C9YA 2Y0SN 5FLXZ 3CCSI 3QPLA 5JLWA 4XLFA 2L7KA 4U0YA 2A3SA 2JT1A 3JR9A 4FX4A 3IWZA 1Y0UA 9ANTA 2LD5A 3JRAA 2VXZA 2EWNA 2LR8A 3FMRA 1QPMA 2RKHA 4L5EA 4C3JJ 2R7ZJ 3PIOF 2A6TA 1OFCX 3LSJA 4OIQF 4I76A 4XR6A 1HKTA 4GO1A 1BW5A 2OQGA 3OOUA 4LB6B 1AHDP 2GXAA 5E79C 4GYIA 4YELA 2A6HF 1Z9CA 1X1BA 2Z9OA 3BR6A 4JYKA 3K4LA 2DN0A 2UXXA 3M4OJ 2JVGA 3AG1H 1CF7A 3PFYA 3CDLA 5C4JJ 2L3DA 1D1BA 3MD2A 4M3DA 1SMTA 1R36A 1AWCA 1HA8A 2XPWA 2XUBA 4A3IJ 3I59A 4MQVA 5E17F 2QYOA 1JXSA 1I3QJ 3ISPA 3LAPA 3KEYA 2IGKA 2V4JC 3C2HA 3LQQA 1JGSA 3CP2A 4IZZA 2LMDA 5DM7F 1JE8A 3KP5A 4AIHA 3WTWC 1KGSA 2M0CA 3QP6A 5IP7J 1IN6A 4A5MA 2M8GX 3PUFA 2HTJA 1VQOI 1JT0A 4HX7A 1KONA 3VODA 1PP7U 2YS9A 3GTMJ 1HKQA 3OYEA 5F64A 5D8KB 4WXHA 1O3SA 1MNDA 3REOA 2W7NA 5HS8A 3IUOA 4A3EJ 3CD6I 2QEXI 2LY2A 2JUGA 2ZJ2A 1XTAA 2Z2SB 4RB1A 2Z99A 1PJRA 2E1OA 3KZYA 2OU2A 3CESA 3FXMA 2KRHA 1LUJB 5FKNA 3LAJA 2VT2A 5D8LB 1TWFJ 2XB5A 1OISA 2E7WA 3AFHA 3O3KA 1T6SA 3HGYA 5IY5H 3CQZJ 4AIJA 1U5TC 5FROA 3FXRA 1B72B 3IAS2 3A03A 3BJ6A 3SEQA 3DTKA 4KIGA 3HOVJ 1J0RA 3K7AJ 4BU2A 4M3FA 2HVSA 2YU3A 2DA1A 1XDSA 4EATA 4RB3C 1OPCA 2CUZA 2WV0A 3E0JB 4ASNA 1T08B 1WSUA 3FBIB 2B7EA 1AKHA 2A5WA 3C2GA 2Y69H 4MTEA 2O8KA 5KK1A 1K7AA 2W24A 4WWCA 5CVVA 4M73A 2ELKA 1FLIA 5LRRA 3ZN0A 3WHBA 4I98B 2DFIA 3TGNA 1ZTRA 1A31A 4H4KC 5J1YA 5D5WB 2E1NA 1FZPB 1W0UA 2DCEA 2DMPA 5IT9K 1LPQA 2A61A 2FBHA 3WTXC 2EA4A 4HW0A 3H3UA 1XX5A 1MKMA 3MZ8A 1JGGA 5L3CA 3GTJJ 3GTQJ 2JK3A 2RREA 2XV4S 1H9GA 2EV0A 2KIQA 2GA2A 2ZB9A 5J4VA 2CV2A 4LLNA 4QIWN 3ZP5A 4II2A 3S17J 1Y6IA 3TQNA 2XROA 3H9GA 2LC2A 2QZ8A 3E5UA 1NHAA 3ULQB 3EUHA 3QYFA 3GX4X 1I39A 4KT6A 2EV6A 1V4RA 2PBIA 1LDKB 4C3HJ 3HYIA 1W4MA 3HOXJ 4U0VA 1YIJI 2N8GA 4AWXB 2AXTC 2VQCA 2PN6A 4NNJA 3I3LA 3I4MJ 5GPAA 4OMZA 2QCOA 3RZOJ 1ZREA 2EFPA 3KX2A 2UV1A 4DJAA 5JR3A 3ESWB 1ZGJA 4P96A 1APLC 2VE9A 3GTOJ 3RKQA 3SHFA 4X6AJ 2DFEA 1F36A 1Z6RA 1WJCA 2LTPA 2ADUA 3OYNA 1W0TA 3H3VK 1Y1VJ 4HQMA 5TGTA 2HOAA 3QWLA 4ESFA 1A35A 3IH3A 3FXUA 4L9NA 1YYVA 3RQIA 1Z0XA 2W85A 4E70A 3COAC 2R5ZA 4PZJA 3KETA 1X1DA 2FJ1A 4WXCA 4RGRA 3BPXA 1BW6A 3S3OA 2LBFB 2CUEA 5F08A 5C44J 2VJ4A 2HXOA 2BY2A 4IX7A 1F43A 4IHVA 3VWBA 3J7AY 1X58A 2V26A 3LA7A 1YX5A 3H0DA 1OCPA 4P9UA 2XSDC 4CZZA 1IAWA 4ENJA 2P7CB 1V3FA 2B0LA 2HYFA 3CCLI 2F5EA 2R7TA 1I27A 4YFXF 2OCCH 2RAEA 3KYDB 3KYLA 1JKOC 3V7RA 1DGRM 3CJQB 4FTHA 5DCMA 2VPLA 2R5YA 5KVRA 4GFBA 4G7HF 4OIPF 3HOWJ 2IS6A 1R7JA 3LSPA 2L9VA 4M3BA 1RI7A 4UY8I 3KIOA 3B73A 1G6NA 3BG6A 1X2NA 2BVMA 5GPCA 1FBUA 4A2UA 1A6QA 2GBYA 4BBSJ 2V6EA 1F9NA 3HB9A 1ZLJA 2V6CA 2R4GA 5D5XB 2IS4A 1P7JA 2GOXB 1Z3YA 2M7BA 4I02A 3AKZA 2K4BA 1K83J 3EUKL 2HDCA 1NK3P 3F23A 3HKZN 2BXZA 1UG0A 2PQ8A 1H0MA 4HV6A 3DF8A 1U5TB 1B1BA 3EPZA 3S2WA 1UCRA 5H2FC 4PFOA 4ZZLA 4IO9F 1N77A 1XGOA 1TWAJ 3RKWA 1WI3A 2RDPA 1LKXA 2LF8A 2E19A 3FIWA 4XBFA 1XGMA 2DOEA 4MFDA 3NQOA 3LNQA 1IV6A 5DDGA 2RNGA 2NYXA 3LOCA 4HEA2 2QLZA 2F4OB 1BOBA 1TLHB 1ZG5A 2E7XA 4EM1A 3CZ6A 3F6OA 1NTCA 2RNJA 3JAMK 1UHSA 3A4CA 2EPFA 4V2GA 3DFGA 4JX4A 3ZQQA 3PSIA 4OOIA 6PAXA 1O7FA 3PJRA 2EBIA 3DLAA 2EILH 3D5SC 2NXNB 4RGXA 2R7DA 5E3MA 3BDDA 2VKHA 4HF2A 4Q47A 1OYYA 1HDPA 2VQHA 1R71A 2ESHA 5JHUA 1E17A 2AHQA 4A0XA 5HLGA 4KIBA 3BQYA 1IJWC 1FIPA 2F4MB 5LHIA 2JSPA 3ABTA 2E2IJ 1MJBA 3I5UA 3PO2J 1BA5A 4ANJA 2E34A 1YFHA 1W36C 3FKJA 3BZCA 2Y9ZA 3D5RC 3LA2A 3N05A 3V8LA 5F0HA 3M7GA 4BKXA 2DI3A 4B47A 4XOTA 3HM5A 3HSFA 5L3BA 2P4WA 1FBSA 3SZPA 1VQ6I 5E1XA 4KJZA 5EG0A 2X1CA 3ECOA 3L2RA 3D1NI 3HDDA 1GT0C 3OYBA 1DGWY 2M0MA 2MLGA 2UUZA 2UXNA 3WTTC 1RESA 1ZG1A 3HOYJ 4DYRA 4D9JA 2M1BA 4M9ZA 1JKPC 1S29A 4RAYA 5DV5A 4LG0B 3MCZA 3CCVI 1GHCA 2LREA 4KIFA 4XRMA 2RN7A 2YX7A 3HHGA 3CMEI 2BE5F 3RI4A 3DCFA 3ABUA 2ZXIA 3LWFA 2VBWA 4LLGF 1MMAA 2BYVE 3HXLA 1EH6A 4HV5A 3L2VA 4WK8F 2ZKZA 2KL4A 2HXIA 4XIDA 1JUSA 3TP0A 2HZTA 1P92A 3MMYB 3KEQA 3N97A 4FASD 3DPUA 1TTYA 3DQVC 3HOZJ 1R5GA 3OL3A 3Q0VA 1ORKA 3TP3A 2VASA 1MNMC 2X4HA 3ZQGA 1HW5A 2KKOA 5E3LA 1SFEA 2LRDA 1W1WE 3A01B 2H1LA 3ELKA 2IS1A 2MC3A 2X6XA 4I0AA 2NOGA 1LE8B 1Z1DA 2JA2A 2H8WA 1USSA 2F5CA 2QVOA 1MMGA 4HAMA 2MYSA 2HFHA 2K4JA 4KYWA 4IKFA 2QQAA 3IRQA 3GLXA 4XMYA 3VB2A 2VXDA 3FXLA 5FKKA 5GADJ 1DP3A 5LRSA 1QZZA 2K9SA 5LGNA 2K7LA 4F7ZA 3LSGA 5CQGA 1L3LA 2XAHA 2W00A 4CCOA 4DZPA 1IXCA 1X19A 2E5ZA 3CCRI 3HUGB 1EV7A 2ZO4A 5BS6A 1YW8A 1A36A 1MJ9A 2OJED 1YS6A 1KQ8A 3E5QA 5H20A 3IHUA 2BY0A 1XB4A 3O8GA 5M3MJ 1XMAA 1NH3A 4W97A 1YX3A 3M1CA 1EA3A 1BR1A 4XKCA 2LLKA 4PDKA 1JT6A 2L0KA 5L3FA 3J80K 2ESNA 1XN7A 3OL4A 4PJLA 4BHCA 1T8IA 2K9LA 2DO7A 1YIOA 3BR0A 2OQRA 2COBA 3L9FA 4KMUX 1SFOJ 1SVOA 2L7ZA 1S5LC 2MG4A 4UUSA 2W82A 1WCMJ 4RLQA 5BOXA 1P2FA 3KEOA 4ZDLA 2H6BA 3SFZA 2OTLI 3QOPA 3E5XA 2HU9A 2KLOA 1F5TA 5F6FA 2ZFUA 3CCUI 1H9TA 3JREA 5EJCA 1VTNC 1CF7B 3O2PE 3JTGA 4CCKA 1T2KA 3WG9A 1X3UA 4LMYA 1MMSA 1EH8A 2OUMA 3GLLA 3SDGA 2D1HA 4YFNF 3OYHA 3RDIA 3GW2A 4OINF 3FX3A 4FE7A 3X2QH 3FHZA 5E8GA 1IN7A 1PUFB 1F4KA 3ZQHA 5LBQA 2JA6J 2Z3YA 2IT0A 1BI2A 1HC8A 1K61A 1HCRA 5FLMJ 4WXDA 3TKYA 2CMPA 3FK6A 3E7LA 3I54A 3VYSB 2L01A 1GUUA 4AYBN 2VB6A 1TW3A 3OYKA 3G6EI 2F5FA 4HLYA 4O3MA 1XMXA 2MH2A 3BC8A 3J7ZI 3JCUC 4HNVA 3K2AA 4LLLA 4ZYDA 4MO7A 2KQRA 1PVEA 1WQ2A 3S32A 3WU0A 3VPRA 4BJ5C 4CCMA 1ZR4A 1WI9A 2EV5A 3GXOA 4I01A 4UV8A 5DEQA 1YITI 1AA7A 1IXSB 1RNLA 1Z05A 2CQXA 2JVHA 1SVMA 1ZKGA 2G7HA 4A93J 3GTPJ 4XLCA 2V7FA 4WCGA 3U21A 5TRDA 5GAEJ 4A0YA 1HLVA 2CW0F 1KZHA 2HDDA 3BG9A 2DT6A 1B9NA 2P6TA 2DQRA 2XB0X 5KCMA 2WV1A 1RR7A 1Y8QB 2DMUA 1XCVA 4ZZDA 4XLHA 3PQKA 4Y17A 2XC7A 1ZG3A 3H1CA 3BLYA 5K7HA 2K86A 1YOVB 3MKWB 4MEXF 1WJFA 2JA7J 3G4SI 3L2QA 3SJMA 1RKWA 4XONA 2GIZA 3R61A 5F0FA 3FK7A 4FX0A 2BEOA 1RC9A 1WVRA 3CP8A 4RB0A 5IYBJ 1FYKA 1Z67A 3MFKA 3K6GA 4W1UA 4ZDPA 3LMMA 3VYRB 3ERED 1O57A 2CQKA 2WY7Q 4A3BJ 3F22A 2IW5A 2Y0MA 2KT0A 1Z77A 4PFPA 1R4MB 4EVIA 3BOQA 3ZR8X 3RPQA 3CO7C 2VBYA 5H6RA 4R79A 4CSWA 3TOAA 3QYEA 2QUFA 4BUPA 1LJ9A 5DUIA 1WH5A 5DUKA 4A3CJ 1T98A 2A05A 2ME0A 4IF4A 3ZQIA 4JP0A 2YPRA 4PGHA 5LFAA 3KLNA 3QPTA 4E7IA 1Z7LA 4G6TB 2NS8A 2PX9A 1XSDA 2QBYA 1ZELA 3G73A 2JSCA 3FMSA 3H9QA 3CF5F 2L7MP 4AVPA 5E1ZB 4BNCA 3S1NJ 2K85A 2DOAA 3BG5A 1OCTC 1YRNB 2MBFA 1IRFA 1QQIA 3A2KA 1TNSA 2HPMA 2GQQA 3U1KA 2XGEA 2FBKA 4B09A 1QBJA 4C2MJ 1YE9A 2OPTA 3A0BC 1GVJA 3DPLC 5BNGA 3H92A 1H88C 1U78A 2QKMB 1D5YA 2X0LA 1VQ5I 2AS5F 5CLSA 1R58A 1CQTA 3SDBA 4X0GA 4NQWA 3KP3A 1UB9A 4YEJA 1S7EA 4B48A 2FA5A 4V19K 1W36D 2EZIA 5A2QZ 5FJ8J 1WJDA 2DMTA 1NK2P 5HDGA 4XRSA 3CCQI 4GCVA 3OYLA 4CGZA 2LKSA 1I6XA 2IVMA 2XASA 3MKYB 3WG7H 2PEXA 1KYWA 1U6GA 2Z16A 5IOYA 3F8FA 1LQ1A 4IEJA 3DPTA 2QM3A 4D7MA 2ELJA 4FISA 4B44A 2K27A 2VBZA 1S3JA 4CCNA 4E7JA 3E3VA 2VE8A 5IT9Z 4HX8A 3CCJI 4A3JJ 1FMVA 4BQNA 1J7KA 1D1AA 3BPVA 2VKVA 4BS9A 2F2EA 2XIGA 2LH9A 2PI0A 5AIQA 2VC0A 3QU6A 4F55A 4UUVA 5ERIA 3RYRA 3OS1A 2KJCA 2M7AA 3GWZA 1SD5A 4EJUA 4HF0A 3EETA 1P9QC 5HODA 1XD7A 1LFUP 3B02A 1TP4A 3GUDA 2BOLA 3SYTA 4CYDA 4I09A 1IN4A 1HBXG 4L9JA 4S04A 1D5VA 1QPIA 4XLAA 4BY1J 2XGXA 2RQPA 2D45A 2HTSA 5D6FA 2AQFA 3HC7A 4ZH4F 1D3YA 2XPVA 2Y0SA 1I1SA 2QGUA 2YX4A 2CS3A 5HNFA 5EG0B 4A3FJ 2NVUB 4ZTFA 1RUNA 2HQAA 2FRHA 2R7XA 3HSEA 5ICEA 2HOTA 1FSHA 3BG3A 3IV5A 3G1MA 1B72A 2M5WA 2HI3A 2CG4A 4CHUA 5EEHA 2R7FA 3JRBA 5C4XJ 5DS9A 2XAFA 3K10A 3HRSA 4N4OB 4WF2A 3FXOA 4G7OF 2W48A 1WGXA 2HQRA 3PQJA 4CYCA 3LFKA 4MHGA 5ICCA 1ZRCA 1TC3C 2WWYA 2NOJB 5J47A 2E1CA 3AL0C 1W5CC 1IRXA 2NNNA 2PMZN 2CRGA 5K7ZA 1S6LA 3WE3A 1U8BA 1KU3A 2IXSA 2L9SA 2ZSHB 1IN5A 4P5OA 2DA2A 3UNGC 3PNVA 1ETWA 4AM3A 3K9TA 1GXQA 3ZQ7A 5IPAA 4IQ4A 3PL8A 1FP1D 2Q8KA 3Q5FA 2VOPA 3BR1A 3I53A 3ASNH 5IOZA 3KLOA 3LSTA 3CCYA 4AD9A 4EMSA 4HBLA 4CXFA 1OCZH 2FQ4A 1MBEA 3M8FA 1MDMB 4B3AA 2M8EA 1XSXA 3DTIA 4HA8A 3I55I 3MAJA 1YW9A 3CUOA 1ON2A 2EZKA 2CQNA 3CC4I 2XRLA 3IWFA 1LDJA 3SZTA 2ISYA 4DBRA 2VKDA 3G1OA 2ZNYA 5CKTA 3OYIA 2HVRA 4A12A 3L2UA 5GAGJ 1IRGA 4IXAA 4D5CA 1LFBA 1W5SA 4A3GJ 4M9XA 1A04A 4M6YA 3ASOH 2LK2A 3NEUA 2CFOA 2ZMEA 2LYCA 2MH9A 5FKMA 2OD5A 2Z33A 4KISA 1I50J 1W7PA 3H3ZA 2HDWA 2R7SA 2GAUA 2KIUA 5K7FA 2ZXWH 2DYRH 2HS5A 5ICFA 5FKOA 1D1CA 4HPQA 2D2WA 1V5EA 4BACA 2NVYJ 4HYEA 2LOOA 4DYCA 4RMNA 1LB2A 2CV1A 2ZCWA 1BR2A 2O03A 4NBQA 1K6OA 3HUGA 3IP4B 4NC7A 4U7DA 2JUCA 3K4BA 1VQ8I 1MH4A 4U7BA 1YQAA 3D0SA 3OYMA 2IGMA 2HWVA 3JAMZ 2EINH 2V9VA 2D1VA 5HOOA 4LIUA 2R7OA 2ID3A 3MKLA 4BH9A 3EUHC 1XSVA 2CW7A 2CUJA 3Q3SA 4UHTA 4QSHA 4F93B 4G94A 1R6RA 3AAFA 3GEZA 2P8TA 3K0LA 2HOSA 2W4SA 3DKXA 2FD5A 3K1NA 3MZYA 5FFXA 1JUMA 2L54A 4Q5SF 5CJ9A 1BM9A 3W2AA 3J81K 1AOYA 4I7HA 2FOWA 3HIFA 1Y1WJ 1WHUA 1SFUA 1RETA 2QSGX 3JRGA 4CA0A 1G8XA 2VQGA 1W7PB 2EIJH 5TISC 1SC7A 1LEBA 3BR2A 1Q1HA 2A68F 3OSFA 1FOYA 4HX4A 3RTRA 3S15J 4AVZA 5D5VB 3K4JA 1QA6A 2L02A 2RQQA 3S3MA 1H89C 3RJPA 3GTLJ 5LHHA 1TW2A 4N9IA 2LDUA 3DU5A 3I71A 4UB8C 2L5QA 2FX0A 4G6DA 5HVQC 2DU9A 4DIQA 3K2ZA 3RCOA 4FE4A 4EJOA 1D0YA 2DFHA 2KPMA 4U0WA 2K02A 1U8RA 1PYVA 2R92J 2RV8A 1UELB 1ZR2A 1R4NB 3HG9A 4FT8A 4M71A 2IA2A 2PMZA 1BOAA 1N25A 3OS0A 3Q0UA 1YS7A 1O3TA 3LSRA 4JK1X 4LG0A 4E4HA 3V7SA 3AL0B 4OU0A 3GTKJ 3LSHA 2R7RA 3P9IA 4NB5A 3HGGA 1DU0A 1DPUA 2DODA 3E6MA 5IP9J 4CICA 2ZMEC 1UJ8A 1R00A 1EF4A 5B5EC 3LSIA 1WZ2A 5L3DA 2LFBA 4M3EA 2XAGA 1SAUA 2COMA 3K70C 1ZN2A 5IYDJ 1UZCA 2ZJQF 2DXIA 2XPUA 5B1AH 2ETHA 1NG7A 3OIQA 2WTEA 1CGPA 2GXGA 1XDUA 1RPWA 1X4OA 2NVXJ 3GFIA 3IH4A 4IHYA 1D8KA 1R5HA 4V2FA 2PG4A 4I6ZA 1G3SA 1IUFA 3PIPF 3ZGKA 1VQ9I 4EJWA 3C3WA 5LLQA 3ML6A 3N4MA 3MWMA 4ENKA 1YI2I 2M34A 3CC7I 2L4AA 2R93J 3OIOA 2IA0A 1S8NA 2OAZA 3BY6A 3KP6A 1Z7UA 1FPQA 1LVKA 3S2DJ 1LDDA 2GOMA 3HKZA 2BHYA 4MNUA 2XHKA 4XKBA 4BE0A 3CC2I 5C3EJ 2ZMEB 5ILVA 5FD6A 3DKYA 3C2BA 3IC7A 2ZBKA 2VJ5A 1Q1VA 5JLXA 1JI8A 2KDZA 3HJEA 3ZQFA 1FNNA 3W2WA 4UVBA 4HRIA 3GMEA 4BXFA 1RRJA 3QPHA 1G4DA 1ZRFA 5B66C 3WGGA 1HSTA 2CFXA 3KZIC 5E3NA 1X4PA 2JQ7A 3L7WA 5DYMA 4OWRB 4BQOA 3HEFA 3K4CA 2CQ7A 4OIOF 2XAUA 1N78A 2WAEA 3R0AA 3KP2A 4DBQA 4M3GA 3TW7A 3LA3A 3C7JA 2WC2A 4EEFG 2LP0A 2EIKH 2NVQJ 4MIMA 3CTAA 4Y15A 4C2UA 1QNTA 1SMYF 1XCBA 2A5YB 2XGDA 1DP7P 4I99C 2CO5A 3P7NA 3IKTA 1XPXA 4NDLA 3WODF 3EDPA 1K4TA 2IP2A 4P1WA 4D7NA 4Z6YA 1RKTA 1I1GA 5IYCJ 2X85A 3I4NJ 3AG3H 1MMDA 5AIPA 1S7AA 4PSXA 5F04A 2M45A 3E1SA 4F92B 1E3OC 2L9NA 4BQAA 2VUMJ 1ETKA 2QSFX 2VL8A 3WTZA 3I56I 3ZRGA 2TRTA 2PJPA 2E36A 4BJ6C 1B8IA 4DGWB 1SD6A 1D0XA 2E1MC 1IGNA 4A0ZA 3ZCOA 1K78A 3NARA 3ECHA 1MSFC 4M74A 1JJ6C 4GGGA 3EYIA 3HRUA 3F8MA 1KQ0A 2K3PA 3BTJA 3GZ5A 1WRJA 2UZKA 5LEKA 1IXRC 5CVIA 4KN7X 3RYPA 2DPDA 3WHCA 5H6QA 3G1LA 3F21A 1XGSA 4EM0B 5BQTA 3E6DA 1JHHA 5EYRA 4AIDA 3SXYA 3FHNA 3S1RJ 1E2XA 2GXBA 1I5ZA 1FWZA 3PUBA 2OBPA 2QA4I 2QSHX 3CMMA 3CUQA 3JSOA 2M4KA 3ZMSA 1FIAA 1XG1A 4DYQA 5K5QA 1TWGJ 3P9KA 3JRHA 3CUQB 2K9QA 2O0YA 5B1BH 5EGOA 1J59A 5LD2C 4EGZA 3OWTA 3BR5A 4XKVA 2K9NA 4IJAA 1TNTA 3FWEA 2RC4A 2DA5A 2BV6A 2V1XA 2W25A 2GZWA 5DM6F 3GZ6A 1V5FA 2FE3A 4KUMA 1YHQI 4B1RA 1IF1A 4ZJZA 1ZQ3P 4XLEA 3OYFA 4IHWA 1J9IA 5CQEA 2X9DA 4ZYHA 2X48A 2DAOA 4XORA 3ROUA 3QODA 3HPHA 2QENA 4CCLA 2BW3A 1ZRDA 1REPC 5FD5A 5AONA 2O9LA 3C1DA 3DEUA 2KZVA 4L5IA 4C30A 4S0HB 2O3FA 2FEZA 4LIVA 1VFCA 4LGWA 3HZJA 3GO5A 4PJMA 1WJAA 3V8KA 4AIKA 4QTRA 1B6AA 1KA8A 2ECBA 2IAIA 2JPBA 3GCMA 4BDZA 5D4SA 4KMFA 3F72A 3EUAA 1P6RA 1GVDA 5CVRA 3TO7A 1LEAA 4FETA 4ZDOA 3T0YA 4BYYA 4A6EA 5GTIC 3SEZA 3FXQA 3A0HC 4Y4RA 5FB2A 3GZNB 3T8RA 1RR8C 1TT0A 2GWRA 3Q9VA 4M9SA 4N4NB 3GVAA 1SFKA 2ISZA 3G2BA 3TL4X 1J5YA 3K70D 1ZK8A 2LY9A 3H5AA 3CMAI 2NS7A 3M07A 2M2EA 5J1UA 2JRTA 2LKXA 2OZUA 3BTCA 3HPGA 3DWLE 1G3WA 2BGCA 1FP2A 1UHMA 4KICA 4RLFA 2BY1A 1TWCJ 4E6KG 2E1MB 4RGSA 5D5UB 1IRZA 3QAHA 4CZCA 1QHHD 3GFMA 3ZMTA 1ZYRF 2VBXA 1U9OA 1HXDA 3OYDA 1R22A 4XL9A 2MW8A 2ZXHA 4DW6A 3VFZA 3S14J 1WJEA 3FZVA 1DDNA 2BVLA 1BJZA 1U2WA 1RUOA 2DMNA 3KZZA 3QYBA 1U5TA 2WAQA 4RS8A 4XKWA 4B4CA 4LB5A 2CJJA 1ETXA 3SFIA 3GBGA 2Z1DA 4NQWB 4QPOA 2ELHA 1STZA 5A2QK 3ABLH 1BI1A 2BY3A 3CJNA 4OMYA 1IC8A 4I2OA 4RDUA 2F5DA 2IGNA 3OY9A 1HW2A 3HTUA 2NAZA 2HOEA 3ZMDA 1J75A 3S2HJ 2R0QC 4LITA 2KRCA 3M9AA 5CVUA 2P0WA 2F6CA 4Y3OA 2H1KA 2XDVA 2AQEA 2MSYA 1VZ0A 2WADA 2YUSA 4KT5C 1JUPA 2NRAC 4H0EA 2X6OA 1ON1A 2MFZA 2P6SA 3M8EA 3CDHA 2PLYA 3TEDA 3VYUB 1X1CA 1BJAA 5ILUA 1OKRA 3LL7A 2JMWA 2TDXA 1MNEA 2VN2A 3DEWA 3J7AO 2IS2A 2KIMA 1W7PD 1ODDA 3M8JA 3BROA 3BQZA 4P55A 3ZMVA 3V4GA 4NUBA 3WU1B 4FHTA 1PDNC 1MDMA 2ZFWA 1GV2A 3F0CA 3JRFA 3ZOBA 3CJRB 5FLXK 4RA2A 3MKZA 2DQLA 1MBKA 4A3MJ 1ENHA 2AO9A 5FLVA 2EIMH 3UR3C 2Y30A 3KP4A 1FSEA 3H35A 5D6EA 4KDPA 2E35A 3TO6A 1Y39A 4BEHA 1TQPA 3L1PA 1O4XA 3F8NA 2IBDA 4G9YA 2NVTJ 3Q9SA 1ETVA 4O5VA 2KDOA 3GFJA 4YIIA 3DKWA 2L9RA 3DBRB 5M5WJ 3OYJA 3QOEA 3S1QJ 2O7OA 5KHDA 5KAIC 4A6DA 1P4AA 1ZGAA 1YW7A 3CLOA 2STWA 2A07F 4A3DJ 1IV8A 2BHZA 3V8JA 3KYCB 2ZC2A 3K4KA 5FKLA 3RIRA 5KNLA 2XSJC 2WB1A 4F52A 1B8IB 5FRMA 2MLKA 4JX6A 3O6BB 1K78B 2QF7A 2R5YB 4RM3A 3WTYC 5DCFA 2VODA 1V54H 2XF6A 1FOWA 4KN4X 1BL0A 3OYCA 2AXLA 2CH0A 4BJTA 5B3SH 1VQ7I 2LY1A 2V1NA 2IA1A 1UFMA 2PMUA 1S7OA 2Y9YA 5JVTA 5M3FJ 5ILSA 2BW3B 3FKIJ 1JJ8C 3P9CA 2XKOA 3QPSA 3QU3A 3W6KB 4BBRJ 2NS0A 4B3XA 3VOEA 4KFCA 3F8BA 4J01A 2VKEA 2HQ5A 5E8IA 2XVCA 5E3OA 3DP7A 1QU3A 2V1DA 2V9PA 1FJLA 3WE2A 3KE2A 2VOOA 1L0OC 4PJ0C 4DOZA 1FX7A 5LGTA 3OR2C 4GDFA 3K4NA 4Y52J 4XRFA 4G8XA 2LG4A 5J1RA 1DQUA 4BE1A 1ZH5A 1F1ZA 2M9HA
chains in the Genus database with same CATH topology
3LQRA 5HS7A 1T0FA 1DUXC 1YTYA 1OYWA 2H09A 4ZYGA 3EYYA 3BJAA 4TV7A 2EK5A 2HKXA 1B59A 1BI0A 3R60A 5LHGA 1O3QA 1IUYA 4OIRF 2HR3A 4RAZA 4PCQA 3KFWX 3D5LA 3HRTA 2HYGD 2VONA 3DV8A 3T8TA 5F1RA 4KNYA 1TQIA 2P7VB 2A6EF 2HGCA 4K2EA 2P5VA 2IPQX 3C18A 4DNCA 2P5LC 1OR7A 2GIVA 4G7ZF 2O61A 2FU4A 3SQNA 4GXOA 1FY7A 1B4AA 4WX9A 2EFWA 1WWXA 2YR2A 4EJTA 3QRFF 2DK8A 3JTHA 2A69F 2EFNA 4YG2F 3I0TA 4BHBA 5K5OA 1R1UA 2UWMA 2CWEA 1UHWA 2XAQA 1SD7A 4HZFA 3WGHA 2FQ3A 4I0BA 1OMIA 5ED4A 2FSWA 4ON0A 2PMHA 2H94A 4ESJA 1HSJA 1IW7F 2EFQA 3OV8A 4L5JA 3IRRA 1O7LA 4HLXA 2MA3A 4EQQA 2DT5A 5E20A 3RPUA 3L09A 2EB7A 3HRMA 1PP8F 4Y13A 4HF1A 3W6JB 3F8CA 2J5PA 3KCCA 5FGMA 4P9FA 2CGPA 5E1WA 4ETSA 4EV0A 2FBIA 1T38A 4MGRA 2Z5UA 3U9GA 1RIOH 4XSZF 3K69A 3WTUC 2VT3A 1YLFA 4M6XA 4N9HA 2KJBA 4BXUA 2XKPA 2DPUA 5EEGA 1Z91A 5JI6A 1D8JA 3RKXA 5HLIA 1IZ1A 1P4WA 1U3EM 5FFZA 2FMYA 4M72A 4MEYF 2LNBA 3G3ZA 1SD4A 2EA2A 4S05A 3EQLF 3I64A 4MQ9F 3CO6C 1FT9A 5CVJA 3JSPA 2EFOA 3TO9A 3L2CA 1ZARA 2ACJA 3WTVC 2R3SA 1USTA 4UNOA 3ZMUA 2BBYA 3FM3A 2HQNA 3FMQA 4MTDA 5K1YA 1K79A 2V79A 2JPCA 3BZ6A 5J8FA 5K5RA 1XMKA 4LK0F 2VC1A 1J2XA 2FF4A 1YG2A 2PFBA 4NHJA 3PFIA 3F3XA 3T1BA 3HSRA 4XLNF 4HQEA 1WKMA 4IVNA 4PGGA 1BC7C 3V7CA 5ICGA 4EJVA 2H27A 2DLLA 1LVAA 2STTA 3NRVA 1MJAA 4UVAA 2NNYA 3I58A 4Z2YA 2XRNA 5D4RA 3F6VA 3E6BA 4JBAA 5JFRA 1FC3A 2W57A 3ZN1A 1XGNA 1HQCA 3FM5A 5CYVA 3BP8A 1FOKA 3I4PA 1BIAA 2JZYA 4UXNA 2IRFG 1T39A 3ZMZA 2G7UA 2DK5A 3T5XA 4R8HA 1ZLKA 2HEOA 4IHSA 2O6GE 4HOBA 1R23A 2W84A 2Q0OA 2DTRA 4LJZF 4QLCU 2FNAA 1C0WA 1FBQA 1SFXA 4BAYA 3R4KA 3BJOA 4L18B 1ONVA 4JQFA 3ZPLA 4UVCA 4L9VA 4Q48A 4CDGA 5J6XA 4UV9A 4EM2A 1ULYA 1MZBA 5DD4A 2FNPA 4GYGA 1W5TA 3RKYA 2LKPA 3IKVA 3L00A 5TJJA 3HOSA 1FYMA 3MQ0A 1HKSA 2FMLA 3U1DA 2IJLA 3U2RA 4DQ2A 4IRGA 4ZYEA 2V1UA 4BHPA 4O6JA 2P5KA 4HDUA 3K1PA 3MZHA 3GYHX 4IRHA 5IT3A 1ZHFA 1PUEE 2Y48A 1TQMA 3CUQC 1G3YA 3FF5A 1DPRA 2GA1A 5L3EA 4ENMA 5FO5A 4IRIA 1SAXA 5LEJA 3R0JA 1O3RA 1QGPA 3BWGA 2QWWA 4L0ZB 2C6YA 1IN8A 4IHTA 2J5OA 1KU7A 2QQ9A 1FYLA 4B8XA 2MD5A 4L9TA 5BPDA 2RGVA 1BN5A 2KIFA 4L0YB 1GXPA 5HS9A 1YO5C 5HLHA 5BPIA 4A5NA 2Q2EA 3E6CC 3K1MA 2XAJA 3GFLA 2RVCA 2FXAA 3TDZC 1BIBA 2QQBA 2LSOA 5HDNA 1OYIA 1TBXA 1B9MA 1LNWA 2Y75A 3E97A 2CSOA 4RGUA 2LF7A 4LD5A 4R1HA 2QBYB 4LK1F 5HDKA 4XLPF 5DCMB 4LFUA 3VEPA 3WTSC 4KA4A 1G3TA 1KU9A 3HHHA 2HKOA 4QWQA 4ESBA 2DW4A 1BI3A 3TDUC 1HW1A 2CYYA 4ENNA 2O8XA 3GF2A 5BMZA 1ZAOA 2OZ6A 1R1TA 1MGTA 1EH7A 4U88A 2DBBA 5LGUA 3WGIA 3HOTA 1KU2A 3IL2A 3J80Z 5L3GA 1BC8C 1RZ4A 4RB2C 5DD8A 1P4XA 3JW4A 2EJRA 2M87A 1MD0A 1KYZA 1JHFA 4D0PA 4YFKF 4CO8A 2M30A 1Z6TA 1R1VA 5E18F 3MEXA 4G6QA 3R6SA 4EGYA 4HDVA 2H6CA 3QP5A 3M1EA 2JTVA 2OA4A 4YIFA 2G9WA 4N0BA 2ZNZA 3DXJF 2ZXJA 5J8CA 2FOKA 1BBYA 3KP7A 4XSXF 2L4MA 1QO0D 2YSRA 1QZYA 2KRFA 3I59B 4IPAA 3J81Z 3TOBA 1KQ9A 3OOPA 3HTSB 4Q4ZF 5FLXZ 4U0YA 2A3SA 2JT1A 4FX4A 3IWZA 1Y0UA 2VXZA 2EWNA 3FMRA 1QPMA 2RKHA 4OIQF 1HKTA 4GO1A 2OQGA 4LB6B 4GYIA 1Z9CA 2A6HF 2Z9OA 2UXXA 1CF7A 2L3DA 1SMTA 1R36A 1AWCA 2XUBA 3I59A 4MQVA 5E17F 2QYOA 1JXSA 3ISPA 3LAPA 3LQQA 1JGSA 1JE8A 3KP5A 4AIHA 3WTWC 1KGSA 3QP6A 1IN6A 4A5MA 2HTJA 4HX7A 3VODA 1PP7U 1HKQA 5F64A 5D8KB 4WXHA 1O3SA 3REOA 5HS8A 2ZJ2A 4RB1A 2Z99A 3KZYA 2OU2A 3LAJA 2VT2A 5D8LB 2E7WA 3O3KA 1T6SA 4AIJA 1U5TC 3FXRA 3BJ6A 4KIGA 1J0RA 2YU3A 1XDSA 4RB3C 1OPCA 2WV0A 4ASNA 1WSUA 4MTEA 5KK1A 1K7AA 2W24A 4WWCA 5CVVA 4M73A 1FLIA 5LRRA 3ZN0A 4I98B 2DFIA 3TGNA 5D5WB 1FZPB 2E1NA 5IT9K 2A61A 2FBHA 3WTXC 2EA4A 4HW0A 3H3UA 1MKMA 5L3CA 2XV4S 1H9GA 2EV0A 2GA2A 4LLNA 3ZP5A 3TQNA 2XROA 2QZ8A 3E5UA 1NHAA 3ULQB 3EUHA 3GX4X 2EV6A 1V4RA 2PBIA 1LDKB 3HYIA 1W4MA 4U0VA 4AWXB 2PN6A 4OMZA 1ZREA 2EFPA 5JR3A 1ZGJA 4P96A 2VE9A 3SHFA 1Z6RA 2ADUA 4HQMA 4ESFA 4L9NA 3FXUA 1YYVA 4E70A 2W85A 3COAC 4PZJA 3KETA 4WXCA 4RGRA 3BPXA 3LA7A 4P9UA 4CZZA 1IAWA 4ENJA 2P7CB 1V3FA 2B0LA 2HYFA 2F5EA 1I27A 4YFXF 3V7RA 5DCMA 5KVRA 4OIPF 4G7HF 1R7JA 1RI7A 3B73A 1G6NA 1FBUA 4A2UA 1F9NA 1ZLJA 2V6CA 5D5XB 4I02A 2K4BA 2HDCA 3F23A 2PQ8A 1H0MA 4HV6A 3DF8A 1U5TB 1B1BA 3S2WA 1UCRA 4ZZLA 1XGOA 3RKWA 2RDPA 2LF8A 4XBFA 1XGMA 3NQOA 5DDGA 2NYXA 2QLZA 1TLHB 1ZG5A 2E7XA 4EM1A 3F6OA 2RNJA 3JAMK 3DFGA 4OOIA 6PAXA 1O7FA 4RGXA 4HF2A 2R7DA 3BDDA 4Q47A 1OYYA 2ESHA 5JHUA 1E17A 4A0XA 5HLGA 4KIBA 5LHIA 3ABTA 1MJBA 3I5UA 1YFHA 3LA2A 3V8LA 3M7GA 2DI3A 3HSFA 5L3BA 2P4WA 1FBSA 3SZPA 5E1XA 3ECOA 2MLGA 3WTTC 1ZG1A 2UXNA 2M1BA 4M9ZA 1S29A 4RAYA 5DV5A 4LG0B 3MCZA 1GHCA 4KIFA 2RN7A 2YX7A 3HHGA 2BE5F 3RI4A 3ABUA 3LWFA 2VBWA 4LLGF 2BYVE 1EH6A 4HV5A 4WK8F 2ZKZA 2HZTA 1P92A 3KEQA 3N97A 1TTYA 3DQVC 1R5GA 2X4HA 1HW5A 2KKOA 1SFEA 3ELKA 2MC3A 4I0AA 1Z1DA 1USSA 2F5CA 2QVOA 4HAMA 2HFHA 2K4JA 4KYWA 2QQAA 3IRQA 3GLXA 3VB2A 5LRSA 1QZZA 5LGNA 2K7LA 4F7ZA 1L3LA 2XAHA 1IXCA 1EV7A 2ZO4A 5BS6A 1YW8A 1MJ9A 1YS6A 1KQ8A 3E5QA 5H20A 3IHUA 1XB4A 1XMAA 4PDKA 5L3FA 3J80K 2ESNA 1XN7A 4BHCA 2DO7A 1YIOA 3L9FA 2OQRA 4KMUX 5BOXA 1P2FA 3KEOA 2H6BA 3SFZA 3QOPA 3E5XA 1F5TA 5F6FA 1H9TA 1VTNC 1CF7B 3O2PE 3JTGA 1T2KA 3WG9A 1X3UA 4LMYA 1EH8A 2D1HA 4YFNF 3RDIA 3GW2A 4OINF 3FX3A 3FHZA 5E8GA 1IN7A 1F4KA 5LBQA 2Z3YA 2IT0A 1BI2A 4WXDA 3TKYA 3I54A 2L01A 1TW3A 2F5FA 4HLYA 4O3MA 2MH2A 4LLLA 4ZYDA 1WQ2A 3WU0A 1WI9A 2EV5A 3GXOA 4I01A 4UV8A 5DEQA 1IXSB 1RNLA 1Z05A 2G7HA 4WCGA 5TRDA 4A0YA 2CW0F 1B9NA 2P6TA 2DQRA 1XCVA 4ZZDA 3PQKA 4Y17A 1ZG3A 2K86A 4MEXF 3R61A 4FX0A 2BEOA 1FYKA 4RB0A 3MFKA 3ERED 1O57A 2CQKA 3F22A 2IW5A 2Y0MA 4EVIA 3BOQA 3RPQA 3CO7C 2VBYA 5H6RA 4R79A 3TOAA 2QUFA 1LJ9A 5DUIA 5DUKA 1T98A 4IF4A 2YPRA 4PGHA 3KLNA 3QPTA 1XSDA 2QBYA 3G73A 2JSCA 3FMSA 4AVPA 5E1ZB 4BNCA 2MBFA 1IRFA 1QQIA 1TNSA 2GQQA 2FBKA 4B09A 1QBJA 1GVJA 3DPLC 2AS5F 3H92A 1U78A 2X0LA 5CLSA 1R58A 4NQWA 3KP3A 1UB9A 2FA5A 5A2QZ 5HDGA 4GCVA 4CGZA 1I6XA 2IVMA 2XASA 2PEXA 1KYWA 1U6GA 3F8FA 1LQ1A 3DPTA 2QM3A 2K27A 2VBZA 1S3JA 3E3VA 2VE8A 5IT9Z 4HX8A 1J7KA 3BPVA 2F2EA 2XIGA 2PI0A 5AIQA 2VC0A 3QU6A 4UUVA 5ERIA 3RYRA 2KJCA 3GWZA 1SD5A 4EJUA 4HF0A 3EETA 1XD7A 3B02A 3GUDA 4CYDA 4I09A 1IN4A 1HBXG 4L9JA 4S04A 1D5VA 2XGXA 2RQPA 2D45A 2HTSA 5D6FA 4ZH4F 1D3YA 1I1SA 2YX4A 1RUNA 2FRHA 3HSEA 5ICEA 1FSHA 2M5WA 2CG4A 4CHUA 5EEHA 2R7FA 2XAFA 3HRSA 4WF2A 4G7OF 3PQJA 2HQRA 3LFKA 4MHGA 5ICCA 1ZRCA 2WWYA 2E1CA 2NNNA 1S6LA 3WE3A 1KU3A 4P5OA 1IN5A 3K9TA 1GXQA 3ZQ7A 3Q5FA 1FP1D 2Q8KA 2VOPA 3I53A 3KLOA 3LSTA 4AD9A 4EMSA 4HBLA 4CXFA 1MDMB 3M8FA 2M8EA 1XSXA 4HA8A 3MAJA 1YW9A 3CUOA 1ON2A 3IWFA 1LDJA 3SZTA 2ISYA 2ZNYA 4A12A 1IRGA 4IXAA 1W5SA 4M9XA 1A04A 4M6YA 3NEUA 2ZMEA 2MH9A 2OD5A 2Z33A 1W7PA 3H3ZA 2GAUA 2KIUA 2HS5A 5ICFA 2D2WA 4HYEA 1LB2A 2ZCWA 2O03A 1K6OA 3HUGA 4U7DA 4U7BA 1YQAA 3D0SA 2HWVA 3JAMZ 2V9VA 5HOOA 2D1VA 4BH9A 1XSVA 4UHTA 4G94A 3AAFA 3GEZA 2P8TA 3K0LA 3K1NA 3MZYA 5FFXA 2L54A 4Q5SF 5CJ9A 1BM9A 3J81K 1AOYA 4I7HA 3HIFA 1SFUA 1W7PB 1LEBA 1Q1HA 2A68F 4HX4A 3RTRA 5D5VB 2L02A 3RJPA 5LHHA 1TW2A 4N9IA 2LDUA 3I71A 4G6DA 5HVQC 2DU9A 3K2ZA 4EJOA 4U0WA 2K02A 1U8RA 2RV8A 4FT8A 4M71A 2IA2A 1BOAA 1YS7A 1O3TA 4JK1X 4LG0A 3V7SA 4OU0A 3P9IA 4NB5A 1DPUA 3E6MA 4CICA 1R00A 5L3DA 2XAGA 2COMA 1ZN2A 2ETHA 2WTEA 1CGPA 2GXGA 1XDUA 3GFIA 1D8KA 1R5HA 2PG4A 1G3SA 4EJWA 3C3WA 5LLQA 3ML6A 3N4MA 3MWMA 4ENKA 2L4AA 2IA0A 1S8NA 2OAZA 3BY6A 3KP6A 1Z7UA 1FPQA 1LDDA 4MNUA 2XHKA 2ZMEB 5ILVA 5FD6A 3IC7A 2ZBKA 1FNNA 4UVBA 3QPHA 1G4DA 1ZRFA 3WGGA 1HSTA 2CFXA 3L7WA 5DYMA 4OIOF 3R0AA 3KP2A 3LA3A 3C7JA 2WC2A 3CTAA 4Y15A 1QNTA 1SMYF 1XCBA 2A5YB 1DP7P 2CO5A 3P7NA 3IKTA 3WODF 3EDPA 2IP2A 1I1GA 5AIPA 1S7AA 2M45A 4BQAA 3WTZA 2PJPA 1SD6A 4A0ZA 1K78A 3ECHA 4M74A 4GGGA 3EYIA 3HRUA 3F8MA 1KQ0A 3GZ5A 1WRJA 2UZKA 5LEKA 1IXRC 5CVIA 4KN7X 3RYPA 2DPDA 5H6QA 3F21A 1XGSA 4EM0B 5BQTA 3E6DA 1JHHA 3SXYA 1E2XA 2GXBA 1I5ZA 1FWZA 2OBPA 3CUQA 3JSOA 3ZMSA 5K5QA 3P9KA 3CUQB 2O0YA 1J59A 4EGZA 4IJAA 1TNTA 3FWEA 2RC4A 2BV6A 2V1XA 2W25A 2GZWA 3GZ6A 2FE3A 4KUMA 1IF1A 1J9IA 4ZYHA 2DAOA 3ROUA 2QENA 1ZRDA 1REPC 5FD5A 5AONA 3C1DA 3DEUA 4L5IA 2O3FA 2FEZA 4LGWA 3GO5A 3V8KA 4AIKA 1B6AA 1KA8A 2JPBA 4KMFA 5D4SA 3F72A 1P6RA 3TO7A 5CVRA 1LEAA 3T0YA 4BYYA 4A6EA 3FXQA 5FB2A 3T8RA 2GWRA 3Q9VA 4M9SA 3GVAA 2ISZA 1J5YA 2JRTA 2OZUA 1G3WA 2BGCA 1FP2A 4KICA 1UHMA 4RGSA 5D5UB 3QAHA 3GFMA 3ZMTA 1ZYRF 2VBXA 1HXDA 1R22A 3VFZA 3FZVA 1DDNA 1U2WA 1RUOA 3KZZA 1U5TA 4RS8A 4LB5A 5A2QK 2ELHA 1STZA 1BI1A 3CJNA 4OMYA 4I2OA 2F5DA 1HW2A 3HTUA 2NAZA 2HOEA 3ZMDA 1J75A 3M9AA 5CVUA 4KT5C 2NRAC 4H0EA 1ON1A 2P6SA 3M8EA 3CDHA 2PLYA 1BJAA 5ILUA 1OKRA 2TDXA 2VN2A 3J7AO 2KIMA 1W7PD 1ODDA 3BROA 4P55A 3ZMVA 3V4GA 3WU1B 4FHTA 1PDNC 1MDMA 2ZFWA 5FLXK 2DQLA 3KP4A 1FSEA 4KDPA 5D6EA 3TO6A 1TQPA 3F8NA 4G9YA 3Q9SA 4YIIA 4O5VA 3GFJA 3DKWA 4A6DA 1P4AA 1ZGAA 1YW7A 3CLOA 2STWA 2A07F 3V8JA 3RIRA 2MLKA 3O6BB 1K78B 3WTYC 5DCFA 2VODA 4KN4X 2AXLA 2IA1A 1UFMA 2PMUA 1S7OA 5JVTA 5ILSA 3P9CA 2XKOA 3QU3A 3W6KB 2NS0A 3VOEA 4KFCA 3F8BA 5E8IA 2XVCA 3DP7A 2V1DA 3WE2A 3KE2A 2VOOA 1L0OC 5LGTA 1FX7A 4XRFA 4G8XA 1ZH5A 1F1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQR A;  5HS7 A;  1T0F A;  1DUX C;  1YTY A;  1OYW A;  2H09 A;  4ZYG A;  3EYY A;  3BJA A;  4TV7 A;  2EK5 A;  2HKX A;  1B59 A;  1BI0 A;  3R60 A;  5LHG A;  1O3Q A;  1IUY A;  4OIR F;  2HR3 A;  4RAZ A;  4PCQ A;  3KFW X;  3D5L A;  3HRT A;  2HYG D;  2VON A;  3DV8 A;  3T8T A;  5F1R A;  4KNY A;  1TQI A;  2P7V B;  2A6E F;  2HGC A;  4K2E A;  2P5V A;  2IPQ X;  3C18 A;  4DNC A;  2P5L C;  1OR7 A;  2GIV A;  4G7Z F;  2O61 A;  2FU4 A;  3SQN A;  4GXO A;  1FY7 A;  1B4A A;  4WX9 A;  2EFW A;  1WWX A;  2YR2 A;  4EJT A;  3QRF F;  2DK8 A;  3JTH A;  2A69 F;  2EFN A;  4YG2 F;  3I0T A;  4BHB A;  5K5O A;  1R1U A;  2UWM A;  2CWE A;  1UHW A;  2XAQ A;  1SD7 A;  4HZF A;  3WGH A;  2FQ3 A;  4I0B A;  1OMI A;  5ED4 A;  2FSW A;  4ON0 A;  2PMH A;  2H94 A;  4ESJ A;  1HSJ A;  1IW7 F;  2EFQ A;  3OV8 A;  4L5J A;  3IRR A;  1O7L A;  4HLX A;  2MA3 A;  4EQQ A;  2DT5 A;  5E20 A;  3RPU A;  3L09 A;  2EB7 A;  3HRM A;  1PP8 F;  4Y13 A;  4HF1 A;  3W6J B;  3F8C A;  2J5P A;  3KCC A;  5FGM A;  4P9F A;  2CGP A;  5E1W A;  4ETS A;  4EV0 A;  2FBI A;  1T38 A;  4MGR A;  2Z5U A;  3U9G A;  1RIO H;  4XSZ F;  3K69 A;  3WTU C;  2VT3 A;  1YLF A;  4M6X A;  4N9H A;  2KJB A;  4BXU A;  2XKP A;  2DPU A;  5EEG A;  1Z91 A;  5JI6 A;  1D8J A;  3RKX A;  5HLI A;  1IZ1 A;  1P4W A;  1U3E M;  5FFZ A;  2FMY A;  4M72 A;  4MEY F;  2LNB A;  3G3Z A;  1SD4 A;  2EA2 A;  4S05 A;  3EQL F;  3I64 A;  4MQ9 F;  3CO6 C;  1FT9 A;  5CVJ A;  3JSP A;  2EFO A;  3TO9 A;  3L2C A;  1ZAR A;  2ACJ A;  3WTV C;  2R3S A;  1UST A;  4UNO A;  3ZMU A;  2BBY A;  3FM3 A;  2HQN A;  3FMQ A;  4MTD A;  5K1Y A;  1K79 A;  2V79 A;  2JPC A;  3BZ6 A;  5J8F A;  5K5R A;  1XMK A;  4LK0 F;  2VC1 A;  1J2X A;  2FF4 A;  1YG2 A;  2PFB A;  4NHJ A;  3PFI A;  3F3X A;  3T1B A;  3HSR A;  4XLN F;  4HQE A;  1WKM A;  4IVN A;  4PGG A;  1BC7 C;  3V7C A;  5ICG A;  4EJV A;  2H27 A;  2DLL A;  1LVA A;  2STT A;  3NRV A;  1MJA A;  4UVA A;  2NNY A;  3I58 A;  4Z2Y A;  2XRN A;  5D4R A;  3F6V A;  3E6B A;  4JBA A;  5JFR A;  1FC3 A;  2W57 A;  3ZN1 A;  1XGN A;  1HQC A;  3FM5 A;  5CYV A;  3BP8 A;  1FOK A;  3I4P A;  1BIA A;  2JZY A;  4UXN A;  2IRF G;  1T39 A;  3ZMZ A;  2G7U A;  2DK5 A;  3T5X A;  4R8H A;  1ZLK A;  2HEO A;  4IHS A;  2O6G E;  4HOB A;  1R23 A;  2W84 A;  2Q0O A;  2DTR A;  4LJZ F;  4QLC U;  2FNA A;  1C0W A;  1FBQ A;  1SFX A;  4BAY A;  3R4K A;  3BJO A;  4L18 B;  1ONV A;  4JQF A;  3ZPL A;  4UVC A;  4L9V A;  4Q48 A;  4CDG A;  5J6X A;  4UV9 A;  4EM2 A;  1ULY A;  1MZB A;  5DD4 A;  2FNP A;  4GYG A;  1W5T A;  3RKY A;  2LKP A;  3IKV A;  3L00 A;  5TJJ A;  3HOS A;  1FYM A;  3MQ0 A;  1HKS A;  2FML A;  3U1D A;  2IJL A;  3U2R A;  4DQ2 A;  4IRG A;  4ZYE A;  2V1U A;  4BHP A;  4O6J A;  2P5K A;  4HDU A;  3K1P A;  3MZH A;  3GYH X;  4IRH A;  5IT3 A;  1ZHF A;  1PUE E;  2Y48 A;  1TQM A;  3CUQ C;  1G3Y A;  3FF5 A;  1DPR A;  2GA1 A;  5L3E A;  4ENM A;  5FO5 A;  4IRI A;  1SAX A;  5LEJ A;  3R0J A;  1O3R A;  1QGP A;  3BWG A;  2QWW A;  4L0Z B;  2C6Y A;  1IN8 A;  4IHT A;  2J5O A;  1KU7 A;  2QQ9 A;  1FYL A;  4B8X A;  2MD5 A;  4L9T A;  5BPD A;  2RGV A;  1BN5 A;  2KIF A;  4L0Y B;  1GXP A;  5HS9 A;  1YO5 C;  5HLH A;  5BPI A;  4A5N A;  2Q2E A;  3E6C C;  3K1M A;  2XAJ A;  3GFL A;  2RVC A;  2FXA A;  3TDZ C;  1BIB A;  2QQB A;  2LSO A;  5HDN A;  1OYI A;  1TBX A;  1B9M A;  1LNW A;  2Y75 A;  3E97 A;  2CSO A;  4RGU A;  2LF7 A;  4LD5 A;  4R1H A;  2QBY B;  4LK1 F;  5HDK A;  4XLP F;  5DCM B;  4LFU A;  3VEP A;  3WTS C;  4KA4 A;  1G3T A;  1KU9 A;  3HHH A;  2HKO A;  4QWQ A;  4ESB A;  2DW4 A;  1BI3 A;  3TDU C;  1HW1 A;  2CYY A;  4ENN A;  2O8X A;  3GF2 A;  5BMZ A;  1ZAO A;  2OZ6 A;  1R1T A;  1MGT A;  1EH7 A;  4U88 A;  2DBB A;  5LGU A;  3WGI A;  3HOT A;  1KU2 A;  3IL2 A;  3J80 Z;  5L3G A;  1BC8 C;  1RZ4 A;  4RB2 C;  5DD8 A;  1P4X A;  3JW4 A;  2EJR A;  2M87 A;  1MD0 A;  1KYZ A;  1JHF A;  4D0P A;  4YFK F;  4CO8 A;  2M30 A;  1Z6T A;  1R1V A;  5E18 F;  3MEX A;  4G6Q A;  3R6S A;  4EGY A;  4HDV A;  2H6C A;  3QP5 A;  3M1E A;  2JTV A;  2OA4 A;  4YIF A;  2G9W A;  4N0B A;  2ZNZ A;  3DXJ F;  2ZXJ A;  5J8C A;  2FOK A;  1BBY A;  3KP7 A;  4XSX F;  2L4M A;  1QO0 D;  2YSR A;  1QZY A;  2KRF A;  3I59 B;  4IPA A;  3J81 Z;  3TOB A;  1KQ9 A;  3OOP A;  3HTS B;  4Q4Z F;  5FLX Z;  4U0Y A;  2A3S A;  2JT1 A;  4FX4 A;  3IWZ A;  1Y0U A;  2VXZ A;  2EWN A;  3FMR A;  1QPM A;  2RKH A;  4OIQ F;  1HKT A;  4GO1 A;  2OQG A;  4LB6 B;  4GYI A;  1Z9C A;  2A6H F;  2Z9O A;  2UXX A;  1CF7 A;  2L3D A;  1SMT A;  1R36 A;  1AWC A;  2XUB A;  3I59 A;  4MQV A;  5E17 F;  2QYO A;  1JXS A;  3ISP A;  3LAP A;  3LQQ A;  1JGS A;  1JE8 A;  3KP5 A;  4AIH A;  3WTW C;  1KGS A;  3QP6 A;  1IN6 A;  4A5M A;  2HTJ A;  4HX7 A;  3VOD A;  1PP7 U;  1HKQ A;  5F64 A;  5D8K B;  4WXH A;  1O3S A;  3REO A;  5HS8 A;  2ZJ2 A;  4RB1 A;  2Z99 A;  3KZY A;  2OU2 A;  3LAJ A;  2VT2 A;  5D8L B;  2E7W A;  3O3K A;  1T6S A;  4AIJ A;  1U5T C;  3FXR A;  3BJ6 A;  4KIG A;  1J0R A;  2YU3 A;  1XDS A;  4RB3 C;  1OPC A;  2WV0 A;  4ASN A;  1WSU A;  4MTE A;  5KK1 A;  1K7A A;  2W24 A;  4WWC A;  5CVV A;  4M73 A;  1FLI A;  5LRR A;  3ZN0 A;  4I98 B;  2DFI A;  3TGN A;  5D5W B;  1FZP B;  2E1N A;  5IT9 K;  2A61 A;  2FBH A;  3WTX C;  2EA4 A;  4HW0 A;  3H3U A;  1MKM A;  5L3C A;  2XV4 S;  1H9G A;  2EV0 A;  2GA2 A;  4LLN A;  3ZP5 A;  3TQN A;  2XRO A;  2QZ8 A;  3E5U A;  1NHA A;  3ULQ B;  3EUH A;  3GX4 X;  2EV6 A;  1V4R A;  2PBI A;  1LDK B;  3HYI A;  1W4M A;  4U0V A;  4AWX B;  2PN6 A;  4OMZ A;  1ZRE A;  2EFP A;  5JR3 A;  1ZGJ A;  4P96 A;  2VE9 A;  3SHF A;  1Z6R A;  2ADU A;  4HQM A;  4ESF A;  4L9N A;  3FXU A;  1YYV A;  4E70 A;  2W85 A;  3COA C;  4PZJ A;  3KET A;  4WXC A;  4RGR A;  3BPX A;  3LA7 A;  4P9U A;  4CZZ A;  1IAW A;  4ENJ A;  2P7C B;  1V3F A;  2B0L A;  2HYF A;  2F5E A;  1I27 A;  4YFX F;  3V7R A;  5DCM A;  5KVR A;  4OIP F;  4G7H F;  1R7J A;  1RI7 A;  3B73 A;  1G6N A;  1FBU A;  4A2U A;  1F9N A;  1ZLJ A;  2V6C A;  5D5X B;  4I02 A;  2K4B A;  2HDC A;  3F23 A;  2PQ8 A;  1H0M A;  4HV6 A;  3DF8 A;  1U5T B;  1B1B A;  3S2W A;  1UCR A;  4ZZL A;  1XGO A;  3RKW A;  2RDP A;  2LF8 A;  4XBF A;  1XGM A;  3NQO A;  5DDG A;  2NYX A;  2QLZ A;  1TLH B;  1ZG5 A;  2E7X A;  4EM1 A;  3F6O A;  2RNJ A;  3JAM K;  3DFG A;  4OOI A;  6PAX A;  1O7F A;  4RGX A;  4HF2 A;  2R7D A;  3BDD A;  4Q47 A;  1OYY A;  2ESH A;  5JHU A;  1E17 A;  4A0X A;  5HLG A;  4KIB A;  5LHI A;  3ABT A;  1MJB A;  3I5U A;  1YFH A;  3LA2 A;  3V8L A;  3M7G A;  2DI3 A;  3HSF A;  5L3B A;  2P4W A;  1FBS A;  3SZP A;  5E1X A;  3ECO A;  2MLG A;  3WTT C;  1ZG1 A;  2UXN A;  2M1B A;  4M9Z A;  1S29 A;  4RAY A;  5DV5 A;  4LG0 B;  3MCZ A;  1GHC A;  4KIF A;  2RN7 A;  2YX7 A;  3HHG A;  2BE5 F;  3RI4 A;  3ABU A;  3LWF A;  2VBW A;  4LLG F;  2BYV E;  1EH6 A;  4HV5 A;  4WK8 F;  2ZKZ A;  2HZT A;  1P92 A;  3KEQ A;  3N97 A;  1TTY A;  3DQV C;  1R5G A;  2X4H A;  1HW5 A;  2KKO A;  1SFE A;  3ELK A;  2MC3 A;  4I0A A;  1Z1D A;  1USS A;  2F5C A;  2QVO A;  4HAM A;  2HFH A;  2K4J A;  4KYW A;  2QQA A;  3IRQ A;  3GLX A;  3VB2 A;  5LRS A;  1QZZ A;  5LGN A;  2K7L A;  4F7Z A;  1L3L A;  2XAH A;  1IXC A;  1EV7 A;  2ZO4 A;  5BS6 A;  1YW8 A;  1MJ9 A;  1YS6 A;  1KQ8 A;  3E5Q A;  5H20 A;  3IHU A;  1XB4 A;  1XMA A;  4PDK A;  5L3F A;  3J80 K;  2ESN A;  1XN7 A;  4BHC A;  2DO7 A;  1YIO A;  3L9F A;  2OQR A;  4KMU X;  5BOX A;  1P2F A;  3KEO A;  2H6B A;  3SFZ A;  3QOP A;  3E5X A;  1F5T A;  5F6F A;  1H9T A;  1VTN C;  1CF7 B;  3O2P E;  3JTG A;  1T2K A;  3WG9 A;  1X3U A;  4LMY A;  1EH8 A;  2D1H A;  4YFN F;  3RDI A;  3GW2 A;  4OIN F;  3FX3 A;  3FHZ A;  5E8G A;  1IN7 A;  1F4K A;  5LBQ A;  2Z3Y A;  2IT0 A;  1BI2 A;  4WXD A;  3TKY A;  3I54 A;  2L01 A;  1TW3 A;  2F5F A;  4HLY A;  4O3M A;  2MH2 A;  4LLL A;  4ZYD A;  1WQ2 A;  3WU0 A;  1WI9 A;  2EV5 A;  3GXO A;  4I01 A;  4UV8 A;  5DEQ A;  1IXS B;  1RNL A;  1Z05 A;  2G7H A;  4WCG A;  5TRD A;  4A0Y A;  2CW0 F;  1B9N A;  2P6T A;  2DQR A;  1XCV A;  4ZZD A;  3PQK A;  4Y17 A;  1ZG3 A;  2K86 A;  4MEX F;  3R61 A;  4FX0 A;  2BEO A;  1FYK A;  4RB0 A;  3MFK A;  3ERE D;  1O57 A;  2CQK A;  3F22 A;  2IW5 A;  2Y0M A;  4EVI A;  3BOQ A;  3RPQ A;  3CO7 C;  2VBY A;  5H6R A;  4R79 A;  3TOA A;  2QUF A;  1LJ9 A;  5DUI A;  5DUK A;  1T98 A;  4IF4 A;  2YPR A;  4PGH A;  3KLN A;  3QPT A;  1XSD A;  2QBY A;  3G73 A;  2JSC A;  3FMS A;  4AVP A;  5E1Z B;  4BNC A;  2MBF A;  1IRF A;  1QQI A;  1TNS A;  2GQQ A;  2FBK A;  4B09 A;  1QBJ A;  1GVJ A;  3DPL C;  2AS5 F;  3H92 A;  1U78 A;  2X0L A;  5CLS A;  1R58 A;  4NQW A;  3KP3 A;  1UB9 A;  2FA5 A;  5A2Q Z;  5HDG A;  4GCV A;  4CGZ A;  1I6X A;  2IVM A;  2XAS A;  2PEX A;  1KYW A;  1U6G A;  3F8F A;  1LQ1 A;  3DPT A;  2QM3 A;  2K27 A;  2VBZ A;  1S3J A;  3E3V A;  2VE8 A;  5IT9 Z;  4HX8 A;  1J7K A;  3BPV A;  2F2E A;  2XIG A;  2PI0 A;  5AIQ A;  2VC0 A;  3QU6 A;  4UUV A;  5ERI A;  3RYR A;  2KJC A;  3GWZ A;  1SD5 A;  4EJU A;  4HF0 A;  3EET A;  1XD7 A;  3B02 A;  3GUD A;  4CYD A;  4I09 A;  1IN4 A;  1HBX G;  4L9J A;  4S04 A;  1D5V A;  2XGX A;  2RQP A;  2D45 A;  2HTS A;  5D6F A;  4ZH4 F;  1D3Y A;  1I1S A;  2YX4 A;  1RUN A;  2FRH A;  3HSE A;  5ICE A;  1FSH A;  2M5W A;  2CG4 A;  4CHU A;  5EEH A;  2R7F A;  2XAF A;  3HRS A;  4WF2 A;  4G7O F;  3PQJ A;  2HQR A;  3LFK A;  4MHG A;  5ICC A;  1ZRC A;  2WWY A;  2E1C A;  2NNN A;  1S6L A;  3WE3 A;  1KU3 A;  4P5O A;  1IN5 A;  3K9T A;  1GXQ A;  3ZQ7 A;  3Q5F A;  1FP1 D;  2Q8K A;  2VOP A;  3I53 A;  3KLO A;  3LST A;  4AD9 A;  4EMS A;  4HBL A;  4CXF A;  1MDM B;  3M8F A;  2M8E A;  1XSX A;  4HA8 A;  3MAJ A;  1YW9 A;  3CUO A;  1ON2 A;  3IWF A;  1LDJ A;  3SZT A;  2ISY A;  2ZNY A;  4A12 A;  1IRG A;  4IXA A;  1W5S A;  4M9X A;  1A04 A;  4M6Y A;  3NEU A;  2ZME A;  2MH9 A;  2OD5 A;  2Z33 A;  1W7P A;  3H3Z A;  2GAU A;  2KIU A;  2HS5 A;  5ICF A;  2D2W A;  4HYE A;  1LB2 A;  2ZCW A;  2O03 A;  1K6O A;  3HUG A;  4U7D A;  4U7B A;  1YQA A;  3D0S A;  2HWV A;  3JAM Z;  2V9V A;  5HOO A;  2D1V A;  4BH9 A;  1XSV A;  4UHT A;  4G94 A;  3AAF A;  3GEZ A;  2P8T A;  3K0L A;  3K1N A;  3MZY A;  5FFX A;  2L54 A;  4Q5S F;  5CJ9 A;  1BM9 A;  3J81 K;  1AOY A;  4I7H A;  3HIF A;  1SFU A;  1W7P B;  1LEB A;  1Q1H A;  2A68 F;  4HX4 A;  3RTR A;  5D5V B;  2L02 A;  3RJP A;  5LHH A;  1TW2 A;  4N9I A;  2LDU A;  3I71 A;  4G6D A;  5HVQ C;  2DU9 A;  3K2Z A;  4EJO A;  4U0W A;  2K02 A;  1U8R A;  2RV8 A;  4FT8 A;  4M71 A;  2IA2 A;  1BOA A;  1YS7 A;  1O3T A;  4JK1 X;  4LG0 A;  3V7S A;  4OU0 A;  3P9I A;  4NB5 A;  1DPU A;  3E6M A;  4CIC A;  1R00 A;  5L3D A;  2XAG A;  2COM A;  1ZN2 A;  2ETH A;  2WTE A;  1CGP A;  2GXG A;  1XDU A;  3GFI A;  1D8K A;  1R5H A;  2PG4 A;  1G3S A;  4EJW A;  3C3W A;  5LLQ A;  3ML6 A;  3N4M A;  3MWM A;  4ENK A;  2L4A A;  2IA0 A;  1S8N A;  2OAZ A;  3BY6 A;  3KP6 A;  1Z7U A;  1FPQ A;  1LDD A;  4MNU A;  2XHK A;  2ZME B;  5ILV A;  5FD6 A;  3IC7 A;  2ZBK A;  1FNN A;  4UVB A;  3QPH A;  1G4D A;  1ZRF A;  3WGG A;  1HST A;  2CFX A;  3L7W A;  5DYM A;  4OIO F;  3R0A A;  3KP2 A;  3LA3 A;  3C7J A;  2WC2 A;  3CTA A;  4Y15 A;  1QNT A;  1SMY F;  1XCB A;  2A5Y B;  1DP7 P;  2CO5 A;  3P7N A;  3IKT A;  3WOD F;  3EDP A;  2IP2 A;  1I1G A;  5AIP A;  1S7A A;  2M45 A;  4BQA A;  3WTZ A;  2PJP A;  1SD6 A;  4A0Z A;  1K78 A;  3ECH A;  4M74 A;  4GGG A;  3EYI A;  3HRU A;  3F8M A;  1KQ0 A;  3GZ5 A;  1WRJ A;  2UZK A;  5LEK A;  1IXR C;  5CVI A;  4KN7 X;  3RYP A;  2DPD A;  5H6Q A;  3F21 A;  1XGS A;  4EM0 B;  5BQT A;  3E6D A;  1JHH A;  3SXY A;  1E2X A;  2GXB A;  1I5Z A;  1FWZ A;  2OBP A;  3CUQ A;  3JSO A;  3ZMS A;  5K5Q A;  3P9K A;  3CUQ B;  2O0Y A;  1J59 A;  4EGZ A;  4IJA A;  1TNT A;  3FWE A;  2RC4 A;  2BV6 A;  2V1X A;  2W25 A;  2GZW A;  3GZ6 A;  2FE3 A;  4KUM A;  1IF1 A;  1J9I A;  4ZYH A;  2DAO A;  3ROU A;  2QEN A;  1ZRD A;  1REP C;  5FD5 A;  5AON A;  3C1D A;  3DEU A;  4L5I A;  2O3F A;  2FEZ A;  4LGW A;  3GO5 A;  3V8K A;  4AIK A;  1B6A A;  1KA8 A;  2JPB A;  4KMF A;  5D4S A;  3F72 A;  1P6R A;  3TO7 A;  5CVR A;  1LEA A;  3T0Y A;  4BYY A;  4A6E A;  3FXQ A;  5FB2 A;  3T8R A;  2GWR A;  3Q9V A;  4M9S A;  3GVA A;  2ISZ A;  1J5Y A;  2JRT A;  2OZU A;  1G3W A;  2BGC A;  1FP2 A;  4KIC A;  1UHM A;  4RGS A;  5D5U B;  3QAH A;  3GFM A;  3ZMT A;  1ZYR F;  2VBX A;  1HXD A;  1R22 A;  3VFZ A;  3FZV A;  1DDN A;  1U2W A;  1RUO A;  3KZZ A;  1U5T A;  4RS8 A;  4LB5 A;  5A2Q K;  2ELH A;  1STZ A;  1BI1 A;  3CJN A;  4OMY A;  4I2O A;  2F5D A;  1HW2 A;  3HTU A;  2NAZ A;  2HOE A;  3ZMD A;  1J75 A;  3M9A A;  5CVU A;  4KT5 C;  2NRA C;  4H0E A;  1ON1 A;  2P6S A;  3M8E A;  3CDH A;  2PLY A;  1BJA A;  5ILU A;  1OKR A;  2TDX A;  2VN2 A;  3J7A O;  2KIM A;  1W7P D;  1ODD A;  3BRO A;  4P55 A;  3ZMV A;  3V4G A;  3WU1 B;  4FHT A;  1PDN C;  1MDM A;  2ZFW A;  5FLX K;  2DQL A;  3KP4 A;  1FSE A;  4KDP A;  5D6E A;  3TO6 A;  1TQP A;  3F8N A;  4G9Y A;  3Q9S A;  4YII A;  4O5V A;  3GFJ A;  3DKW A;  4A6D A;  1P4A A;  1ZGA A;  1YW7 A;  3CLO A;  2STW A;  2A07 F;  3V8J A;  3RIR A;  2MLK A;  3O6B B;  1K78 B;  3WTY C;  5DCF A;  2VOD A;  4KN4 X;  2AXL A;  2IA1 A;  1UFM A;  2PMU A;  1S7O A;  5JVT A;  5ILS A;  3P9C A;  2XKO A;  3QU3 A;  3W6K B;  2NS0 A;  3VOE A;  4KFC A;  3F8B A;  5E8I A;  2XVC A;  3DP7 A;  2V1D A;  3WE2 A;  3KE2 A;  2VOO A;  1L0O C;  5LGT A;  1FX7 A;  4XRF A;  4G8X A;  1ZH5 A;  1F1Z A; 
#chains in the Genus database with same CATH topology
 2X6Y A;  2VJI A;  2CU7 A;  3LQR A;  3W2V A;  5HS7 A;  2JA8 J;  1ITY A;  1T0F A;  1DUX C;  4NC8 A;  5GAH J;  1YTY A;  1OYW A;  2H09 A;  3F9K A;  4ZYG A;  3TBI A;  2DFF A;  1X1A A;  3W6V A;  2HNH A;  3EYY A;  3BJA A;  4TV7 A;  4BY7 J;  4PSW A;  1VI0 A;  2EK5 A;  4E7H A;  2HKX A;  1B59 A;  2X6W A;  1BI0 A;  3R60 A;  5LHG A;  1O3Q A;  4A3L J;  2VJJ A;  3I9V 2;  1OR7 C;  1IUY A;  3ONQ A;  2HR3 A;  1MBF A;  4OIR F;  4RAZ A;  1GDT A;  1ETY A;  4ZTJ A;  3TW6 A;  1T33 A;  4PCQ A;  2OV7 A;  2ZJP F;  2HVQ A;  3KFW X;  3D5L A;  3HRT A;  1OJL A;  4CH7 A;  5EEA A;  1R49 A;  2HYG D;  3MVP A;  5F27 A;  2VON A;  3DV8 A;  4PJN A;  3T8T A;  5F1R A;  4KNY A;  5DTD A;  3BTL A;  1H8A C;  2DT7 B;  3NAU A;  1UMQ A;  3B6C A;  2KIS A;  1IDY A;  1TQI A;  2VLA A;  2P7V B;  2A6E F;  3GTG J;  2HGC A;  4BXX J;  4K2E A;  1M1E B;  2P5V A;  2IPQ X;  3C18 A;  4HG2 A;  4ITV A;  4DNC A;  2P5L C;  3JRC A;  1OR7 A;  4XNF A;  2GIV A;  1S9H A;  4G7Z F;  2O61 A;  2M4G A;  2OCE A;  2FU4 A;  1UG2 A;  2QQ8 A;  1J09 A;  3SQN A;  2B63 J;  1QHG A;  4GXO A;  1HOM A;  3VSK A;  3M3Y J;  3S1M J;  1FY7 A;  1B4A A;  4WX9 A;  1ERD A;  2EFW A;  1WWX A;  3OIP A;  2YR2 A;  4XRS G;  4EJT A;  2M3A A;  4E7Z A;  3QRF F;  2DK8 A;  1WJB A;  3JTH A;  2A69 F;  2LVS A;  1T0F C;  2I8D A;  2EFN A;  2XF7 A;  1E3H A;  4YG2 F;  1JKR C;  1GV5 A;  1U0J A;  3I0T A;  4LG3 A;  4BHB A;  5K5O A;  1A6I A;  2XGC A;  4J19 A;  2WA0 A;  2JJ7 A;  1QVU A;  1R1U A;  3H0G J;  3K4M A;  2UWM A;  2EZH A;  2E2H J;  3SZG A;  2CWE A;  1UHW A;  2XAQ A;  1SD7 A;  4HZF A;  3WGH A;  3RZD J;  1ETO A;  1YJ9 I;  2FQ3 A;  4I0B A;  3OS2 A;  3V42 A;  1OMI A;  5ED4 A;  4ZC3 A;  1DU6 A;  4C2T A;  2FSW A;  4ON0 A;  3RQ4 A;  1K4S A;  3L2W A;  2PMH A;  2H94 A;  4ESJ A;  1HSJ A;  1OQY A;  1WFX A;  3G71 I;  1HF0 A;  4UUT A;  2L2O A;  1IW7 F;  2EFQ A;  3OV8 A;  4L5J A;  4JX5 A;  3IRR A;  1O7L A;  2R7Q A;  4HLX A;  4MLO A;  2ME6 A;  1TT5 B;  2MA3 A;  3BCB A;  4EQQ A;  4E7K A;  2DT5 A;  4U87 A;  1VQN I;  5E20 A;  1SEU A;  2VI6 A;  3RPU A;  3L09 A;  2EB7 A;  4QPQ A;  3HRM A;  2V9K A;  5IP6 A;  1WPK A;  4XK4 A;  1VQK I;  1PP8 F;  4Y13 A;  4HF1 A;  3CCE I;  3W6J B;  3F8C A;  5M5X J;  2J5P A;  3KPH A;  3KCC A;  5FGM A;  4A3K J;  4RAF A;  3ABK H;  4P9F A;  2CGP A;  5E1W A;  4ETS A;  4EV0 A;  2FBI A;  4IOA F;  1T38 A;  2H8R A;  1IG7 A;  4MGR A;  4HST A;  3RSN A;  2Z5U A;  3U9G A;  2JN6 A;  1RIO H;  3NWS A;  4XSZ F;  3K69 A;  3Q0W A;  3WTU C;  2JRM A;  1YLF A;  2VT3 A;  4M6X A;  4IL6 C;  1JKQ C;  4N9H A;  2KJB A;  4OAY A;  4BXU A;  2XKP A;  5GTH C;  2DPU A;  5EEG A;  1Z91 A;  3FXK A;  4ABZ A;  2D5V A;  2IGO A;  3OMY A;  4A69 C;  5JI6 A;  1D8J A;  3PNT A;  2JA5 J;  3RKX A;  4HSR A;  5HLI A;  1IO2 A;  1IZ1 A;  1P4W A;  1U3E M;  3H36 A;  5FFZ A;  2R7U A;  2FMY A;  4M72 A;  4MEY F;  2DA4 A;  2LNB A;  3G3Z A;  3DTE A;  1SD4 A;  2R5Z B;  2EA2 A;  4S05 A;  3EQL F;  3S8P A;  3I64 A;  3ZQC A;  4MQ9 F;  3H9J A;  3CO6 C;  1FT9 A;  4IOC F;  5CVJ A;  3JSP A;  2EFO A;  3TO9 A;  3L2C A;  1ZAR A;  3LSK A;  2ACJ A;  3WTV C;  2R3S A;  2K3F A;  2MD0 A;  1UST A;  4UNO A;  2EZL A;  3ZMU A;  1QRY A;  2BBY A;  1FTZ A;  5M5Y J;  3FM3 A;  2HQN A;  3FMQ A;  4MFE A;  4BEH B;  1T95 A;  4MTD A;  5K1Y A;  1K79 A;  2V79 A;  2JPC A;  3BZ6 A;  4D5F A;  1OCR H;  5J8F A;  3IAM 2;  3DEE A;  4PUS A;  3VYT B;  5K5R A;  1XMK A;  2DJI A;  4LK0 F;  1SVL A;  4CYC B;  2VC1 A;  1J2X A;  2FF4 A;  1YG2 A;  2PFB A;  4GRI A;  2E60 A;  4NHJ A;  3PFI A;  3F3X A;  4NC6 A;  4XOP A;  4C3I J;  3VSL A;  4M6V A;  3T1B A;  3HSR A;  4XLN F;  4HNT A;  4RM2 A;  4HQE A;  2P81 A;  1WKM A;  4IVN A;  4PGG A;  1G59 A;  2ZSI B;  3V7C A;  1BC7 C;  2K5C A;  2G0E A;  5ICG A;  3CF2 A;  4EJV A;  2H27 A;  1OCO H;  4LOC A;  3BR3 A;  2DLL A;  1LVA A;  3A01 A;  2STT A;  1ZGW A;  3NRV A;  1MJA A;  4UVA A;  3PNY A;  2NNY A;  1MW7 A;  2FUG 2;  3I58 A;  4Z2Y A;  3HL2 A;  4J00 A;  2E2J J;  2VPR A;  1XC5 A;  2XRN A;  5D4R A;  3F6V A;  3E6B A;  4JBA A;  3OR1 C;  2WAQ N;  3ZQL A;  3FIS A;  5JFR A;  1UAA A;  2DMQ A;  5FRN A;  1FC3 A;  2DDA A;  2X1E A;  1AU7 A;  3S3N A;  1D0Z A;  2W57 A;  3CLQ A;  3ZN1 A;  1XGN A;  3MN2 A;  3OYA A;  1HQC A;  1P7I A;  1I3A A;  1MIJ A;  3FM5 A;  5CYV A;  3BP8 A;  5J4Y A;  5F1J A;  1FOK A;  3I4P A;  1BIA A;  2JZY A;  1VND A;  4UXN A;  4AUX A;  4XN3 A;  1MBJ A;  2IRF G;  1T39 A;  3ZMZ A;  1MBH A;  2G7U A;  2W1O A;  1PUF A;  2IEK A;  4FCY A;  4Y7N J;  2DK5 A;  3T5X A;  4R8H A;  1SAN A;  4UB6 C;  1ZLK A;  4YIR X;  2HEO A;  4IHS A;  2O6G E;  4HOB A;  1R23 A;  2TCT A;  2W84 A;  2Q0O A;  2DTR A;  1G2H A;  4LJZ F;  4QLC U;  1Y0N A;  2FNA A;  4D1Q A;  3LSM A;  1C0W A;  1FBQ A;  2ZJR F;  1SFX A;  4BAY A;  3R4K A;  2ID6 A;  3BJO A;  4L18 B;  2MAB A;  1VF9 A;  3OSG A;  3CJT B;  4RBO A;  1ONV A;  1X3Z B;  4JQF A;  2E71 A;  3ZPL A;  1E3P A;  2OC6 A;  4UVC A;  4L9V A;  4FQG A;  4Q48 A;  4CDG A;  5J6X A;  2ICW G;  4UV9 A;  4PJJ A;  1ULY A;  4EM2 A;  2F5V A;  1MZB A;  4CCJ A;  2WAF A;  3FXJ A;  5DD4 A;  2FNP A;  4GYG A;  1JTX A;  3PM1 A;  3CCM I;  1W5T A;  3RKY A;  1XS9 A;  2LKP A;  3IKV A;  3L00 A;  4ZYA A;  1FEX A;  5TJJ A;  1ACI A;  1EKE A;  3HOS A;  1FYM A;  3MQ0 A;  1POG A;  2VIX A;  1HKS A;  2FML A;  2X51 A;  3U1D A;  3ERM A;  2IJL A;  1A5J A;  2KMU A;  3U2R A;  3BZK A;  2MC4 A;  4DQ2 A;  4IRG A;  3H5N A;  4ZYE A;  2V1U A;  2WBM A;  4O6J A;  4BHP A;  2P5K A;  2DTZ A;  5KAF C;  4HDU A;  3K1P A;  4XQF A;  3MZH A;  3S16 J;  3GYH X;  4IRH A;  1FOX A;  5IT3 A;  1ZHF A;  1PUE E;  2Y48 A;  3FDY A;  3AG4 H;  2EQR A;  1TQM A;  3CUQ C;  1G3Y A;  2B9S A;  3FF5 A;  1DPR A;  3ZXS A;  2GA1 A;  5L3E A;  4ENM A;  4AYB A;  1QZE A;  2K9M A;  4XIC A;  4E7S A;  5J3L A;  3WU2 C;  5FO5 A;  4IRI A;  1SAX A;  1Z3X A;  3DBL B;  2EH3 A;  3PO3 J;  5LEJ A;  5EGO B;  4AU7 A;  3R0J A;  2K40 A;  1O3R A;  1QGP A;  3ABM H;  3BWG A;  2QWW A;  4L0Z B;  2VQL A;  2C6Y A;  1IN8 A;  2DA6 A;  1K6Y A;  3OYG A;  2XF5 A;  4HNU A;  4IHT A;  5J40 A;  2PJR B;  2WY8 Q;  2KFD A;  3S93 A;  2J5O A;  1KU7 A;  5F0C A;  1MH3 A;  2QQ9 A;  4BDY A;  1FYL A;  1V55 H;  4B8X A;  3HOU J;  1FTT A;  4UUS B;  4E7L A;  2MD5 A;  2KHM A;  1GLN A;  4L9T A;  4XN0 A;  2CUF A;  5BPD A;  2GLO A;  2RGV A;  5EZG A;  3JRD A;  1BN5 A;  2KIF A;  4L0Y B;  1GXP A;  5HS9 A;  2HZD A;  3QQA A;  1YO5 C;  1MMN A;  1R9T J;  5HLH A;  1X1P A;  5BPI A;  3HBL A;  4A5N A;  1YJN I;  3DU6 A;  2Q2E A;  3E6C C;  4IQJ A;  3K1M A;  1WJ5 A;  3BG7 A;  1ETQ A;  3GFL A;  2QKL B;  2XAJ A;  1FMW A;  2RVC A;  2FXA A;  4OAZ A;  1LFP A;  3TDZ C;  4BE2 A;  5JHF A;  3W3C A;  1VQM I;  1BIB A;  3B6A A;  5EF6 A;  2QQB A;  2LSO A;  4BGD A;  5HDN A;  1OYI A;  1TBX A;  2Q1Z B;  1B9M A;  1LNW A;  2Y2Z A;  2Y75 A;  3E97 A;  2CSO A;  1OLT A;  2CW8 A;  5EDN A;  4RGU A;  2LF7 A;  4LD5 A;  4R1H A;  2QBY B;  4LK1 F;  4II3 A;  1T56 A;  5HDK A;  2CQQ A;  2E5N A;  4XLP F;  3BT9 A;  5DCM B;  3P5J A;  1JTY A;  2JWT A;  4LFU A;  1MBG A;  3VEP A;  4AC0 A;  3VDX A;  3WTS C;  5JVG F;  4KA4 A;  1G3T A;  2WB1 N;  1QVT A;  4RAG A;  3BCA A;  2OTJ I;  1KU9 A;  1Y56 A;  4YRV A;  3BTI A;  1VQP I;  3IH2 A;  3HHH A;  2HKO A;  1U9N A;  1WH7 A;  1YJW I;  4G12 A;  2DA7 A;  4QWQ A;  4ESB A;  3LFU A;  4PK4 A;  3JRI A;  2DW4 A;  1BI3 A;  1BR4 A;  2BXY A;  2Y31 A;  3TDU C;  1HW1 A;  3H5R A;  2CYY A;  4F91 B;  1N75 A;  4ENN A;  2O8X A;  3GF2 A;  5BMZ A;  1ZAO A;  2OZ6 A;  3O8H A;  4BL0 B;  4XM3 A;  1R1T A;  2O5R A;  1MGT A;  2GM4 A;  1EH7 A;  1X3W B;  4U88 A;  4F3Q A;  3CMY A;  1VQ4 I;  2DBB A;  5LGU A;  3WGI A;  5GP9 A;  3HOT A;  3A1Y A;  1KU2 A;  1E0E A;  2DJN A;  3DLL F;  3J7Y J;  3IL2 A;  3J80 Z;  4DZJ A;  4B43 A;  1MSE C;  5EZH A;  5L3G A;  3UKG A;  1BC8 C;  1VQL I;  5HLT A;  1RZ4 A;  1TL8 A;  4RB2 C;  1I6H J;  2F48 A;  4BQQ A;  5DD8 A;  1P4X A;  3JW4 A;  4IHX A;  4Y33 A;  2EJR A;  2M87 A;  2YU9 J;  1MD0 A;  1OCC H;  2OF7 A;  2HPI A;  1HDD C;  1KYZ A;  1JHF A;  2R7W A;  4X1E A;  4D0P A;  4YFK F;  2R7V A;  4CO8 A;  1Y8R B;  2X1D A;  1YRN A;  1LE8 A;  3TMO A;  2KZG A;  3AG2 H;  1EJ9 A;  1NG6 A;  2M30 A;  3FBN B;  1R1V A;  1Z6T A;  2I5U A;  5E18 F;  5HNH A;  2BZT A;  5CPR B;  2DDB A;  4KIT B;  3MEX A;  1V5G A;  2DOF A;  4G6Q A;  3R6S A;  3RPU D;  1R5I D;  4EGY A;  2MGQ A;  3NWT A;  2H6C A;  4HDV A;  2Q2E B;  2DA3 A;  1AKH B;  3QP5 A;  3M1E A;  2I10 A;  2ECC A;  2JTV A;  2OA4 A;  2KP6 A;  3CDI A;  4YIF A;  2G9W A;  3PSF A;  3A02 A;  4N0B A;  2ZNZ A;  1Z21 A;  3DXJ F;  2HYJ A;  2ZXJ A;  2CV0 A;  5J8C A;  2FOK A;  1BBY A;  3KP7 A;  1X2M A;  4XSX F;  2LBF A;  2L4M A;  4JOM A;  1QO0 D;  2YSR A;  1QZY A;  2F4I A;  2KRF A;  3I59 B;  4IPA A;  3J81 Z;  3TOB A;  2L7F P;  1TZL A;  1S72 I;  1KQ9 A;  3OOP A;  2PJR A;  1TWH J;  3HTS B;  4CUG A;  4Q4Z F;  3DBH B;  1IDZ A;  2DYS H;  4C9Y A;  2Y0S N;  5FLX Z;  3CCS I;  3QPL A;  5JLW A;  4XLF A;  2L7K A;  4U0Y A;  2A3S A;  2JT1 A;  3JR9 A;  4FX4 A;  3IWZ A;  1Y0U A;  9ANT A;  2LD5 A;  3JRA A;  2VXZ A;  2EWN A;  2LR8 A;  3FMR A;  1QPM A;  2RKH A;  4L5E A;  4C3J J;  2R7Z J;  3PIO F;  2A6T A;  1OFC X;  3LSJ A;  4OIQ F;  4I76 A;  4XR6 A;  1HKT A;  4GO1 A;  1BW5 A;  2OQG A;  3OOU A;  4LB6 B;  1AHD P;  2GXA A;  5E79 C;  4GYI A;  4YEL A;  2A6H F;  1Z9C A;  1X1B A;  2Z9O A;  3BR6 A;  4JYK A;  3K4L A;  2DN0 A;  2UXX A;  3M4O J;  2JVG A;  3AG1 H;  1CF7 A;  3PFY A;  3CDL A;  5C4J J;  2L3D A;  1D1B A;  3MD2 A;  4M3D A;  1SMT A;  1R36 A;  1AWC A;  1HA8 A;  2XPW A;  2XUB A;  4A3I J;  3I59 A;  4MQV A;  5E17 F;  2QYO A;  1JXS A;  1I3Q J;  3ISP A;  3LAP A;  3KEY A;  2IGK A;  2V4J C;  3C2H A;  3LQQ A;  1JGS A;  3CP2 A;  4IZZ A;  2LMD A;  5DM7 F;  1JE8 A;  3KP5 A;  4AIH A;  3WTW C;  1KGS A;  2M0C A;  3QP6 A;  5IP7 J;  1IN6 A;  4A5M A;  2M8G X;  3PUF A;  2HTJ A;  1VQO I;  1JT0 A;  4HX7 A;  1KON A;  3VOD A;  1PP7 U;  2YS9 A;  3GTM J;  1HKQ A;  3OYE A;  5F64 A;  5D8K B;  4WXH A;  1O3S A;  1MND A;  3REO A;  2W7N A;  5HS8 A;  3IUO A;  4A3E J;  3CD6 I;  2QEX I;  2LY2 A;  2JUG A;  2ZJ2 A;  1XTA A;  2Z2S B;  4RB1 A;  2Z99 A;  1PJR A;  2E1O A;  3KZY A;  2OU2 A;  3CES A;  3FXM A;  2KRH A;  1LUJ B;  5FKN A;  3LAJ A;  2VT2 A;  5D8L B;  1TWF J;  2XB5 A;  1OIS A;  2E7W A;  3AFH A;  3O3K A;  1T6S A;  3HGY A;  5IY5 H;  3CQZ J;  4AIJ A;  1U5T C;  5FRO A;  3FXR A;  1B72 B;  3IAS 2;  3A03 A;  3BJ6 A;  3SEQ A;  3DTK A;  4KIG A;  3HOV J;  1J0R A;  3K7A J;  4BU2 A;  4M3F A;  2HVS A;  2YU3 A;  2DA1 A;  1XDS A;  4EAT A;  4RB3 C;  1OPC A;  2CUZ A;  2WV0 A;  3E0J B;  4ASN A;  1T08 B;  1WSU A;  3FBI B;  2B7E A;  1AKH A;  2A5W A;  3C2G A;  2Y69 H;  4MTE A;  2O8K A;  5KK1 A;  1K7A A;  2W24 A;  4WWC A;  5CVV A;  4M73 A;  2ELK A;  1FLI A;  5LRR A;  3ZN0 A;  3WHB A;  4I98 B;  2DFI A;  3TGN A;  1ZTR A;  1A31 A;  4H4K C;  5J1Y A;  5D5W B;  2E1N A;  1FZP B;  1W0U A;  2DCE A;  2DMP A;  5IT9 K;  1LPQ A;  2A61 A;  2FBH A;  3WTX C;  2EA4 A;  4HW0 A;  3H3U A;  1XX5 A;  1MKM A;  3MZ8 A;  1JGG A;  5L3C A;  3GTJ J;  3GTQ J;  2JK3 A;  2RRE A;  2XV4 S;  1H9G A;  2EV0 A;  2KIQ A;  2GA2 A;  2ZB9 A;  5J4V A;  2CV2 A;  4LLN A;  4QIW N;  3ZP5 A;  4II2 A;  3S17 J;  1Y6I A;  3TQN A;  2XRO A;  3H9G A;  2LC2 A;  2QZ8 A;  3E5U A;  1NHA A;  3ULQ B;  3EUH A;  3QYF A;  3GX4 X;  1I39 A;  4KT6 A;  2EV6 A;  1V4R A;  2PBI A;  1LDK B;  4C3H J;  3HYI A;  1W4M A;  3HOX J;  4U0V A;  1YIJ I;  2N8G A;  4AWX B;  2AXT C;  2VQC A;  2PN6 A;  4NNJ A;  3I3L A;  3I4M J;  5GPA A;  4OMZ A;  2QCO A;  3RZO J;  1ZRE A;  2EFP A;  3KX2 A;  2UV1 A;  4DJA A;  5JR3 A;  3ESW B;  1ZGJ A;  4P96 A;  1APL C;  2VE9 A;  3GTO J;  3RKQ A;  3SHF A;  4X6A J;  2DFE A;  1F36 A;  1Z6R A;  1WJC A;  2LTP A;  2ADU A;  3OYN A;  1W0T A;  3H3V K;  1Y1V J;  4HQM A;  5TGT A;  2HOA A;  3QWL A;  4ESF A;  1A35 A;  3IH3 A;  3FXU A;  4L9N A;  1YYV A;  3RQI A;  1Z0X A;  2W85 A;  4E70 A;  3COA C;  2R5Z A;  4PZJ A;  3KET A;  1X1D A;  2FJ1 A;  4WXC A;  4RGR A;  3BPX A;  1BW6 A;  3S3O A;  2LBF B;  2CUE A;  5F08 A;  5C44 J;  2VJ4 A;  2HXO A;  2BY2 A;  4IX7 A;  1F43 A;  4IHV A;  3VWB A;  3J7A Y;  1X58 A;  2V26 A;  3LA7 A;  1YX5 A;  3H0D A;  1OCP A;  4P9U A;  2XSD C;  4CZZ A;  1IAW A;  4ENJ A;  2P7C B;  1V3F A;  2B0L A;  2HYF A;  3CCL I;  2F5E A;  2R7T A;  1I27 A;  4YFX F;  2OCC H;  2RAE A;  3KYD B;  3KYL A;  1JKO C;  3V7R A;  1DGR M;  3CJQ B;  4FTH A;  5DCM A;  2VPL A;  2R5Y A;  5KVR A;  4GFB A;  4G7H F;  4OIP F;  3HOW J;  2IS6 A;  1R7J A;  3LSP A;  2L9V A;  4M3B A;  1RI7 A;  4UY8 I;  3KIO A;  3B73 A;  1G6N A;  3BG6 A;  1X2N A;  2BVM A;  5GPC A;  1FBU A;  4A2U A;  1A6Q A;  2GBY A;  4BBS J;  2V6E A;  1F9N A;  3HB9 A;  1ZLJ A;  2V6C A;  2R4G A;  5D5X B;  2IS4 A;  1P7J A;  2GOX B;  1Z3Y A;  2M7B A;  4I02 A;  3AKZ A;  2K4B A;  1K83 J;  3EUK L;  2HDC A;  1NK3 P;  3F23 A;  3HKZ N;  2BXZ A;  1UG0 A;  2PQ8 A;  1H0M A;  4HV6 A;  3DF8 A;  1U5T B;  1B1B A;  3EPZ A;  3S2W A;  1UCR A;  5H2F C;  4PFO A;  4ZZL A;  4IO9 F;  1N77 A;  1XGO A;  1TWA J;  3RKW A;  1WI3 A;  2RDP A;  1LKX A;  2LF8 A;  2E19 A;  3FIW A;  4XBF A;  1XGM A;  2DOE A;  4MFD A;  3NQO A;  3LNQ A;  1IV6 A;  5DDG A;  2RNG A;  2NYX A;  3LOC A;  4HEA 2;  2QLZ A;  2F4O B;  1BOB A;  1TLH B;  1ZG5 A;  2E7X A;  4EM1 A;  3CZ6 A;  3F6O A;  1NTC A;  2RNJ A;  3JAM K;  1UHS A;  3A4C A;  2EPF A;  4V2G A;  3DFG A;  4JX4 A;  3ZQQ A;  3PSI A;  4OOI A;  6PAX A;  1O7F A;  3PJR A;  2EBI A;  3DLA A;  2EIL H;  3D5S C;  2NXN B;  4RGX A;  2R7D A;  5E3M A;  3BDD A;  2VKH A;  4HF2 A;  4Q47 A;  1OYY A;  1HDP A;  2VQH A;  1R71 A;  2ESH A;  5JHU A;  1E17 A;  2AHQ A;  4A0X A;  5HLG A;  4KIB A;  3BQY A;  1IJW C;  1FIP A;  2F4M B;  5LHI A;  2JSP A;  3ABT A;  2E2I J;  1MJB A;  3I5U A;  3PO2 J;  1BA5 A;  4ANJ A;  2E34 A;  1YFH A;  1W36 C;  3FKJ A;  3BZC A;  2Y9Z A;  3D5R C;  3LA2 A;  3N05 A;  3V8L A;  5F0H A;  3M7G A;  4BKX A;  2DI3 A;  4B47 A;  4XOT A;  3HM5 A;  3HSF A;  5L3B A;  2P4W A;  1FBS A;  3SZP A;  1VQ6 I;  5E1X A;  4KJZ A;  5EG0 A;  2X1C A;  3ECO A;  3L2R A;  3D1N I;  3HDD A;  1GT0 C;  3OYB A;  1DGW Y;  2M0M A;  2MLG A;  2UUZ A;  2UXN A;  3WTT C;  1RES A;  1ZG1 A;  3HOY J;  4DYR A;  4D9J A;  2M1B A;  4M9Z A;  1JKP C;  1S29 A;  4RAY A;  5DV5 A;  4LG0 B;  3MCZ A;  3CCV I;  1GHC A;  2LRE A;  4KIF A;  4XRM A;  2RN7 A;  2YX7 A;  3HHG A;  3CME I;  2BE5 F;  3RI4 A;  3DCF A;  3ABU A;  2ZXI A;  3LWF A;  2VBW A;  4LLG F;  1MMA A;  2BYV E;  3HXL A;  1EH6 A;  4HV5 A;  3L2V A;  4WK8 F;  2ZKZ A;  2KL4 A;  2HXI A;  4XID A;  1JUS A;  3TP0 A;  2HZT A;  1P92 A;  3MMY B;  3KEQ A;  3N97 A;  4FAS D;  3DPU A;  1TTY A;  3DQV C;  3HOZ J;  1R5G A;  3OL3 A;  3Q0V A;  1ORK A;  3TP3 A;  2VAS A;  1MNM C;  2X4H A;  3ZQG A;  1HW5 A;  2KKO A;  5E3L A;  1SFE A;  2LRD A;  1W1W E;  3A01 B;  2H1L A;  3ELK A;  2IS1 A;  2MC3 A;  2X6X A;  4I0A A;  2NOG A;  1LE8 B;  1Z1D A;  2JA2 A;  2H8W A;  1USS A;  2F5C A;  2QVO A;  1MMG A;  4HAM A;  2MYS A;  2HFH A;  2K4J A;  4KYW A;  4IKF A;  2QQA A;  3IRQ A;  3GLX A;  4XMY A;  3VB2 A;  2VXD A;  3FXL A;  5FKK A;  5GAD J;  1DP3 A;  5LRS A;  1QZZ A;  2K9S A;  5LGN A;  2K7L A;  4F7Z A;  3LSG A;  5CQG A;  1L3L A;  2XAH A;  2W00 A;  4CCO A;  4DZP A;  1IXC A;  1X19 A;  2E5Z A;  3CCR I;  3HUG B;  1EV7 A;  2ZO4 A;  5BS6 A;  1YW8 A;  1A36 A;  1MJ9 A;  2OJE D;  1YS6 A;  1KQ8 A;  3E5Q A;  5H20 A;  3IHU A;  2BY0 A;  1XB4 A;  3O8G A;  5M3M J;  1XMA A;  1NH3 A;  4W97 A;  1YX3 A;  3M1C A;  1EA3 A;  1BR1 A;  4XKC A;  2LLK A;  4PDK A;  1JT6 A;  2L0K A;  5L3F A;  3J80 K;  2ESN A;  1XN7 A;  3OL4 A;  4PJL A;  4BHC A;  1T8I A;  2K9L A;  2DO7 A;  1YIO A;  3BR0 A;  2OQR A;  2COB A;  3L9F A;  4KMU X;  1SFO J;  1SVO A;  2L7Z A;  1S5L C;  2MG4 A;  4UUS A;  2W82 A;  1WCM J;  4RLQ A;  5BOX A;  1P2F A;  3KEO A;  4ZDL A;  2H6B A;  3SFZ A;  2OTL I;  3QOP A;  3E5X A;  2HU9 A;  2KLO A;  1F5T A;  5F6F A;  2ZFU A;  3CCU I;  1H9T A;  3JRE A;  5EJC A;  1VTN C;  1CF7 B;  3O2P E;  3JTG A;  4CCK A;  1T2K A;  3WG9 A;  1X3U A;  4LMY A;  1MMS A;  1EH8 A;  2OUM A;  3GLL A;  3SDG A;  2D1H A;  4YFN F;  3OYH A;  3RDI A;  3GW2 A;  4OIN F;  3FX3 A;  4FE7 A;  3X2Q H;  3FHZ A;  5E8G A;  1IN7 A;  1PUF B;  1F4K A;  3ZQH A;  5LBQ A;  2JA6 J;  2Z3Y A;  2IT0 A;  1BI2 A;  1HC8 A;  1K61 A;  1HCR A;  5FLM J;  4WXD A;  3TKY A;  2CMP A;  3FK6 A;  3E7L A;  3I54 A;  3VYS B;  2L01 A;  1GUU A;  4AYB N;  2VB6 A;  1TW3 A;  3OYK A;  3G6E I;  2F5F A;  4HLY A;  4O3M A;  1XMX A;  2MH2 A;  3BC8 A;  3J7Z I;  3JCU C;  4HNV A;  3K2A A;  4LLL A;  4ZYD A;  4MO7 A;  2KQR A;  1PVE A;  1WQ2 A;  3S32 A;  3WU0 A;  3VPR A;  4BJ5 C;  4CCM A;  1ZR4 A;  1WI9 A;  2EV5 A;  3GXO A;  4I01 A;  4UV8 A;  5DEQ A;  1YIT I;  1AA7 A;  1IXS B;  1RNL A;  1Z05 A;  2CQX A;  2JVH A;  1SVM A;  1ZKG A;  2G7H A;  4A93 J;  3GTP J;  4XLC A;  2V7F A;  4WCG A;  3U21 A;  5TRD A;  5GAE J;  4A0Y A;  1HLV A;  2CW0 F;  1KZH A;  2HDD A;  3BG9 A;  2DT6 A;  1B9N A;  2P6T A;  2DQR A;  2XB0 X;  5KCM A;  2WV1 A;  1RR7 A;  1Y8Q B;  2DMU A;  1XCV A;  4ZZD A;  4XLH A;  3PQK A;  4Y17 A;  2XC7 A;  1ZG3 A;  3H1C A;  3BLY A;  5K7H A;  2K86 A;  1YOV B;  3MKW B;  4MEX F;  1WJF A;  2JA7 J;  3G4S I;  3L2Q A;  3SJM A;  1RKW A;  4XON A;  2GIZ A;  3R61 A;  5F0F A;  3FK7 A;  4FX0 A;  2BEO A;  1RC9 A;  1WVR A;  3CP8 A;  4RB0 A;  5IYB J;  1FYK A;  1Z67 A;  3MFK A;  3K6G A;  4W1U A;  4ZDP A;  3LMM A;  3VYR B;  3ERE D;  1O57 A;  2CQK A;  2WY7 Q;  4A3B J;  3F22 A;  2IW5 A;  2Y0M A;  2KT0 A;  1Z77 A;  4PFP A;  1R4M B;  4EVI A;  3BOQ A;  3ZR8 X;  3RPQ A;  3CO7 C;  2VBY A;  5H6R A;  4R79 A;  4CSW A;  3TOA A;  3QYE A;  2QUF A;  4BUP A;  1LJ9 A;  5DUI A;  1WH5 A;  5DUK A;  4A3C J;  1T98 A;  2A05 A;  2ME0 A;  4IF4 A;  3ZQI A;  4JP0 A;  2YPR A;  4PGH A;  5LFA A;  3KLN A;  3QPT A;  4E7I A;  1Z7L A;  4G6T B;  2NS8 A;  2PX9 A;  1XSD A;  2QBY A;  1ZEL A;  3G73 A;  2JSC A;  3FMS A;  3H9Q A;  3CF5 F;  2L7M P;  4AVP A;  5E1Z B;  4BNC A;  3S1N J;  2K85 A;  2DOA A;  3BG5 A;  1OCT C;  1YRN B;  2MBF A;  1IRF A;  1QQI A;  3A2K A;  1TNS A;  2HPM A;  2GQQ A;  3U1K A;  2XGE A;  2FBK A;  4B09 A;  1QBJ A;  4C2M J;  1YE9 A;  2OPT A;  3A0B C;  1GVJ A;  3DPL C;  5BNG A;  3H92 A;  1H88 C;  1U78 A;  2QKM B;  1D5Y A;  2X0L A;  1VQ5 I;  2AS5 F;  5CLS A;  1R58 A;  1CQT A;  3SDB A;  4X0G A;  4NQW A;  3KP3 A;  1UB9 A;  4YEJ A;  1S7E A;  4B48 A;  2FA5 A;  4V19 K;  1W36 D;  2EZI A;  5A2Q Z;  5FJ8 J;  1WJD A;  2DMT A;  1NK2 P;  5HDG A;  4XRS A;  3CCQ I;  4GCV A;  3OYL A;  4CGZ A;  2LKS A;  1I6X A;  2IVM A;  2XAS A;  3MKY B;  3WG7 H;  2PEX A;  1KYW A;  1U6G A;  2Z16 A;  5IOY A;  3F8F A;  1LQ1 A;  4IEJ A;  3DPT A;  2QM3 A;  4D7M A;  2ELJ A;  4FIS A;  4B44 A;  2K27 A;  2VBZ A;  1S3J A;  4CCN A;  4E7J A;  3E3V A;  2VE8 A;  5IT9 Z;  4HX8 A;  3CCJ I;  4A3J J;  1FMV A;  4BQN A;  1J7K A;  1D1A A;  3BPV A;  2VKV A;  4BS9 A;  2F2E A;  2XIG A;  2LH9 A;  2PI0 A;  5AIQ A;  2VC0 A;  3QU6 A;  4F55 A;  4UUV A;  5ERI A;  3RYR A;  3OS1 A;  2KJC A;  2M7A A;  3GWZ A;  1SD5 A;  4EJU A;  4HF0 A;  3EET A;  1P9Q C;  5HOD A;  1XD7 A;  1LFU P;  3B02 A;  1TP4 A;  3GUD A;  2BOL A;  3SYT A;  4CYD A;  4I09 A;  1IN4 A;  1HBX G;  4L9J A;  4S04 A;  1D5V A;  1QPI A;  4XLA A;  4BY1 J;  2XGX A;  2RQP A;  2D45 A;  2HTS A;  5D6F A;  2AQF A;  3HC7 A;  4ZH4 F;  1D3Y A;  2XPV A;  2Y0S A;  1I1S A;  2QGU A;  2YX4 A;  2CS3 A;  5HNF A;  5EG0 B;  4A3F J;  2NVU B;  4ZTF A;  1RUN A;  2HQA A;  2FRH A;  2R7X A;  3HSE A;  5ICE A;  2HOT A;  1FSH A;  3BG3 A;  3IV5 A;  3G1M A;  1B72 A;  2M5W A;  2HI3 A;  2CG4 A;  4CHU A;  5EEH A;  2R7F A;  3JRB A;  5C4X J;  5DS9 A;  2XAF A;  3K10 A;  3HRS A;  4N4O B;  4WF2 A;  3FXO A;  4G7O F;  2W48 A;  1WGX A;  2HQR A;  3PQJ A;  4CYC A;  3LFK A;  4MHG A;  5ICC A;  1ZRC A;  1TC3 C;  2WWY A;  2NOJ B;  5J47 A;  2E1C A;  3AL0 C;  1W5C C;  1IRX A;  2NNN A;  2PMZ N;  2CRG A;  5K7Z A;  1S6L A;  3WE3 A;  1U8B A;  1KU3 A;  2IXS A;  2L9S A;  2ZSH B;  1IN5 A;  4P5O A;  2DA2 A;  3UNG C;  3PNV A;  1ETW A;  4AM3 A;  3K9T A;  1GXQ A;  3ZQ7 A;  5IPA A;  4IQ4 A;  3PL8 A;  1FP1 D;  2Q8K A;  3Q5F A;  2VOP A;  3BR1 A;  3I53 A;  3ASN H;  5IOZ A;  3KLO A;  3LST A;  3CCY A;  4AD9 A;  4EMS A;  4HBL A;  4CXF A;  1OCZ H;  2FQ4 A;  1MBE A;  3M8F A;  1MDM B;  4B3A A;  2M8E A;  1XSX A;  3DTI A;  4HA8 A;  3I55 I;  3MAJ A;  1YW9 A;  3CUO A;  1ON2 A;  2EZK A;  2CQN A;  3CC4 I;  2XRL A;  3IWF A;  1LDJ A;  3SZT A;  2ISY A;  4DBR A;  2VKD A;  3G1O A;  2ZNY A;  5CKT A;  3OYI A;  2HVR A;  4A12 A;  3L2U A;  5GAG J;  1IRG A;  4IXA A;  4D5C A;  1LFB A;  1W5S A;  4A3G J;  4M9X A;  1A04 A;  4M6Y A;  3ASO H;  2LK2 A;  3NEU A;  2CFO A;  2ZME A;  2LYC A;  2MH9 A;  5FKM A;  2OD5 A;  2Z33 A;  4KIS A;  1I50 J;  1W7P A;  3H3Z A;  2HDW A;  2R7S A;  2GAU A;  2KIU A;  5K7F A;  2ZXW H;  2DYR H;  2HS5 A;  5ICF A;  5FKO A;  1D1C A;  4HPQ A;  2D2W A;  1V5E A;  4BAC A;  2NVY J;  4HYE A;  2LOO A;  4DYC A;  4RMN A;  1LB2 A;  2CV1 A;  2ZCW A;  1BR2 A;  2O03 A;  4NBQ A;  1K6O A;  3HUG A;  3IP4 B;  4NC7 A;  4U7D A;  2JUC A;  3K4B A;  1VQ8 I;  1MH4 A;  4U7B A;  1YQA A;  3D0S A;  3OYM A;  2IGM A;  2HWV A;  3JAM Z;  2EIN H;  2V9V A;  2D1V A;  5HOO A;  4LIU A;  2R7O A;  2ID3 A;  3MKL A;  4BH9 A;  3EUH C;  1XSV A;  2CW7 A;  2CUJ A;  3Q3S A;  4UHT A;  4QSH A;  4F93 B;  4G94 A;  1R6R A;  3AAF A;  3GEZ A;  2P8T A;  3K0L A;  2HOS A;  2W4S A;  3DKX A;  2FD5 A;  3K1N A;  3MZY A;  5FFX A;  1JUM A;  2L54 A;  4Q5S F;  5CJ9 A;  1BM9 A;  3W2A A;  3J81 K;  1AOY A;  4I7H A;  2FOW A;  3HIF A;  1Y1W J;  1WHU A;  1SFU A;  1RET A;  2QSG X;  3JRG A;  4CA0 A;  1G8X A;  2VQG A;  1W7P B;  2EIJ H;  5TIS C;  1SC7 A;  1LEB A;  3BR2 A;  1Q1H A;  2A68 F;  3OSF A;  1FOY A;  4HX4 A;  3RTR A;  3S15 J;  4AVZ A;  5D5V B;  3K4J A;  1QA6 A;  2L02 A;  2RQQ A;  3S3M A;  1H89 C;  3RJP A;  3GTL J;  5LHH A;  1TW2 A;  4N9I A;  2LDU A;  3DU5 A;  3I71 A;  4UB8 C;  2L5Q A;  2FX0 A;  4G6D A;  5HVQ C;  2DU9 A;  4DIQ A;  3K2Z A;  3RCO A;  4FE4 A;  4EJO A;  1D0Y A;  2DFH A;  2KPM A;  4U0W A;  2K02 A;  1U8R A;  1PYV A;  2R92 J;  2RV8 A;  1UEL B;  1ZR2 A;  1R4N B;  3HG9 A;  4FT8 A;  4M71 A;  2IA2 A;  2PMZ A;  1BOA A;  1N25 A;  3OS0 A;  3Q0U A;  1YS7 A;  1O3T A;  3LSR A;  4JK1 X;  4LG0 A;  4E4H A;  3V7S A;  3AL0 B;  4OU0 A;  3GTK J;  3LSH A;  2R7R A;  3P9I A;  4NB5 A;  3HGG A;  1DU0 A;  1DPU A;  2DOD A;  3E6M A;  5IP9 J;  4CIC A;  2ZME C;  1UJ8 A;  1R00 A;  1EF4 A;  5B5E C;  3LSI A;  1WZ2 A;  5L3D A;  2LFB A;  4M3E A;  2XAG A;  1SAU A;  2COM A;  3K70 C;  1ZN2 A;  5IYD J;  1UZC A;  2ZJQ F;  2DXI A;  2XPU A;  5B1A H;  2ETH A;  1NG7 A;  3OIQ A;  2WTE A;  1CGP A;  2GXG A;  1XDU A;  1RPW A;  1X4O A;  2NVX J;  3GFI A;  3IH4 A;  4IHY A;  1D8K A;  1R5H A;  4V2F A;  2PG4 A;  4I6Z A;  1G3S A;  1IUF A;  3PIP F;  3ZGK A;  1VQ9 I;  4EJW A;  3C3W A;  5LLQ A;  3ML6 A;  3N4M A;  3MWM A;  4ENK A;  1YI2 I;  2M34 A;  3CC7 I;  2L4A A;  2R93 J;  3OIO A;  2IA0 A;  1S8N A;  2OAZ A;  3BY6 A;  3KP6 A;  1Z7U A;  1FPQ A;  1LVK A;  3S2D J;  1LDD A;  2GOM A;  3HKZ A;  2BHY A;  4MNU A;  2XHK A;  4XKB A;  4BE0 A;  3CC2 I;  5C3E J;  2ZME B;  5ILV A;  5FD6 A;  3DKY A;  3C2B A;  3IC7 A;  2ZBK A;  2VJ5 A;  1Q1V A;  5JLX A;  1JI8 A;  2KDZ A;  3HJE A;  3ZQF A;  1FNN A;  3W2W A;  4UVB A;  4HRI A;  3GME A;  4BXF A;  1RRJ A;  3QPH A;  1G4D A;  1ZRF A;  5B66 C;  3WGG A;  1HST A;  2CFX A;  3KZI C;  5E3N A;  1X4P A;  2JQ7 A;  3L7W A;  5DYM A;  4OWR B;  4BQO A;  3HEF A;  3K4C A;  2CQ7 A;  4OIO F;  2XAU A;  1N78 A;  2WAE A;  3R0A A;  3KP2 A;  4DBQ A;  4M3G A;  3TW7 A;  3LA3 A;  3C7J A;  2WC2 A;  4EEF G;  2LP0 A;  2EIK H;  2NVQ J;  4MIM A;  3CTA A;  4Y15 A;  4C2U A;  1QNT A;  1SMY F;  1XCB A;  2A5Y B;  2XGD A;  1DP7 P;  4I99 C;  2CO5 A;  3P7N A;  3IKT A;  1XPX A;  4NDL A;  3WOD F;  3EDP A;  1K4T A;  2IP2 A;  4P1W A;  4D7N A;  4Z6Y A;  1RKT A;  1I1G A;  5IYC J;  2X85 A;  3I4N J;  3AG3 H;  1MMD A;  5AIP A;  1S7A A;  4PSX A;  5F04 A;  2M45 A;  3E1S A;  4F92 B;  1E3O C;  2L9N A;  4BQA A;  2VUM J;  1ETK A;  2QSF X;  2VL8 A;  3WTZ A;  3I56 I;  3ZRG A;  2TRT A;  2PJP A;  2E36 A;  4BJ6 C;  1B8I A;  4DGW B;  1SD6 A;  1D0X A;  2E1M C;  1IGN A;  4A0Z A;  3ZCO A;  1K78 A;  3NAR A;  3ECH A;  1MSF C;  4M74 A;  1JJ6 C;  4GGG A;  3EYI A;  3HRU A;  3F8M A;  1KQ0 A;  2K3P A;  3BTJ A;  3GZ5 A;  1WRJ A;  2UZK A;  5LEK A;  1IXR C;  5CVI A;  4KN7 X;  3RYP A;  2DPD A;  3WHC A;  5H6Q A;  3G1L A;  3F21 A;  1XGS A;  4EM0 B;  5BQT A;  3E6D A;  1JHH A;  5EYR A;  4AID A;  3SXY A;  3FHN A;  3S1R J;  1E2X A;  2GXB A;  1I5Z A;  1FWZ A;  3PUB A;  2OBP A;  2QA4 I;  2QSH X;  3CMM A;  3CUQ A;  3JSO A;  2M4K A;  3ZMS A;  1FIA A;  1XG1 A;  4DYQ A;  5K5Q A;  1TWG J;  3P9K A;  3JRH A;  3CUQ B;  2K9Q A;  2O0Y A;  5B1B H;  5EGO A;  1J59 A;  5LD2 C;  4EGZ A;  3OWT A;  3BR5 A;  4XKV A;  2K9N A;  4IJA A;  1TNT A;  3FWE A;  2RC4 A;  2DA5 A;  2BV6 A;  2V1X A;  2W25 A;  2GZW A;  5DM6 F;  3GZ6 A;  1V5F A;  2FE3 A;  4KUM A;  1YHQ I;  4B1R A;  1IF1 A;  4ZJZ A;  1ZQ3 P;  4XLE A;  3OYF A;  4IHW A;  1J9I A;  5CQE A;  2X9D A;  4ZYH A;  2X48 A;  2DAO A;  4XOR A;  3ROU A;  3QOD A;  3HPH A;  2QEN A;  4CCL A;  2BW3 A;  1ZRD A;  1REP C;  5FD5 A;  5AON A;  2O9L A;  3C1D A;  3DEU A;  2KZV A;  4L5I A;  4C30 A;  4S0H B;  2O3F A;  2FEZ A;  4LIV A;  1VFC A;  4LGW A;  3HZJ A;  3GO5 A;  4PJM A;  1WJA A;  3V8K A;  4AIK A;  4QTR A;  1B6A A;  1KA8 A;  2ECB A;  2IAI A;  2JPB A;  3GCM A;  4BDZ A;  5D4S A;  4KMF A;  3F72 A;  3EUA A;  1P6R A;  1GVD A;  5CVR A;  3TO7 A;  1LEA A;  4FET A;  4ZDO A;  3T0Y A;  4BYY A;  4A6E A;  5GTI C;  3SEZ A;  3FXQ A;  3A0H C;  4Y4R A;  5FB2 A;  3GZN B;  3T8R A;  1RR8 C;  1TT0 A;  2GWR A;  3Q9V A;  4M9S A;  4N4N B;  3GVA A;  1SFK A;  2ISZ A;  3G2B A;  3TL4 X;  1J5Y A;  3K70 D;  1ZK8 A;  2LY9 A;  3H5A A;  3CMA I;  2NS7 A;  3M07 A;  2M2E A;  5J1U A;  2JRT A;  2LKX A;  2OZU A;  3BTC A;  3HPG A;  3DWL E;  1G3W A;  2BGC A;  1FP2 A;  1UHM A;  4KIC A;  4RLF A;  2BY1 A;  1TWC J;  4E6K G;  2E1M B;  4RGS A;  5D5U B;  1IRZ A;  3QAH A;  4CZC A;  1QHH D;  3GFM A;  3ZMT A;  1ZYR F;  2VBX A;  1U9O A;  1HXD A;  3OYD A;  1R22 A;  4XL9 A;  2MW8 A;  2ZXH A;  4DW6 A;  3VFZ A;  3S14 J;  1WJE A;  3FZV A;  1DDN A;  2BVL A;  1BJZ A;  1U2W A;  1RUO A;  2DMN A;  3KZZ A;  3QYB A;  1U5T A;  2WAQ A;  4RS8 A;  4XKW A;  4B4C A;  4LB5 A;  2CJJ A;  1ETX A;  3SFI A;  3GBG A;  2Z1D A;  4NQW B;  4QPO A;  2ELH A;  1STZ A;  5A2Q K;  3ABL H;  1BI1 A;  2BY3 A;  3CJN A;  4OMY A;  1IC8 A;  4I2O A;  4RDU A;  2F5D A;  2IGN A;  3OY9 A;  1HW2 A;  3HTU A;  2NAZ A;  2HOE A;  3ZMD A;  1J75 A;  3S2H J;  2R0Q C;  4LIT A;  2KRC A;  3M9A A;  5CVU A;  2P0W A;  2F6C A;  4Y3O A;  2H1K A;  2XDV A;  2AQE A;  2MSY A;  1VZ0 A;  2WAD A;  2YUS A;  4KT5 C;  1JUP A;  2NRA C;  4H0E A;  2X6O A;  1ON1 A;  2MFZ A;  2P6S A;  3M8E A;  3CDH A;  2PLY A;  3TED A;  3VYU B;  1X1C A;  1BJA A;  5ILU A;  1OKR A;  3LL7 A;  2JMW A;  2TDX A;  1MNE A;  2VN2 A;  3DEW A;  3J7A O;  2IS2 A;  2KIM A;  1W7P D;  1ODD A;  3M8J A;  3BRO A;  3BQZ A;  4P55 A;  3ZMV A;  3V4G A;  4NUB A;  3WU1 B;  4FHT A;  1PDN C;  1MDM A;  2ZFW A;  1GV2 A;  3F0C A;  3JRF A;  3ZOB A;  3CJR B;  5FLX K;  4RA2 A;  3MKZ A;  2DQL A;  1MBK A;  4A3M J;  1ENH A;  2AO9 A;  5FLV A;  2EIM H;  3UR3 C;  2Y30 A;  3KP4 A;  1FSE A;  3H35 A;  5D6E A;  4KDP A;  2E35 A;  3TO6 A;  1Y39 A;  4BEH A;  1TQP A;  3L1P A;  1O4X A;  3F8N A;  2IBD A;  4G9Y A;  2NVT J;  3Q9S A;  1ETV A;  4O5V A;  2KDO A;  3GFJ A;  4YII A;  3DKW A;  2L9R A;  3DBR B;  5M5W J;  3OYJ A;  3QOE A;  3S1Q J;  2O7O A;  5KHD A;  5KAI C;  4A6D A;  1P4A A;  1ZGA A;  1YW7 A;  3CLO A;  2STW A;  2A07 F;  4A3D J;  1IV8 A;  2BHZ A;  3V8J A;  3KYC B;  2ZC2 A;  3K4K A;  5FKL A;  3RIR A;  5KNL A;  2XSJ C;  2WB1 A;  4F52 A;  1B8I B;  5FRM A;  2MLK A;  4JX6 A;  3O6B B;  1K78 B;  2QF7 A;  2R5Y B;  4RM3 A;  3WTY C;  5DCF A;  2VOD A;  1V54 H;  2XF6 A;  1FOW A;  4KN4 X;  1BL0 A;  3OYC A;  2AXL A;  2CH0 A;  4BJT A;  5B3S H;  1VQ7 I;  2LY1 A;  2V1N A;  2IA1 A;  1UFM A;  2PMU A;  1S7O A;  2Y9Y A;  5JVT A;  5M3F J;  5ILS A;  2BW3 B;  3FKI J;  1JJ8 C;  3P9C A;  2XKO A;  3QPS A;  3QU3 A;  3W6K B;  4BBR J;  2NS0 A;  4B3X A;  3VOE A;  4KFC A;  3F8B A;  4J01 A;  2VKE A;  2HQ5 A;  5E8I A;  2XVC A;  5E3O A;  3DP7 A;  1QU3 A;  2V1D A;  2V9P A;  1FJL A;  3WE2 A;  3KE2 A;  2VOO A;  1L0O C;  4PJ0 C;  4DOZ A;  1FX7 A;  5LGT A;  3OR2 C;  4GDF A;  3K4N A;  4Y52 J;  4XRF A;  4G8X A;  2LG4 A;  5J1R A;  1DQU A;  4BE1 A;  1ZH5 A;  1F1Z A;  2M9H A; 
#chains in the Genus database with same CATH homology
 3LQR A;  5HS7 A;  1T0F A;  1DUX C;  1YTY A;  1OYW A;  2H09 A;  4ZYG A;  3EYY A;  3BJA A;  4TV7 A;  2EK5 A;  2HKX A;  1B59 A;  1BI0 A;  3R60 A;  5LHG A;  1O3Q A;  1IUY A;  4OIR F;  2HR3 A;  4RAZ A;  4PCQ A;  3KFW X;  3D5L A;  3HRT A;  2HYG D;  2VON A;  3DV8 A;  3T8T A;  5F1R A;  4KNY A;  1TQI A;  2P7V B;  2A6E F;  2HGC A;  4K2E A;  2P5V A;  2IPQ X;  3C18 A;  4DNC A;  2P5L C;  1OR7 A;  2GIV A;  4G7Z F;  2O61 A;  2FU4 A;  3SQN A;  4GXO A;  1FY7 A;  1B4A A;  4WX9 A;  2EFW A;  1WWX A;  2YR2 A;  4EJT A;  3QRF F;  2DK8 A;  3JTH A;  2A69 F;  2EFN A;  4YG2 F;  3I0T A;  4BHB A;  5K5O A;  1R1U A;  2UWM A;  2CWE A;  1UHW A;  2XAQ A;  1SD7 A;  4HZF A;  3WGH A;  2FQ3 A;  4I0B A;  1OMI A;  5ED4 A;  2FSW A;  4ON0 A;  2PMH A;  2H94 A;  4ESJ A;  1HSJ A;  1IW7 F;  2EFQ A;  3OV8 A;  4L5J A;  3IRR A;  1O7L A;  4HLX A;  2MA3 A;  4EQQ A;  2DT5 A;  5E20 A;  3RPU A;  3L09 A;  2EB7 A;  3HRM A;  1PP8 F;  4Y13 A;  4HF1 A;  3W6J B;  3F8C A;  2J5P A;  3KCC A;  5FGM A;  4P9F A;  2CGP A;  5E1W A;  4ETS A;  4EV0 A;  2FBI A;  1T38 A;  4MGR A;  2Z5U A;  3U9G A;  1RIO H;  4XSZ F;  3K69 A;  3WTU C;  2VT3 A;  1YLF A;  4M6X A;  4N9H A;  2KJB A;  4BXU A;  2XKP A;  2DPU A;  5EEG A;  1Z91 A;  5JI6 A;  1D8J A;  3RKX A;  5HLI A;  1IZ1 A;  1P4W A;  1U3E M;  5FFZ A;  2FMY A;  4M72 A;  4MEY F;  2LNB A;  3G3Z A;  1SD4 A;  2EA2 A;  4S05 A;  3EQL F;  3I64 A;  4MQ9 F;  3CO6 C;  1FT9 A;  5CVJ A;  3JSP A;  2EFO A;  3TO9 A;  3L2C A;  1ZAR A;  2ACJ A;  3WTV C;  2R3S A;  1UST A;  4UNO A;  3ZMU A;  2BBY A;  3FM3 A;  2HQN A;  3FMQ A;  4MTD A;  5K1Y A;  1K79 A;  2V79 A;  2JPC A;  3BZ6 A;  5J8F A;  5K5R A;  1XMK A;  4LK0 F;  2VC1 A;  1J2X A;  2FF4 A;  1YG2 A;  2PFB A;  4NHJ A;  3PFI A;  3F3X A;  3T1B A;  3HSR A;  4XLN F;  4HQE A;  1WKM A;  4IVN A;  4PGG A;  1BC7 C;  3V7C A;  5ICG A;  4EJV A;  2H27 A;  2DLL A;  1LVA A;  2STT A;  3NRV A;  1MJA A;  4UVA A;  2NNY A;  3I58 A;  4Z2Y A;  2XRN A;  5D4R A;  3F6V A;  3E6B A;  4JBA A;  5JFR A;  1FC3 A;  2W57 A;  3ZN1 A;  1XGN A;  1HQC A;  3FM5 A;  5CYV A;  3BP8 A;  1FOK A;  3I4P A;  1BIA A;  2JZY A;  4UXN A;  2IRF G;  1T39 A;  3ZMZ A;  2G7U A;  2DK5 A;  3T5X A;  4R8H A;  1ZLK A;  2HEO A;  4IHS A;  2O6G E;  4HOB A;  1R23 A;  2W84 A;  2Q0O A;  2DTR A;  4LJZ F;  4QLC U;  2FNA A;  1C0W A;  1FBQ A;  1SFX A;  4BAY A;  3R4K A;  3BJO A;  4L18 B;  1ONV A;  4JQF A;  3ZPL A;  4UVC A;  4L9V A;  4Q48 A;  4CDG A;  5J6X A;  4UV9 A;  4EM2 A;  1ULY A;  1MZB A;  5DD4 A;  2FNP A;  4GYG A;  1W5T A;  3RKY A;  2LKP A;  3IKV A;  3L00 A;  5TJJ A;  3HOS A;  1FYM A;  3MQ0 A;  1HKS A;  2FML A;  3U1D A;  2IJL A;  3U2R A;  4DQ2 A;  4IRG A;  4ZYE A;  2V1U A;  4BHP A;  4O6J A;  2P5K A;  4HDU A;  3K1P A;  3MZH A;  3GYH X;  4IRH A;  5IT3 A;  1ZHF A;  1PUE E;  2Y48 A;  1TQM A;  3CUQ C;  1G3Y A;  3FF5 A;  1DPR A;  2GA1 A;  5L3E A;  4ENM A;  5FO5 A;  4IRI A;  1SAX A;  5LEJ A;  3R0J A;  1O3R A;  1QGP A;  3BWG A;  2QWW A;  4L0Z B;  2C6Y A;  1IN8 A;  4IHT A;  2J5O A;  1KU7 A;  2QQ9 A;  1FYL A;  4B8X A;  2MD5 A;  4L9T A;  5BPD A;  2RGV A;  1BN5 A;  2KIF A;  4L0Y B;  1GXP A;  5HS9 A;  1YO5 C;  5HLH A;  5BPI A;  4A5N A;  2Q2E A;  3E6C C;  3K1M A;  2XAJ A;  3GFL A;  2RVC A;  2FXA A;  3TDZ C;  1BIB A;  2QQB A;  2LSO A;  5HDN A;  1OYI A;  1TBX A;  1B9M A;  1LNW A;  2Y75 A;  3E97 A;  2CSO A;  4RGU A;  2LF7 A;  4LD5 A;  4R1H A;  2QBY B;  4LK1 F;  5HDK A;  4XLP F;  5DCM B;  4LFU A;  3VEP A;  3WTS C;  4KA4 A;  1G3T A;  1KU9 A;  3HHH A;  2HKO A;  4QWQ A;  4ESB A;  2DW4 A;  1BI3 A;  3TDU C;  1HW1 A;  2CYY A;  4ENN A;  2O8X A;  3GF2 A;  5BMZ A;  1ZAO A;  2OZ6 A;  1R1T A;  1MGT A;  1EH7 A;  4U88 A;  2DBB A;  5LGU A;  3WGI A;  3HOT A;  1KU2 A;  3IL2 A;  3J80 Z;  5L3G A;  1BC8 C;  1RZ4 A;  4RB2 C;  5DD8 A;  1P4X A;  3JW4 A;  2EJR A;  2M87 A;  1MD0 A;  1KYZ A;  1JHF A;  4D0P A;  4YFK F;  4CO8 A;  2M30 A;  1Z6T A;  1R1V A;  5E18 F;  3MEX A;  4G6Q A;  3R6S A;  4EGY A;  4HDV A;  2H6C A;  3QP5 A;  3M1E A;  2JTV A;  2OA4 A;  4YIF A;  2G9W A;  4N0B A;  2ZNZ A;  3DXJ F;  2ZXJ A;  5J8C A;  2FOK A;  1BBY A;  3KP7 A;  4XSX F;  2L4M A;  1QO0 D;  2YSR A;  1QZY A;  2KRF A;  3I59 B;  4IPA A;  3J81 Z;  3TOB A;  1KQ9 A;  3OOP A;  3HTS B;  4Q4Z F;  5FLX Z;  4U0Y A;  2A3S A;  2JT1 A;  4FX4 A;  3IWZ A;  1Y0U A;  2VXZ A;  2EWN A;  3FMR A;  1QPM A;  2RKH A;  4OIQ F;  1HKT A;  4GO1 A;  2OQG A;  4LB6 B;  4GYI A;  1Z9C A;  2A6H F;  2Z9O A;  2UXX A;  1CF7 A;  2L3D A;  1SMT A;  1R36 A;  1AWC A;  2XUB A;  3I59 A;  4MQV A;  5E17 F;  2QYO A;  1JXS A;  3ISP A;  3LAP A;  3LQQ A;  1JGS A;  1JE8 A;  3KP5 A;  4AIH A;  3WTW C;  1KGS A;  3QP6 A;  1IN6 A;  4A5M A;  2HTJ A;  4HX7 A;  3VOD A;  1PP7 U;  1HKQ A;  5F64 A;  5D8K B;  4WXH A;  1O3S A;  3REO A;  5HS8 A;  2ZJ2 A;  4RB1 A;  2Z99 A;  3KZY A;  2OU2 A;  3LAJ A;  2VT2 A;  5D8L B;  2E7W A;  3O3K A;  1T6S A;  4AIJ A;  1U5T C;  3FXR A;  3BJ6 A;  4KIG A;  1J0R A;  2YU3 A;  1XDS A;  4RB3 C;  1OPC A;  2WV0 A;  4ASN A;  1WSU A;  4MTE A;  5KK1 A;  1K7A A;  2W24 A;  4WWC A;  5CVV A;  4M73 A;  1FLI A;  5LRR A;  3ZN0 A;  4I98 B;  2DFI A;  3TGN A;  5D5W B;  1FZP B;  2E1N A;  5IT9 K;  2A61 A;  2FBH A;  3WTX C;  2EA4 A;  4HW0 A;  3H3U A;  1MKM A;  5L3C A;  2XV4 S;  1H9G A;  2EV0 A;  2GA2 A;  4LLN A;  3ZP5 A;  3TQN A;  2XRO A;  2QZ8 A;  3E5U A;  1NHA A;  3ULQ B;  3EUH A;  3GX4 X;  2EV6 A;  1V4R A;  2PBI A;  1LDK B;  3HYI A;  1W4M A;  4U0V A;  4AWX B;  2PN6 A;  4OMZ A;  1ZRE A;  2EFP A;  5JR3 A;  1ZGJ A;  4P96 A;  2VE9 A;  3SHF A;  1Z6R A;  2ADU A;  4HQM A;  4ESF A;  4L9N A;  3FXU A;  1YYV A;  4E70 A;  2W85 A;  3COA C;  4PZJ A;  3KET A;  4WXC A;  4RGR A;  3BPX A;  3LA7 A;  4P9U A;  4CZZ A;  1IAW A;  4ENJ A;  2P7C B;  1V3F A;  2B0L A;  2HYF A;  2F5E A;  1I27 A;  4YFX F;  3V7R A;  5DCM A;  5KVR A;  4OIP F;  4G7H F;  1R7J A;  1RI7 A;  3B73 A;  1G6N A;  1FBU A;  4A2U A;  1F9N A;  1ZLJ A;  2V6C A;  5D5X B;  4I02 A;  2K4B A;  2HDC A;  3F23 A;  2PQ8 A;  1H0M A;  4HV6 A;  3DF8 A;  1U5T B;  1B1B A;  3S2W A;  1UCR A;  4ZZL A;  1XGO A;  3RKW A;  2RDP A;  2LF8 A;  4XBF A;  1XGM A;  3NQO A;  5DDG A;  2NYX A;  2QLZ A;  1TLH B;  1ZG5 A;  2E7X A;  4EM1 A;  3F6O A;  2RNJ A;  3JAM K;  3DFG A;  4OOI A;  6PAX A;  1O7F A;  4RGX A;  4HF2 A;  2R7D A;  3BDD A;  4Q47 A;  1OYY A;  2ESH A;  5JHU A;  1E17 A;  4A0X A;  5HLG A;  4KIB A;  5LHI A;  3ABT A;  1MJB A;  3I5U A;  1YFH A;  3LA2 A;  3V8L A;  3M7G A;  2DI3 A;  3HSF A;  5L3B A;  2P4W A;  1FBS A;  3SZP A;  5E1X A;  3ECO A;  2MLG A;  3WTT C;  1ZG1 A;  2UXN A;  2M1B A;  4M9Z A;  1S29 A;  4RAY A;  5DV5 A;  4LG0 B;  3MCZ A;  1GHC A;  4KIF A;  2RN7 A;  2YX7 A;  3HHG A;  2BE5 F;  3RI4 A;  3ABU A;  3LWF A;  2VBW A;  4LLG F;  2BYV E;  1EH6 A;  4HV5 A;  4WK8 F;  2ZKZ A;  2HZT A;  1P92 A;  3KEQ A;  3N97 A;  1TTY A;  3DQV C;  1R5G A;  2X4H A;  1HW5 A;  2KKO A;  1SFE A;  3ELK A;  2MC3 A;  4I0A A;  1Z1D A;  1USS A;  2F5C A;  2QVO A;  4HAM A;  2HFH A;  2K4J A;  4KYW A;  2QQA A;  3IRQ A;  3GLX A;  3VB2 A;  5LRS A;  1QZZ A;  5LGN A;  2K7L A;  4F7Z A;  1L3L A;  2XAH A;  1IXC A;  1EV7 A;  2ZO4 A;  5BS6 A;  1YW8 A;  1MJ9 A;  1YS6 A;  1KQ8 A;  3E5Q A;  5H20 A;  3IHU A;  1XB4 A;  1XMA A;  4PDK A;  5L3F A;  3J80 K;  2ESN A;  1XN7 A;  4BHC A;  2DO7 A;  1YIO A;  3L9F A;  2OQR A;  4KMU X;  5BOX A;  1P2F A;  3KEO A;  2H6B A;  3SFZ A;  3QOP A;  3E5X A;  1F5T A;  5F6F A;  1H9T A;  1VTN C;  1CF7 B;  3O2P E;  3JTG A;  1T2K A;  3WG9 A;  1X3U A;  4LMY A;  1EH8 A;  2D1H A;  4YFN F;  3RDI A;  3GW2 A;  4OIN F;  3FX3 A;  3FHZ A;  5E8G A;  1IN7 A;  1F4K A;  5LBQ A;  2Z3Y A;  2IT0 A;  1BI2 A;  4WXD A;  3TKY A;  3I54 A;  2L01 A;  1TW3 A;  2F5F A;  4HLY A;  4O3M A;  2MH2 A;  4LLL A;  4ZYD A;  1WQ2 A;  3WU0 A;  1WI9 A;  2EV5 A;  3GXO A;  4I01 A;  4UV8 A;  5DEQ A;  1IXS B;  1RNL A;  1Z05 A;  2G7H A;  4WCG A;  5TRD A;  4A0Y A;  2CW0 F;  1B9N A;  2P6T A;  2DQR A;  1XCV A;  4ZZD A;  3PQK A;  4Y17 A;  1ZG3 A;  2K86 A;  4MEX F;  3R61 A;  4FX0 A;  2BEO A;  1FYK A;  4RB0 A;  3MFK A;  3ERE D;  1O57 A;  2CQK A;  3F22 A;  2IW5 A;  2Y0M A;  4EVI A;  3BOQ A;  3RPQ A;  3CO7 C;  2VBY A;  5H6R A;  4R79 A;  3TOA A;  2QUF A;  1LJ9 A;  5DUI A;  5DUK A;  1T98 A;  4IF4 A;  2YPR A;  4PGH A;  3KLN A;  3QPT A;  1XSD A;  2QBY A;  3G73 A;  2JSC A;  3FMS A;  4AVP A;  5E1Z B;  4BNC A;  2MBF A;  1IRF A;  1QQI A;  1TNS A;  2GQQ A;  2FBK A;  4B09 A;  1QBJ A;  1GVJ A;  3DPL C;  2AS5 F;  3H92 A;  1U78 A;  2X0L A;  5CLS A;  1R58 A;  4NQW A;  3KP3 A;  1UB9 A;  2FA5 A;  5A2Q Z;  5HDG A;  4GCV A;  4CGZ A;  1I6X A;  2IVM A;  2XAS A;  2PEX A;  1KYW A;  1U6G A;  3F8F A;  1LQ1 A;  3DPT A;  2QM3 A;  2K27 A;  2VBZ A;  1S3J A;  3E3V A;  2VE8 A;  5IT9 Z;  4HX8 A;  1J7K A;  3BPV A;  2F2E A;  2XIG A;  2PI0 A;  5AIQ A;  2VC0 A;  3QU6 A;  4UUV A;  5ERI A;  3RYR A;  2KJC A;  3GWZ A;  1SD5 A;  4EJU A;  4HF0 A;  3EET A;  1XD7 A;  3B02 A;  3GUD A;  4CYD A;  4I09 A;  1IN4 A;  1HBX G;  4L9J A;  4S04 A;  1D5V A;  2XGX A;  2RQP A;  2D45 A;  2HTS A;  5D6F A;  4ZH4 F;  1D3Y A;  1I1S A;  2YX4 A;  1RUN A;  2FRH A;  3HSE A;  5ICE A;  1FSH A;  2M5W A;  2CG4 A;  4CHU A;  5EEH A;  2R7F A;  2XAF A;  3HRS A;  4WF2 A;  4G7O F;  3PQJ A;  2HQR A;  3LFK A;  4MHG A;  5ICC A;  1ZRC A;  2WWY A;  2E1C A;  2NNN A;  1S6L A;  3WE3 A;  1KU3 A;  4P5O A;  1IN5 A;  3K9T A;  1GXQ A;  3ZQ7 A;  3Q5F A;  1FP1 D;  2Q8K A;  2VOP A;  3I53 A;  3KLO A;  3LST A;  4AD9 A;  4EMS A;  4HBL A;  4CXF A;  1MDM B;  3M8F A;  2M8E A;  1XSX A;  4HA8 A;  3MAJ A;  1YW9 A;  3CUO A;  1ON2 A;  3IWF A;  1LDJ A;  3SZT A;  2ISY A;  2ZNY A;  4A12 A;  1IRG A;  4IXA A;  1W5S A;  4M9X A;  1A04 A;  4M6Y A;  3NEU A;  2ZME A;  2MH9 A;  2OD5 A;  2Z33 A;  1W7P A;  3H3Z A;  2GAU A;  2KIU A;  2HS5 A;  5ICF A;  2D2W A;  4HYE A;  1LB2 A;  2ZCW A;  2O03 A;  1K6O A;  3HUG A;  4U7D A;  4U7B A;  1YQA A;  3D0S A;  2HWV A;  3JAM Z;  2V9V A;  5HOO A;  2D1V A;  4BH9 A;  1XSV A;  4UHT A;  4G94 A;  3AAF A;  3GEZ A;  2P8T A;  3K0L A;  3K1N A;  3MZY A;  5FFX A;  2L54 A;  4Q5S F;  5CJ9 A;  1BM9 A;  3J81 K;  1AOY A;  4I7H A;  3HIF A;  1SFU A;  1W7P B;  1LEB A;  1Q1H A;  2A68 F;  4HX4 A;  3RTR A;  5D5V B;  2L02 A;  3RJP A;  5LHH A;  1TW2 A;  4N9I A;  2LDU A;  3I71 A;  4G6D A;  5HVQ C;  2DU9 A;  3K2Z A;  4EJO A;  4U0W A;  2K02 A;  1U8R A;  2RV8 A;  4FT8 A;  4M71 A;  2IA2 A;  1BOA A;  1YS7 A;  1O3T A;  4JK1 X;  4LG0 A;  3V7S A;  4OU0 A;  3P9I A;  4NB5 A;  1DPU A;  3E6M A;  4CIC A;  1R00 A;  5L3D A;  2XAG A;  2COM A;  1ZN2 A;  2ETH A;  2WTE A;  1CGP A;  2GXG A;  1XDU A;  3GFI A;  1D8K A;  1R5H A;  2PG4 A;  1G3S A;  4EJW A;  3C3W A;  5LLQ A;  3ML6 A;  3N4M A;  3MWM A;  4ENK A;  2L4A A;  2IA0 A;  1S8N A;  2OAZ A;  3BY6 A;  3KP6 A;  1Z7U A;  1FPQ A;  1LDD A;  4MNU A;  2XHK A;  2ZME B;  5ILV A;  5FD6 A;  3IC7 A;  2ZBK A;  1FNN A;  4UVB A;  3QPH A;  1G4D A;  1ZRF A;  3WGG A;  1HST A;  2CFX A;  3L7W A;  5DYM A;  4OIO F;  3R0A A;  3KP2 A;  3LA3 A;  3C7J A;  2WC2 A;  3CTA A;  4Y15 A;  1QNT A;  1SMY F;  1XCB A;  2A5Y B;  1DP7 P;  2CO5 A;  3P7N A;  3IKT A;  3WOD F;  3EDP A;  2IP2 A;  1I1G A;  5AIP A;  1S7A A;  2M45 A;  4BQA A;  3WTZ A;  2PJP A;  1SD6 A;  4A0Z A;  1K78 A;  3ECH A;  4M74 A;  4GGG A;  3EYI A;  3HRU A;  3F8M A;  1KQ0 A;  3GZ5 A;  1WRJ A;  2UZK A;  5LEK A;  1IXR C;  5CVI A;  4KN7 X;  3RYP A;  2DPD A;  5H6Q A;  3F21 A;  1XGS A;  4EM0 B;  5BQT A;  3E6D A;  1JHH A;  3SXY A;  1E2X A;  2GXB A;  1I5Z A;  1FWZ A;  2OBP A;  3CUQ A;  3JSO A;  3ZMS A;  5K5Q A;  3P9K A;  3CUQ B;  2O0Y A;  1J59 A;  4EGZ A;  4IJA A;  1TNT A;  3FWE A;  2RC4 A;  2BV6 A;  2V1X A;  2W25 A;  2GZW A;  3GZ6 A;  2FE3 A;  4KUM A;  1IF1 A;  1J9I A;  4ZYH A;  2DAO A;  3ROU A;  2QEN A;  1ZRD A;  1REP C;  5FD5 A;  5AON A;  3C1D A;  3DEU A;  4L5I A;  2O3F A;  2FEZ A;  4LGW A;  3GO5 A;  3V8K A;  4AIK A;  1B6A A;  1KA8 A;  2JPB A;  4KMF A;  5D4S A;  3F72 A;  1P6R A;  3TO7 A;  5CVR A;  1LEA A;  3T0Y A;  4BYY A;  4A6E A;  3FXQ A;  5FB2 A;  3T8R A;  2GWR A;  3Q9V A;  4M9S A;  3GVA A;  2ISZ A;  1J5Y A;  2JRT A;  2OZU A;  1G3W A;  2BGC A;  1FP2 A;  4KIC A;  1UHM A;  4RGS A;  5D5U B;  3QAH A;  3GFM A;  3ZMT A;  1ZYR F;  2VBX A;  1HXD A;  1R22 A;  3VFZ A;  3FZV A;  1DDN A;  1U2W A;  1RUO A;  3KZZ A;  1U5T A;  4RS8 A;  4LB5 A;  5A2Q K;  2ELH A;  1STZ A;  1BI1 A;  3CJN A;  4OMY A;  4I2O A;  2F5D A;  1HW2 A;  3HTU A;  2NAZ A;  2HOE A;  3ZMD A;  1J75 A;  3M9A A;  5CVU A;  4KT5 C;  2NRA C;  4H0E A;  1ON1 A;  2P6S A;  3M8E A;  3CDH A;  2PLY A;  1BJA A;  5ILU A;  1OKR A;  2TDX A;  2VN2 A;  3J7A O;  2KIM A;  1W7P D;  1ODD A;  3BRO A;  4P55 A;  3ZMV A;  3V4G A;  3WU1 B;  4FHT A;  1PDN C;  1MDM A;  2ZFW A;  5FLX K;  2DQL A;  3KP4 A;  1FSE A;  4KDP A;  5D6E A;  3TO6 A;  1TQP A;  3F8N A;  4G9Y A;  3Q9S A;  4YII A;  4O5V A;  3GFJ A;  3DKW A;  4A6D A;  1P4A A;  1ZGA A;  1YW7 A;  3CLO A;  2STW A;  2A07 F;  3V8J A;  3RIR A;  2MLK A;  3O6B B;  1K78 B;  3WTY C;  5DCF A;  2VOD A;  4KN4 X;  2AXL A;  2IA1 A;  1UFM A;  2PMU A;  1S7O A;  5JVT A;  5ILS A;  3P9C A;  2XKO A;  3QU3 A;  3W6K B;  2NS0 A;  3VOE A;  4KFC A;  3F8B A;  5E8I A;  2XVC A;  3DP7 A;  2V1D A;  3WE2 A;  3KE2 A;  2VOO A;  1L0O C;  5LGT A;  1FX7 A;  4XRF A;  4G8X A;  1ZH5 A;  1F1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...