1R1VA

Crystal structure of the metal-sensing transcriptional repressor czra from staphylococcus aureus in the zn2-form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords repressor protein
publication title A metal-ligand-mediated intersubunit allosteric switch in related SmtB/ArsR zinc sensor proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription repressor
total genus 34
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r1vA00
1KYZA 4WCGA 4EJTA 2HWVA 1B4AA 1OYIA 3IL2A 2P5KA 3Q5FA 4BYYA 5HVQC 2MC3A 1S8NA 3HTSB 3I71A 2F5EA 1QNTA 2K4BA 1Z05A 2QUFA 4G9YA 3C18A 3WTYC 2QLZA 2R3SA 5JR3A 4EM1A 1SD4A 4IVNA 4I02A 5FFXA 2LSOA 1F9NA 3E6DA 3T8TA 2XVCA 2JSCA 4LMYA 4EJUA 2GAUA 3I59A 1RZ4A 1K78B 3I54A 4N0BA 1LEAA 4MEYF 1SFEA 1TQIA 4CO8A 3RYRA 5CYVA 1IUYA 3QRFF 3LSTA 4PGGA 3VEPA 1KQ9A 1G3WA 1FBSA 4OIPF 2ACJA 2EA2A 5D5XB 3I0TA 4ON0A 1P4XA 2FBKA 2L4AA 2C6YA 4G8XA 4IRHA 5K5QA 4RAYA 4M71A 2FSWA 2KRFA 1K7AA 1J7KA 1Z9CA 2HTSA 5HDGA 1TTYA 1DP7P 2A6HF 2Z9OA 3OV8A 4GYIA 4IHTA 4KA4A 2VBYA 1W7PA 2ETHA 3N4MA 2RQPA 4HQMA 4KN7X 2XAFA 2EV6A 2BGCA 1ZRDA 5FD5A 4YIIA 2H6BA 3KLNA 5BS6A 4CGZA 2HFHA 3FM5A 2EFWA 5H6RA 1XDSA 1I6XA 2EJRA 4A6EA 2RGVA 1XGNA 2F5CA 4G6QA 3WTXC 2DQRA 1FWZA 4DQ2A 3BP8A 5F6FA 3F6OA 1J5YA 3D5LA 1RI7A 4P9UA 1FYKA 3I59B 4M74A 5F64A 4UVCA 4OMZA 4UXNA 2OU2A 2CSOA 4CHUA 3QOPA 2HGCA 5TRDA 2OZ6A 3E3VA 2VOOA 3MQ0A 4EGZA 1P4AA 2F5FA 1NHAA 4A5NA 1BIAA 5LEKA 2FMLA 3M7GA 3GXOA 1H0MA 3E6MA 3MZHA 1EH6A 3GW2A 4B8XA 3NEUA 4HAMA 4AIJA 1W7PB 2GA2A 2A3SA 2V6CA 3D0SA 4ZZLA 5HLHA 2DT5A 5DUIA 1MD0A 2K7LA 2XV4S 1S29A 5E1ZB 2W85A 2HZTA 1ZYRF 4HYEA 4L9VA 3GO5A 4KMUX 1QGPA 2FNPA 3TGNA 4O6JA 3JTGA 2L4MA 1I5ZA 2EA4A 4R8HA 4LB6B 3HRTA 2DW4A 5DD8A 3U2RA 1WQ2A 2HKXA 3IC7A 3J81K 1V4RA 5IT3A 2XIGA 2XRNA 3BPVA 5JFRA 3L9FA 4HZFA 1QQIA 1USSA 1E2XA 2D45A 5KVRA 5DD4A 4Z2YA 1REPC 3QU6A 4S05A 1OYWA 2O61A 1KA8A 3B73A 3GFJA 5BQTA 2L3DA 5LBQA 4HA8A 2VONA 2DTRA 2ESHA 3I4PA 3V8KA 2PN6A 3K69A 2P8TA 2Q0OA 3LFKA 2EK5A 4XSZF 4UV8A 5ILUA 4P5OA 1XSXA 3WGIA 5HOOA 3NQOA 2YR2A 2PBIA 3T5XA 2IJLA 4HLYA 4G7OF 4A0ZA 4Y15A 2P6TA 4YIFA 4LB5A 1R7JA 4LFUA 2J5OA 2LDUA 3WODF 4MQ9F 5HDNA 5HLGA 2UWMA 5EEGA 3U1DA 5ICFA 1FLIA 2NYXA 1XSDA 2VBWA 3P9KA 3F8MA 2XUBA 3E6BA 2JRTA 1MJ9A 4MNUA 2M1BA 1J59A 3MWMA 1XGMA 4NHJA 2EFOA 4L0ZB 1J0RA 1FYMA 2O6GE 1J75A 2XHKA 3WTVC 3K1PA 2R7DA 5A2QZ 1WRJA 2PQ8A 2H09A 2KIUA 4I0AA 2R7FA 1USTA 4A5MA 2O8XA 4RGXA 5E18F 1ODDA 1E17A 1L3LA 1HKSA 2DBBA 3DPTA 5L3BA 2IP2A 1KQ0A 4BXUA 1IXSB 4ESBA 1XCVA 2UZKA 3F3XA 1PUEE 3VODA 3N97A 3EDPA 2V79A 2L01A 3KEQA 1U2WA 2Q8KA 1H9TA 4RB3C 4ETSA 1QZYA 3DV8A 2W57A 2IRFG 4GGGA 4XRFA 1J9IA 2Z99A 1SFXA 4Y17A 2OA4A 4M6YA 5DCFA 3ULQB 2COMA 2UXNA 4OOIA 5D6EA 3WU1B 1ZN2A 2FBHA 1DPRA 5E17F 3FHZA 4PDKA 3I64A 2VE8A 1MZBA 3V7RA 1ZLJA 1UCRA 2H6CA 1U5TA 4KT5C 1FZPB 3BWGA 4EJWA 2EFPA 1EH8A 1B9MA 2MLGA 4HX8A 3BZ6A 3O6BB 3QAHA 5CVVA 1BI2A 1S7OA 1EV7A 1RIOH 4U7DA 4EM0B 2HR3A 1JGSA 4ENNA 4XLNF 3ABTA 4U0WA 1LVAA 3TO9A 2FBIA 3WE3A 2YX7A 1A04A 3GWZA 4QLCU 4LLLA 3QU3A 4AD9A 4KNYA 1ZAOA 2RC4A 3SQNA 4IF4A 1R00A 3VOEA 1D5VA 6PAXA 5FLXK 3T0YA 4A6DA 1YLFA 3E5UA 3M8EA 3DF8A 1KU2A 1YW9A 1SD6A 3IKTA 1W5TA 3JSOA 1O57A 4BNCA 4IHSA 3LQRA 2DLLA 1KYWA 2P7CB 1G3SA 3K2ZA 5ERIA 2ZJ2A 1STZA 1YFHA 1IRFA 4G6DA 3MFKA 1SMTA 5E8GA 1TBXA 2PLYA 2XAJA 4LK1F 4WXHA 1P2FA 3ZMVA 5BPIA 3KEOA 2VBZA 3AAFA 5D5VB 1PP7U 2EB7A 1O3TA 1TNTA 4KN4X 2O0YA 4RGUA 2DK5A 4GXOA 2KKOA 3DEUA 2W24A 5AIQA 3BJ6A 1Q1HA 4OU0A 3V8JA 2QBYB 3S2WA 3EQLF 2FXAA 3IKVA 4A12A 4WWCA 3LA7A 2VE9A 1J2XA 3SXYA 3WGHA 2F2EA 3QP5A 4CYDA 3EUHA 3RPQA 1R1UA 2STTA 3W6KB 1AWCA 3NRVA 2TDXA 2PG4A 1JHFA 1YYVA 4F7ZA 5BMZA 2Y75A 2P5LC 1S7AA 2L02A 5CVIA 3WTSC 1ZG5A 5BPDA 1OPCA 2WC2A 4WX9A 3IWFA 3RJPA 3GYHX 3BY6A 5E8IA 5LEJA 1UFMA 1HW5A 2XAHA 1QZZA 4XSXF 4EMSA 2VBXA 1DUXC 2M8EA 1WSUA 1P4WA 2MLKA 1YS6A 1ZG3A 3ECHA 3J81Z 2A68F 4DNCA 1OYYA 3IRRA 5ILVA 2H27A 3FXQA 2IA0A 5ICEA 3ZN0A 2EWNA 2QM3A 5ICCA 1Z6TA 3KETA 3CUQA 3FMQA 5F1RA 4NB5A 3GX4X 2LNBA 5FB2A 1R22A 1I1GA 2G7UA 2E7XA 1U78A 4RGRA 3FX3A 2Z33A 3V7CA 1O3SA 3KE2A 4ENMA 1ZREA 4HX7A 4HW0A 2DPUA 1QO0D 2FU4A 5KK1A 4OIQF 2M87A 1TQMA 1VTNC 2F5DA 3H3ZA 4L5IA 5L3GA 3FF5A 3HRMA 2K4JA 4LG0A 1T6SA 1BIBA 5TJJA 1BBYA 3IHUA 4RS8A 4I98B 3F8FA 2WV0A 4HQEA 5HLIA 4MTEA 3ZQ7A 4U0YA 4FHTA 3WTWC 3HSEA 1R58A 1U5TC 4UVBA 1LQ1A 4BHPA 5H20A 3IRQA 3MCZA 4WXCA 2FF4A 1WWXA 2ELHA 3IWZA 1GXQA 2KIFA 1YO5C 1HW2A 4FX4A 3CUQB 4G94A 2M5WA 4OINF 3ZP5A 4HLXA 2ZKZA 5ILSA 5D8KB 3F8NA 3I53A 2M30A 4KDPA 4ZYGA 2NNNA 1R5GA 2K27A 4BHBA 3F23A 2L54A 2BYVE 3KFWX 1O7FA 4KYWA 3OOPA 1HXDA 3WGGA 2O3FA 5CVJA 2IA1A 5L3EA 2OQRA 3RDIA 4FX0A 1FOKA 4LG0B 1IW7F 3GUDA 1MKMA 4A2UA 3GFLA 4LJZF 4ASNA 3R60A 5LGNA 4G7HF 2Q2EA 2MBFA 4R1HA 4M9XA 2G7HA 1LNWA 4M9SA 1Z7UA 2RVCA 2IW5A 3TO7A 2X4HA 1TNSA 3K0LA 3GF2A 2ZNZA 4LLNA 1MGTA 2HKOA 5CVRA 3BJOA 5H6QA 2HEOA 2GQQA 1ON2A 2CWEA 2A6EF 3BJAA 2PJPA 2BE5F 2B0LA 2VT3A 1T38A 2V1DA 4HV6A 4GYGA 1IN7A 4L18B 1ZGAA 4Q4ZF 1ZG1A 3DKWA 1R23A 3RKYA 3LQQA 2LKPA 4JBAA 2KIMA 1T39A 2JT1A 4WF2A 3ZMZA 2ZO4A 3CTAA 2DI3A 4AIHA 1FC3A 4L9NA 3GLXA 3DP7A 2FOKA 2DO7A 4N9IA 3J7AO 5FD6A 4JQFA 1I1SA 4XBFA 3V7SA 2QQAA 3WU0A 1QPMA 2DQLA 3Q9VA 2V1UA 3JAMK 5D8LB 4KMFA 2QYOA 3SHFA 2RN7A 2FA5A 4KFCA 1KU3A 3TO6A 4ZYHA 1S6LA 2XAQA 2X0LA 1IRGA 1P6RA 5K1YA 5LRRA 1H9GA 1SD5A 1LB2A 2HYFA 5LLQA 3RKWA 1F4KA 2OD5A 1PP8F 4ZH4F 2EFNA 2PEXA 4L5JA 1ZH5A 2ZFWA 1YIOA 4L9JA 5HS9A 1FPQA 2XGXA 2A07F 3ZMTA 1YS7A 3SFZA 3KP6A 4BH9A 4E70A 4BAYA 4TV7A 4OMYA 4I01A 4EGYA 4HX4A 3CLOA 4U88A 4I7HA 2OQGA 1FSEA 3HOSA 1YQAA 3VB2A 1DPUA 3RIRA 3CUQC 3ZMDA 2DFIA 1BI1A 1CGPA 3F6VA 4YFNF 4Q48A 1XB4A 1O7LA 4EVIA 1SAXA 3C7JA 1U3EM 2A5YB 4M6XA 1W5SA 4CZZA 3J80K 2FMYA 4U7BA 4EJOA 2YU3A 1IXRC 3LAJA 3VFZA 4RB0A 1UHWA 5D4SA 1MDMA 1IN5A 5AONA 4O3MA 2K02A 2QZ8A 4HOBA 1R36A 1RNLA 3M9AA 2QBYA 2MD5A 5L3CA 4YFXF 2EFQA 1XMAA 2PMHA 1X3UA 4ESFA 1HKTA 2P6SA 4O5VA 5IT9K 3KP4A 1KQ8A 3L7WA 4RB1A 1BJAA 4HF1A 1T0FA 4I2OA 5LHHA 3WTUC 1FP1D 1R1TA 2BBYA 4XLPF 3KP5A 3HRUA 5K5OA 3F72A 3V4GA 5BOXA 1ON1A 2WWYA 5DDGA 1HQCA 5JVTA 3L2CA 5JI6A 2HQNA 5E20A 3H92A 3R4KA 1U6GA 3KP7A 1YW8A 1LDDA 1GXPA 3HHGA 1RUNA 3T1BA 4RGSA 4RB2C 1U8RA 3T8RA 2JZYA 5E1XA 4BQAA 3B02A 2NAZA 3M8FA 1FBUA 3KCCA 2XROA 1MDMB 2HDCA 4EM2A 5LHIA 1XMKA 4R79A 1FYLA 2HYGD 1FP2A 2J5PA 4H0EA 1YW7A 4YG2F 1HSTA 4P55A 2JPCA 2DU9A 1HKQA 3ROUA 2FEZA 4L0YB 1YG2A 3U9GA 3HSRA 1BN5A 3HTUA 2NRAC 1FX7A 4ZYEA 3CO6C 4B09A 2IT0A 1BOAA 2XAGA 2FQ3A 1SMYF 3ELKA 4CDGA 1V3FA 3TOBA 3F8CA 2VODA 5LHGA 5L3DA 1IN6A 1G3TA 3EYIA 4IRGA 2EV0A 3W6JB 2ZBKA 3RYPA 2IPQX 4P96A 2YSRA 2ZXJA 3WE2A 3CO7C 4UUVA 3V8LA 4PGHA 2AXLA 2VN2A 2GXBA 5CVUA 4KUMA 5D5UB 1PDNC 4KIBA 1HW1A 5LGUA 2GA1A 5J8FA 2GZWA 2CFXA 2XKOA 3ZPLA 2K86A 1TW3A 3BPXA 3HHHA 4P9FA 2ADUA 3E5XA 3FZVA 3HYIA 3GZ5A 3HSFA 4WK8F 3GEZA 5FO5A 2CQKA 1ONVA 1XN7A 3EETA 4EJVA 1LEBA 2D1HA 1F1ZA 1IZ1A 2ZMEA 3E97A 3KP3A 3H3UA 1IXCA 1TW2A 1BI0A 1JXSA 3ECOA 5D4RA 3LA2A 1B9NA 3WG9A 5LGTA 4S04A 3FXRA 3DXJF 4Q47A 1ZHFA 1T2KA 3MAJA 1FY7A 1YTYA 4CICA 1FNNA 2MH2A 1DDNA 4M72A 3PQJA 2EV5A 4ZZDA 2P4WA 3RI4A 2DAOA 1KU7A 3I5UA 3F22A 4KICA 3K1MA 4ZYDA 5AIPA 4ESJA 1I27A 1IN8A 2OBPA 2BV6A 3FM3A 4I0BA 4L9TA 5D5WB 4GCVA 2HS5A 4LD5A 2RV8A 3KLOA 3ZMUA 4IPAA 4QWQA 2QQ9A 4JK1X 3JW4A 4WXDA 2GWRA 3MEXA 1XGSA 2E1CA 3K1NA 2CO5A 2ZMEB 4GO1A 1R1VA 4LLGF 5HS8A 2CGPA 3HRSA 1W4MA 4MEXF 2JPBA 3LA3A 2M45A 2PMUA 3JAMZ 5J8CA 1B6AA 5EEHA 3ABUA 3WTTC 4HDUA 4MGRA 1ZRFA 2BEOA 3LWFA 1K79A 3WTZA 4I09A 2YX4A 3PQKA 3MZYA 2UXXA 1MJAA 1FSHA 5K5RA 3F21A 4D0PA 3ZN1A 1W7PD 2OAZA 4OIOF 2V9VA 4M9ZA 1B59A 5DEQA 3HUGA 1D3YA 3TKYA 1Z1DA 1IAWA 3K9TA 2ESNA 3GFIA 2STWA 2FNAA 2NNYA 2G9WA 3COAC 1UB9A 3C3WA 3BROA 1ZGJA 2Y0MA 2LF7A 2PI0A 3I58A 2WTEA 2ZCWA 5HDKA 1Z6RA 1G6NA 1P92A 3P7NA 2Z5UA 3RTRA 4AIKA 2W25A 2KJCA 3CJNA 1O3QA 4N9HA 5DCMA 4OIRF 4AWXB 2CW0F 3TDZC 3J80Z 2VC0A 1FT9A 2DPDA 3G73A 3M1EA 3C1DA 4K2EA 1JE8A 2XASA 2RKHA 3E6CC 2W84A 4EQQA 2V1XA 1GVJA 1KGSA 4A0YA 2CYYA 2ZNYA 3KZYA 2FRHA 3L09A 1T98A 3FXUA 3FWEA 1G4DA 5ED4A 4KIFA 1ULYA 5IT9Z 2D1VA 2HTJA 5FLXZ 1OMIA 3KZZA 1RUOA 2VT2A 3R6SA 3RKXA 1OKRA 3P9CA 1ZRCA 1G3YA 3E5QA 4ENJA 4UV9A 4PZJA 1S3JA 4UVAA 4BHCA 2MH9A 4A0XA 3JSPA 1BI3A 3O2PE 4LGWA 1LDJA 1FBQA 1WKMA 1JHHA 3JTHA 4FT8A 4G7ZF 2CG4A 5DCMB 3DQVC 3FMRA 1SD7A 4EV0A 3REOA 3GVAA 4MQVA 1UHMA 3CUOA 2QWWA 3ERED 4IJAA 3SZTA 2PFBA 5D6FA 4Y13A 2LF8A 2KJBA 1KU9A 1Z91A 2GIVA 2QVOA 3ISPA 1BC7C 4HF0A 4NQWA 2ISYA 3TOAA 1XD7A 4IXAA 4IRIA 2AS5F 3GFMA 1XGOA 4KIGA 2QENA 2Y48A 1B1BA 2A61A 2IVMA 4LK0F 4MHGA 2HQRA 3BOQA 1LJ9A 3L00A 3BDDA 3PFIA 4HDVA 5DUKA 3HOTA 4HBLA 1HBXG 3ZMSA 3DPLC 3F8BA 1ZLKA 1OR7A 4PCQA 1BC8C 3Q9SA 1CF7A 2DK8A 1XDUA 1R5HA 2GXGA 5CLSA 2YPRA 1MJBA 5FGMA 3R0JA 3R0AA 5J6XA 2P5VA 1GHCA 1ZARA 3EYYA 2VXZA 2A69F 2ISZA 1XSVA 1HSJA 4YFKF 1Y0UA 2Z3YA 5E1WA 3DFGA 2D2WA 2RNJA 3QPTA 5FFZA 2RDPA 5A2QK 4MTDA 2JTVA 2MA3A 2VOPA 4CXFA 5HS7A 1QBJA 1TQPA 3ML6A 3CDHA 1IF1A 1F5TA 3P9IA 3G3ZA 2FE3A 3GZ6A 5DV5A 2NS0A 1IN4A 4Q5SF 2VC1A 1L0OC 1TLHB 5L3FA 4HF2A 5JHUA 4RAZA 5ICGA 4M73A 2HOEA 1XCBA 1K78A 5LRSA 1EH7A 1O3RA 1K6OA 1AOYA 1WI9A 1D8KA 1C0WA 3FMSA 3LAPA 2E1NA 5CJ9A 3R61A 3O3KA 1SFUA 1BM9A 1U5TB 2P7VB 1LDKB 1D8JA 1CF7B 4UHTA 4U0VA 2E7WA 4HV5A 3TDUC 2H94A 2O03A 4UNOA 2OZUA 2XKPA 3HIFA 5DYMA 2QQBA 4AVPA 3RPUA 3QP6A 3TQNA 3QPHA 3SZPA 3KP2A 2IA2A 4ENKA
chains in the Genus database with same CATH superfamily
1KYZA 4WCGA 1R4NB 3AG4H 4EJTA 3HB9A 2HWVA 4A3IJ 1LFPA 1B4AA 3JCUC 1OYIA 3G1LA 3IL2A 2P5KA 3Q5FA 4BYYA 3ONQA 4A93J 5EEAA 4BEHA 5HVQC 2MC4A 2MC3A 4DZJA 1S8NA 2KL4A 3HTSB 3I71A 3MKWB 1EF4A 2F5EA 3ZQCA 2RQQA 2Q1ZB 1IRZA 1QNTA 5FKMA 3K2AA 2K4BA 1Z05A 3FK7A 5F0HA 2QUFA 5F1JA 4G9YA 3C18A 4AVZA 3WTYC 2LMDA 2IAIA 2QLZA 3O8GA 2R3SA 2V9PA 5JR3A 2CQNA 1SD4A 4IVNA 4EM1A 4I02A 5FFXA 2LSOA 1JGGA 3S1QJ 1F9NA 2BW3A 3E6DA 3HM5A 3T8TA 4C3JJ 2GXAA 2UUZA 1X1AA 2XVCA 1BW5A 2JSCA 4LMYA 4EJUA 2GAUA 4QIWN 1WJFA 3I59A 1RZ4A 2PJRB 1K78B 1GV2A 3I54A 4N0BA 3CMMA 2ID3A 2VQGA 1P7JA 1LEAA 4MEYF 1SFEA 1TQIA 3K4LA 4CO8A 2WY8Q 2YUSA 3RYRA 5CYVA 1IUYA 2KZGA 3BG5A 2W7NA 3QRFF 3LSTA 4PGGA 3VEPA 1Z21A 1KQ9A 4BE1A 1G3WA 1FBSA 4OIPF 4XL9A 2ACJA 2EA2A 1BR2A 5D5XB 1QVTA 3I0TA 3MN2A 3HOZJ 4ON0A 1P4XA 2FBKA 2R7OA 2L4AA 2C6YA 3H0DA 3K4JA 4G8XA 3DTEA 1ZR4A 4IRHA 5K5QA 3CCEI 4RAYA 4M71A 5E3LA 2KQRA 2FSWA 2JK3A 3GBGA 2HOTA 2F4OB 2KRFA 4BJ5C 1K7AA 2IGMA 5EZHA 1J7KA 1RKWA 1Z9CA 2HTSA 5HDGA 1TTYA 1DP7P 2A6HF 3M3YJ 2Z9OA 3OV8A 2DT7B 4GYIA 4A69C 4IHTA 4KA4A 3IH4A 3W6VA 2IS2A 4IHWA 2VBYA 1W7PA 2FJ1A 2ETHA 3GTOJ 3N4MA 1YHQI 2ECBA 2RQPA 1WCMJ 2M9HA 4HQMA 1SFOJ 2R7VA 4C2UA 4KN7X 2XAFA 2EV6A 2BGCA 1ZRDA 4AUXA 5FD5A 2L9NA 4UY8I 4YIIA 2H6BA 1UAAA 1JUPA 3KLNA 5BS6A 4CGZA 2HFHA 3FM5A 3CDLA 2EFWA 2KRHA 2M4KA 1MMGA 2VPRA 2DA4A 2IS6A 1QVUA 4U87A 4NC6A 5H6RA 1XDSA 1TWAJ 4BEHB 3HOUJ 1I6XA 3E7LA 2EJRA 2NVQJ 4A6EA 2RGVA 2HDDA 1XGNA 2F5CA 4G6QA 3WTXC 2KDOA 3G4SI 2DQRA 1J09A 5HODA 1FIAA 4DW6A 1FWZA 4DQ2A 3AG2H 3BP8A 1Y39A 4W1UA 4RBOA 2BW3B 5F6FA 4A3KJ 2KIQA 3F6OA 1J5YA 3D5LA 1RI7A 4P9UA 2MFZA 1FYKA 2Y31A 3I59B 4M74A 2NVXJ 2NOJB 5F64A 1QZEA 4DGWB 4UVCA 4LITA 1KONA 4OMZA 4XLAA 4UXNA 2OU2A 2CSOA 2AXTC 3WHCA 3HL2A 1VQMI 5TISC 4CHUA 2DA7A 1X58A 2CQQA 3QOPA 5GTIC 2HGCA 2WAQN 5CKTA 5TRDA 5F27A 2OZ6A 5EGOA 3M8JA 5J3LA 3E3VA 2VOOA 3MVPA 1VQPI 2WBMA 1WJEA 3DTKA 3MQ0A 1XX5A 5HNFA 1P4AA 2VJJA 3FKIJ 4EGZA 3S3NA 4GDFA 3J7AY 2F5FA 1NHAA 4QSHA 4PJMA 4A5NA 1BIAA 5LEKA 2FMLA 3M7GA 4RMNA 3KEYA 3GXOA 1H0MA 3MZ8A 3E6MA 5J4VA 3MZHA 1EH6A 2H8WA 3GW2A 4B8XA 4MO7A 3H5NA 3NEUA 3AFHA 4HAMA 5B1AH 3CF5F 4AIJA 1W7PB 1Z77A 2A3SA 2GA2A 2V6CA 3LFUA 1I6HJ 2DDAA 3D0SA 4ZZLA 5HLHA 2DT5A 4II2A 3OS2A 3S2HJ 4HNTA 5DUIA 1DGRM 1D1AA 1MD0A 2K7LA 2ZFUA 2X85A 2XV4S 1VQOI 4AU7A 3CDIA 3CZ6A 3DPUA 2EZHA 3OYBA 3SFIA 2M3AA 1S29A 2XPWA 5E1ZB 1OR7C 2HZTA 1ZYRF 2W85A 4HYEA 1ETOA 4L9VA 2IS1A 4E4HA 3GO5A 4KMUX 4D7MA 3K7AJ 1AKHA 1QGPA 5DTDA 2FNPA 3TGNA 4ZTFA 4O6JA 3OR2C 3FK6A 3Q0WA 3JTGA 1IV6A 2L4MA 1I5ZA 3G1OA 2EA4A 4R8HA 5IOYA 4LB6B 1XPXA 3HRTA 2DW4A 2MYSA 2A05A 3VSLA 4IZZA 5DD8A 3U2RA 3RKQA 2K9LA 1WQ2A 2HKXA 3IC7A 1QHGA 3J81K 1V4RA 1XC5A 2DYRH 5IT3A 1XS9A 2XIGA 4HNUA 4A3LJ 2XRNA 3BPVA 5JFRA 4XONA 5E79C 3L9FA 3NWTA 4HZFA 1ZKGA 1QQIA 1USSA 1E2XA 1T08B 2D45A 4YEJA 4M3GA 3CCLI 5KVRA 1D1BA 5DD4A 4BS9A 2VXDA 4Z2YA 1REPC 3QU6A 2BHYA 2DMNA 4JX4A 5EDNA 3PSFA 4HNVA 4S05A 1OYWA 2O61A 1KA8A 3B73A 1W0TA 3GFJA 2B7EA 5BQTA 2L7MP 5EGOB 2L3DA 1WPKA 5LBQA 4AM3A 4HA8A 2VONA 2DTRA 2ESHA 3CP8A 3I4PA 3V8KA 4AYBN 1MNMC 3CC2I 2PN6A 3HOWJ 3VYSB 3K69A 4ZDLA 2P8TA 2Q0OA 3HBLA 3LFKA 2EK5A 3L2RA 1EJ9A 2X6XA 1A31A 4XN0A 4XSZF 4UV8A 4JX5A 5ILUA 4P5OA 1XSXA 2YU9J 3BR2A 3WGIA 5HOOA 1LKXA 3NQOA 2YR2A 2PBIA 2DMTA 3T5XA 2IJLA 3RCOA 4HLYA 2XF5A 4G7OF 4A0ZA 5M5XJ 4Y15A 2P6TA 4YIFA 4LB5A 1PUFA 1K4SA 1R7JA 5FRNA 5H2FC 2PX9A 1U0JA 1WJ5A 4LFUA 1Z7LA 2HPIA 1ITYA 1AKHB 2J5OA 2LDUA 3HC7A 3WODF 2ELJA 1DU6A 4MQ9F 1D0ZA 2VB6A 1WH7A 1PJRA 5HDNA 5HLGA 5IYCJ 2OPTA 2UWMA 2FQ4A 5EEGA 4UUSA 3CLQA 3I4NJ 3U1DA 5ICFA 1FLIA 3GLLA 2NYXA 4V2FA 1XSDA 1NK3P 2VBWA 3GTLJ 2KRCA 1A6QA 1FEXA 4HG2A 1HA8A 3P9KA 2X1EA 3F8MA 2ELKA 2XUBA 3E6BA 3CC4I 2JRTA 3OYEA 2EZLA 1MJ9A 4MNUA 2M1BA 3H3VK 1J59A 3MWMA 3VWBA 1OCRH 1XGMA 2I8DA 3H5AA 4NHJA 2EFOA 4L0ZB 1J0RA 1FYMA 1MBGA 2O6GE 1J75A 1FOYA 2DJNA 2XHKA 2LRDA 1R4MB 4BQQA 3WTVC 2QQ8A 3K1PA 2R7DA 3KPHA 3HKZA 4BBRJ 5M5WJ 4XRMA 4UB8C 2Y0SA 1ZELA 1LUJB 4JP0A 3U1KA 5A2QZ 3VDXA 3SDGA 1WRJA 2PQ8A 2H09A 2KIUA 4HSRA 4I0AA 4XLCA 4E7SA 2R7FA 1QU3A 3QWLA 1USTA 4A5MA 2O8XA 4RGXA 4B47A 5E18F 1ODDA 1E17A 1L3LA 2JA8J 3NAUA 1HKSA 3IV5A 2DBBA 2Y9YA 3DPTA 5L3BA 2IP2A 1KQ0A 2LY9A 4BXUA 5IOZA 1IXSB 2R7ZJ 3SDBA 2E5NA 1RETA 4ESBA 1XCVA 1MSFC 3BCBA 3F3XA 2UZKA 2HPMA 1PUEE 3VODA 3N97A 3EDPA 2V79A 3LNQA 1K6YA 2IBDA 2L01A 3S15J 2W4SA 2L9VA 2ZJRF 4ZTJA 3KEQA 1PUFB 3GTKJ 1U2WA 3OYKA 2Q8KA 1WGXA 1H9TA 2H1KA 1ZGWA 4RB3C 4ETSA 1QZYA 3DV8A 2W57A 2BY0A 2IRFG 3DEEA 1GT0C 3HJEA 4GGGA 4XRFA 3OYIA 3JREA 1J9IA 4UUSB 2CMPA 2Z99A 2GOMA 1SFXA 3A2KA 4RAFA 3EUKL 5DM6F 4Y17A 1X4PA 2OA4A 2XGCA 4M6YA 2ID6A 1YIJI 3W3CA 5DCFA 3ULQB 2ZC2A 2VQCA 2ZMEC 2COMA 4IX7A 2UXNA 2NS7A 4OOIA 3PUBA 3QPSA 5D6EA 4E7ZA 3WU1B 1ZN2A 1E0EA 3CCQI 2FBHA 1DPRA 5E17F 3ASNH 3FHZA 4PDKA 3DLLF 3I64A 3BR3A 3DKYA 2VE8A 3MKLA 4XOPA 5GP9A 1E3PA 1MZBA 2F6CA 3V7RA 4F93B 4F52A 1ZLJA 1UCRA 2H6CA 1U5TA 2P0WA 4KT5C 1FZPB 5IP6A 3BWGA 2JJ7A 3UR3C 4EJWA 2EFPA 1EH8A 1B9MA 2MLGA 3HZJA 2CJJA 4HX8A 4M6VA 3BZ6A 3JRFA 3O6BB 3QAHA 5CVVA 1BI2A 3H1CA 3ZR8X 3DKXA 1S7OA 1EV7A 2XPVA 1RIOH 3PFYA 1SAUA 3KYDB 2VQHA 4Y52J 3BT9A 3TW6A 4EM0B 4U7DA 4QTRA 4CCJA 4C9YA 3C2GA 3O8HA 2EQRA 2XC7A 2HR3A 4JYKA 1JGSA 1OJLA 2GM4A 4ENNA 1TT5B 1I3QJ 2NVUB 3LSKA 1DP3A 4XLNF 1IUFA 1MH3A 3ABTA 3E1SA 3C2HA 3BZKA 4BACA 2R7SA 3BC8A 1V5EA 3K4MA 1P7IA 3LSHA 4U0WA 1LVAA 3TO9A 4LG3A 1UG2A 2FBIA 3WE3A 2YX7A 1S9HA 1A04A 3GWZA 4QLCU 4LLLA 2DJIA 3QQAA 3QU3A 4AD9A 4PJLA 4LOCA 2GOXB 4KNYA 1ETVA 1ZAOA 4D9JA 2RC4A 3SQNA 2L7FP 4IF4A 3CCVI 1R00A 3VOEA 2GLOA 1D5VA 2QKLB 6PAXA 4CCOA 5FLXK 3FKJA 2DOAA 3I3LA 2NVTJ 3T0YA 3S1NJ 3LSIA 2KP6A 4A6DA 1P9QC 1W0UA 1YLFA 2R93J 3ZGKA 3E5UA 1RC9A 3M8EA 3DF8A 1KU2A 2L9SA 1QRYA 1YW9A 3OOUA 1SD6A 3IKTA 1W5TA 3A01A 4X6AJ 3JSOA 1Y6IA 3F9KA 1D1CA 1O57A 2QSGX 2W1OA 5KAFC 1YJNI 2GIZA 1WVRA 4BNCA 4IHSA 3ZQIA 3LQRA 2E1MB 2DLLA 1ERDA 3CQZJ 1KYWA 4BDYA 2JA5J 3CCUI 1G3SA 2P7CB 1WJCA 3K2ZA 3IUOA 4A3DJ 2HQAA 5ERIA 2ZJ2A 1STZA 1SFKA 1YFHA 1IRFA 2EZKA 4G6DA 1IDZA 3MFKA 2EH3A 4BQNA 1SMTA 5E8GA 3K70C 1TBXA 4BXFA 1H88C 2PLYA 2XAJA 4LK1F 5J47A 1ORKA 2CV0A 4WXHA 2XSDC 2OJED 1P2FA 3ZMVA 5BPIA 3KEOA 2VBZA 3HPGA 4PJNA 3TMOA 3AAFA 1EKEA 5D5VB 1PP7U 5JLXA 4B4CA 1Z3XA 2VJIA 2EB7A 5IYDJ 1Y1WJ 1O3TA 1TNTA 3CESA 4KN4X 4PSXA 3S32A 2CU7A 1VQ6I 1X1PA 4B1RA 5J40A 2O0YA 4RGUA 2DK5A 4GXOA 3HOVJ 2FD5A 1YX5A 2KKOA 2IXSA 3IH3A 3DEUA 2W24A 2LK2A 1B72A 5AIQA 3BJ6A 2Z2SB 2JSPA 4Y3OA 1H89C 1Q1HA 4OU0A 3V8JA 2QBYB 4CCNA 2XB0X 1M1EB 4XKWA 1V5FA 3S2WA 3EQLF 1OISA 2FXAA 3IKVA 5GADJ 4A12A 3JRDA 4WWCA 3LA7A 2Y69H 2VE9A 1J2XA 4B3AA 3SXYA 3WGHA 2PMZA 2Z16A 2F2EA 2V6EA 5HLTA 2CQXA 3QP5A 2DN0A 1MSEC 2O5RA 1Z3YA 3FXKA 4CYDA 3EUHA 3GTMJ 2DMQA 3OYCA 3RPQA 1R1UA 2STTA 3W6KB 1AWCA 3NRVA 2DA1A 2TDXA 2PG4A 1JHFA 1YYVA 3K4KA 4IQJA 3A01B 1X2NA 2MSYA 4F7ZA 2IGOA 5BMZA 2Y75A 2E19A 2P5LC 1S7AA 1MW7A 2VJ5A 1E3HA 2L02A 5CVIA 3WTSC 3KX2A 2ZSIB 1ZG5A 3N05A 5BPDA 1SEUA 3K6GA 2JUCA 1OPCA 1POGA 2IGNA 2QGUA 2WC2A 4WX9A 3IWFA 3ZQGA 3RJPA 1MBKA 3U21A 4NDLA 5KCMA 4BE0A 1HDDC 3GYHX 4E7JA 3BY6A 3QODA 4CCLA 4DIQA 1OCCH 2O7OA 3ZOBA 5E8IA 3PIPF 5LEJA 1UFMA 1HW5A 3OR1C 4DBRA 1GDTA 5IYBJ 3BG3A 2M34A 2XAHA 1QZZA 4XSXF 3W2WA 2P81A 4EMSA 3JRGA 2VBXA 1DUXC 2MW8A 2M8EA 1WSUA 1P4WA 2M8GX 2ME0A 2MLKA 2RAEA 4FASD 1ZTRA 1ENHA 1YS6A 1ZG3A 1MMAA 1YI2I 3ECHA 3J81Z 2A68F 4DNCA 1OYYA 2KFDA 2OTLI 3IRRA 4E7LA 5ILVA 1HDPA 2H27A 3FXQA 1TC3C 3OSFA 2IA0A 3FBNB 4DYQA 4S0HB 2DOEA 4OAYA 2L0KA 1B72B 3JR9A 5ICEA 3P5JA 3ZN0A 2EWNA 2QM3A 5ICCA 3I4MJ 1WJAA 3K10A 1D5YA 1WHUA 1D0XA 1VI0A 1Z6TA 5FJ8J 2NS8A 3KETA 4ZJZA 4LIVA 3CUQA 3FMQA 2GBYA 5F1RA 4NB5A 3GX4X 5M3FJ 3PL8A 2LNBA 1AHDP 4D5CA 1EA3A 4D1QA 4BL0B 3OYMA 2BZTA 5BNGA 5FB2A 1GV5A 1R22A 1I1GA 2G7UA 1ETXA 3L2VA 2E7XA 1U78A 4RGRA 1OCOH 3FX3A 2Z33A 3V7CA 3BQYA 3AG1H 3K4NA 1O3SA 3KE2A 1V55H 4ENMA 1ZREA 2OC6A 1I50J 4GRIA 1X1BA 2NXNB 1Q1VA 2B63J 1NH3A 4HX7A 3VPRA 4HW0A 3DCFA 1VFCA 2ZJPF 2DPUA 1QO0D 1WJDA 4I99C 2FU4A 5KK1A 4OIQF 1TT0A 2M87A 1TQMA 2CUFA 2F5DA 4NC7A 2BVLA 1VTNC 2JA6J 3PSIA 1JKPC 3H3ZA 1W5CC 3FXLA 4L5IA 5L3GA 3OIPA 3FF5A 4BXXJ 3HRMA 2V26A 2K4JA 4LG0A 1T6SA 1LFBA 1BIBA 5TJJA 1BBYA 3IHUA 4RS8A 3LSGA 4I98B 3F8FA 5FLVA 1BL0A 2WV0A 1IO2A 2KDZA 1UELB 5C4XJ 2Y9ZA 4HQEA 1OQYA 3HEFA 5HLIA 4MTEA 3ZQ7A 1U8BA 4U0YA 4DYCA 4D5FA 1FMVA 4ZDPA 4FHTA 1MBFA 3X2QH 3M4OJ 1F43A 4M3FA 3WTWC 2K9QA 3HSEA 4RM2A 4A3FJ 2JQ7A 1R58A 2HVSA 1U5TC 2YS9A 4UVBA 1LQ1A 4IOAF 1K83J 4BHPA 1FOWA 4ZC3A 5H20A 1JT0A 1B8IA 3IRQA 3MKYB 3MCZA 4WXCA 2FF4A 1WWXA 5FKNA 2ELHA 3IWZA 3CF2A 2I10A 1GXQA 2KIFA 5DS9A 5TGTA 4F92B 1YO5C 1HW2A 4ABZA 4XRSA 3M1CA 2XF6A 4FX4A 3LSPA 3CUQB 3EUAA 2MGQA 4XRSG 1DU0A 3BTIA 5EYRA 1A36A 4G94A 2M5WA 1O4XA 4OINF 3ZP5A 3LL7A 4HLXA 2ZKZA 5ILSA 5D8KB 3OY9A 4I6ZA 1A6IA 3F8NA 3S2DJ 3OYLA 3HOYJ 3I53A 2E71A 2M30A 1OFCX 3TW7A 4KDPA 4ZYGA 2NNNA 1R5GA 5J1UA 2W00A 3OYJA 1JKOC 2VPLA 2E36A 2F48A 2K27A 4BHBA 3K4BA 4XKVA 1IV8A 3JRHA 1MBHA 5K7HA 3F23A 5B1BH 2A6TA 1RR8C 2O9LA 2G0EA 2L54A 2BYVE 2H1LA 1OCPA 3KFWX 1O7FA 4FTHA 3S1RJ 3MKZA 4KYWA 3BQZA 1MMDA 3DWLE 3OOPA 2CV2A 1HXDA 2DODA 1ZR2A 2M4GA 3WGGA 2O3FA 5CVJA 2KPMA 2IA1A 2E2HJ 3DBRB 3CCJI 2BY3A 2LVSA 1N77A 5L3EA 4CCMA 3BLYA 2OQRA 3RDIA 4FX0A 1FOKA 4LG0B 1IW7F 3GUDA 1MKMA 1TP4A 2BHZA 1NK2P 2LYCA 4A2UA 3GFLA 2EILH 4CSWA 1PYVA 4LJZF 4ASNA 1BW6A 3R60A 5LGNA 4G7HF 2Q2EA 2MBFA 3WG7H 1UG0A 4R1HA 4NUBA 4M9XA 2G7HA 2HOSA 4A3JJ 1VQNI 1LNWA 3OYAA 2LTPA 4M9SA 2R7RA 1Z7UA 3LSJA 4CCKA 5C3EJ 2RVCA 1ETYA 1YJ9I 3HKZN 2IW5A 4B44A 3FXOA 1JUSA 2XPUA 2OCCH 3TO7A 2X4HA 2XGDA 2Y0SN 1TNSA 4BU2A 2O8KA 3K0LA 3GF2A 2VKHA 2XF7A 3BR5A 1F36A 5B5EC 5IY5H 1B8IB 4IHYA 2E5ZA 2ZNZA 1G59A 4C2TA 1MGTA 4LLNA 4KITB 2HKOA 5CVRA 3BJOA 2M0MA 5H6QA 2HEOA 2GQQA 3MMYB 1N25A 1ON2A 3FIWA 2CWEA 2BY1A 4XK4A 2M7BA 4B43A 2A6EF 4BJ6C 3BJAA 4M3BA 2M2EA 2PJPA 2BE5F 2MG4A 2B0LA 1N75A 2VT3A 1T38A 2V1DA 3DTIA 4HV6A 4GYGA 1IN7A 4L18B 1ZGAA 2WAFA 3PNYA 2E2JJ 4Q4ZF 1ZG1A 2AO9A 3DKWA 1R23A 3RKYA 3LQQA 2LKPA 3D1NI 1MNEA 5CQGA 3F0CA 2JA2A 4A3MJ 2X1DA 2KIMA 4JBAA 1T39A 2JT1A 4WF2A 3ZMZA 1JTYA 2ZO4A 3CTAA 2DI3A 2JMWA 4AIHA 3S14J 1WH5A 2TCTA 1FC3A 4L9NA 3GLXA 3DP7A 2HVQA 2FOKA 5J4YA 2DO7A 4N9IA 3J7AO 5FD6A 3FBIB 4JQFA 2ZXIA 1I1SA 4XBFA 5F0CA 3V7SA 2QQAA 3WU0A 1QPMA 1ZK8A 2DQLA 3EUHC 3FDYA 3Q9VA 2V1UA 3CJRB 3JAMK 3PIOF 5D8LB 2X51A 2COBA 2V1NA 1NG6A 3QYEA 4KMFA 2QYOA 3SHFA 2RN7A 2Q2EB 2FA5A 4KFCA 1KU3A 3BG7A 3TO6A 2QEXI 4ZYHA 4CUGA 3PUFA 4BGDA 1S6LA 4DJAA 5GAHJ 2LH9A 2XAQA 2X0LA 3A4CA 1IRGA 3VYUB 1P6RA 3IAM2 5K1YA 2LD5A 1KZHA 4QPQA 1Z67A 3GMEA 1FIPA 2ZB9A 1LFUP 2R7UA 5LRRA 1K4TA 5FRMA 2LREA 1XG1A 1H9GA 1SD5A 3I55I 2ZXHA 2R5YA 1T8IA 1LB2A 2ICWG 2DDBA 2HYFA 5LLQA 3RKWA 3L1PA 1F4KA 2OD5A 1PP8F 2JN6A 4ZH4F 2EFNA 1W36C 2PEXA 2F4IA 4L5JA 3CMAI 4W97A 2OV7A 1ZH5A 2ZFWA 1MIJA 1YIOA 4L9JA 5HS9A 5LFAA 1FPQA 5IP7J 2UV1A 2XGXA 2A07F 3ZMTA 1YS7A 4KJZA 3SFZA 3KP6A 4BH9A 4E70A 4C3IJ 1R5ID 4BAYA 4TV7A 1D0YA 2Z1DA 2OTJI 4OMYA 4I01A 4EGYA 1R6RA 2DT6A 4HX4A 1IC8A 3CLOA 4ZYAA 4U88A 1QHHD 4I7HA 2OQGA 1FSEA 3HOSA 3JRIA 1T33A 1YQAA 4YELA 3L2UA 2W82A 2LG4A 3SEZA 4E7HA 3VB2A 1DPUA 3RIRA 3CUQC 3ZMDA 4E6KG 5GPCA 2DFIA 1BI1A 2XRLA 1I39A 1CGPA 3F6VA 1DQUA 4Q48A 4YFNF 2DCEA 1XB4A 2AQFA 1FOXA 5F04A 1O7LA 4EVIA 3PJRA 4X1EA 1SAXA 5DM7F 4FCYA 3C7JA 1U3EM 2A5YB 4M6XA 1W5SA 4G12A 5EF6A 4CZZA 3J80K 2FMYA 1ZQ3P 2LFBA 1PVEA 4E7IA 2KMUA 1W1WE 4U7BA 3AG3H 4PFOA 3S17J 1APLC 4Y33A 5HNHA 4EJOA 2YU3A 2EIMH 4JX6A 1IXRC 2LLKA 5K7ZA 4RA2A 3LAJA 3VFZA 5K7FA 3BG9A 3S93A 1JT6A 4RB0A 4V2GA 1RESA 1UHWA 5D4SA 1MDMA 4BY7J 1IN5A 5AONA 4O3MA 4I76A 4G6TB 1IG7A 1VQ9I 2K02A 2LC2A 5EJCA 1N78A 4ANJA 2QZ8A 3A0BC 4HOBA 1DGWY 2K9NA 4XKCA 1R36A 4EEFG 2WAEA 1GVDA 1RNLA 3M9AA 2QBYA 1TWGJ 2MD5A 2R5YB 5L3CA 4YFXF 2EFQA 1XMAA 2PMHA 1X3UA 4ESFA 1HKTA 2P6SA 4O5VA 5IT9K 2DFFA 3H0GJ 5CQEA 3KP4A 5C4JJ 1KQ8A 3A03A 3L7WA 4RB1A 1BJAA 4HF1A 1T0FA 2R7TA 4I2OA 2BY2A 5LHHA 4XLHA 3S16J 2HXIA 2LBFA 3V42A 1FP1D 1R1TA 2BBYA 3WTUC 4XLPF 3S1MJ 3KP5A 3HRUA 5K5OA 4B48A 3F72A 3TBIA 3V4GA 5BOXA 3ESWB 1Y1VJ 3BZCA 1VQ8I 1SC7A 2MD0A 1ON1A 2WWYA 1HF0A 2L7ZA 2LY1A 2X48A 5DDGA 1HQCA 5JVTA 1X1CA 4HSTA 3TP3A 2DXIA 1V54H 3L2CA 5JI6A 1U9OA 2JVGA 2HQNA 4YIRX 5E20A 3SZGA 1BJZA 3H92A 2V4JC 1RKTA 3R4KA 1U6GA 3KP7A 2PMZN 1YW8A 2WA0A 1LDDA 3Q0VA 1YRNA 1MH4A 3OYHA 2DFHA 5M3MJ 3GTGJ 2KZVA 1GXPA 3HHGA 3B6AA 1RUNA 3T1BA 4RGSA 3OSGA 4RB2C 1U8RA 3T8RA 4D7NA 2JZYA 5E1XA 2OF7A 3AL0B 4BQAA 2F5VA 1ETQA 1S5LC 3B02A 3FXJA 2DA3A 3A0HC 2K3FA 2NAZA 1ACIA 2VASA 1Y8RB 3M8FA 3PNTA 1E3OC 1HOMA 2XAUA 2ZXWH 1VNDA 2K5CA 1FBUA 3KCCA 2XROA 1MDMB 2HDCA 3RZDJ 1UJ8A 5E3MA 4IQ4A 4EM2A 3BR0A 5LHIA 4BBSJ 1XMKA 3EPZA 4PSWA 2FOWA 4R79A 4BY1J 4XQFA 1FYLA 2HYGD 1FP2A 3ZCOA 4ZDOA 2J5PA 1RR7A 4YRVA 2E35A 3JRCA 3MD2A 4H0EA 1YW7A 3KYCB 4A3BJ 2WB1A 1ETKA 1TZLA 4YG2F 1HSTA 3DLAA 4P55A 2JPCA 2DU9A 1HKQA 2BOLA 3ROUA 4NNJA 2FEZA 1X19A 4L0YB 1VQLI 2DTZA 1BR4A 5IPAA 3UKGA 4RAGA 2HYJA 2OUMA 4ITVA 2LBFB 4FE4A 1YG2A 3U9GA 3H9JA 3HSRA 1BN5A 3HTUA 3HGYA 4DYRA 2NRAC 1FX7A 2NVYJ 1LVKA 4B3XA 4ZYEA 3CO6C 3SEQA 1X3WB 2CV1A 4B09A 2RNGA 3E0JB 2QF7A 2IT0A 1BOAA 2XAGA 2FQ3A 1SMYF 3VYTB 5JHFA 3ELKA 3IP4B 4FE7A 4CDGA 2EINH 2L2OA 3OL3A 1V3FA 5M5YJ 2HU9A 3TOBA 3F8CA 4PJ0C 2HI3A 5FKKA 1YRNB 3SYTA 2VODA 5LHGA 5L3DA 2JWTA 1IN6A 1G3TA 2QSHX 3EYIA 4IRGA 4XOTA 2EV0A 3W6JB 2EZIA 2ZBKA 3RYPA 1T56A 2IPQX 4BE2A 2M7AA 4P96A 5EG0A 3ZQHA 5FROA 2D5VA 2YSRA 2ZXJA 4PFPA 3WE2A 3CO7C 1U9NA 4UUVA 3V8LA 3G6EI 4PGHA 2AXLA 2VN2A 1IRXA 3J7ZI 2GXBA 2TRTA 5GPAA 1G2HA 5CVUA 3TP0A 4KUMA 5D5UB 1PDNC 4CZCA 4KIBA 1JUMA 1HW1A 4II3A 5LGUA 2WADA 2GA1A 3HXLA 1YE9A 2CH0A 2EIJH 5J8FA 1FJLA 2GZWA 2CFXA 4X0GA 2XKOA 3DBHB 1SANA 3ZPLA 2K86A 2MABA 2R92J 1TW3A 3BPXA 3HHHA 4P9FA 1WFXA 2ADUA 3E5XA 3FZVA 3HYIA 1BA5A 3GZ5A 3HSFA 4WK8F 3GEZA 5FO5A 1UHSA 3GCMA 2IS4A 2DMUA 1ETWA 4DBQA 2CQKA 1ONVA 1XN7A 3EETA 4EJVA 1LEBA 2D1HA 1F1ZA 1IZ1A 2ZMEA 3E97A 3KP3A 1VF9A 4HPQA 2QA4I 3L2QA 3Q3SA 3DEWA 3OS1A 3FXMA 3H3UA 3HOXJ 2KISA 1IXCA 1TW2A 1BI0A 2Y2ZA 4A3GJ 1JXSA 3ECOA 5D4RA 3GTQJ 2EIKH 2XB5A 3LA2A 1B9NA 3WG9A 5LGTA 1XMXA 4S04A 4IEJA 3FXRA 5F0FA 3SJMA 4PJJA 3DXJF 4Q47A 1ZHFA 2CUJA 4A3EJ 3G2BA 1T2KA 3MAJA 1FY7A 1YTYA 3H35A 4AC0A 4CICA 1FNNA 3QYFA 3CCSI 2MH2A 3OYGA 4CYCA 3ZQLA 1X3ZB 4M72A 3PQJA 2EV5A 1DDNA 4ZZDA 2P4WA 3RI4A 1RRJA 4OAZA 3OWTA 4AIDA 2I5UA 2XSJC 2DAOA 3QOEA 2CUZA 1KU7A 5GTHC 4MFEA 4DZPA 3I5UA 2WV1A 3K1MA 2VKEA 4KICA 3F22A 3CCMI 5J1RA 1AA7A 4M3EA 1X1DA 2DYSH 3D5SC 1JTXA 3RPUD 4ZYDA 5AIPA 4JOMA 4ESJA 5FKOA 1H8AC 1I27A 1IN8A 3S3MA 5EG0B 5KHDA 2OBPA 2BV6A 3FM3A 4I0BA 4L9TA 5D5WB 2OCEA 4GCVA 3WHBA 1VZ0A 2E1MC 2HS5A 4LD5A 2VIXA 3UNGC 2DA5A 2JRMA 5GAEJ 2K9SA 2RV8A 5IP9J 3KLOA 1T95A 2KHMA 3ZMUA 2A5WA 4IPAA 3CP2A 3DBLB 4QWQA 2QQ9A 4JK1X 3JW4A 1JJ8C 4WXDA 2GWRA 3MEXA 3JRBA 2NOGA 1XGSA 3M07A 2E1CA 2E60A 3K1NA 1MBEA 2CO5A 4V19K 1WJBA 2ZMEB 3AL0C 2H8RA 4GO1A 1VQ4I 4XLEA 2FX0A 1R1VA 4LLGF 2K85A 4BKXA 3OYDA 4XORA 5HS8A 3JRAA 3CMEI 2CGPA 3HRSA 3DU5A 3OMYA 1W4MA 4XICA 1Y0NA 4MEXF 1TWHJ 2VI6A 3FHNA 2JPBA 3LA3A 2M45A 1VQ7I 2PMUA 4PK4A 3JAMZ 4HEA2 5J8CA 2N8GA 2HXOA 5B66C 2LY2A 1B6AA 2V9KA 5EEHA 3ABUA 3GZNB 3WTTC 4HDUA 4MGRA 2WAQA 1LE8A 3H5RA 1ZRFA 2BEOA 2QCOA 3ERMA 3BR1A 3LWFA 1K79A 2JVHA 3ZQFA 3WTZA 1AU7A 1K61A 4BQOA 4I09A 4XLFA 2YX4A 4CYCB 3PQKA 2X6OA 3MZYA 1W36D 2UXXA 4XMYA 5J1YA 1MJAA 3I9V2 1GUUA 1FSHA 5K5RA 1T0FC 4J01A 3F21A 4D0PA 2WY7Q 3BTJA 3ZN1A 1W7PD 2OAZA 2E2IJ 4OIOF 3OYFA 4FISA 2V9VA 3ZRGA 4M9ZA 4MIMA 1JKRC 2HQ5A 1B59A 1YOVB 3CCRI 2QSFX 5DEQA 3NARA 1UZCA 3HUGA 2HZDA 1NG7A 1D3YA 3TKYA 4F91B 1Z1DA 1IAWA 3K9TA 4CA0A 1G8XA 2ESNA 3GFIA 3LMMA 2FNAA 2STWA 2NNYA 1V5GA 2G9WA 2CRGA 3AKZA 4XM3A 3PM1A 4XR6A 3COAC 1UB9A 4QPOA 3C3WA 2JUGA 3BROA 1ZGJA 4C30A 5E3NA 2Y0MA 2R7QA 2LF7A 4XN3A 4IOCF 1TWFJ 1YJWI 2PI0A 3I58A 2HVRA 2WTEA 2ZCWA 5HDKA 2IGKA 3H9QA 3H36A 1Z6RA 1G6NA 4Y7NJ 1P92A 9ANTA 4P1WA 1I3AA 2VJ4A 2HDWA 3P7NA 2Z5UA 3RTRA 3LSRA 4FETA 4AIKA 2W25A 1A35A 1TWCJ 1BR1A 2DA2A 2KJCA 5CPRB 3OS0A 2R7XA 2X6WA 3CJNA 1O3QA 4Y4RA 2VQLA 3CD6I 3PO3J 4N9HA 4UB6C 4EATA 5DCMA 4OIRF 4AWXB 2VLAA 2CW0F 4N4OB 4H4KC 3L2WA 3TDZC 3J80Z 3OIQA 4XNFA 2VC0A 1FT9A 5C44J 2LKXA 2DPDA 3PO2J 3KYLA 5JLWA 3G73A 3M1EA 4XIDA 3OYNA 3C1DA 3PNVA 4K2EA 2BVMA 1JE8A 1LE8B 2XASA 2RKHA 5KNLA 3E6CC 4IO9F 2W84A 4EQQA 2HNHA 2ZSHB 2LP0A 1SVLA 4AYBA 2V1XA 1GVJA 3HDDA 2DMPA 4N4NB 3HG9A 3RZOJ 1KGSA 3B6CA 2LOOA 4A0YA 4KISA 2CYYA 2ZNYA 1YITI 3KZYA 2CUEA 2FRHA 2L5QA 1S72I 3L09A 1IDYA 1T98A 2R7WA 3FXUA 3FWEA 3ZQQA 2R5ZA 3GTJJ 1G4DA 5ED4A 4KIFA 3S8PA 1VQ5I 1ULYA 4IL6C 5IT9Z 2D1VA 2HTJA 3HUGB 5FLXZ 4LIUA 2VKDA 2AHQA 1JJ6C 1OMIA 3A02A 3KZZA 3LSMA 4MFDA 1RUOA 3BG6A 2VT2A 4NC8A 3R6SA 3RKXA 1TL8A 2M0CA 4C3HJ 4UUTA 1OKRA 3KIOA 3P9CA 1QPIA 1GLNA 1ZRCA 1G3YA 1UMQA 3E5QA 4ENJA 4UV9A 4PZJA 1S3JA 2E34A 1Z0XA 5GAGJ 4UVAA 1X2MA 2JA7J 3Q0UA 4BHCA 3K70D 2MH9A 4J19A 4A0XA 2ZJQF 3S3OA 3JSPA 3H9GA 1NTCA 3CJTB 1WZ2A 2KLOA 2VKVA 1BI3A 1HC8A 3O2PE 2X9DA 1CQTA 4LGWA 1LDJA 3TL4X 1FBQA 1WKMA 1JHHA 3JTHA 2EBIA 3WU2C 4FT8A 1R71A 3GTPJ 4G7ZF 2LKSA 2VL8A 1S7EA 1MBJA 3HPHA 5FKLA 3QYBA 2CG4A 5DCMB 3DQVC 2Y30A 2VUMJ 3FMRA 1SD7A 2KT0A 2XGEA 3DU6A 4PUSA 5F08A 4EV0A 3IH2A 3REOA 5EZGA 3J7YJ 3GVAA 4MQVA 1UHMA 3CUOA 2QWWA 3ERED 4IJAA 3SZTA 2PFBA 4XKBA 2R4GA 5D6FA 2LF8A 2KJBA 4Y13A 1KU9A 1OCZH 4NBQA 1A5JA 1JI8A 1Z91A 2GIVA 2QVOA 3ISPA 3HGGA 1MMNA 4RDUA 1BC7C 4HF0A 4NQWA 2CQ7A 2ISYA 3TOAA 1XD7A 2LR8A 4IXAA 1FTZA 4IRIA 2AS5F 3GFMA 1XGOA 4KIGA 2QENA 2CW7A 2X1CA 1OLTA 2Y48A 1B1BA 3OIOA 2A61A 5E3OA 2IVMA 1SVMA 2ECCA 4LK0F 4MHGA 4IHXA 2HQRA 3BOQA 4RLQA 1LJ9A 3L00A 2K3PA 3BDDA 1OCTC 1QA6A 3BTCA 2R5ZB 3LOCA 3PFIA 4HDVA 5DUKA 3HOTA 4HBLA 1HBXG 3ZMSA 3DPLC 3F8BA 1ZLKA 1OR7A 4PCQA 1R9TJ 1BC8C 3Q9SA 4Z6YA 1CF7A 2DK8A 4DOZA 1XDUA 1R5HA 2GXGA 2L9RA 3CCYA 5CLSA 1VQKI 5KAIC 4J00A 2YPRA 4RLFA 1MJBA 5FGMA 3G1MA 1Y8QB 3R0JA 3R0AA 5J6XA 2P5VA 3VYRB 3RSNA 1GHCA 1ZARA 2E1OA 3EYYA 3FISA 2VXZA 2CFOA 1MMSA 3W2VA 2A69F 3BTLA 4E7KA 2ISZA 3ABLH 1XTAA 1XSVA 3ASOH 3ZXSA 2K40A 2W48A 2K9MA 1FTTA 1HSJA 4YFKF 1Y0UA 2Z3YA 5E1WA 3DFGA 5FLMJ 2D2WA 2RNJA 1IJWC 3CC7I 1FMWA 3ABMH 3QPTA 2F4MB 5FFZA 3VSKA 2RDPA 4MLOA 5A2QK 1HLVA 4MTDA 3CJQB 2AQEA 2JTVA 2MA3A 3K4CA 2VOPA 4CXFA 5HS7A 1QBJA 1TQPA 4FQGA 4IKFA 3ML6A 3W2AA 4BDZA 3CDHA 1IF1A 2DFEA 4L5EA 1F5TA 4HRIA 3QPLA 3P9IA 4RM3A 3G71I 3G3ZA 3OL4A 2FE3A 3GZ6A 5DV5A 4A3CJ 4CH7A 2QKMB 2NS0A 3D5RC 1IN4A 4Q5SF 2VC1A 1MNDA 1L0OC 1TLHB 5L3FA 2HOAA 4HF2A 2WB1N 5B3SH 5JHUA 4RAZA 5ICGA 3RQ4A 4M73A 5JVGF 2CW8A 2HOEA 4BJTA 4NQWB 2ME6A 2RREA 2PJRA 4C2MJ 1XCBA 1K78A 5LRSA 2L7KA 1HCRA 1EH7A 4F55A 1O3RA 1K6OA 1AOYA 2BXYA 1WI9A 1D8KA 1C0WA 2CS3A 3BR6A 3FMSA 3LAPA 2E1NA 1LPQA 3IAS2 5CJ9A 3NWSA 3R61A 3O3KA 1WI3A 2R0QC 1SFUA 1BM9A 3RQIA 3CMYA 1Y56A 1U5TB 1IGNA 2P7VB 1LDKB 3I56I 1JKQC 2V7FA 1BOBA 1D8JA 2X6YA 1CF7B 2DA6A 1YX3A 4UHTA 4U0VA 2E7WA 1RPWA 4GFBA 3ABKH 2XDVA 4HV5A 3TDUC 2H94A 2DOFA 2O03A 4M3DA 4UNOA 2FUG2 3A1YA 2OZUA 2XKPA 4OWRB 3HIFA 2B9SA 2BXZA 5DYMA 2QQBA 4IHVA 2EPFA 4AVPA 3RPUA 3QP6A 3KZIC 3TQNA 3QPHA 3SZPA 3KP2A 2IA2A 3C2BA 1X4OA 2IEKA 4KT6A 4BUPA 3TEDA 5LD2C 3BCAA 1SVOA 4ENKA 1R49A 4F3QA
chains in the Genus database with same CATH topology
1KYZA 4WCGA 4EJTA 2HWVA 1B4AA 1OYIA 3IL2A 2P5KA 3Q5FA 4BYYA 5HVQC 2MC3A 1S8NA 3HTSB 3I71A 2F5EA 1QNTA 2K4BA 1Z05A 2QUFA 4G9YA 3C18A 3WTYC 2QLZA 2R3SA 5JR3A 4EM1A 1SD4A 4IVNA 4I02A 5FFXA 2LSOA 1F9NA 3E6DA 3T8TA 2XVCA 2JSCA 4LMYA 4EJUA 2GAUA 3I59A 1RZ4A 1K78B 3I54A 4N0BA 1LEAA 4MEYF 1SFEA 1TQIA 4CO8A 3RYRA 5CYVA 1IUYA 3QRFF 3LSTA 4PGGA 3VEPA 1KQ9A 1G3WA 1FBSA 4OIPF 2ACJA 2EA2A 5D5XB 3I0TA 4ON0A 1P4XA 2FBKA 2L4AA 2C6YA 4G8XA 4IRHA 5K5QA 4RAYA 4M71A 2FSWA 2KRFA 1K7AA 1J7KA 1Z9CA 2HTSA 5HDGA 1TTYA 1DP7P 2A6HF 2Z9OA 3OV8A 4GYIA 4IHTA 4KA4A 2VBYA 1W7PA 2ETHA 3N4MA 2RQPA 4HQMA 4KN7X 2XAFA 2EV6A 2BGCA 1ZRDA 5FD5A 4YIIA 2H6BA 3KLNA 5BS6A 4CGZA 2HFHA 3FM5A 2EFWA 5H6RA 1XDSA 1I6XA 2EJRA 4A6EA 2RGVA 1XGNA 2F5CA 4G6QA 3WTXC 2DQRA 1FWZA 4DQ2A 3BP8A 5F6FA 3F6OA 1J5YA 3D5LA 1RI7A 4P9UA 1FYKA 3I59B 4M74A 5F64A 4UVCA 4OMZA 4UXNA 2OU2A 2CSOA 4CHUA 3QOPA 2HGCA 5TRDA 2OZ6A 3E3VA 2VOOA 3MQ0A 4EGZA 1P4AA 2F5FA 1NHAA 4A5NA 1BIAA 5LEKA 2FMLA 3M7GA 3GXOA 1H0MA 3E6MA 3MZHA 1EH6A 3GW2A 4B8XA 3NEUA 4HAMA 4AIJA 1W7PB 2GA2A 2A3SA 2V6CA 3D0SA 4ZZLA 5HLHA 2DT5A 5DUIA 1MD0A 2K7LA 2XV4S 1S29A 5E1ZB 2W85A 2HZTA 1ZYRF 4HYEA 4L9VA 3GO5A 4KMUX 1QGPA 2FNPA 3TGNA 4O6JA 3JTGA 2L4MA 1I5ZA 2EA4A 4R8HA 4LB6B 3HRTA 2DW4A 5DD8A 3U2RA 1WQ2A 2HKXA 3IC7A 3J81K 1V4RA 5IT3A 2XIGA 2XRNA 3BPVA 5JFRA 3L9FA 4HZFA 1QQIA 1USSA 1E2XA 2D45A 5KVRA 5DD4A 4Z2YA 1REPC 3QU6A 4S05A 1OYWA 2O61A 1KA8A 3B73A 3GFJA 5BQTA 2L3DA 5LBQA 4HA8A 2VONA 2DTRA 2ESHA 3I4PA 3V8KA 2PN6A 3K69A 2P8TA 2Q0OA 3LFKA 2EK5A 4XSZF 4UV8A 5ILUA 4P5OA 1XSXA 3WGIA 5HOOA 3NQOA 2YR2A 2PBIA 3T5XA 2IJLA 4HLYA 4G7OF 4A0ZA 4Y15A 2P6TA 4YIFA 4LB5A 1R7JA 4LFUA 2J5OA 2LDUA 3WODF 4MQ9F 5HDNA 5HLGA 2UWMA 5EEGA 3U1DA 5ICFA 1FLIA 2NYXA 1XSDA 2VBWA 3P9KA 3F8MA 2XUBA 3E6BA 2JRTA 1MJ9A 4MNUA 2M1BA 1J59A 3MWMA 1XGMA 4NHJA 2EFOA 4L0ZB 1J0RA 1FYMA 2O6GE 1J75A 2XHKA 3WTVC 3K1PA 2R7DA 5A2QZ 1WRJA 2PQ8A 2H09A 2KIUA 4I0AA 2R7FA 1USTA 4A5MA 2O8XA 4RGXA 5E18F 1ODDA 1E17A 1L3LA 1HKSA 2DBBA 3DPTA 5L3BA 2IP2A 1KQ0A 4BXUA 1IXSB 4ESBA 1XCVA 2UZKA 3F3XA 1PUEE 3VODA 3N97A 3EDPA 2V79A 2L01A 3KEQA 1U2WA 2Q8KA 1H9TA 4RB3C 4ETSA 1QZYA 3DV8A 2W57A 2IRFG 4GGGA 4XRFA 1J9IA 2Z99A 1SFXA 4Y17A 2OA4A 4M6YA 5DCFA 3ULQB 2COMA 2UXNA 4OOIA 5D6EA 3WU1B 1ZN2A 2FBHA 1DPRA 5E17F 3FHZA 4PDKA 3I64A 2VE8A 1MZBA 3V7RA 1ZLJA 1UCRA 2H6CA 1U5TA 4KT5C 1FZPB 3BWGA 4EJWA 2EFPA 1EH8A 1B9MA 2MLGA 4HX8A 3BZ6A 3O6BB 3QAHA 5CVVA 1BI2A 1S7OA 1EV7A 1RIOH 4U7DA 4EM0B 2HR3A 1JGSA 4ENNA 4XLNF 3ABTA 4U0WA 1LVAA 3TO9A 2FBIA 3WE3A 2YX7A 1A04A 3GWZA 4QLCU 4LLLA 3QU3A 4AD9A 4KNYA 1ZAOA 2RC4A 3SQNA 4IF4A 1R00A 3VOEA 1D5VA 6PAXA 5FLXK 3T0YA 4A6DA 1YLFA 3E5UA 3M8EA 3DF8A 1KU2A 1YW9A 1SD6A 3IKTA 1W5TA 3JSOA 1O57A 4BNCA 4IHSA 3LQRA 2DLLA 1KYWA 2P7CB 1G3SA 3K2ZA 5ERIA 2ZJ2A 1STZA 1YFHA 1IRFA 4G6DA 3MFKA 1SMTA 5E8GA 1TBXA 2PLYA 2XAJA 4LK1F 4WXHA 1P2FA 3ZMVA 5BPIA 3KEOA 2VBZA 3AAFA 5D5VB 1PP7U 2EB7A 1O3TA 1TNTA 4KN4X 2O0YA 4RGUA 2DK5A 4GXOA 2KKOA 3DEUA 2W24A 5AIQA 3BJ6A 1Q1HA 4OU0A 3V8JA 2QBYB 3S2WA 3EQLF 2FXAA 3IKVA 4A12A 4WWCA 3LA7A 2VE9A 1J2XA 3SXYA 3WGHA 2F2EA 3QP5A 4CYDA 3EUHA 3RPQA 1R1UA 2STTA 3W6KB 1AWCA 3NRVA 2TDXA 2PG4A 1JHFA 1YYVA 4F7ZA 5BMZA 2Y75A 2P5LC 1S7AA 2L02A 5CVIA 3WTSC 1ZG5A 5BPDA 1OPCA 2WC2A 4WX9A 3IWFA 3RJPA 3GYHX 3BY6A 5E8IA 5LEJA 1UFMA 1HW5A 2XAHA 1QZZA 4XSXF 4EMSA 2VBXA 1DUXC 2M8EA 1WSUA 1P4WA 2MLKA 1YS6A 1ZG3A 3ECHA 3J81Z 2A68F 4DNCA 1OYYA 3IRRA 5ILVA 2H27A 3FXQA 2IA0A 5ICEA 3ZN0A 2EWNA 2QM3A 5ICCA 1Z6TA 3KETA 3CUQA 3FMQA 5F1RA 4NB5A 3GX4X 2LNBA 5FB2A 1R22A 1I1GA 2G7UA 2E7XA 1U78A 4RGRA 3FX3A 2Z33A 3V7CA 1O3SA 3KE2A 4ENMA 1ZREA 4HX7A 4HW0A 2DPUA 1QO0D 2FU4A 5KK1A 4OIQF 2M87A 1TQMA 1VTNC 2F5DA 3H3ZA 4L5IA 5L3GA 3FF5A 3HRMA 2K4JA 4LG0A 1T6SA 1BIBA 5TJJA 1BBYA 3IHUA 4RS8A 4I98B 3F8FA 2WV0A 4HQEA 5HLIA 4MTEA 3ZQ7A 4U0YA 4FHTA 3WTWC 3HSEA 1R58A 1U5TC 4UVBA 1LQ1A 4BHPA 5H20A 3IRQA 3MCZA 4WXCA 2FF4A 1WWXA 2ELHA 3IWZA 1GXQA 2KIFA 1YO5C 1HW2A 4FX4A 3CUQB 4G94A 2M5WA 4OINF 3ZP5A 4HLXA 2ZKZA 5ILSA 5D8KB 3F8NA 3I53A 2M30A 4KDPA 4ZYGA 2NNNA 1R5GA 2K27A 4BHBA 3F23A 2L54A 2BYVE 3KFWX 1O7FA 4KYWA 3OOPA 1HXDA 3WGGA 2O3FA 5CVJA 2IA1A 5L3EA 2OQRA 3RDIA 4FX0A 1FOKA 4LG0B 1IW7F 3GUDA 1MKMA 4A2UA 3GFLA 4LJZF 4ASNA 3R60A 5LGNA 4G7HF 2Q2EA 2MBFA 4R1HA 4M9XA 2G7HA 1LNWA 4M9SA 1Z7UA 2RVCA 2IW5A 3TO7A 2X4HA 1TNSA 3K0LA 3GF2A 2ZNZA 4LLNA 1MGTA 2HKOA 5CVRA 3BJOA 5H6QA 2HEOA 2GQQA 1ON2A 2CWEA 2A6EF 3BJAA 2PJPA 2BE5F 2B0LA 2VT3A 1T38A 2V1DA 4HV6A 4GYGA 1IN7A 4L18B 1ZGAA 4Q4ZF 1ZG1A 3DKWA 1R23A 3RKYA 3LQQA 2LKPA 4JBAA 2KIMA 1T39A 2JT1A 4WF2A 3ZMZA 2ZO4A 3CTAA 2DI3A 4AIHA 1FC3A 4L9NA 3GLXA 3DP7A 2FOKA 2DO7A 4N9IA 3J7AO 5FD6A 4JQFA 1I1SA 4XBFA 3V7SA 2QQAA 3WU0A 1QPMA 2DQLA 3Q9VA 2V1UA 3JAMK 5D8LB 4KMFA 2QYOA 3SHFA 2RN7A 2FA5A 4KFCA 1KU3A 3TO6A 4ZYHA 1S6LA 2XAQA 2X0LA 1IRGA 1P6RA 5K1YA 5LRRA 1H9GA 1SD5A 1LB2A 2HYFA 5LLQA 3RKWA 1F4KA 2OD5A 1PP8F 4ZH4F 2EFNA 2PEXA 4L5JA 1ZH5A 2ZFWA 1YIOA 4L9JA 5HS9A 1FPQA 2XGXA 2A07F 3ZMTA 1YS7A 3SFZA 3KP6A 4BH9A 4E70A 4BAYA 4TV7A 4OMYA 4I01A 4EGYA 4HX4A 3CLOA 4U88A 4I7HA 2OQGA 1FSEA 3HOSA 1YQAA 3VB2A 1DPUA 3RIRA 3CUQC 3ZMDA 2DFIA 1BI1A 1CGPA 3F6VA 4YFNF 4Q48A 1XB4A 1O7LA 4EVIA 1SAXA 3C7JA 1U3EM 2A5YB 4M6XA 1W5SA 4CZZA 3J80K 2FMYA 4U7BA 4EJOA 2YU3A 1IXRC 3LAJA 3VFZA 4RB0A 1UHWA 5D4SA 1MDMA 1IN5A 5AONA 4O3MA 2K02A 2QZ8A 4HOBA 1R36A 1RNLA 3M9AA 2QBYA 2MD5A 5L3CA 4YFXF 2EFQA 1XMAA 2PMHA 1X3UA 4ESFA 1HKTA 2P6SA 4O5VA 5IT9K 3KP4A 1KQ8A 3L7WA 4RB1A 1BJAA 4HF1A 1T0FA 4I2OA 5LHHA 3WTUC 1FP1D 1R1TA 2BBYA 4XLPF 3KP5A 3HRUA 5K5OA 3F72A 3V4GA 5BOXA 1ON1A 2WWYA 5DDGA 1HQCA 5JVTA 3L2CA 5JI6A 2HQNA 5E20A 3H92A 3R4KA 1U6GA 3KP7A 1YW8A 1LDDA 1GXPA 3HHGA 1RUNA 3T1BA 4RGSA 4RB2C 1U8RA 3T8RA 2JZYA 5E1XA 4BQAA 3B02A 2NAZA 3M8FA 1FBUA 3KCCA 2XROA 1MDMB 2HDCA 4EM2A 5LHIA 1XMKA 4R79A 1FYLA 2HYGD 1FP2A 2J5PA 4H0EA 1YW7A 4YG2F 1HSTA 4P55A 2JPCA 2DU9A 1HKQA 3ROUA 2FEZA 4L0YB 1YG2A 3U9GA 3HSRA 1BN5A 3HTUA 2NRAC 1FX7A 4ZYEA 3CO6C 4B09A 2IT0A 1BOAA 2XAGA 2FQ3A 1SMYF 3ELKA 4CDGA 1V3FA 3TOBA 3F8CA 2VODA 5LHGA 5L3DA 1IN6A 1G3TA 3EYIA 4IRGA 2EV0A 3W6JB 2ZBKA 3RYPA 2IPQX 4P96A 2YSRA 2ZXJA 3WE2A 3CO7C 4UUVA 3V8LA 4PGHA 2AXLA 2VN2A 2GXBA 5CVUA 4KUMA 5D5UB 1PDNC 4KIBA 1HW1A 5LGUA 2GA1A 5J8FA 2GZWA 2CFXA 2XKOA 3ZPLA 2K86A 1TW3A 3BPXA 3HHHA 4P9FA 2ADUA 3E5XA 3FZVA 3HYIA 3GZ5A 3HSFA 4WK8F 3GEZA 5FO5A 2CQKA 1ONVA 1XN7A 3EETA 4EJVA 1LEBA 2D1HA 1F1ZA 1IZ1A 2ZMEA 3E97A 3KP3A 3H3UA 1IXCA 1TW2A 1BI0A 1JXSA 3ECOA 5D4RA 3LA2A 1B9NA 3WG9A 5LGTA 4S04A 3FXRA 3DXJF 4Q47A 1ZHFA 1T2KA 3MAJA 1FY7A 1YTYA 4CICA 1FNNA 2MH2A 1DDNA 4M72A 3PQJA 2EV5A 4ZZDA 2P4WA 3RI4A 2DAOA 1KU7A 3I5UA 3F22A 4KICA 3K1MA 4ZYDA 5AIPA 4ESJA 1I27A 1IN8A 2OBPA 2BV6A 3FM3A 4I0BA 4L9TA 5D5WB 4GCVA 2HS5A 4LD5A 2RV8A 3KLOA 3ZMUA 4IPAA 4QWQA 2QQ9A 4JK1X 3JW4A 4WXDA 2GWRA 3MEXA 1XGSA 2E1CA 3K1NA 2CO5A 2ZMEB 4GO1A 1R1VA 4LLGF 5HS8A 2CGPA 3HRSA 1W4MA 4MEXF 2JPBA 3LA3A 2M45A 2PMUA 3JAMZ 5J8CA 1B6AA 5EEHA 3ABUA 3WTTC 4HDUA 4MGRA 1ZRFA 2BEOA 3LWFA 1K79A 3WTZA 4I09A 2YX4A 3PQKA 3MZYA 2UXXA 1MJAA 1FSHA 5K5RA 3F21A 4D0PA 3ZN1A 1W7PD 2OAZA 4OIOF 2V9VA 4M9ZA 1B59A 5DEQA 3HUGA 1D3YA 3TKYA 1Z1DA 1IAWA 3K9TA 2ESNA 3GFIA 2STWA 2FNAA 2NNYA 2G9WA 3COAC 1UB9A 3C3WA 3BROA 1ZGJA 2Y0MA 2LF7A 2PI0A 3I58A 2WTEA 2ZCWA 5HDKA 1Z6RA 1G6NA 1P92A 3P7NA 2Z5UA 3RTRA 4AIKA 2W25A 2KJCA 3CJNA 1O3QA 4N9HA 5DCMA 4OIRF 4AWXB 2CW0F 3TDZC 3J80Z 2VC0A 1FT9A 2DPDA 3G73A 3M1EA 3C1DA 4K2EA 1JE8A 2XASA 2RKHA 3E6CC 2W84A 4EQQA 2V1XA 1GVJA 1KGSA 4A0YA 2CYYA 2ZNYA 3KZYA 2FRHA 3L09A 1T98A 3FXUA 3FWEA 1G4DA 5ED4A 4KIFA 1ULYA 5IT9Z 2D1VA 2HTJA 5FLXZ 1OMIA 3KZZA 1RUOA 2VT2A 3R6SA 3RKXA 1OKRA 3P9CA 1ZRCA 1G3YA 3E5QA 4ENJA 4UV9A 4PZJA 1S3JA 4UVAA 4BHCA 2MH9A 4A0XA 3JSPA 1BI3A 3O2PE 4LGWA 1LDJA 1FBQA 1WKMA 1JHHA 3JTHA 4FT8A 4G7ZF 2CG4A 5DCMB 3DQVC 3FMRA 1SD7A 4EV0A 3REOA 3GVAA 4MQVA 1UHMA 3CUOA 2QWWA 3ERED 4IJAA 3SZTA 2PFBA 5D6FA 4Y13A 2LF8A 2KJBA 1KU9A 1Z91A 2GIVA 2QVOA 3ISPA 1BC7C 4HF0A 4NQWA 2ISYA 3TOAA 1XD7A 4IXAA 4IRIA 2AS5F 3GFMA 1XGOA 4KIGA 2QENA 2Y48A 1B1BA 2A61A 2IVMA 4LK0F 4MHGA 2HQRA 3BOQA 1LJ9A 3L00A 3BDDA 3PFIA 4HDVA 5DUKA 3HOTA 4HBLA 1HBXG 3ZMSA 3DPLC 3F8BA 1ZLKA 1OR7A 4PCQA 1BC8C 3Q9SA 1CF7A 2DK8A 1XDUA 1R5HA 2GXGA 5CLSA 2YPRA 1MJBA 5FGMA 3R0JA 3R0AA 5J6XA 2P5VA 1GHCA 1ZARA 3EYYA 2VXZA 2A69F 2ISZA 1XSVA 1HSJA 4YFKF 1Y0UA 2Z3YA 5E1WA 3DFGA 2D2WA 2RNJA 3QPTA 5FFZA 2RDPA 5A2QK 4MTDA 2JTVA 2MA3A 2VOPA 4CXFA 5HS7A 1QBJA 1TQPA 3ML6A 3CDHA 1IF1A 1F5TA 3P9IA 3G3ZA 2FE3A 3GZ6A 5DV5A 2NS0A 1IN4A 4Q5SF 2VC1A 1L0OC 1TLHB 5L3FA 4HF2A 5JHUA 4RAZA 5ICGA 4M73A 2HOEA 1XCBA 1K78A 5LRSA 1EH7A 1O3RA 1K6OA 1AOYA 1WI9A 1D8KA 1C0WA 3FMSA 3LAPA 2E1NA 5CJ9A 3R61A 3O3KA 1SFUA 1BM9A 1U5TB 2P7VB 1LDKB 1D8JA 1CF7B 4UHTA 4U0VA 2E7WA 4HV5A 3TDUC 2H94A 2O03A 4UNOA 2OZUA 2XKPA 3HIFA 5DYMA 2QQBA 4AVPA 3RPUA 3QP6A 3TQNA 3QPHA 3SZPA 3KP2A 2IA2A 4ENKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYZ A;  4WCG A;  4EJT A;  2HWV A;  1B4A A;  1OYI A;  3IL2 A;  2P5K A;  3Q5F A;  4BYY A;  5HVQ C;  2MC3 A;  1S8N A;  3HTS B;  3I71 A;  2F5E A;  1QNT A;  2K4B A;  1Z05 A;  2QUF A;  4G9Y A;  3C18 A;  3WTY C;  2QLZ A;  2R3S A;  5JR3 A;  4EM1 A;  1SD4 A;  4IVN A;  4I02 A;  5FFX A;  2LSO A;  1F9N A;  3E6D A;  3T8T A;  2XVC A;  2JSC A;  4LMY A;  4EJU A;  2GAU A;  3I59 A;  1RZ4 A;  1K78 B;  3I54 A;  4N0B A;  1LEA A;  4MEY F;  1SFE A;  1TQI A;  4CO8 A;  3RYR A;  5CYV A;  1IUY A;  3QRF F;  3LST A;  4PGG A;  3VEP A;  1KQ9 A;  1G3W A;  1FBS A;  4OIP F;  2ACJ A;  2EA2 A;  5D5X B;  3I0T A;  4ON0 A;  1P4X A;  2FBK A;  2L4A A;  2C6Y A;  4G8X A;  4IRH A;  5K5Q A;  4RAY A;  4M71 A;  2FSW A;  2KRF A;  1K7A A;  1J7K A;  1Z9C A;  2HTS A;  5HDG A;  1TTY A;  1DP7 P;  2A6H F;  2Z9O A;  3OV8 A;  4GYI A;  4IHT A;  4KA4 A;  2VBY A;  1W7P A;  2ETH A;  3N4M A;  2RQP A;  4HQM A;  4KN7 X;  2XAF A;  2EV6 A;  2BGC A;  1ZRD A;  5FD5 A;  4YII A;  2H6B A;  3KLN A;  5BS6 A;  4CGZ A;  2HFH A;  3FM5 A;  2EFW A;  5H6R A;  1XDS A;  1I6X A;  2EJR A;  4A6E A;  2RGV A;  1XGN A;  2F5C A;  4G6Q A;  3WTX C;  2DQR A;  1FWZ A;  4DQ2 A;  3BP8 A;  5F6F A;  3F6O A;  1J5Y A;  3D5L A;  1RI7 A;  4P9U A;  1FYK A;  3I59 B;  4M74 A;  5F64 A;  4UVC A;  4OMZ A;  4UXN A;  2OU2 A;  2CSO A;  4CHU A;  3QOP A;  2HGC A;  5TRD A;  2OZ6 A;  3E3V A;  2VOO A;  3MQ0 A;  4EGZ A;  1P4A A;  2F5F A;  1NHA A;  4A5N A;  1BIA A;  5LEK A;  2FML A;  3M7G A;  3GXO A;  1H0M A;  3E6M A;  3MZH A;  1EH6 A;  3GW2 A;  4B8X A;  3NEU A;  4HAM A;  4AIJ A;  1W7P B;  2GA2 A;  2A3S A;  2V6C A;  3D0S A;  4ZZL A;  5HLH A;  2DT5 A;  5DUI A;  1MD0 A;  2K7L A;  2XV4 S;  1S29 A;  5E1Z B;  2W85 A;  2HZT A;  1ZYR F;  4HYE A;  4L9V A;  3GO5 A;  4KMU X;  1QGP A;  2FNP A;  3TGN A;  4O6J A;  3JTG A;  2L4M A;  1I5Z A;  2EA4 A;  4R8H A;  4LB6 B;  3HRT A;  2DW4 A;  5DD8 A;  3U2R A;  1WQ2 A;  2HKX A;  3IC7 A;  3J81 K;  1V4R A;  5IT3 A;  2XIG A;  2XRN A;  3BPV A;  5JFR A;  3L9F A;  4HZF A;  1QQI A;  1USS A;  1E2X A;  2D45 A;  5KVR A;  5DD4 A;  4Z2Y A;  1REP C;  3QU6 A;  4S05 A;  1OYW A;  2O61 A;  1KA8 A;  3B73 A;  3GFJ A;  5BQT A;  2L3D A;  5LBQ A;  4HA8 A;  2VON A;  2DTR A;  2ESH A;  3I4P A;  3V8K A;  2PN6 A;  3K69 A;  2P8T A;  2Q0O A;  3LFK A;  2EK5 A;  4XSZ F;  4UV8 A;  5ILU A;  4P5O A;  1XSX A;  3WGI A;  5HOO A;  3NQO A;  2YR2 A;  2PBI A;  3T5X A;  2IJL A;  4HLY A;  4G7O F;  4A0Z A;  4Y15 A;  2P6T A;  4YIF A;  4LB5 A;  1R7J A;  4LFU A;  2J5O A;  2LDU A;  3WOD F;  4MQ9 F;  5HDN A;  5HLG A;  2UWM A;  5EEG A;  3U1D A;  5ICF A;  1FLI A;  2NYX A;  1XSD A;  2VBW A;  3P9K A;  3F8M A;  2XUB A;  3E6B A;  2JRT A;  1MJ9 A;  4MNU A;  2M1B A;  1J59 A;  3MWM A;  1XGM A;  4NHJ A;  2EFO A;  4L0Z B;  1J0R A;  1FYM A;  2O6G E;  1J75 A;  2XHK A;  3WTV C;  3K1P A;  2R7D A;  5A2Q Z;  1WRJ A;  2PQ8 A;  2H09 A;  2KIU A;  4I0A A;  2R7F A;  1UST A;  4A5M A;  2O8X A;  4RGX A;  5E18 F;  1ODD A;  1E17 A;  1L3L A;  1HKS A;  2DBB A;  3DPT A;  5L3B A;  2IP2 A;  1KQ0 A;  4BXU A;  1IXS B;  4ESB A;  1XCV A;  2UZK A;  3F3X A;  1PUE E;  3VOD A;  3N97 A;  3EDP A;  2V79 A;  2L01 A;  3KEQ A;  1U2W A;  2Q8K A;  1H9T A;  4RB3 C;  4ETS A;  1QZY A;  3DV8 A;  2W57 A;  2IRF G;  4GGG A;  4XRF A;  1J9I A;  2Z99 A;  1SFX A;  4Y17 A;  2OA4 A;  4M6Y A;  5DCF A;  3ULQ B;  2COM A;  2UXN A;  4OOI A;  5D6E A;  3WU1 B;  1ZN2 A;  2FBH A;  1DPR A;  5E17 F;  3FHZ A;  4PDK A;  3I64 A;  2VE8 A;  1MZB A;  3V7R A;  1ZLJ A;  1UCR A;  2H6C A;  1U5T A;  4KT5 C;  1FZP B;  3BWG A;  4EJW A;  2EFP A;  1EH8 A;  1B9M A;  2MLG A;  4HX8 A;  3BZ6 A;  3O6B B;  3QAH A;  5CVV A;  1BI2 A;  1S7O A;  1EV7 A;  1RIO H;  4U7D A;  4EM0 B;  2HR3 A;  1JGS A;  4ENN A;  4XLN F;  3ABT A;  4U0W A;  1LVA A;  3TO9 A;  2FBI A;  3WE3 A;  2YX7 A;  1A04 A;  3GWZ A;  4QLC U;  4LLL A;  3QU3 A;  4AD9 A;  4KNY A;  1ZAO A;  2RC4 A;  3SQN A;  4IF4 A;  1R00 A;  3VOE A;  1D5V A;  6PAX A;  5FLX K;  3T0Y A;  4A6D A;  1YLF A;  3E5U A;  3M8E A;  3DF8 A;  1KU2 A;  1YW9 A;  1SD6 A;  3IKT A;  1W5T A;  3JSO A;  1O57 A;  4BNC A;  4IHS A;  3LQR A;  2DLL A;  1KYW A;  2P7C B;  1G3S A;  3K2Z A;  5ERI A;  2ZJ2 A;  1STZ A;  1YFH A;  1IRF A;  4G6D A;  3MFK A;  1SMT A;  5E8G A;  1TBX A;  2PLY A;  2XAJ A;  4LK1 F;  4WXH A;  1P2F A;  3ZMV A;  5BPI A;  3KEO A;  2VBZ A;  3AAF A;  5D5V B;  1PP7 U;  2EB7 A;  1O3T A;  1TNT A;  4KN4 X;  2O0Y A;  4RGU A;  2DK5 A;  4GXO A;  2KKO A;  3DEU A;  2W24 A;  5AIQ A;  3BJ6 A;  1Q1H A;  4OU0 A;  3V8J A;  2QBY B;  3S2W A;  3EQL F;  2FXA A;  3IKV A;  4A12 A;  4WWC A;  3LA7 A;  2VE9 A;  1J2X A;  3SXY A;  3WGH A;  2F2E A;  3QP5 A;  4CYD A;  3EUH A;  3RPQ A;  1R1U A;  2STT A;  3W6K B;  1AWC A;  3NRV A;  2TDX A;  2PG4 A;  1JHF A;  1YYV A;  4F7Z A;  5BMZ A;  2Y75 A;  2P5L C;  1S7A A;  2L02 A;  5CVI A;  3WTS C;  1ZG5 A;  5BPD A;  1OPC A;  2WC2 A;  4WX9 A;  3IWF A;  3RJP A;  3GYH X;  3BY6 A;  5E8I A;  5LEJ A;  1UFM A;  1HW5 A;  2XAH A;  1QZZ A;  4XSX F;  4EMS A;  2VBX A;  1DUX C;  2M8E A;  1WSU A;  1P4W A;  2MLK A;  1YS6 A;  1ZG3 A;  3ECH A;  3J81 Z;  2A68 F;  4DNC A;  1OYY A;  3IRR A;  5ILV A;  2H27 A;  3FXQ A;  2IA0 A;  5ICE A;  3ZN0 A;  2EWN A;  2QM3 A;  5ICC A;  1Z6T A;  3KET A;  3CUQ A;  3FMQ A;  5F1R A;  4NB5 A;  3GX4 X;  2LNB A;  5FB2 A;  1R22 A;  1I1G A;  2G7U A;  2E7X A;  1U78 A;  4RGR A;  3FX3 A;  2Z33 A;  3V7C A;  1O3S A;  3KE2 A;  4ENM A;  1ZRE A;  4HX7 A;  4HW0 A;  2DPU A;  1QO0 D;  2FU4 A;  5KK1 A;  4OIQ F;  2M87 A;  1TQM A;  1VTN C;  2F5D A;  3H3Z A;  4L5I A;  5L3G A;  3FF5 A;  3HRM A;  2K4J A;  4LG0 A;  1T6S A;  1BIB A;  5TJJ A;  1BBY A;  3IHU A;  4RS8 A;  4I98 B;  3F8F A;  2WV0 A;  4HQE A;  5HLI A;  4MTE A;  3ZQ7 A;  4U0Y A;  4FHT A;  3WTW C;  3HSE A;  1R58 A;  1U5T C;  4UVB A;  1LQ1 A;  4BHP A;  5H20 A;  3IRQ A;  3MCZ A;  4WXC A;  2FF4 A;  1WWX A;  2ELH A;  3IWZ A;  1GXQ A;  2KIF A;  1YO5 C;  1HW2 A;  4FX4 A;  3CUQ B;  4G94 A;  2M5W A;  4OIN F;  3ZP5 A;  4HLX A;  2ZKZ A;  5ILS A;  5D8K B;  3F8N A;  3I53 A;  2M30 A;  4KDP A;  4ZYG A;  2NNN A;  1R5G A;  2K27 A;  4BHB A;  3F23 A;  2L54 A;  2BYV E;  3KFW X;  1O7F A;  4KYW A;  3OOP A;  1HXD A;  3WGG A;  2O3F A;  5CVJ A;  2IA1 A;  5L3E A;  2OQR A;  3RDI A;  4FX0 A;  1FOK A;  4LG0 B;  1IW7 F;  3GUD A;  1MKM A;  4A2U A;  3GFL A;  4LJZ F;  4ASN A;  3R60 A;  5LGN A;  4G7H F;  2Q2E A;  2MBF A;  4R1H A;  4M9X A;  2G7H A;  1LNW A;  4M9S A;  1Z7U A;  2RVC A;  2IW5 A;  3TO7 A;  2X4H A;  1TNS A;  3K0L A;  3GF2 A;  2ZNZ A;  4LLN A;  1MGT A;  2HKO A;  5CVR A;  3BJO A;  5H6Q A;  2HEO A;  2GQQ A;  1ON2 A;  2CWE A;  2A6E F;  3BJA A;  2PJP A;  2BE5 F;  2B0L A;  2VT3 A;  1T38 A;  2V1D A;  4HV6 A;  4GYG A;  1IN7 A;  4L18 B;  1ZGA A;  4Q4Z F;  1ZG1 A;  3DKW A;  1R23 A;  3RKY A;  3LQQ A;  2LKP A;  4JBA A;  2KIM A;  1T39 A;  2JT1 A;  4WF2 A;  3ZMZ A;  2ZO4 A;  3CTA A;  2DI3 A;  4AIH A;  1FC3 A;  4L9N A;  3GLX A;  3DP7 A;  2FOK A;  2DO7 A;  4N9I A;  3J7A O;  5FD6 A;  4JQF A;  1I1S A;  4XBF A;  3V7S A;  2QQA A;  3WU0 A;  1QPM A;  2DQL A;  3Q9V A;  2V1U A;  3JAM K;  5D8L B;  4KMF A;  2QYO A;  3SHF A;  2RN7 A;  2FA5 A;  4KFC A;  1KU3 A;  3TO6 A;  4ZYH A;  1S6L A;  2XAQ A;  2X0L A;  1IRG A;  1P6R A;  5K1Y A;  5LRR A;  1H9G A;  1SD5 A;  1LB2 A;  2HYF A;  5LLQ A;  3RKW A;  1F4K A;  2OD5 A;  1PP8 F;  4ZH4 F;  2EFN A;  2PEX A;  4L5J A;  1ZH5 A;  2ZFW A;  1YIO A;  4L9J A;  5HS9 A;  1FPQ A;  2XGX A;  2A07 F;  3ZMT A;  1YS7 A;  3SFZ A;  3KP6 A;  4BH9 A;  4E70 A;  4BAY A;  4TV7 A;  4OMY A;  4I01 A;  4EGY A;  4HX4 A;  3CLO A;  4U88 A;  4I7H A;  2OQG A;  1FSE A;  3HOS A;  1YQA A;  3VB2 A;  1DPU A;  3RIR A;  3CUQ C;  3ZMD A;  2DFI A;  1BI1 A;  1CGP A;  3F6V A;  4YFN F;  4Q48 A;  1XB4 A;  1O7L A;  4EVI A;  1SAX A;  3C7J A;  1U3E M;  2A5Y B;  4M6X A;  1W5S A;  4CZZ A;  3J80 K;  2FMY A;  4U7B A;  4EJO A;  2YU3 A;  1IXR C;  3LAJ A;  3VFZ A;  4RB0 A;  1UHW A;  5D4S A;  1MDM A;  1IN5 A;  5AON A;  4O3M A;  2K02 A;  2QZ8 A;  4HOB A;  1R36 A;  1RNL A;  3M9A A;  2QBY A;  2MD5 A;  5L3C A;  4YFX F;  2EFQ A;  1XMA A;  2PMH A;  1X3U A;  4ESF A;  1HKT A;  2P6S A;  4O5V A;  5IT9 K;  3KP4 A;  1KQ8 A;  3L7W A;  4RB1 A;  1BJA A;  4HF1 A;  1T0F A;  4I2O A;  5LHH A;  3WTU C;  1FP1 D;  1R1T A;  2BBY A;  4XLP F;  3KP5 A;  3HRU A;  5K5O A;  3F72 A;  3V4G A;  5BOX A;  1ON1 A;  2WWY A;  5DDG A;  1HQC A;  5JVT A;  3L2C A;  5JI6 A;  2HQN A;  5E20 A;  3H92 A;  3R4K A;  1U6G A;  3KP7 A;  1YW8 A;  1LDD A;  1GXP A;  3HHG A;  1RUN A;  3T1B A;  4RGS A;  4RB2 C;  1U8R A;  3T8R A;  2JZY A;  5E1X A;  4BQA A;  3B02 A;  2NAZ A;  3M8F A;  1FBU A;  3KCC A;  2XRO A;  1MDM B;  2HDC A;  4EM2 A;  5LHI A;  1XMK A;  4R79 A;  1FYL A;  2HYG D;  1FP2 A;  2J5P A;  4H0E A;  1YW7 A;  4YG2 F;  1HST A;  4P55 A;  2JPC A;  2DU9 A;  1HKQ A;  3ROU A;  2FEZ A;  4L0Y B;  1YG2 A;  3U9G A;  3HSR A;  1BN5 A;  3HTU A;  2NRA C;  1FX7 A;  4ZYE A;  3CO6 C;  4B09 A;  2IT0 A;  1BOA A;  2XAG A;  2FQ3 A;  1SMY F;  3ELK A;  4CDG A;  1V3F A;  3TOB A;  3F8C A;  2VOD A;  5LHG A;  5L3D A;  1IN6 A;  1G3T A;  3EYI A;  4IRG A;  2EV0 A;  3W6J B;  2ZBK A;  3RYP A;  2IPQ X;  4P96 A;  2YSR A;  2ZXJ A;  3WE2 A;  3CO7 C;  4UUV A;  3V8L A;  4PGH A;  2AXL A;  2VN2 A;  2GXB A;  5CVU A;  4KUM A;  5D5U B;  1PDN C;  4KIB A;  1HW1 A;  5LGU A;  2GA1 A;  5J8F A;  2GZW A;  2CFX A;  2XKO A;  3ZPL A;  2K86 A;  1TW3 A;  3BPX A;  3HHH A;  4P9F A;  2ADU A;  3E5X A;  3FZV A;  3HYI A;  3GZ5 A;  3HSF A;  4WK8 F;  3GEZ A;  5FO5 A;  2CQK A;  1ONV A;  1XN7 A;  3EET A;  4EJV A;  1LEB A;  2D1H A;  1F1Z A;  1IZ1 A;  2ZME A;  3E97 A;  3KP3 A;  3H3U A;  1IXC A;  1TW2 A;  1BI0 A;  1JXS A;  3ECO A;  5D4R A;  3LA2 A;  1B9N A;  3WG9 A;  5LGT A;  4S04 A;  3FXR A;  3DXJ F;  4Q47 A;  1ZHF A;  1T2K A;  3MAJ A;  1FY7 A;  1YTY A;  4CIC A;  1FNN A;  2MH2 A;  1DDN A;  4M72 A;  3PQJ A;  2EV5 A;  4ZZD A;  2P4W A;  3RI4 A;  2DAO A;  1KU7 A;  3I5U A;  3F22 A;  4KIC A;  3K1M A;  4ZYD A;  5AIP A;  4ESJ A;  1I27 A;  1IN8 A;  2OBP A;  2BV6 A;  3FM3 A;  4I0B A;  4L9T A;  5D5W B;  4GCV A;  2HS5 A;  4LD5 A;  2RV8 A;  3KLO A;  3ZMU A;  4IPA A;  4QWQ A;  2QQ9 A;  4JK1 X;  3JW4 A;  4WXD A;  2GWR A;  3MEX A;  1XGS A;  2E1C A;  3K1N A;  2CO5 A;  2ZME B;  4GO1 A;  1R1V A;  4LLG F;  5HS8 A;  2CGP A;  3HRS A;  1W4M A;  4MEX F;  2JPB A;  3LA3 A;  2M45 A;  2PMU A;  3JAM Z;  5J8C A;  1B6A A;  5EEH A;  3ABU A;  3WTT C;  4HDU A;  4MGR A;  1ZRF A;  2BEO A;  3LWF A;  1K79 A;  3WTZ A;  4I09 A;  2YX4 A;  3PQK A;  3MZY A;  2UXX A;  1MJA A;  1FSH A;  5K5R A;  3F21 A;  4D0P A;  3ZN1 A;  1W7P D;  2OAZ A;  4OIO F;  2V9V A;  4M9Z A;  1B59 A;  5DEQ A;  3HUG A;  1D3Y A;  3TKY A;  1Z1D A;  1IAW A;  3K9T A;  2ESN A;  3GFI A;  2STW A;  2FNA A;  2NNY A;  2G9W A;  3COA C;  1UB9 A;  3C3W A;  3BRO A;  1ZGJ A;  2Y0M A;  2LF7 A;  2PI0 A;  3I58 A;  2WTE A;  2ZCW A;  5HDK A;  1Z6R A;  1G6N A;  1P92 A;  3P7N A;  2Z5U A;  3RTR A;  4AIK A;  2W25 A;  2KJC A;  3CJN A;  1O3Q A;  4N9H A;  5DCM A;  4OIR F;  4AWX B;  2CW0 F;  3TDZ C;  3J80 Z;  2VC0 A;  1FT9 A;  2DPD A;  3G73 A;  3M1E A;  3C1D A;  4K2E A;  1JE8 A;  2XAS A;  2RKH A;  3E6C C;  2W84 A;  4EQQ A;  2V1X A;  1GVJ A;  1KGS A;  4A0Y A;  2CYY A;  2ZNY A;  3KZY A;  2FRH A;  3L09 A;  1T98 A;  3FXU A;  3FWE A;  1G4D A;  5ED4 A;  4KIF A;  1ULY A;  5IT9 Z;  2D1V A;  2HTJ A;  5FLX Z;  1OMI A;  3KZZ A;  1RUO A;  2VT2 A;  3R6S A;  3RKX A;  1OKR A;  3P9C A;  1ZRC A;  1G3Y A;  3E5Q A;  4ENJ A;  4UV9 A;  4PZJ A;  1S3J A;  4UVA A;  4BHC A;  2MH9 A;  4A0X A;  3JSP A;  1BI3 A;  3O2P E;  4LGW A;  1LDJ A;  1FBQ A;  1WKM A;  1JHH A;  3JTH A;  4FT8 A;  4G7Z F;  2CG4 A;  5DCM B;  3DQV C;  3FMR A;  1SD7 A;  4EV0 A;  3REO A;  3GVA A;  4MQV A;  1UHM A;  3CUO A;  2QWW A;  3ERE D;  4IJA A;  3SZT A;  2PFB A;  5D6F A;  4Y13 A;  2LF8 A;  2KJB A;  1KU9 A;  1Z91 A;  2GIV A;  2QVO A;  3ISP A;  1BC7 C;  4HF0 A;  4NQW A;  2ISY A;  3TOA A;  1XD7 A;  4IXA A;  4IRI A;  2AS5 F;  3GFM A;  1XGO A;  4KIG A;  2QEN A;  2Y48 A;  1B1B A;  2A61 A;  2IVM A;  4LK0 F;  4MHG A;  2HQR A;  3BOQ A;  1LJ9 A;  3L00 A;  3BDD A;  3PFI A;  4HDV A;  5DUK A;  3HOT A;  4HBL A;  1HBX G;  3ZMS A;  3DPL C;  3F8B A;  1ZLK A;  1OR7 A;  4PCQ A;  1BC8 C;  3Q9S A;  1CF7 A;  2DK8 A;  1XDU A;  1R5H A;  2GXG A;  5CLS A;  2YPR A;  1MJB A;  5FGM A;  3R0J A;  3R0A A;  5J6X A;  2P5V A;  1GHC A;  1ZAR A;  3EYY A;  2VXZ A;  2A69 F;  2ISZ A;  1XSV A;  1HSJ A;  4YFK F;  1Y0U A;  2Z3Y A;  5E1W A;  3DFG A;  2D2W A;  2RNJ A;  3QPT A;  5FFZ A;  2RDP A;  5A2Q K;  4MTD A;  2JTV A;  2MA3 A;  2VOP A;  4CXF A;  5HS7 A;  1QBJ A;  1TQP A;  3ML6 A;  3CDH A;  1IF1 A;  1F5T A;  3P9I A;  3G3Z A;  2FE3 A;  3GZ6 A;  5DV5 A;  2NS0 A;  1IN4 A;  4Q5S F;  2VC1 A;  1L0O C;  1TLH B;  5L3F A;  4HF2 A;  5JHU A;  4RAZ A;  5ICG A;  4M73 A;  2HOE A;  1XCB A;  1K78 A;  5LRS A;  1EH7 A;  1O3R A;  1K6O A;  1AOY A;  1WI9 A;  1D8K A;  1C0W A;  3FMS A;  3LAP A;  2E1N A;  5CJ9 A;  3R61 A;  3O3K A;  1SFU A;  1BM9 A;  1U5T B;  2P7V B;  1LDK B;  1D8J A;  1CF7 B;  4UHT A;  4U0V A;  2E7W A;  4HV5 A;  3TDU C;  2H94 A;  2O03 A;  4UNO A;  2OZU A;  2XKP A;  3HIF A;  5DYM A;  2QQB A;  4AVP A;  3RPU A;  3QP6 A;  3TQN A;  3QPH A;  3SZP A;  3KP2 A;  2IA2 A;  4ENK A; 
#chains in the Genus database with same CATH topology
 1KYZ A;  4WCG A;  1R4N B;  3AG4 H;  4EJT A;  3HB9 A;  2HWV A;  4A3I J;  1LFP A;  1B4A A;  3JCU C;  1OYI A;  3G1L A;  3IL2 A;  2P5K A;  3Q5F A;  4BYY A;  3ONQ A;  4A93 J;  5EEA A;  4BEH A;  5HVQ C;  2MC4 A;  2MC3 A;  4DZJ A;  1S8N A;  2KL4 A;  3HTS B;  3I71 A;  3MKW B;  1EF4 A;  2F5E A;  3ZQC A;  2RQQ A;  2Q1Z B;  1IRZ A;  1QNT A;  5FKM A;  3K2A A;  2K4B A;  1Z05 A;  3FK7 A;  5F0H A;  2QUF A;  5F1J A;  4G9Y A;  3C18 A;  4AVZ A;  3WTY C;  2LMD A;  2IAI A;  2QLZ A;  3O8G A;  2R3S A;  2V9P A;  5JR3 A;  2CQN A;  1SD4 A;  4IVN A;  4EM1 A;  4I02 A;  5FFX A;  2LSO A;  1JGG A;  3S1Q J;  1F9N A;  2BW3 A;  3E6D A;  3HM5 A;  3T8T A;  4C3J J;  2GXA A;  2UUZ A;  1X1A A;  2XVC A;  1BW5 A;  2JSC A;  4LMY A;  4EJU A;  2GAU A;  4QIW N;  1WJF A;  3I59 A;  1RZ4 A;  2PJR B;  1K78 B;  1GV2 A;  3I54 A;  4N0B A;  3CMM A;  2ID3 A;  2VQG A;  1P7J A;  1LEA A;  4MEY F;  1SFE A;  1TQI A;  3K4L A;  4CO8 A;  2WY8 Q;  2YUS A;  3RYR A;  5CYV A;  1IUY A;  2KZG A;  3BG5 A;  2W7N A;  3QRF F;  3LST A;  4PGG A;  3VEP A;  1Z21 A;  1KQ9 A;  4BE1 A;  1G3W A;  1FBS A;  4OIP F;  4XL9 A;  2ACJ A;  2EA2 A;  1BR2 A;  5D5X B;  1QVT A;  3I0T A;  3MN2 A;  3HOZ J;  4ON0 A;  1P4X A;  2FBK A;  2R7O A;  2L4A A;  2C6Y A;  3H0D A;  3K4J A;  4G8X A;  3DTE A;  1ZR4 A;  4IRH A;  5K5Q A;  3CCE I;  4RAY A;  4M71 A;  5E3L A;  2KQR A;  2FSW A;  2JK3 A;  3GBG A;  2HOT A;  2F4O B;  2KRF A;  4BJ5 C;  1K7A A;  2IGM A;  5EZH A;  1J7K A;  1RKW A;  1Z9C A;  2HTS A;  5HDG A;  1TTY A;  1DP7 P;  2A6H F;  3M3Y J;  2Z9O A;  3OV8 A;  2DT7 B;  4GYI A;  4A69 C;  4IHT A;  4KA4 A;  3IH4 A;  3W6V A;  2IS2 A;  4IHW A;  2VBY A;  1W7P A;  2FJ1 A;  2ETH A;  3GTO J;  3N4M A;  1YHQ I;  2ECB A;  2RQP A;  1WCM J;  2M9H A;  4HQM A;  1SFO J;  2R7V A;  4C2U A;  4KN7 X;  2XAF A;  2EV6 A;  2BGC A;  1ZRD A;  4AUX A;  5FD5 A;  2L9N A;  4UY8 I;  4YII A;  2H6B A;  1UAA A;  1JUP A;  3KLN A;  5BS6 A;  4CGZ A;  2HFH A;  3FM5 A;  3CDL A;  2EFW A;  2KRH A;  2M4K A;  1MMG A;  2VPR A;  2DA4 A;  2IS6 A;  1QVU A;  4U87 A;  4NC6 A;  5H6R A;  1XDS A;  1TWA J;  4BEH B;  3HOU J;  1I6X A;  3E7L A;  2EJR A;  2NVQ J;  4A6E A;  2RGV A;  2HDD A;  1XGN A;  2F5C A;  4G6Q A;  3WTX C;  2KDO A;  3G4S I;  2DQR A;  1J09 A;  5HOD A;  1FIA A;  4DW6 A;  1FWZ A;  4DQ2 A;  3AG2 H;  3BP8 A;  1Y39 A;  4W1U A;  4RBO A;  2BW3 B;  5F6F A;  4A3K J;  2KIQ A;  3F6O A;  1J5Y A;  3D5L A;  1RI7 A;  4P9U A;  2MFZ A;  1FYK A;  2Y31 A;  3I59 B;  4M74 A;  2NVX J;  2NOJ B;  5F64 A;  1QZE A;  4DGW B;  4UVC A;  4LIT A;  1KON A;  4OMZ A;  4XLA A;  4UXN A;  2OU2 A;  2CSO A;  2AXT C;  3WHC A;  3HL2 A;  1VQM I;  5TIS C;  4CHU A;  2DA7 A;  1X58 A;  2CQQ A;  3QOP A;  5GTI C;  2HGC A;  2WAQ N;  5CKT A;  5TRD A;  5F27 A;  2OZ6 A;  5EGO A;  3M8J A;  5J3L A;  3E3V A;  2VOO A;  3MVP A;  1VQP I;  2WBM A;  1WJE A;  3DTK A;  3MQ0 A;  1XX5 A;  5HNF A;  1P4A A;  2VJJ A;  3FKI J;  4EGZ A;  3S3N A;  4GDF A;  3J7A Y;  2F5F A;  1NHA A;  4QSH A;  4PJM A;  4A5N A;  1BIA A;  5LEK A;  2FML A;  3M7G A;  4RMN A;  3KEY A;  3GXO A;  1H0M A;  3MZ8 A;  3E6M A;  5J4V A;  3MZH A;  1EH6 A;  2H8W A;  3GW2 A;  4B8X A;  4MO7 A;  3H5N A;  3NEU A;  3AFH A;  4HAM A;  5B1A H;  3CF5 F;  4AIJ A;  1W7P B;  1Z77 A;  2A3S A;  2GA2 A;  2V6C A;  3LFU A;  1I6H J;  2DDA A;  3D0S A;  4ZZL A;  5HLH A;  2DT5 A;  4II2 A;  3OS2 A;  3S2H J;  4HNT A;  5DUI A;  1DGR M;  1D1A A;  1MD0 A;  2K7L A;  2ZFU A;  2X85 A;  2XV4 S;  1VQO I;  4AU7 A;  3CDI A;  3CZ6 A;  3DPU A;  2EZH A;  3OYB A;  3SFI A;  2M3A A;  1S29 A;  2XPW A;  5E1Z B;  1OR7 C;  2HZT A;  1ZYR F;  2W85 A;  4HYE A;  1ETO A;  4L9V A;  2IS1 A;  4E4H A;  3GO5 A;  4KMU X;  4D7M A;  3K7A J;  1AKH A;  1QGP A;  5DTD A;  2FNP A;  3TGN A;  4ZTF A;  4O6J A;  3OR2 C;  3FK6 A;  3Q0W A;  3JTG A;  1IV6 A;  2L4M A;  1I5Z A;  3G1O A;  2EA4 A;  4R8H A;  5IOY A;  4LB6 B;  1XPX A;  3HRT A;  2DW4 A;  2MYS A;  2A05 A;  3VSL A;  4IZZ A;  5DD8 A;  3U2R A;  3RKQ A;  2K9L A;  1WQ2 A;  2HKX A;  3IC7 A;  1QHG A;  3J81 K;  1V4R A;  1XC5 A;  2DYR H;  5IT3 A;  1XS9 A;  2XIG A;  4HNU A;  4A3L J;  2XRN A;  3BPV A;  5JFR A;  4XON A;  5E79 C;  3L9F A;  3NWT A;  4HZF A;  1ZKG A;  1QQI A;  1USS A;  1E2X A;  1T08 B;  2D45 A;  4YEJ A;  4M3G A;  3CCL I;  5KVR A;  1D1B A;  5DD4 A;  4BS9 A;  2VXD A;  4Z2Y A;  1REP C;  3QU6 A;  2BHY A;  2DMN A;  4JX4 A;  5EDN A;  3PSF A;  4HNV A;  4S05 A;  1OYW A;  2O61 A;  1KA8 A;  3B73 A;  1W0T A;  3GFJ A;  2B7E A;  5BQT A;  2L7M P;  5EGO B;  2L3D A;  1WPK A;  5LBQ A;  4AM3 A;  4HA8 A;  2VON A;  2DTR A;  2ESH A;  3CP8 A;  3I4P A;  3V8K A;  4AYB N;  1MNM C;  3CC2 I;  2PN6 A;  3HOW J;  3VYS B;  3K69 A;  4ZDL A;  2P8T A;  2Q0O A;  3HBL A;  3LFK A;  2EK5 A;  3L2R A;  1EJ9 A;  2X6X A;  1A31 A;  4XN0 A;  4XSZ F;  4UV8 A;  4JX5 A;  5ILU A;  4P5O A;  1XSX A;  2YU9 J;  3BR2 A;  3WGI A;  5HOO A;  1LKX A;  3NQO A;  2YR2 A;  2PBI A;  2DMT A;  3T5X A;  2IJL A;  3RCO A;  4HLY A;  2XF5 A;  4G7O F;  4A0Z A;  5M5X J;  4Y15 A;  2P6T A;  4YIF A;  4LB5 A;  1PUF A;  1K4S A;  1R7J A;  5FRN A;  5H2F C;  2PX9 A;  1U0J A;  1WJ5 A;  4LFU A;  1Z7L A;  2HPI A;  1ITY A;  1AKH B;  2J5O A;  2LDU A;  3HC7 A;  3WOD F;  2ELJ A;  1DU6 A;  4MQ9 F;  1D0Z A;  2VB6 A;  1WH7 A;  1PJR A;  5HDN A;  5HLG A;  5IYC J;  2OPT A;  2UWM A;  2FQ4 A;  5EEG A;  4UUS A;  3CLQ A;  3I4N J;  3U1D A;  5ICF A;  1FLI A;  3GLL A;  2NYX A;  4V2F A;  1XSD A;  1NK3 P;  2VBW A;  3GTL J;  2KRC A;  1A6Q A;  1FEX A;  4HG2 A;  1HA8 A;  3P9K A;  2X1E A;  3F8M A;  2ELK A;  2XUB A;  3E6B A;  3CC4 I;  2JRT A;  3OYE A;  2EZL A;  1MJ9 A;  4MNU A;  2M1B A;  3H3V K;  1J59 A;  3MWM A;  3VWB A;  1OCR H;  1XGM A;  2I8D A;  3H5A A;  4NHJ A;  2EFO A;  4L0Z B;  1J0R A;  1FYM A;  1MBG A;  2O6G E;  1J75 A;  1FOY A;  2DJN A;  2XHK A;  2LRD A;  1R4M B;  4BQQ A;  3WTV C;  2QQ8 A;  3K1P A;  2R7D A;  3KPH A;  3HKZ A;  4BBR J;  5M5W J;  4XRM A;  4UB8 C;  2Y0S A;  1ZEL A;  1LUJ B;  4JP0 A;  3U1K A;  5A2Q Z;  3VDX A;  3SDG A;  1WRJ A;  2PQ8 A;  2H09 A;  2KIU A;  4HSR A;  4I0A A;  4XLC A;  4E7S A;  2R7F A;  1QU3 A;  3QWL A;  1UST A;  4A5M A;  2O8X A;  4RGX A;  4B47 A;  5E18 F;  1ODD A;  1E17 A;  1L3L A;  2JA8 J;  3NAU A;  1HKS A;  3IV5 A;  2DBB A;  2Y9Y A;  3DPT A;  5L3B A;  2IP2 A;  1KQ0 A;  2LY9 A;  4BXU A;  5IOZ A;  1IXS B;  2R7Z J;  3SDB A;  2E5N A;  1RET A;  4ESB A;  1XCV A;  1MSF C;  3BCB A;  3F3X A;  2UZK A;  2HPM A;  1PUE E;  3VOD A;  3N97 A;  3EDP A;  2V79 A;  3LNQ A;  1K6Y A;  2IBD A;  2L01 A;  3S15 J;  2W4S A;  2L9V A;  2ZJR F;  4ZTJ A;  3KEQ A;  1PUF B;  3GTK J;  1U2W A;  3OYK A;  2Q8K A;  1WGX A;  1H9T A;  2H1K A;  1ZGW A;  4RB3 C;  4ETS A;  1QZY A;  3DV8 A;  2W57 A;  2BY0 A;  2IRF G;  3DEE A;  1GT0 C;  3HJE A;  4GGG A;  4XRF A;  3OYI A;  3JRE A;  1J9I A;  4UUS B;  2CMP A;  2Z99 A;  2GOM A;  1SFX A;  3A2K A;  4RAF A;  3EUK L;  5DM6 F;  4Y17 A;  1X4P A;  2OA4 A;  2XGC A;  4M6Y A;  2ID6 A;  1YIJ I;  3W3C A;  5DCF A;  3ULQ B;  2ZC2 A;  2VQC A;  2ZME C;  2COM A;  4IX7 A;  2UXN A;  2NS7 A;  4OOI A;  3PUB A;  3QPS A;  5D6E A;  4E7Z A;  3WU1 B;  1ZN2 A;  1E0E A;  3CCQ I;  2FBH A;  1DPR A;  5E17 F;  3ASN H;  3FHZ A;  4PDK A;  3DLL F;  3I64 A;  3BR3 A;  3DKY A;  2VE8 A;  3MKL A;  4XOP A;  5GP9 A;  1E3P A;  1MZB A;  2F6C A;  3V7R A;  4F93 B;  4F52 A;  1ZLJ A;  1UCR A;  2H6C A;  1U5T A;  2P0W A;  4KT5 C;  1FZP B;  5IP6 A;  3BWG A;  2JJ7 A;  3UR3 C;  4EJW A;  2EFP A;  1EH8 A;  1B9M A;  2MLG A;  3HZJ A;  2CJJ A;  4HX8 A;  4M6V A;  3BZ6 A;  3JRF A;  3O6B B;  3QAH A;  5CVV A;  1BI2 A;  3H1C A;  3ZR8 X;  3DKX A;  1S7O A;  1EV7 A;  2XPV A;  1RIO H;  3PFY A;  1SAU A;  3KYD B;  2VQH A;  4Y52 J;  3BT9 A;  3TW6 A;  4EM0 B;  4U7D A;  4QTR A;  4CCJ A;  4C9Y A;  3C2G A;  3O8H A;  2EQR A;  2XC7 A;  2HR3 A;  4JYK A;  1JGS A;  1OJL A;  2GM4 A;  4ENN A;  1TT5 B;  1I3Q J;  2NVU B;  3LSK A;  1DP3 A;  4XLN F;  1IUF A;  1MH3 A;  3ABT A;  3E1S A;  3C2H A;  3BZK A;  4BAC A;  2R7S A;  3BC8 A;  1V5E A;  3K4M A;  1P7I A;  3LSH A;  4U0W A;  1LVA A;  3TO9 A;  4LG3 A;  1UG2 A;  2FBI A;  3WE3 A;  2YX7 A;  1S9H A;  1A04 A;  3GWZ A;  4QLC U;  4LLL A;  2DJI A;  3QQA A;  3QU3 A;  4AD9 A;  4PJL A;  4LOC A;  2GOX B;  4KNY A;  1ETV A;  1ZAO A;  4D9J A;  2RC4 A;  3SQN A;  2L7F P;  4IF4 A;  3CCV I;  1R00 A;  3VOE A;  2GLO A;  1D5V A;  2QKL B;  6PAX A;  4CCO A;  5FLX K;  3FKJ A;  2DOA A;  3I3L A;  2NVT J;  3T0Y A;  3S1N J;  3LSI A;  2KP6 A;  4A6D A;  1P9Q C;  1W0U A;  1YLF A;  2R93 J;  3ZGK A;  3E5U A;  1RC9 A;  3M8E A;  3DF8 A;  1KU2 A;  2L9S A;  1QRY A;  1YW9 A;  3OOU A;  1SD6 A;  3IKT A;  1W5T A;  3A01 A;  4X6A J;  3JSO A;  1Y6I A;  3F9K A;  1D1C A;  1O57 A;  2QSG X;  2W1O A;  5KAF C;  1YJN I;  2GIZ A;  1WVR A;  4BNC A;  4IHS A;  3ZQI A;  3LQR A;  2E1M B;  2DLL A;  1ERD A;  3CQZ J;  1KYW A;  4BDY A;  2JA5 J;  3CCU I;  1G3S A;  2P7C B;  1WJC A;  3K2Z A;  3IUO A;  4A3D J;  2HQA A;  5ERI A;  2ZJ2 A;  1STZ A;  1SFK A;  1YFH A;  1IRF A;  2EZK A;  4G6D A;  1IDZ A;  3MFK A;  2EH3 A;  4BQN A;  1SMT A;  5E8G A;  3K70 C;  1TBX A;  4BXF A;  1H88 C;  2PLY A;  2XAJ A;  4LK1 F;  5J47 A;  1ORK A;  2CV0 A;  4WXH A;  2XSD C;  2OJE D;  1P2F A;  3ZMV A;  5BPI A;  3KEO A;  2VBZ A;  3HPG A;  4PJN A;  3TMO A;  3AAF A;  1EKE A;  5D5V B;  1PP7 U;  5JLX A;  4B4C A;  1Z3X A;  2VJI A;  2EB7 A;  5IYD J;  1Y1W J;  1O3T A;  1TNT A;  3CES A;  4KN4 X;  4PSX A;  3S32 A;  2CU7 A;  1VQ6 I;  1X1P A;  4B1R A;  5J40 A;  2O0Y A;  4RGU A;  2DK5 A;  4GXO A;  3HOV J;  2FD5 A;  1YX5 A;  2KKO A;  2IXS A;  3IH3 A;  3DEU A;  2W24 A;  2LK2 A;  1B72 A;  5AIQ A;  3BJ6 A;  2Z2S B;  2JSP A;  4Y3O A;  1H89 C;  1Q1H A;  4OU0 A;  3V8J A;  2QBY B;  4CCN A;  2XB0 X;  1M1E B;  4XKW A;  1V5F A;  3S2W A;  3EQL F;  1OIS A;  2FXA A;  3IKV A;  5GAD J;  4A12 A;  3JRD A;  4WWC A;  3LA7 A;  2Y69 H;  2VE9 A;  1J2X A;  4B3A A;  3SXY A;  3WGH A;  2PMZ A;  2Z16 A;  2F2E A;  2V6E A;  5HLT A;  2CQX A;  3QP5 A;  2DN0 A;  1MSE C;  2O5R A;  1Z3Y A;  3FXK A;  4CYD A;  3EUH A;  3GTM J;  2DMQ A;  3OYC A;  3RPQ A;  1R1U A;  2STT A;  3W6K B;  1AWC A;  3NRV A;  2DA1 A;  2TDX A;  2PG4 A;  1JHF A;  1YYV A;  3K4K A;  4IQJ A;  3A01 B;  1X2N A;  2MSY A;  4F7Z A;  2IGO A;  5BMZ A;  2Y75 A;  2E19 A;  2P5L C;  1S7A A;  1MW7 A;  2VJ5 A;  1E3H A;  2L02 A;  5CVI A;  3WTS C;  3KX2 A;  2ZSI B;  1ZG5 A;  3N05 A;  5BPD A;  1SEU A;  3K6G A;  2JUC A;  1OPC A;  1POG A;  2IGN A;  2QGU A;  2WC2 A;  4WX9 A;  3IWF A;  3ZQG A;  3RJP A;  1MBK A;  3U21 A;  4NDL A;  5KCM A;  4BE0 A;  1HDD C;  3GYH X;  4E7J A;  3BY6 A;  3QOD A;  4CCL A;  4DIQ A;  1OCC H;  2O7O A;  3ZOB A;  5E8I A;  3PIP F;  5LEJ A;  1UFM A;  1HW5 A;  3OR1 C;  4DBR A;  1GDT A;  5IYB J;  3BG3 A;  2M34 A;  2XAH A;  1QZZ A;  4XSX F;  3W2W A;  2P81 A;  4EMS A;  3JRG A;  2VBX A;  1DUX C;  2MW8 A;  2M8E A;  1WSU A;  1P4W A;  2M8G X;  2ME0 A;  2MLK A;  2RAE A;  4FAS D;  1ZTR A;  1ENH A;  1YS6 A;  1ZG3 A;  1MMA A;  1YI2 I;  3ECH A;  3J81 Z;  2A68 F;  4DNC A;  1OYY A;  2KFD A;  2OTL I;  3IRR A;  4E7L A;  5ILV A;  1HDP A;  2H27 A;  3FXQ A;  1TC3 C;  3OSF A;  2IA0 A;  3FBN B;  4DYQ A;  4S0H B;  2DOE A;  4OAY A;  2L0K A;  1B72 B;  3JR9 A;  5ICE A;  3P5J A;  3ZN0 A;  2EWN A;  2QM3 A;  5ICC A;  3I4M J;  1WJA A;  3K10 A;  1D5Y A;  1WHU A;  1D0X A;  1VI0 A;  1Z6T A;  5FJ8 J;  2NS8 A;  3KET A;  4ZJZ A;  4LIV A;  3CUQ A;  3FMQ A;  2GBY A;  5F1R A;  4NB5 A;  3GX4 X;  5M3F J;  3PL8 A;  2LNB A;  1AHD P;  4D5C A;  1EA3 A;  4D1Q A;  4BL0 B;  3OYM A;  2BZT A;  5BNG A;  5FB2 A;  1GV5 A;  1R22 A;  1I1G A;  2G7U A;  1ETX A;  3L2V A;  2E7X A;  1U78 A;  4RGR A;  1OCO H;  3FX3 A;  2Z33 A;  3V7C A;  3BQY A;  3AG1 H;  3K4N A;  1O3S A;  3KE2 A;  1V55 H;  4ENM A;  1ZRE A;  2OC6 A;  1I50 J;  4GRI A;  1X1B A;  2NXN B;  1Q1V A;  2B63 J;  1NH3 A;  4HX7 A;  3VPR A;  4HW0 A;  3DCF A;  1VFC A;  2ZJP F;  2DPU A;  1QO0 D;  1WJD A;  4I99 C;  2FU4 A;  5KK1 A;  4OIQ F;  1TT0 A;  2M87 A;  1TQM A;  2CUF A;  2F5D A;  4NC7 A;  2BVL A;  1VTN C;  2JA6 J;  3PSI A;  1JKP C;  3H3Z A;  1W5C C;  3FXL A;  4L5I A;  5L3G A;  3OIP A;  3FF5 A;  4BXX J;  3HRM A;  2V26 A;  2K4J A;  4LG0 A;  1T6S A;  1LFB A;  1BIB A;  5TJJ A;  1BBY A;  3IHU A;  4RS8 A;  3LSG A;  4I98 B;  3F8F A;  5FLV A;  1BL0 A;  2WV0 A;  1IO2 A;  2KDZ A;  1UEL B;  5C4X J;  2Y9Z A;  4HQE A;  1OQY A;  3HEF A;  5HLI A;  4MTE A;  3ZQ7 A;  1U8B A;  4U0Y A;  4DYC A;  4D5F A;  1FMV A;  4ZDP A;  4FHT A;  1MBF A;  3X2Q H;  3M4O J;  1F43 A;  4M3F A;  3WTW C;  2K9Q A;  3HSE A;  4RM2 A;  4A3F J;  2JQ7 A;  1R58 A;  2HVS A;  1U5T C;  2YS9 A;  4UVB A;  1LQ1 A;  4IOA F;  1K83 J;  4BHP A;  1FOW A;  4ZC3 A;  5H20 A;  1JT0 A;  1B8I A;  3IRQ A;  3MKY B;  3MCZ A;  4WXC A;  2FF4 A;  1WWX A;  5FKN A;  2ELH A;  3IWZ A;  3CF2 A;  2I10 A;  1GXQ A;  2KIF A;  5DS9 A;  5TGT A;  4F92 B;  1YO5 C;  1HW2 A;  4ABZ A;  4XRS A;  3M1C A;  2XF6 A;  4FX4 A;  3LSP A;  3CUQ B;  3EUA A;  2MGQ A;  4XRS G;  1DU0 A;  3BTI A;  5EYR A;  1A36 A;  4G94 A;  2M5W A;  1O4X A;  4OIN F;  3ZP5 A;  3LL7 A;  4HLX A;  2ZKZ A;  5ILS A;  5D8K B;  3OY9 A;  4I6Z A;  1A6I A;  3F8N A;  3S2D J;  3OYL A;  3HOY J;  3I53 A;  2E71 A;  2M30 A;  1OFC X;  3TW7 A;  4KDP A;  4ZYG A;  2NNN A;  1R5G A;  5J1U A;  2W00 A;  3OYJ A;  1JKO C;  2VPL A;  2E36 A;  2F48 A;  2K27 A;  4BHB A;  3K4B A;  4XKV A;  1IV8 A;  3JRH A;  1MBH A;  5K7H A;  3F23 A;  5B1B H;  2A6T A;  1RR8 C;  2O9L A;  2G0E A;  2L54 A;  2BYV E;  2H1L A;  1OCP A;  3KFW X;  1O7F A;  4FTH A;  3S1R J;  3MKZ A;  4KYW A;  3BQZ A;  1MMD A;  3DWL E;  3OOP A;  2CV2 A;  1HXD A;  2DOD A;  1ZR2 A;  2M4G A;  3WGG A;  2O3F A;  5CVJ A;  2KPM A;  2IA1 A;  2E2H J;  3DBR B;  3CCJ I;  2BY3 A;  2LVS A;  1N77 A;  5L3E A;  4CCM A;  3BLY A;  2OQR A;  3RDI A;  4FX0 A;  1FOK A;  4LG0 B;  1IW7 F;  3GUD A;  1MKM A;  1TP4 A;  2BHZ A;  1NK2 P;  2LYC A;  4A2U A;  3GFL A;  2EIL H;  4CSW A;  1PYV A;  4LJZ F;  4ASN A;  1BW6 A;  3R60 A;  5LGN A;  4G7H F;  2Q2E A;  2MBF A;  3WG7 H;  1UG0 A;  4R1H A;  4NUB A;  4M9X A;  2G7H A;  2HOS A;  4A3J J;  1VQN I;  1LNW A;  3OYA A;  2LTP A;  4M9S A;  2R7R A;  1Z7U A;  3LSJ A;  4CCK A;  5C3E J;  2RVC A;  1ETY A;  1YJ9 I;  3HKZ N;  2IW5 A;  4B44 A;  3FXO A;  1JUS A;  2XPU A;  2OCC H;  3TO7 A;  2X4H A;  2XGD A;  2Y0S N;  1TNS A;  4BU2 A;  2O8K A;  3K0L A;  3GF2 A;  2VKH A;  2XF7 A;  3BR5 A;  1F36 A;  5B5E C;  5IY5 H;  1B8I B;  4IHY A;  2E5Z A;  2ZNZ A;  1G59 A;  4C2T A;  1MGT A;  4LLN A;  4KIT B;  2HKO A;  5CVR A;  3BJO A;  2M0M A;  5H6Q A;  2HEO A;  2GQQ A;  3MMY B;  1N25 A;  1ON2 A;  3FIW A;  2CWE A;  2BY1 A;  4XK4 A;  2M7B A;  4B43 A;  2A6E F;  4BJ6 C;  3BJA A;  4M3B A;  2M2E A;  2PJP A;  2BE5 F;  2MG4 A;  2B0L A;  1N75 A;  2VT3 A;  1T38 A;  2V1D A;  3DTI A;  4HV6 A;  4GYG A;  1IN7 A;  4L18 B;  1ZGA A;  2WAF A;  3PNY A;  2E2J J;  4Q4Z F;  1ZG1 A;  2AO9 A;  3DKW A;  1R23 A;  3RKY A;  3LQQ A;  2LKP A;  3D1N I;  1MNE A;  5CQG A;  3F0C A;  2JA2 A;  4A3M J;  2X1D A;  2KIM A;  4JBA A;  1T39 A;  2JT1 A;  4WF2 A;  3ZMZ A;  1JTY A;  2ZO4 A;  3CTA A;  2DI3 A;  2JMW A;  4AIH A;  3S14 J;  1WH5 A;  2TCT A;  1FC3 A;  4L9N A;  3GLX A;  3DP7 A;  2HVQ A;  2FOK A;  5J4Y A;  2DO7 A;  4N9I A;  3J7A O;  5FD6 A;  3FBI B;  4JQF A;  2ZXI A;  1I1S A;  4XBF A;  5F0C A;  3V7S A;  2QQA A;  3WU0 A;  1QPM A;  1ZK8 A;  2DQL A;  3EUH C;  3FDY A;  3Q9V A;  2V1U A;  3CJR B;  3JAM K;  3PIO F;  5D8L B;  2X51 A;  2COB A;  2V1N A;  1NG6 A;  3QYE A;  4KMF A;  2QYO A;  3SHF A;  2RN7 A;  2Q2E B;  2FA5 A;  4KFC A;  1KU3 A;  3BG7 A;  3TO6 A;  2QEX I;  4ZYH A;  4CUG A;  3PUF A;  4BGD A;  1S6L A;  4DJA A;  5GAH J;  2LH9 A;  2XAQ A;  2X0L A;  3A4C A;  1IRG A;  3VYU B;  1P6R A;  3IAM 2;  5K1Y A;  2LD5 A;  1KZH A;  4QPQ A;  1Z67 A;  3GME A;  1FIP A;  2ZB9 A;  1LFU P;  2R7U A;  5LRR A;  1K4T A;  5FRM A;  2LRE A;  1XG1 A;  1H9G A;  1SD5 A;  3I55 I;  2ZXH A;  2R5Y A;  1T8I A;  1LB2 A;  2ICW G;  2DDB A;  2HYF A;  5LLQ A;  3RKW A;  3L1P A;  1F4K A;  2OD5 A;  1PP8 F;  2JN6 A;  4ZH4 F;  2EFN A;  1W36 C;  2PEX A;  2F4I A;  4L5J A;  3CMA I;  4W97 A;  2OV7 A;  1ZH5 A;  2ZFW A;  1MIJ A;  1YIO A;  4L9J A;  5HS9 A;  5LFA A;  1FPQ A;  5IP7 J;  2UV1 A;  2XGX A;  2A07 F;  3ZMT A;  1YS7 A;  4KJZ A;  3SFZ A;  3KP6 A;  4BH9 A;  4E70 A;  4C3I J;  1R5I D;  4BAY A;  4TV7 A;  1D0Y A;  2Z1D A;  2OTJ I;  4OMY A;  4I01 A;  4EGY A;  1R6R A;  2DT6 A;  4HX4 A;  1IC8 A;  3CLO A;  4ZYA A;  4U88 A;  1QHH D;  4I7H A;  2OQG A;  1FSE A;  3HOS A;  3JRI A;  1T33 A;  1YQA A;  4YEL A;  3L2U A;  2W82 A;  2LG4 A;  3SEZ A;  4E7H A;  3VB2 A;  1DPU A;  3RIR A;  3CUQ C;  3ZMD A;  4E6K G;  5GPC A;  2DFI A;  1BI1 A;  2XRL A;  1I39 A;  1CGP A;  3F6V A;  1DQU A;  4Q48 A;  4YFN F;  2DCE A;  1XB4 A;  2AQF A;  1FOX A;  5F04 A;  1O7L A;  4EVI A;  3PJR A;  4X1E A;  1SAX A;  5DM7 F;  4FCY A;  3C7J A;  1U3E M;  2A5Y B;  4M6X A;  1W5S A;  4G12 A;  5EF6 A;  4CZZ A;  3J80 K;  2FMY A;  1ZQ3 P;  2LFB A;  1PVE A;  4E7I A;  2KMU A;  1W1W E;  4U7B A;  3AG3 H;  4PFO A;  3S17 J;  1APL C;  4Y33 A;  5HNH A;  4EJO A;  2YU3 A;  2EIM H;  4JX6 A;  1IXR C;  2LLK A;  5K7Z A;  4RA2 A;  3LAJ A;  3VFZ A;  5K7F A;  3BG9 A;  3S93 A;  1JT6 A;  4RB0 A;  4V2G A;  1RES A;  1UHW A;  5D4S A;  1MDM A;  4BY7 J;  1IN5 A;  5AON A;  4O3M A;  4I76 A;  4G6T B;  1IG7 A;  1VQ9 I;  2K02 A;  2LC2 A;  5EJC A;  1N78 A;  4ANJ A;  2QZ8 A;  3A0B C;  4HOB A;  1DGW Y;  2K9N A;  4XKC A;  1R36 A;  4EEF G;  2WAE A;  1GVD A;  1RNL A;  3M9A A;  2QBY A;  1TWG J;  2MD5 A;  2R5Y B;  5L3C A;  4YFX F;  2EFQ A;  1XMA A;  2PMH A;  1X3U A;  4ESF A;  1HKT A;  2P6S A;  4O5V A;  5IT9 K;  2DFF A;  3H0G J;  5CQE A;  3KP4 A;  5C4J J;  1KQ8 A;  3A03 A;  3L7W A;  4RB1 A;  1BJA A;  4HF1 A;  1T0F A;  2R7T A;  4I2O A;  2BY2 A;  5LHH A;  4XLH A;  3S16 J;  2HXI A;  2LBF A;  3V42 A;  1FP1 D;  1R1T A;  2BBY A;  3WTU C;  4XLP F;  3S1M J;  3KP5 A;  3HRU A;  5K5O A;  4B48 A;  3F72 A;  3TBI A;  3V4G A;  5BOX A;  3ESW B;  1Y1V J;  3BZC A;  1VQ8 I;  1SC7 A;  2MD0 A;  1ON1 A;  2WWY A;  1HF0 A;  2L7Z A;  2LY1 A;  2X48 A;  5DDG A;  1HQC A;  5JVT A;  1X1C A;  4HST A;  3TP3 A;  2DXI A;  1V54 H;  3L2C A;  5JI6 A;  1U9O A;  2JVG A;  2HQN A;  4YIR X;  5E20 A;  3SZG A;  1BJZ A;  3H92 A;  2V4J C;  1RKT A;  3R4K A;  1U6G A;  3KP7 A;  2PMZ N;  1YW8 A;  2WA0 A;  1LDD A;  3Q0V A;  1YRN A;  1MH4 A;  3OYH A;  2DFH A;  5M3M J;  3GTG J;  2KZV A;  1GXP A;  3HHG A;  3B6A A;  1RUN A;  3T1B A;  4RGS A;  3OSG A;  4RB2 C;  1U8R A;  3T8R A;  4D7N A;  2JZY A;  5E1X A;  2OF7 A;  3AL0 B;  4BQA A;  2F5V A;  1ETQ A;  1S5L C;  3B02 A;  3FXJ A;  2DA3 A;  3A0H C;  2K3F A;  2NAZ A;  1ACI A;  2VAS A;  1Y8R B;  3M8F A;  3PNT A;  1E3O C;  1HOM A;  2XAU A;  2ZXW H;  1VND A;  2K5C A;  1FBU A;  3KCC A;  2XRO A;  1MDM B;  2HDC A;  3RZD J;  1UJ8 A;  5E3M A;  4IQ4 A;  4EM2 A;  3BR0 A;  5LHI A;  4BBS J;  1XMK A;  3EPZ A;  4PSW A;  2FOW A;  4R79 A;  4BY1 J;  4XQF A;  1FYL A;  2HYG D;  1FP2 A;  3ZCO A;  4ZDO A;  2J5P A;  1RR7 A;  4YRV A;  2E35 A;  3JRC A;  3MD2 A;  4H0E A;  1YW7 A;  3KYC B;  4A3B J;  2WB1 A;  1ETK A;  1TZL A;  4YG2 F;  1HST A;  3DLA A;  4P55 A;  2JPC A;  2DU9 A;  1HKQ A;  2BOL A;  3ROU A;  4NNJ A;  2FEZ A;  1X19 A;  4L0Y B;  1VQL I;  2DTZ A;  1BR4 A;  5IPA A;  3UKG A;  4RAG A;  2HYJ A;  2OUM A;  4ITV A;  2LBF B;  4FE4 A;  1YG2 A;  3U9G A;  3H9J A;  3HSR A;  1BN5 A;  3HTU A;  3HGY A;  4DYR A;  2NRA C;  1FX7 A;  2NVY J;  1LVK A;  4B3X A;  4ZYE A;  3CO6 C;  3SEQ A;  1X3W B;  2CV1 A;  4B09 A;  2RNG A;  3E0J B;  2QF7 A;  2IT0 A;  1BOA A;  2XAG A;  2FQ3 A;  1SMY F;  3VYT B;  5JHF A;  3ELK A;  3IP4 B;  4FE7 A;  4CDG A;  2EIN H;  2L2O A;  3OL3 A;  1V3F A;  5M5Y J;  2HU9 A;  3TOB A;  3F8C A;  4PJ0 C;  2HI3 A;  5FKK A;  1YRN B;  3SYT A;  2VOD A;  5LHG A;  5L3D A;  2JWT A;  1IN6 A;  1G3T A;  2QSH X;  3EYI A;  4IRG A;  4XOT A;  2EV0 A;  3W6J B;  2EZI A;  2ZBK A;  3RYP A;  1T56 A;  2IPQ X;  4BE2 A;  2M7A A;  4P96 A;  5EG0 A;  3ZQH A;  5FRO A;  2D5V A;  2YSR A;  2ZXJ A;  4PFP A;  3WE2 A;  3CO7 C;  1U9N A;  4UUV A;  3V8L A;  3G6E I;  4PGH A;  2AXL A;  2VN2 A;  1IRX A;  3J7Z I;  2GXB A;  2TRT A;  5GPA A;  1G2H A;  5CVU A;  3TP0 A;  4KUM A;  5D5U B;  1PDN C;  4CZC A;  4KIB A;  1JUM A;  1HW1 A;  4II3 A;  5LGU A;  2WAD A;  2GA1 A;  3HXL A;  1YE9 A;  2CH0 A;  2EIJ H;  5J8F A;  1FJL A;  2GZW A;  2CFX A;  4X0G A;  2XKO A;  3DBH B;  1SAN A;  3ZPL A;  2K86 A;  2MAB A;  2R92 J;  1TW3 A;  3BPX A;  3HHH A;  4P9F A;  1WFX A;  2ADU A;  3E5X A;  3FZV A;  3HYI A;  1BA5 A;  3GZ5 A;  3HSF A;  4WK8 F;  3GEZ A;  5FO5 A;  1UHS A;  3GCM A;  2IS4 A;  2DMU A;  1ETW A;  4DBQ A;  2CQK A;  1ONV A;  1XN7 A;  3EET A;  4EJV A;  1LEB A;  2D1H A;  1F1Z A;  1IZ1 A;  2ZME A;  3E97 A;  3KP3 A;  1VF9 A;  4HPQ A;  2QA4 I;  3L2Q A;  3Q3S A;  3DEW A;  3OS1 A;  3FXM A;  3H3U A;  3HOX J;  2KIS A;  1IXC A;  1TW2 A;  1BI0 A;  2Y2Z A;  4A3G J;  1JXS A;  3ECO A;  5D4R A;  3GTQ J;  2EIK H;  2XB5 A;  3LA2 A;  1B9N A;  3WG9 A;  5LGT A;  1XMX A;  4S04 A;  4IEJ A;  3FXR A;  5F0F A;  3SJM A;  4PJJ A;  3DXJ F;  4Q47 A;  1ZHF A;  2CUJ A;  4A3E J;  3G2B A;  1T2K A;  3MAJ A;  1FY7 A;  1YTY A;  3H35 A;  4AC0 A;  4CIC A;  1FNN A;  3QYF A;  3CCS I;  2MH2 A;  3OYG A;  4CYC A;  3ZQL A;  1X3Z B;  4M72 A;  3PQJ A;  2EV5 A;  1DDN A;  4ZZD A;  2P4W A;  3RI4 A;  1RRJ A;  4OAZ A;  3OWT A;  4AID A;  2I5U A;  2XSJ C;  2DAO A;  3QOE A;  2CUZ A;  1KU7 A;  5GTH C;  4MFE A;  4DZP A;  3I5U A;  2WV1 A;  3K1M A;  2VKE A;  4KIC A;  3F22 A;  3CCM I;  5J1R A;  1AA7 A;  4M3E A;  1X1D A;  2DYS H;  3D5S C;  1JTX A;  3RPU D;  4ZYD A;  5AIP A;  4JOM A;  4ESJ A;  5FKO A;  1H8A C;  1I27 A;  1IN8 A;  3S3M A;  5EG0 B;  5KHD A;  2OBP A;  2BV6 A;  3FM3 A;  4I0B A;  4L9T A;  5D5W B;  2OCE A;  4GCV A;  3WHB A;  1VZ0 A;  2E1M C;  2HS5 A;  4LD5 A;  2VIX A;  3UNG C;  2DA5 A;  2JRM A;  5GAE J;  2K9S A;  2RV8 A;  5IP9 J;  3KLO A;  1T95 A;  2KHM A;  3ZMU A;  2A5W A;  4IPA A;  3CP2 A;  3DBL B;  4QWQ A;  2QQ9 A;  4JK1 X;  3JW4 A;  1JJ8 C;  4WXD A;  2GWR A;  3MEX A;  3JRB A;  2NOG A;  1XGS A;  3M07 A;  2E1C A;  2E60 A;  3K1N A;  1MBE A;  2CO5 A;  4V19 K;  1WJB A;  2ZME B;  3AL0 C;  2H8R A;  4GO1 A;  1VQ4 I;  4XLE A;  2FX0 A;  1R1V A;  4LLG F;  2K85 A;  4BKX A;  3OYD A;  4XOR A;  5HS8 A;  3JRA A;  3CME I;  2CGP A;  3HRS A;  3DU5 A;  3OMY A;  1W4M A;  4XIC A;  1Y0N A;  4MEX F;  1TWH J;  2VI6 A;  3FHN A;  2JPB A;  3LA3 A;  2M45 A;  1VQ7 I;  2PMU A;  4PK4 A;  3JAM Z;  4HEA 2;  5J8C A;  2N8G A;  2HXO A;  5B66 C;  2LY2 A;  1B6A A;  2V9K A;  5EEH A;  3ABU A;  3GZN B;  3WTT C;  4HDU A;  4MGR A;  2WAQ A;  1LE8 A;  3H5R A;  1ZRF A;  2BEO A;  2QCO A;  3ERM A;  3BR1 A;  3LWF A;  1K79 A;  2JVH A;  3ZQF A;  3WTZ A;  1AU7 A;  1K61 A;  4BQO A;  4I09 A;  4XLF A;  2YX4 A;  4CYC B;  3PQK A;  2X6O A;  3MZY A;  1W36 D;  2UXX A;  4XMY A;  5J1Y A;  1MJA A;  3I9V 2;  1GUU A;  1FSH A;  5K5R A;  1T0F C;  4J01 A;  3F21 A;  4D0P A;  2WY7 Q;  3BTJ A;  3ZN1 A;  1W7P D;  2OAZ A;  2E2I J;  4OIO F;  3OYF A;  4FIS A;  2V9V A;  3ZRG A;  4M9Z A;  4MIM A;  1JKR C;  2HQ5 A;  1B59 A;  1YOV B;  3CCR I;  2QSF X;  5DEQ A;  3NAR A;  1UZC A;  3HUG A;  2HZD A;  1NG7 A;  1D3Y A;  3TKY A;  4F91 B;  1Z1D A;  1IAW A;  3K9T A;  4CA0 A;  1G8X A;  2ESN A;  3GFI A;  3LMM A;  2FNA A;  2STW A;  2NNY A;  1V5G A;  2G9W A;  2CRG A;  3AKZ A;  4XM3 A;  3PM1 A;  4XR6 A;  3COA C;  1UB9 A;  4QPO A;  3C3W A;  2JUG A;  3BRO A;  1ZGJ A;  4C30 A;  5E3N A;  2Y0M A;  2R7Q A;  2LF7 A;  4XN3 A;  4IOC F;  1TWF J;  1YJW I;  2PI0 A;  3I58 A;  2HVR A;  2WTE A;  2ZCW A;  5HDK A;  2IGK A;  3H9Q A;  3H36 A;  1Z6R A;  1G6N A;  4Y7N J;  1P92 A;  9ANT A;  4P1W A;  1I3A A;  2VJ4 A;  2HDW A;  3P7N A;  2Z5U A;  3RTR A;  3LSR A;  4FET A;  4AIK A;  2W25 A;  1A35 A;  1TWC J;  1BR1 A;  2DA2 A;  2KJC A;  5CPR B;  3OS0 A;  2R7X A;  2X6W A;  3CJN A;  1O3Q A;  4Y4R A;  2VQL A;  3CD6 I;  3PO3 J;  4N9H A;  4UB6 C;  4EAT A;  5DCM A;  4OIR F;  4AWX B;  2VLA A;  2CW0 F;  4N4O B;  4H4K C;  3L2W A;  3TDZ C;  3J80 Z;  3OIQ A;  4XNF A;  2VC0 A;  1FT9 A;  5C44 J;  2LKX A;  2DPD A;  3PO2 J;  3KYL A;  5JLW A;  3G73 A;  3M1E A;  4XID A;  3OYN A;  3C1D A;  3PNV A;  4K2E A;  2BVM A;  1JE8 A;  1LE8 B;  2XAS A;  2RKH A;  5KNL A;  3E6C C;  4IO9 F;  2W84 A;  4EQQ A;  2HNH A;  2ZSH B;  2LP0 A;  1SVL A;  4AYB A;  2V1X A;  1GVJ A;  3HDD A;  2DMP A;  4N4N B;  3HG9 A;  3RZO J;  1KGS A;  3B6C A;  2LOO A;  4A0Y A;  4KIS A;  2CYY A;  2ZNY A;  1YIT I;  3KZY A;  2CUE A;  2FRH A;  2L5Q A;  1S72 I;  3L09 A;  1IDY A;  1T98 A;  2R7W A;  3FXU A;  3FWE A;  3ZQQ A;  2R5Z A;  3GTJ J;  1G4D A;  5ED4 A;  4KIF A;  3S8P A;  1VQ5 I;  1ULY A;  4IL6 C;  5IT9 Z;  2D1V A;  2HTJ A;  3HUG B;  5FLX Z;  4LIU A;  2VKD A;  2AHQ A;  1JJ6 C;  1OMI A;  3A02 A;  3KZZ A;  3LSM A;  4MFD A;  1RUO A;  3BG6 A;  2VT2 A;  4NC8 A;  3R6S A;  3RKX A;  1TL8 A;  2M0C A;  4C3H J;  4UUT A;  1OKR A;  3KIO A;  3P9C A;  1QPI A;  1GLN A;  1ZRC A;  1G3Y A;  1UMQ A;  3E5Q A;  4ENJ A;  4UV9 A;  4PZJ A;  1S3J A;  2E34 A;  1Z0X A;  5GAG J;  4UVA A;  1X2M A;  2JA7 J;  3Q0U A;  4BHC A;  3K70 D;  2MH9 A;  4J19 A;  4A0X A;  2ZJQ F;  3S3O A;  3JSP A;  3H9G A;  1NTC A;  3CJT B;  1WZ2 A;  2KLO A;  2VKV A;  1BI3 A;  1HC8 A;  3O2P E;  2X9D A;  1CQT A;  4LGW A;  1LDJ A;  3TL4 X;  1FBQ A;  1WKM A;  1JHH A;  3JTH A;  2EBI A;  3WU2 C;  4FT8 A;  1R71 A;  3GTP J;  4G7Z F;  2LKS A;  2VL8 A;  1S7E A;  1MBJ A;  3HPH A;  5FKL A;  3QYB A;  2CG4 A;  5DCM B;  3DQV C;  2Y30 A;  2VUM J;  3FMR A;  1SD7 A;  2KT0 A;  2XGE A;  3DU6 A;  4PUS A;  5F08 A;  4EV0 A;  3IH2 A;  3REO A;  5EZG A;  3J7Y J;  3GVA A;  4MQV A;  1UHM A;  3CUO A;  2QWW A;  3ERE D;  4IJA A;  3SZT A;  2PFB A;  4XKB A;  2R4G A;  5D6F A;  2LF8 A;  2KJB A;  4Y13 A;  1KU9 A;  1OCZ H;  4NBQ A;  1A5J A;  1JI8 A;  1Z91 A;  2GIV A;  2QVO A;  3ISP A;  3HGG A;  1MMN A;  4RDU A;  1BC7 C;  4HF0 A;  4NQW A;  2CQ7 A;  2ISY A;  3TOA A;  1XD7 A;  2LR8 A;  4IXA A;  1FTZ A;  4IRI A;  2AS5 F;  3GFM A;  1XGO A;  4KIG A;  2QEN A;  2CW7 A;  2X1C A;  1OLT A;  2Y48 A;  1B1B A;  3OIO A;  2A61 A;  5E3O A;  2IVM A;  1SVM A;  2ECC A;  4LK0 F;  4MHG A;  4IHX A;  2HQR A;  3BOQ A;  4RLQ A;  1LJ9 A;  3L00 A;  2K3P A;  3BDD A;  1OCT C;  1QA6 A;  3BTC A;  2R5Z B;  3LOC A;  3PFI A;  4HDV A;  5DUK A;  3HOT A;  4HBL A;  1HBX G;  3ZMS A;  3DPL C;  3F8B A;  1ZLK A;  1OR7 A;  4PCQ A;  1R9T J;  1BC8 C;  3Q9S A;  4Z6Y A;  1CF7 A;  2DK8 A;  4DOZ A;  1XDU A;  1R5H A;  2GXG A;  2L9R A;  3CCY A;  5CLS A;  1VQK I;  5KAI C;  4J00 A;  2YPR A;  4RLF A;  1MJB A;  5FGM A;  3G1M A;  1Y8Q B;  3R0J A;  3R0A A;  5J6X A;  2P5V A;  3VYR B;  3RSN A;  1GHC A;  1ZAR A;  2E1O A;  3EYY A;  3FIS A;  2VXZ A;  2CFO A;  1MMS A;  3W2V A;  2A69 F;  3BTL A;  4E7K A;  2ISZ A;  3ABL H;  1XTA A;  1XSV A;  3ASO H;  3ZXS A;  2K40 A;  2W48 A;  2K9M A;  1FTT A;  1HSJ A;  4YFK F;  1Y0U A;  2Z3Y A;  5E1W A;  3DFG A;  5FLM J;  2D2W A;  2RNJ A;  1IJW C;  3CC7 I;  1FMW A;  3ABM H;  3QPT A;  2F4M B;  5FFZ A;  3VSK A;  2RDP A;  4MLO A;  5A2Q K;  1HLV A;  4MTD A;  3CJQ B;  2AQE A;  2JTV A;  2MA3 A;  3K4C A;  2VOP A;  4CXF A;  5HS7 A;  1QBJ A;  1TQP A;  4FQG A;  4IKF A;  3ML6 A;  3W2A A;  4BDZ A;  3CDH A;  1IF1 A;  2DFE A;  4L5E A;  1F5T A;  4HRI A;  3QPL A;  3P9I A;  4RM3 A;  3G71 I;  3G3Z A;  3OL4 A;  2FE3 A;  3GZ6 A;  5DV5 A;  4A3C J;  4CH7 A;  2QKM B;  2NS0 A;  3D5R C;  1IN4 A;  4Q5S F;  2VC1 A;  1MND A;  1L0O C;  1TLH B;  5L3F A;  2HOA A;  4HF2 A;  2WB1 N;  5B3S H;  5JHU A;  4RAZ A;  5ICG A;  3RQ4 A;  4M73 A;  5JVG F;  2CW8 A;  2HOE A;  4BJT A;  4NQW B;  2ME6 A;  2RRE A;  2PJR A;  4C2M J;  1XCB A;  1K78 A;  5LRS A;  2L7K A;  1HCR A;  1EH7 A;  4F55 A;  1O3R A;  1K6O A;  1AOY A;  2BXY A;  1WI9 A;  1D8K A;  1C0W A;  2CS3 A;  3BR6 A;  3FMS A;  3LAP A;  2E1N A;  1LPQ A;  3IAS 2;  5CJ9 A;  3NWS A;  3R61 A;  3O3K A;  1WI3 A;  2R0Q C;  1SFU A;  1BM9 A;  3RQI A;  3CMY A;  1Y56 A;  1U5T B;  1IGN A;  2P7V B;  1LDK B;  3I56 I;  1JKQ C;  2V7F A;  1BOB A;  1D8J A;  2X6Y A;  1CF7 B;  2DA6 A;  1YX3 A;  4UHT A;  4U0V A;  2E7W A;  1RPW A;  4GFB A;  3ABK H;  2XDV A;  4HV5 A;  3TDU C;  2H94 A;  2DOF A;  2O03 A;  4M3D A;  4UNO A;  2FUG 2;  3A1Y A;  2OZU A;  2XKP A;  4OWR B;  3HIF A;  2B9S A;  2BXZ A;  5DYM A;  2QQB A;  4IHV A;  2EPF A;  4AVP A;  3RPU A;  3QP6 A;  3KZI C;  3TQN A;  3QPH A;  3SZP A;  3KP2 A;  2IA2 A;  3C2B A;  1X4O A;  2IEK A;  4KT6 A;  4BUP A;  3TED A;  5LD2 C;  3BCA A;  1SVO A;  4ENK A;  1R49 A;  4F3Q A; 
#chains in the Genus database with same CATH homology
 1KYZ A;  4WCG A;  4EJT A;  2HWV A;  1B4A A;  1OYI A;  3IL2 A;  2P5K A;  3Q5F A;  4BYY A;  5HVQ C;  2MC3 A;  1S8N A;  3HTS B;  3I71 A;  2F5E A;  1QNT A;  2K4B A;  1Z05 A;  2QUF A;  4G9Y A;  3C18 A;  3WTY C;  2QLZ A;  2R3S A;  5JR3 A;  4EM1 A;  1SD4 A;  4IVN A;  4I02 A;  5FFX A;  2LSO A;  1F9N A;  3E6D A;  3T8T A;  2XVC A;  2JSC A;  4LMY A;  4EJU A;  2GAU A;  3I59 A;  1RZ4 A;  1K78 B;  3I54 A;  4N0B A;  1LEA A;  4MEY F;  1SFE A;  1TQI A;  4CO8 A;  3RYR A;  5CYV A;  1IUY A;  3QRF F;  3LST A;  4PGG A;  3VEP A;  1KQ9 A;  1G3W A;  1FBS A;  4OIP F;  2ACJ A;  2EA2 A;  5D5X B;  3I0T A;  4ON0 A;  1P4X A;  2FBK A;  2L4A A;  2C6Y A;  4G8X A;  4IRH A;  5K5Q A;  4RAY A;  4M71 A;  2FSW A;  2KRF A;  1K7A A;  1J7K A;  1Z9C A;  2HTS A;  5HDG A;  1TTY A;  1DP7 P;  2A6H F;  2Z9O A;  3OV8 A;  4GYI A;  4IHT A;  4KA4 A;  2VBY A;  1W7P A;  2ETH A;  3N4M A;  2RQP A;  4HQM A;  4KN7 X;  2XAF A;  2EV6 A;  2BGC A;  1ZRD A;  5FD5 A;  4YII A;  2H6B A;  3KLN A;  5BS6 A;  4CGZ A;  2HFH A;  3FM5 A;  2EFW A;  5H6R A;  1XDS A;  1I6X A;  2EJR A;  4A6E A;  2RGV A;  1XGN A;  2F5C A;  4G6Q A;  3WTX C;  2DQR A;  1FWZ A;  4DQ2 A;  3BP8 A;  5F6F A;  3F6O A;  1J5Y A;  3D5L A;  1RI7 A;  4P9U A;  1FYK A;  3I59 B;  4M74 A;  5F64 A;  4UVC A;  4OMZ A;  4UXN A;  2OU2 A;  2CSO A;  4CHU A;  3QOP A;  2HGC A;  5TRD A;  2OZ6 A;  3E3V A;  2VOO A;  3MQ0 A;  4EGZ A;  1P4A A;  2F5F A;  1NHA A;  4A5N A;  1BIA A;  5LEK A;  2FML A;  3M7G A;  3GXO A;  1H0M A;  3E6M A;  3MZH A;  1EH6 A;  3GW2 A;  4B8X A;  3NEU A;  4HAM A;  4AIJ A;  1W7P B;  2GA2 A;  2A3S A;  2V6C A;  3D0S A;  4ZZL A;  5HLH A;  2DT5 A;  5DUI A;  1MD0 A;  2K7L A;  2XV4 S;  1S29 A;  5E1Z B;  2W85 A;  2HZT A;  1ZYR F;  4HYE A;  4L9V A;  3GO5 A;  4KMU X;  1QGP A;  2FNP A;  3TGN A;  4O6J A;  3JTG A;  2L4M A;  1I5Z A;  2EA4 A;  4R8H A;  4LB6 B;  3HRT A;  2DW4 A;  5DD8 A;  3U2R A;  1WQ2 A;  2HKX A;  3IC7 A;  3J81 K;  1V4R A;  5IT3 A;  2XIG A;  2XRN A;  3BPV A;  5JFR A;  3L9F A;  4HZF A;  1QQI A;  1USS A;  1E2X A;  2D45 A;  5KVR A;  5DD4 A;  4Z2Y A;  1REP C;  3QU6 A;  4S05 A;  1OYW A;  2O61 A;  1KA8 A;  3B73 A;  3GFJ A;  5BQT A;  2L3D A;  5LBQ A;  4HA8 A;  2VON A;  2DTR A;  2ESH A;  3I4P A;  3V8K A;  2PN6 A;  3K69 A;  2P8T A;  2Q0O A;  3LFK A;  2EK5 A;  4XSZ F;  4UV8 A;  5ILU A;  4P5O A;  1XSX A;  3WGI A;  5HOO A;  3NQO A;  2YR2 A;  2PBI A;  3T5X A;  2IJL A;  4HLY A;  4G7O F;  4A0Z A;  4Y15 A;  2P6T A;  4YIF A;  4LB5 A;  1R7J A;  4LFU A;  2J5O A;  2LDU A;  3WOD F;  4MQ9 F;  5HDN A;  5HLG A;  2UWM A;  5EEG A;  3U1D A;  5ICF A;  1FLI A;  2NYX A;  1XSD A;  2VBW A;  3P9K A;  3F8M A;  2XUB A;  3E6B A;  2JRT A;  1MJ9 A;  4MNU A;  2M1B A;  1J59 A;  3MWM A;  1XGM A;  4NHJ A;  2EFO A;  4L0Z B;  1J0R A;  1FYM A;  2O6G E;  1J75 A;  2XHK A;  3WTV C;  3K1P A;  2R7D A;  5A2Q Z;  1WRJ A;  2PQ8 A;  2H09 A;  2KIU A;  4I0A A;  2R7F A;  1UST A;  4A5M A;  2O8X A;  4RGX A;  5E18 F;  1ODD A;  1E17 A;  1L3L A;  1HKS A;  2DBB A;  3DPT A;  5L3B A;  2IP2 A;  1KQ0 A;  4BXU A;  1IXS B;  4ESB A;  1XCV A;  2UZK A;  3F3X A;  1PUE E;  3VOD A;  3N97 A;  3EDP A;  2V79 A;  2L01 A;  3KEQ A;  1U2W A;  2Q8K A;  1H9T A;  4RB3 C;  4ETS A;  1QZY A;  3DV8 A;  2W57 A;  2IRF G;  4GGG A;  4XRF A;  1J9I A;  2Z99 A;  1SFX A;  4Y17 A;  2OA4 A;  4M6Y A;  5DCF A;  3ULQ B;  2COM A;  2UXN A;  4OOI A;  5D6E A;  3WU1 B;  1ZN2 A;  2FBH A;  1DPR A;  5E17 F;  3FHZ A;  4PDK A;  3I64 A;  2VE8 A;  1MZB A;  3V7R A;  1ZLJ A;  1UCR A;  2H6C A;  1U5T A;  4KT5 C;  1FZP B;  3BWG A;  4EJW A;  2EFP A;  1EH8 A;  1B9M A;  2MLG A;  4HX8 A;  3BZ6 A;  3O6B B;  3QAH A;  5CVV A;  1BI2 A;  1S7O A;  1EV7 A;  1RIO H;  4U7D A;  4EM0 B;  2HR3 A;  1JGS A;  4ENN A;  4XLN F;  3ABT A;  4U0W A;  1LVA A;  3TO9 A;  2FBI A;  3WE3 A;  2YX7 A;  1A04 A;  3GWZ A;  4QLC U;  4LLL A;  3QU3 A;  4AD9 A;  4KNY A;  1ZAO A;  2RC4 A;  3SQN A;  4IF4 A;  1R00 A;  3VOE A;  1D5V A;  6PAX A;  5FLX K;  3T0Y A;  4A6D A;  1YLF A;  3E5U A;  3M8E A;  3DF8 A;  1KU2 A;  1YW9 A;  1SD6 A;  3IKT A;  1W5T A;  3JSO A;  1O57 A;  4BNC A;  4IHS A;  3LQR A;  2DLL A;  1KYW A;  2P7C B;  1G3S A;  3K2Z A;  5ERI A;  2ZJ2 A;  1STZ A;  1YFH A;  1IRF A;  4G6D A;  3MFK A;  1SMT A;  5E8G A;  1TBX A;  2PLY A;  2XAJ A;  4LK1 F;  4WXH A;  1P2F A;  3ZMV A;  5BPI A;  3KEO A;  2VBZ A;  3AAF A;  5D5V B;  1PP7 U;  2EB7 A;  1O3T A;  1TNT A;  4KN4 X;  2O0Y A;  4RGU A;  2DK5 A;  4GXO A;  2KKO A;  3DEU A;  2W24 A;  5AIQ A;  3BJ6 A;  1Q1H A;  4OU0 A;  3V8J A;  2QBY B;  3S2W A;  3EQL F;  2FXA A;  3IKV A;  4A12 A;  4WWC A;  3LA7 A;  2VE9 A;  1J2X A;  3SXY A;  3WGH A;  2F2E A;  3QP5 A;  4CYD A;  3EUH A;  3RPQ A;  1R1U A;  2STT A;  3W6K B;  1AWC A;  3NRV A;  2TDX A;  2PG4 A;  1JHF A;  1YYV A;  4F7Z A;  5BMZ A;  2Y75 A;  2P5L C;  1S7A A;  2L02 A;  5CVI A;  3WTS C;  1ZG5 A;  5BPD A;  1OPC A;  2WC2 A;  4WX9 A;  3IWF A;  3RJP A;  3GYH X;  3BY6 A;  5E8I A;  5LEJ A;  1UFM A;  1HW5 A;  2XAH A;  1QZZ A;  4XSX F;  4EMS A;  2VBX A;  1DUX C;  2M8E A;  1WSU A;  1P4W A;  2MLK A;  1YS6 A;  1ZG3 A;  3ECH A;  3J81 Z;  2A68 F;  4DNC A;  1OYY A;  3IRR A;  5ILV A;  2H27 A;  3FXQ A;  2IA0 A;  5ICE A;  3ZN0 A;  2EWN A;  2QM3 A;  5ICC A;  1Z6T A;  3KET A;  3CUQ A;  3FMQ A;  5F1R A;  4NB5 A;  3GX4 X;  2LNB A;  5FB2 A;  1R22 A;  1I1G A;  2G7U A;  2E7X A;  1U78 A;  4RGR A;  3FX3 A;  2Z33 A;  3V7C A;  1O3S A;  3KE2 A;  4ENM A;  1ZRE A;  4HX7 A;  4HW0 A;  2DPU A;  1QO0 D;  2FU4 A;  5KK1 A;  4OIQ F;  2M87 A;  1TQM A;  1VTN C;  2F5D A;  3H3Z A;  4L5I A;  5L3G A;  3FF5 A;  3HRM A;  2K4J A;  4LG0 A;  1T6S A;  1BIB A;  5TJJ A;  1BBY A;  3IHU A;  4RS8 A;  4I98 B;  3F8F A;  2WV0 A;  4HQE A;  5HLI A;  4MTE A;  3ZQ7 A;  4U0Y A;  4FHT A;  3WTW C;  3HSE A;  1R58 A;  1U5T C;  4UVB A;  1LQ1 A;  4BHP A;  5H20 A;  3IRQ A;  3MCZ A;  4WXC A;  2FF4 A;  1WWX A;  2ELH A;  3IWZ A;  1GXQ A;  2KIF A;  1YO5 C;  1HW2 A;  4FX4 A;  3CUQ B;  4G94 A;  2M5W A;  4OIN F;  3ZP5 A;  4HLX A;  2ZKZ A;  5ILS A;  5D8K B;  3F8N A;  3I53 A;  2M30 A;  4KDP A;  4ZYG A;  2NNN A;  1R5G A;  2K27 A;  4BHB A;  3F23 A;  2L54 A;  2BYV E;  3KFW X;  1O7F A;  4KYW A;  3OOP A;  1HXD A;  3WGG A;  2O3F A;  5CVJ A;  2IA1 A;  5L3E A;  2OQR A;  3RDI A;  4FX0 A;  1FOK A;  4LG0 B;  1IW7 F;  3GUD A;  1MKM A;  4A2U A;  3GFL A;  4LJZ F;  4ASN A;  3R60 A;  5LGN A;  4G7H F;  2Q2E A;  2MBF A;  4R1H A;  4M9X A;  2G7H A;  1LNW A;  4M9S A;  1Z7U A;  2RVC A;  2IW5 A;  3TO7 A;  2X4H A;  1TNS A;  3K0L A;  3GF2 A;  2ZNZ A;  4LLN A;  1MGT A;  2HKO A;  5CVR A;  3BJO A;  5H6Q A;  2HEO A;  2GQQ A;  1ON2 A;  2CWE A;  2A6E F;  3BJA A;  2PJP A;  2BE5 F;  2B0L A;  2VT3 A;  1T38 A;  2V1D A;  4HV6 A;  4GYG A;  1IN7 A;  4L18 B;  1ZGA A;  4Q4Z F;  1ZG1 A;  3DKW A;  1R23 A;  3RKY A;  3LQQ A;  2LKP A;  4JBA A;  2KIM A;  1T39 A;  2JT1 A;  4WF2 A;  3ZMZ A;  2ZO4 A;  3CTA A;  2DI3 A;  4AIH A;  1FC3 A;  4L9N A;  3GLX A;  3DP7 A;  2FOK A;  2DO7 A;  4N9I A;  3J7A O;  5FD6 A;  4JQF A;  1I1S A;  4XBF A;  3V7S A;  2QQA A;  3WU0 A;  1QPM A;  2DQL A;  3Q9V A;  2V1U A;  3JAM K;  5D8L B;  4KMF A;  2QYO A;  3SHF A;  2RN7 A;  2FA5 A;  4KFC A;  1KU3 A;  3TO6 A;  4ZYH A;  1S6L A;  2XAQ A;  2X0L A;  1IRG A;  1P6R A;  5K1Y A;  5LRR A;  1H9G A;  1SD5 A;  1LB2 A;  2HYF A;  5LLQ A;  3RKW A;  1F4K A;  2OD5 A;  1PP8 F;  4ZH4 F;  2EFN A;  2PEX A;  4L5J A;  1ZH5 A;  2ZFW A;  1YIO A;  4L9J A;  5HS9 A;  1FPQ A;  2XGX A;  2A07 F;  3ZMT A;  1YS7 A;  3SFZ A;  3KP6 A;  4BH9 A;  4E70 A;  4BAY A;  4TV7 A;  4OMY A;  4I01 A;  4EGY A;  4HX4 A;  3CLO A;  4U88 A;  4I7H A;  2OQG A;  1FSE A;  3HOS A;  1YQA A;  3VB2 A;  1DPU A;  3RIR A;  3CUQ C;  3ZMD A;  2DFI A;  1BI1 A;  1CGP A;  3F6V A;  4YFN F;  4Q48 A;  1XB4 A;  1O7L A;  4EVI A;  1SAX A;  3C7J A;  1U3E M;  2A5Y B;  4M6X A;  1W5S A;  4CZZ A;  3J80 K;  2FMY A;  4U7B A;  4EJO A;  2YU3 A;  1IXR C;  3LAJ A;  3VFZ A;  4RB0 A;  1UHW A;  5D4S A;  1MDM A;  1IN5 A;  5AON A;  4O3M A;  2K02 A;  2QZ8 A;  4HOB A;  1R36 A;  1RNL A;  3M9A A;  2QBY A;  2MD5 A;  5L3C A;  4YFX F;  2EFQ A;  1XMA A;  2PMH A;  1X3U A;  4ESF A;  1HKT A;  2P6S A;  4O5V A;  5IT9 K;  3KP4 A;  1KQ8 A;  3L7W A;  4RB1 A;  1BJA A;  4HF1 A;  1T0F A;  4I2O A;  5LHH A;  3WTU C;  1FP1 D;  1R1T A;  2BBY A;  4XLP F;  3KP5 A;  3HRU A;  5K5O A;  3F72 A;  3V4G A;  5BOX A;  1ON1 A;  2WWY A;  5DDG A;  1HQC A;  5JVT A;  3L2C A;  5JI6 A;  2HQN A;  5E20 A;  3H92 A;  3R4K A;  1U6G A;  3KP7 A;  1YW8 A;  1LDD A;  1GXP A;  3HHG A;  1RUN A;  3T1B A;  4RGS A;  4RB2 C;  1U8R A;  3T8R A;  2JZY A;  5E1X A;  4BQA A;  3B02 A;  2NAZ A;  3M8F A;  1FBU A;  3KCC A;  2XRO A;  1MDM B;  2HDC A;  4EM2 A;  5LHI A;  1XMK A;  4R79 A;  1FYL A;  2HYG D;  1FP2 A;  2J5P A;  4H0E A;  1YW7 A;  4YG2 F;  1HST A;  4P55 A;  2JPC A;  2DU9 A;  1HKQ A;  3ROU A;  2FEZ A;  4L0Y B;  1YG2 A;  3U9G A;  3HSR A;  1BN5 A;  3HTU A;  2NRA C;  1FX7 A;  4ZYE A;  3CO6 C;  4B09 A;  2IT0 A;  1BOA A;  2XAG A;  2FQ3 A;  1SMY F;  3ELK A;  4CDG A;  1V3F A;  3TOB A;  3F8C A;  2VOD A;  5LHG A;  5L3D A;  1IN6 A;  1G3T A;  3EYI A;  4IRG A;  2EV0 A;  3W6J B;  2ZBK A;  3RYP A;  2IPQ X;  4P96 A;  2YSR A;  2ZXJ A;  3WE2 A;  3CO7 C;  4UUV A;  3V8L A;  4PGH A;  2AXL A;  2VN2 A;  2GXB A;  5CVU A;  4KUM A;  5D5U B;  1PDN C;  4KIB A;  1HW1 A;  5LGU A;  2GA1 A;  5J8F A;  2GZW A;  2CFX A;  2XKO A;  3ZPL A;  2K86 A;  1TW3 A;  3BPX A;  3HHH A;  4P9F A;  2ADU A;  3E5X A;  3FZV A;  3HYI A;  3GZ5 A;  3HSF A;  4WK8 F;  3GEZ A;  5FO5 A;  2CQK A;  1ONV A;  1XN7 A;  3EET A;  4EJV A;  1LEB A;  2D1H A;  1F1Z A;  1IZ1 A;  2ZME A;  3E97 A;  3KP3 A;  3H3U A;  1IXC A;  1TW2 A;  1BI0 A;  1JXS A;  3ECO A;  5D4R A;  3LA2 A;  1B9N A;  3WG9 A;  5LGT A;  4S04 A;  3FXR A;  3DXJ F;  4Q47 A;  1ZHF A;  1T2K A;  3MAJ A;  1FY7 A;  1YTY A;  4CIC A;  1FNN A;  2MH2 A;  1DDN A;  4M72 A;  3PQJ A;  2EV5 A;  4ZZD A;  2P4W A;  3RI4 A;  2DAO A;  1KU7 A;  3I5U A;  3F22 A;  4KIC A;  3K1M A;  4ZYD A;  5AIP A;  4ESJ A;  1I27 A;  1IN8 A;  2OBP A;  2BV6 A;  3FM3 A;  4I0B A;  4L9T A;  5D5W B;  4GCV A;  2HS5 A;  4LD5 A;  2RV8 A;  3KLO A;  3ZMU A;  4IPA A;  4QWQ A;  2QQ9 A;  4JK1 X;  3JW4 A;  4WXD A;  2GWR A;  3MEX A;  1XGS A;  2E1C A;  3K1N A;  2CO5 A;  2ZME B;  4GO1 A;  1R1V A;  4LLG F;  5HS8 A;  2CGP A;  3HRS A;  1W4M A;  4MEX F;  2JPB A;  3LA3 A;  2M45 A;  2PMU A;  3JAM Z;  5J8C A;  1B6A A;  5EEH A;  3ABU A;  3WTT C;  4HDU A;  4MGR A;  1ZRF A;  2BEO A;  3LWF A;  1K79 A;  3WTZ A;  4I09 A;  2YX4 A;  3PQK A;  3MZY A;  2UXX A;  1MJA A;  1FSH A;  5K5R A;  3F21 A;  4D0P A;  3ZN1 A;  1W7P D;  2OAZ A;  4OIO F;  2V9V A;  4M9Z A;  1B59 A;  5DEQ A;  3HUG A;  1D3Y A;  3TKY A;  1Z1D A;  1IAW A;  3K9T A;  2ESN A;  3GFI A;  2STW A;  2FNA A;  2NNY A;  2G9W A;  3COA C;  1UB9 A;  3C3W A;  3BRO A;  1ZGJ A;  2Y0M A;  2LF7 A;  2PI0 A;  3I58 A;  2WTE A;  2ZCW A;  5HDK A;  1Z6R A;  1G6N A;  1P92 A;  3P7N A;  2Z5U A;  3RTR A;  4AIK A;  2W25 A;  2KJC A;  3CJN A;  1O3Q A;  4N9H A;  5DCM A;  4OIR F;  4AWX B;  2CW0 F;  3TDZ C;  3J80 Z;  2VC0 A;  1FT9 A;  2DPD A;  3G73 A;  3M1E A;  3C1D A;  4K2E A;  1JE8 A;  2XAS A;  2RKH A;  3E6C C;  2W84 A;  4EQQ A;  2V1X A;  1GVJ A;  1KGS A;  4A0Y A;  2CYY A;  2ZNY A;  3KZY A;  2FRH A;  3L09 A;  1T98 A;  3FXU A;  3FWE A;  1G4D A;  5ED4 A;  4KIF A;  1ULY A;  5IT9 Z;  2D1V A;  2HTJ A;  5FLX Z;  1OMI A;  3KZZ A;  1RUO A;  2VT2 A;  3R6S A;  3RKX A;  1OKR A;  3P9C A;  1ZRC A;  1G3Y A;  3E5Q A;  4ENJ A;  4UV9 A;  4PZJ A;  1S3J A;  4UVA A;  4BHC A;  2MH9 A;  4A0X A;  3JSP A;  1BI3 A;  3O2P E;  4LGW A;  1LDJ A;  1FBQ A;  1WKM A;  1JHH A;  3JTH A;  4FT8 A;  4G7Z F;  2CG4 A;  5DCM B;  3DQV C;  3FMR A;  1SD7 A;  4EV0 A;  3REO A;  3GVA A;  4MQV A;  1UHM A;  3CUO A;  2QWW A;  3ERE D;  4IJA A;  3SZT A;  2PFB A;  5D6F A;  4Y13 A;  2LF8 A;  2KJB A;  1KU9 A;  1Z91 A;  2GIV A;  2QVO A;  3ISP A;  1BC7 C;  4HF0 A;  4NQW A;  2ISY A;  3TOA A;  1XD7 A;  4IXA A;  4IRI A;  2AS5 F;  3GFM A;  1XGO A;  4KIG A;  2QEN A;  2Y48 A;  1B1B A;  2A61 A;  2IVM A;  4LK0 F;  4MHG A;  2HQR A;  3BOQ A;  1LJ9 A;  3L00 A;  3BDD A;  3PFI A;  4HDV A;  5DUK A;  3HOT A;  4HBL A;  1HBX G;  3ZMS A;  3DPL C;  3F8B A;  1ZLK A;  1OR7 A;  4PCQ A;  1BC8 C;  3Q9S A;  1CF7 A;  2DK8 A;  1XDU A;  1R5H A;  2GXG A;  5CLS A;  2YPR A;  1MJB A;  5FGM A;  3R0J A;  3R0A A;  5J6X A;  2P5V A;  1GHC A;  1ZAR A;  3EYY A;  2VXZ A;  2A69 F;  2ISZ A;  1XSV A;  1HSJ A;  4YFK F;  1Y0U A;  2Z3Y A;  5E1W A;  3DFG A;  2D2W A;  2RNJ A;  3QPT A;  5FFZ A;  2RDP A;  5A2Q K;  4MTD A;  2JTV A;  2MA3 A;  2VOP A;  4CXF A;  5HS7 A;  1QBJ A;  1TQP A;  3ML6 A;  3CDH A;  1IF1 A;  1F5T A;  3P9I A;  3G3Z A;  2FE3 A;  3GZ6 A;  5DV5 A;  2NS0 A;  1IN4 A;  4Q5S F;  2VC1 A;  1L0O C;  1TLH B;  5L3F A;  4HF2 A;  5JHU A;  4RAZ A;  5ICG A;  4M73 A;  2HOE A;  1XCB A;  1K78 A;  5LRS A;  1EH7 A;  1O3R A;  1K6O A;  1AOY A;  1WI9 A;  1D8K A;  1C0W A;  3FMS A;  3LAP A;  2E1N A;  5CJ9 A;  3R61 A;  3O3K A;  1SFU A;  1BM9 A;  1U5T B;  2P7V B;  1LDK B;  1D8J A;  1CF7 B;  4UHT A;  4U0V A;  2E7W A;  4HV5 A;  3TDU C;  2H94 A;  2O03 A;  4UNO A;  2OZU A;  2XKP A;  3HIF A;  5DYM A;  2QQB A;  4AVP A;  3RPU A;  3QP6 A;  3TQN A;  3QPH A;  3SZP A;  3KP2 A;  2IA2 A;  4ENK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...