1R24A

Fab from murine igg3 kappa
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
206
structure length
206
Chain Sequence
b'DIQMTQITSSLSVSLGDRVIISCRASQDIGNFLNWYQQKPDGSLKLLIYYTSRLQSGVPSRFSGWGSGTDYSLTISNLEEEDIATFFCQQGKTLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IGG3-KAPPA ANTIBODY (LIGHT CHAIN))
publication title The role of homophilic binding in anti-tumor antibody R24 recognition of molecular surfaces. Demonstration of an intermolecular beta-sheet interaction between vh domains.
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 206
sequence length 206
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r24A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r24A01
5FUZH 5C6PB 4I3SH 4L8CB 1MFEH 4XPAH 2OM5A 5HVHC 1RAMA 2LAAA 2VKWA 1ZHLA 2IAND 3MNVA 3C5ZA 3GMMA 1I1AB 4YBHA 1BOGA 4XCEA 4KKBC 2X4NB 4WVRA 3OAZH 3IDMB 5TF0A 3VFRB 2RAMA 4OF7A 3VFPA 4AIZB 2O26U 3QQ9C 2QQNL 2CLRA 2J4WH 1PYWB 4HKXA 2PNDA 4K9EL 1Z9MA 4X6DB 3E6HB 5F1KC 2VDLL 2P5EE 3TP4A 2KPNA 4MWFB 4R8WL 1H3PL 4LRIA 1WAAA 3UTTB 3MRRA 3N1QC 2M2DA 4Y5YC 4EN3C 2HT2D 1T7VA 1PBYA 4KRPD 4NCDA 3O4LE 4NQUA 4ODSL 5DSCB 4ONHB 3T04D 5IJVA 1KTDA 2VLME 1TNMA 2HVJB 5IF0B 1ZT1B 4U1SB 4QLRA 2R39A 4FABH 3BJ91 2GFBB 3F12A 2GTWA 4ZAKB 3VXNB 2NY5C 3KXFD 1ZLWH 4JRYA 2VXUH 4FQQB 3DETD 1BBJB 3TIDB 1XH3B 3P4NB 2HRLA 1RIUL 4IRSC 4KROD 4CVXA 3I6GA 2AXFA 3O2DL 1IAKB 1TJIL 2FYYA 4PJIB 3IDIB 1WEJH 4PJXB 3T4YB 2KZ1B 2F74B 2GCYA 4HIHB 4MQ7A 3O9WA 1FSKC 4KY1L 5KVGL 1V05A 5FO9B 3BP7A 3DYOA 4WW1B 2H8PB 3F58H 3KHQA 4WWKA 4KI5F 2ICWJ 5I1HH 4OD3H 3HLAB 3F65A 1A5FL 3HAEA 2I9LB 3HMXH 2P7TA 5BOPA 5I1EH 4YFEA 3QG6A 3SJVA 1Y18B 4GG6A 2AVGA 3QUXB 1Z2KA 3RNQB 3MRBB 1ZHBA 1XCQB 2DL9A 3NCYP 4UQ2B 1CICB 5KSBB 5JW5A 4LAQL 3EYFA 1T66D 3H9SD 3PG2A 1RFDH 3ALWA 1L9MA 3DURA 1A1MA 3HN3A 5CJQL 1EHLH 4NN7B 2DRUA 5HD8D 2UZIH 1PGRB 3C8HA 3VXSE 3IDXH 3WFZA 3H2WA 4HLJA 2P24A 5H2BB 4W68A 5I66B 5D1ZC 4PRNA 4WFGD 1C5CH 3QFJE 4U6TA 4PGZA 1HQ4B 5IOPB 3GM8A 2ICWI 4O9HL 5GGTA 1EGJL 3WIHA 1S7RA 4NHUA 2BHUA 1QLRA 3GRWA 4LKXA 2FJFA 5GRUH 4J3VA 3FQNB 1GOGA 5MP6H 2IQ9L 2DKUA 1CZ8L 3X13A 4R6UA 1BM3H 3P11H 2WP3T 4RISL 3DX7B 4KKBD 1BVLA 1FO0A 3PL6B 5D7IB 2D03H 4K7PY 3B5HA 1IGYA 1DN0A 2IG2H 5SX4H 2AJZA 3R1GH 1J18A 1K5NA 4MXQC 4GKZB 1OF2A 3NN8B 4YGVA 1A6VL 4YAQB 3TVMA 3WFCL 4M7LT 4HIIB 4OZ4A 4XP1H 4W6WB 4ZXBA 3RWEB 1A3RH 2I5YH 4OFVA 4PRDA 1DR9A 2G2RB 5E9DA 4K55A 5EN2B 2P49B 2WBJB 4BZYA 3QA3B 4ZS6D 1BFVH 4ZTOH 5C0BE 5BS0B 2FHFA 4MA7L 4D94A 1X3DA 4FFZL 4LHUB 4OJFH 4WUUE 1YEGL 3UTQA 1LO5A 3PHOA 1S3KL 4FN0A 4QYOA 5D6CA 3DUSA 3ZYOA 4BZ2H 4JFED 4I4WB 2NXYC 2QL1A 1T2QH 1S7WA 3AB0B 5CCKH 3BQUA 1KC5H 3ARBA 4S1RL 2IFGA 2KZWA 5CEZL 1DDHA 1MAMH 5GS1B 1ACYL 1CXIA 4KDTA 4QTIL 4M7KL 4ZG1A 1AJ7H 1AI1H 3GSUA 3EHBC 1FNGA 4X5LA 2I60L 3EYSH 5FOJA 3IGAB 3N85L 1P4LA 4BH8A 1BLNA 5C0DB 4QY8B 1UQSA 5D71L 3V7AG 4ELMA 3WKNA 4GS7B 3U48A 1FRGH 5HYJD 3CFCL 4E41A 4PV8B 1PG7H 4XZUB 1RZ8B 3EFFB 3BRDA 3UJIL 1TVHB 3HB3C 4C55A 1C08A 4JFFB 4B7IA 3LQAH 1S7TB 5KAQG 4PTTA 4RWYH 1ZA3A 1RUAH 3C6LC 4HC1H 4DEPC 5FGCB 2FECI 4OM1L 3Q6FA 1KXVC 2Z35B 4MJ5B 1U42A 2HLAA 4J4PA 3AS1A 1YNLH 1XF2A 3TNMB 2DM2A 1UH3A 4AQ1B 3MV8E 2NTSP 2Z91A 3CC5A 3HI5H 4Z7NF 4P9ML 3IDJA 1I3RA 4JKPL 1NBYA 5AWNH 4MAYA 3LKRA 1JNNL 4JO1L 1E4JA 1D3CA 1IC1A 3HRPA 1UJ3C 2OQJA 1N8ZB 4UBDC 2GJZB 4YBQD 3QB7C 3OGCA 4PRHB 2ARJQ 4A6YH 4LCWB 3NH7H 4ZFGH 4ZSOA 2Z92A 5GGSY 5AG9A 3CX5J 4H88L 2XTJB 2YMXL 5D72L 3OR6A 4FQJL 3ABZA 4XCEB 5CEYB 2G5BB 5FYLD 2BVOB 3FQRA 3DRTA 2JCCA 3D0VB 3PDDA 1R3IH 3RDTD 1XR8A 4RCAA 1PSKL 2Z4QA 1YJDH 4MXQD 4GBXB 3UC0H 2CLRB 2E7LC 4JEGB 3V79C 2CK0L 3VRIA 4H8WH 5T3XL 5J8OA 1GVIA 3ES6A 3H0TB 2YN3A 1RZJL 2DLFH 1ZE3C 4L3EA 1JK8A 3S88L 4MLIA 3DWTA 5KW9L 3MRRB 5I30H 3FT3B 5D2NE 2J8UF 3WLBA 1G6RA 3O8XA 3F62A 5C0CB 3WNPA 2X70A 4BH7A 1MHEA 4M61B 5L2KB 5IJVB 3HPLB 3IU4H 5T3ZD 4G43B 2F54E 3BUTA 3U4BH 5MEOB 1SJVA 3HUJE 1K6QL 1NGQL 2D2OA 4TTDC 1HINH 3D3VE 3T0VA 4XP5L 5D5ME 4LARL 4NWTH 2BMKA 4K3JL 3VFNA 2K3TA 4R26L 2CQVA 3P9LA 5BZWA 1IGIL 1VEPA 4OFDA 4MNGA 3KPPA 2AXFB 5I15H 5FECB 4LSVH 2FYYB 4GAJL 1TZGL 1TITA 3EHBD 4MQ7B 3O9WB 3ULSA 4DN4H 3D39A 2B7DT 3UBXB 5DVLA 3QDJE 3NACL 1OT2A 5KVDL 1FGVH 3UDWA 3E3QC 5BCAA 4HCRH 3TCLB 1XCTA 4M93B 1KJMB 4TNWK 1MF2L 4LSUH 2P7TB 3HB3D 3UTSA 4OCYL 5FA3A 3MNWA 2Z31B 4AEFA 3VW3H 3SJVB 1XGYL 4P2CG 5A2FA 3SKJH 3W0WB 1HXMB 5M94B 1ZHBB 3NAAH 5EOCJ 2XQYG 5HDBF 3CU1A 2A6KB 1MFNA 1S7QA 1JYVA 1QKZH 2BCKB 2V5YA 3S36X 4RX4A 4Y5VC 4QHNA 2A9ML 4UINL 3QEGH 4N8CL 1PKQA 1RIHH 5IMLB 3L3KB 4RMVA 2P42B 3HG1A 4X6FA 4TQEH 3ARFA 3WFEH 5A3IC 5F88A 3IXTA 3MXWH 5E2WL 1WIPA 3B4NA 4P2RB 3PGDB 4PRNB 4PTUA 2R0WH 1E27A 4ONFH 3QDGD 1HI6A 1E6JH 5CJXA 2VB5A 3MRGB 2F8XC 4LDOB 1A7BA 3MRJA 4UBDD 5HGGS 3TV3L 1S7RB 1YMMD 2A74A 4HDIA 1BP3B 1X5GA 2FJFB 4RFNC 3MCLH 3A6CL 4O02L 3ARDC 2BVEA 3KPMA 4NT6A 5LGHH 1T0NA 3KLDA 5A2LH 2HT4D 2NY6B 3MCKA 2O5XL 4JPIA 2DMCA 4XMLH 3SCMB 4XHQA 4OFKA 4PJEA 1BVLB 1BVKB 1FO0B 4QHUA 1NGWA 1VGKA 5EU7E 1IGYB 3VXRE 4P4KC 3NA9H 3VMPA 1GGCL 2IFFH 3OAYK 1K5NB 1JGUH 4XPGH 1D9KC 5MENB 3MV7A 3SHSA 4YDVA 4YGVB 1UZ6E 2OZ4A 2H26A 3FAXA 3NCCB 1VFUA 3TJHC 2NMSA 3RU8L 4KTDL 3TVMB 2HTKC 4TUKL 5ESQB 2DQGL 4WIQA 1BJ1H 4PRDB 3J8F7 5JNYA 2CUHA 2Q3AA 3CLEH 4NP4H 2V9QA 5FA4B 2JJVA 3FT4B 4FQ1L 4GRWB 2Y23A 3HPJB 1FYTA 4OLVL 1U92B 1BX2A 1EO8H 1SYSA 1XF4A 4DVRH 2AK4D 5GGVH 3WMSA 1OWWA 3TBVA 3UTQB 3GMRA 3PHOB 3EUUA 3PWNA 4KTEH 2AXGA 4J3WA 2Q8BH 3RI5F 1Z3GL 5D6CB 4DGIH 4OB5H 3GNML 2D7TL 3FFCD 5C0JA 4Z5RA 3NABL 2AEIT 4M48H 5EU3B 1NMCB 1CFSB 3CVHA 4NKIH 1DDHB 1RULH 2J6EH 2PXYC 3PGCA 3QEQA 4NM4H 3K4ZA 1K9TA 4XC1L 4HWZA 5HGAB 4N0UA 1FNGB 3O3UN 2QR0B 2LU4A 2YWYA 1YEEL 1I1YB 1JI2A 3FB8A 3A6BL 3LAFA 3MGTA 4BH8B 1BLNB 4G6JL 2VR5A 4M3JA 1NANI 1UQSB 3IS1X 1JF5A 4QTHA 4DUWA 1G9ML 5C71A 1SYVB 3MZGB 4MHHI 4NQDD 5DTFA 3STBA 4X6DE 1C08B 1TQCB 2VDLH 1JL8A 4QRRA 1H3PH 2C3WA 1EHAA 4PTTB 2AI0L 4H20L 1E4XL 3EYQC 4XNYH 1I7TA 1XF5A 1BGXH 2XKSA 5FM5M 2BSRA 4LSTL 1KELL 4X5WA 5HHOD 3KJ6L 4EUPG 4K7PX 4ODSH 2HWZL 5BZDB 1RUMH 3EDEA 3RJQB 5IEKA 3EOTL 4QXTA 1BQSA 1A6UL 2ERJB 5D1QC 4PJ8C 1XF2B 2XWTB 5A3ID 2NY0D 3B6SB 2DOCA 2Z91B 3H3PH 3RIAF 1PZ5B 2W0FB 1L0QA 4MQXD 3C8DA 5AYQA 1NBYB 5FM5O 1PEWA 3IDYC 1QBLL 4MAYB 4RDQG 5CJ8A 3V6ZA 3O2DH 3U7WL 3OZ9H 2ZUXA 3MR9A 4U7KA 4PJIE 4W6YB 3DTXA 3PABB 4PJXE 4YIQB 1VEOA 3ARDD 2RB8A 3SDCC 4NBXB 5FV1L 2Z92B 5KVGH 3VWJC 5A2IH 2XZAL 3LIZH 5F9JB 1XZ0A 4L4VA 1IM9A 2PW2A 2WWKO 4KJPC 1F3DJ 2B8OT 1BZ7A 2FBOJ 4D9LL 3WNOA 3DRTB 1WC7A 2APBA 2OI9C 4O58H 4P4KD 5KZCD 1J11A 4F57H 4DCQA 2BXZA 1KSRA 1D9KD 4HD9A 2CKNA 2ED8A 3T08A 4G6ML 1UT9A 3OPZH 4U0RC 3SGDI 2HTKD 2X4PB 4RMWA 4JR9H 3P3YA 4OZIA 4L29B 1I3UA 5TGBA 1NUFA 4OLEA 5T1MA 2ICEB 5KSBE 1JK8B 5JXED 4PJ9A 2W91A 4UOJA 1MIML 1G6RB 5CSZB 5DJYA 2EE9A 4LEXH 3CX2A 1YC7A 3LD8C 2AQ3A 2FSEA 4FTVE 2H45A 2X4TA 4RGOL 5HGHA 1KJVB 4FXLA 3AAZA 1DL7L 4I9WE 3JWDL 4APQA 4LGSB 4JDVB 1D5BB 5ICZB 1BEYL 1K8DB 1WICA 4JM2A 3KJ4B 4WU7A 1CFVL 5JR1L 2RFXB 3C5JA 4CUCA 4C57C 1T5XB 2BMKB 4NHCL 3AU1A 1U3ZA 2YD4A 5EIIB 4KK5C 3P9LB 5DWUL 4NDMA 4O9HH 4WUKL 4MNGB 3KPPB 3BD3A 3HHRB 4R97B 2PXYD 3CCHB 3OAYH 3FB6B 2X05A 3LEVL 4JFDA 4NN5C 2YA1A 5TH2A 1MHPL 1U0QA 1CZ8H 4N1EA 1A6AA 3PXJA 3SBWC 3D39B 5J0BA 3BO8B 3HC4H 4JREC 5IIEB 1IZJA 4M62L 5D7IE 3MO1A 3SO3C 4PLOB 5M7QA 1XCTB 1A0QL 3GMQA 2P8PB 4ERSL 5IB1B 2Q8AH 5E6IA 4I0KA 1A02N 5CP3H 4K94L 3U7YL 1CXHA 4PD4K 4ZD3L 3TO4D 1OSPL 1PY4A 1T4KA 1ITBB 2YPLD 1CGXA 4UAOC 4XCFL 4J23A 5C0AD 1IKFL 1F3JA 4X99A 1C16A 4H1LA 5F6IC 1A7NL 5KVMC 1MAKA 3SE8H 5LBSH 1MCFA 5D2LF 1J0JA 3ZE1F 3LMJH 1B4RA 4L4TB 3L3IA 3REWB 5BS0E 4V1DD 3KPSA 4FQCH 3TZVA 4MA7H 1MFAH 2EE6A 3V8OA 4BFBD 4FFZH 5D1QD 1PKQB 1EHNA 1YEGH 5EPMA 3O8XC 3KPRD 3LH2L 4LCYA 4N0YH 1DUZA 1OGTB 1BD2D 1S3KH 3IXTB 2DBJA 1U8MA 2CUMA 4FG6C 4JY4B 1HI6B 3VFOB 2RGSA 4BK4A 2J12B 4S1RH 1ZLSH 2DS4A 1D7FA 3MYJB 3WN5C 1QRNA 5FOBA 4QTIH 3HR6A 3V6OC 2F58L 2A74B 3GSNA 1IC5L 5EBMA 3U4AA 3SDCD 1HHKA 1YNKL 3VWJD 1D6VH 4NT6B 4HWBL 4H26A 4JPIB 3MCKB 4KJPD 1JZ5A 2HTLD 1I9JL 3DI2B 2RCSL 5D71H 3PQYB 4P3DB 4PJEB 2HFEB 3CFCH 3RUGE 4Z7UF 1VGKB 2ICCA 3P30L 1UB6A 3O2WH 4HBCL 4KKAC 5SWSE 1U8LA 2DJUA 4MQTB 1OVZA 4JFFE 3T77A 4UOW0 1UM4L 1N0LA 3SQBA 1N5YH 5TPWH 1L7TH 4DQOL 1EA9C 3INUL 1EERB 3V4VL 2VDML 3MRLA 5FGCE 2N7BA 3ULUC 3GKZA 1B0RB 4XHJD 5EIQA 5EUKA 3ROLA 5DD5L 5AAWA 4JJHA 5IW6A 1IEAB 3SKOB 5DJDA 5KSAA 1IM3A 3FO0H 2AEQL 1AKJA 4U6YA 5EC2A 3MV9A 3QSKB 1BX2B 1SYSB 4PLNC 1XF4B 1SEQL 2B4CL 2VZVA 2ZCHL 1I7RB 3PDGA 4FQXC 1P84K 4ODVL 4OCWH 4KRNA 3T0WA 1DQJA 3ARFC 4KVCH 4XPTH 1FO0H 1FE8L 1PG7X 2QTEA 1OAKL 4OQTA 4D3CH 3PGCB 3QEQB 4PRHE 5CJXC 1KB9K 2X89A 4N68A 3O4LD 4RNRB 5H37G 5KN5A 2VLMD 3E6FA 2XTJE 5D72H 4Y4FA 2ILLA 1RURH 4Q9RH 3FB8B 3K74B 1AH1A 1BIIB 4QTHB 3GK8H 1DANU 4U7SA 1AXTL 4JKKA 4F15C 4AEEA 1AXSA 2CK0H 5D1XC 2P1YA 3HZYA 1EX0A 1WQVT 4GRWH 4XVSL 3FQTA 4QRRB 4HS3B 4PUBH 1KB5A 3S88H 1CGVA 2LU3A 1WAAE 1I7TB 1XF5B 2I27N 3RTQB 2WINA 4NSKA 2H2SC 1FP5A 5F7KC 4X5WB 3WNLA 1CD8A 3ZTJH 3L1OL 2W60A 3MLUL 4RAVA 4MA8H 2DYPD 2W9EL 4HK3J 3CJJA 4S10A 3MOBL 5J13C 4LARH 3FJTA 3G6AB 3CFIC 4PJCB 5ESVB 2E27L 4U2ZA 5TDPA 5EZIL 3WSQH 2M1KA 3G5YA 5I17A 1XAUA 1P2CA 5AZ2L 3CFJA 4K3DL 5CD3A 3MR9B 4NQSA 1E0OB 2J88L 2G75A 3GMNA 1KJ2B 2ZKHL 3J7HA 1EEUA 2AXJA 3LCYA 1GGYA 1Z5LB 1V3MA 2E7CA 1I1FA 4Y4KB 4L4VB 1IM9B 2VLKA 5KVDH 3VXSD 4HZLA 5GJTL 2J7LA 3LKSA 3QIUA 2ADIA 2QQKL 2MFNA 3CXDH 4PR5B 35C8L 3QXDA 4KKAD 3D2UD 3NPSC 1Q94A 4DCQB 1S5IL 4XPFL 3I85A 3K80A 3QFJD 2HN7A 2Q6WA 1N6QH 3OKOA 1HZHL 4GRLC 4UT7H 3SJVE 1R3HB 1RMFL 3UJTL 4GG6E 1S7UA 1OWRM 2DM4A 3CSYB 4OZIB 5EZLA 2MWCA 3ULUD 2FLBT 3WFHB 1I1RA 3SKNA 4JANB 5DEFA 5DJYB 2NY4D 4KPHH 4UINH 2VXQH 3R8BB 2X4TB 5GISH 3AAZB 3CFEA 3T0EB 1ERNA 2PCPA 3MRMB 4KXZI 4OFPA 4LLMA 4R7NA 2WZPD 5IK3B 4R96A 1NFKA 2PN5A 4FQXD 4WU7B 3IFOB 3GUTA 4LLDB 1CL7L 5E4EB 4YR6A 4UIMA 2E6QA 1J1PL 5CUSL 3DI3B 2H32B 1BPVA 2NY3C 3A6CH 3BKYH 4X6CA 3AS0A 5J56B 4K23H 1IKNC 2VL4A 1NAKL 3JTSA 1HKLH 4KKLD 4X80H 3IFPB 4QOKD 3IETA 4GMSL 4GKSA 4NKOB 3BHBB 5KS9A 5E0QA 4FZ8H 3GMQB 2B1AL 3U30B 6CGTA 1GGCH 5D1XD 1ORQA 3AVEA 3O6FB 3LB6D 1I7ZB 2UZXB 1YPZF 2BVUA 4OT1H 4N8VA 1OHQA 4KTDH 1GGIH 4TUKH 3KPNB 2FH6A 3GBML 4I18C 5AG8A 3P2TA 4YHKL 1TJHL 5E9DE 4X4YA 4OI9A 3L9RB 4ZNEA 2H6PA 3QG7L 4Y16C 5E8DL 5HYQA 1OTTC 3L3IB 3KPSB 4LLWB 2BY0A 4OLVH 4Q2ZA 2OK0L 2ARJA 3DPBA 1KN2H 4MAUL 5EPMB 1CGUA 2XOTA 4OAWA 1MJUH 1WITA 4LCYB 4XC3L 1DUZB 2HRPH 2PKDA 1GPOL 4P5MA 1UVQA 3BE1L 4UZGA 1FFQA 3GNMH 4F9LC 3DV6A 1IL1A 2GQHA 3MLZH 3NABH 4APQC 4EEEA 4GQ9L 2XACC 7FABL 1E4WH 3M8OL 4B7LA 3F5WB 4HIXL 1QRNB 4KJWC 2N7AA 3BX7C 2E5EA 5EBMB 4XC1H 1UGNA 4JKLA 5LGJA 3LQAC 5TQ0L 2QHRH 1KIQB 1EV2E 3MV8D 4ELME 1G9MH 4E41E 2JIXA 2HH0H 1C7SA 1YQ2A 1XGPB 4CVZA 1L0YA 3OG6B 4BFGA 4GRLD 4QNPE 3CIQA 3BZ4A 2NNAA 2X4OB 5E08L 1RZIB 3BKMH 2JJSA 2R4RL 2X4UA 5E6IC 1E4XH 1M71A 5I18L 3KPQA 4MXWH 3C09B 3L3OA 4NKMA 4TSBL 4YDKL 2ZUQB 4P46C 3OKLA 4NJ9H 5ALCL 3OHXA 2GSIA 5C86A 3IKKA 3QXWA 4N1HB 3EOTH 5B39A 3MRPA 1EJ6A 1IM3B 1A6UH 2A6IA 4UDTA 1A6ZA 1AKJB 3IAQA 5EC2B 5HY9A 2VDQH 3U0WH 2Q86A 1CXLA 3CSGA 1KIPA 1BAFL 2ZSWA 3TZVC 2VXSH 4Z6AT 4UILL 1JGLL 5I6XB 4LPCA 1QNZL 4C83A 4Y7MA 3S5LB 1QBLH 1MUJA 4L3CA 5BV7C 5H35B 2ZPKL 3VFSA 1VGEH 3ARTA 5DJ6A 4M6NH 3RGHA 4YGAB 1YJDC 4X4ZA 1W2KT 4MJIB 5HHVH 1ZS8A 3GMLA 5E2TL 4ZSOE 1VDGA 3NA4A 4MSWA 3QUZA 1QVOB 2F54D 2IAMC 2APXA 4D9LH 1I8MB 1VKXA 3LRGA 4JPVL 5IB2A 5FYKH 1ZGLA 2WWMD 5DRWA 4JZOB 1X9QA 3VFUB 1CBVL 1BZ9A 1FNSH 4EI6B 1JFQL 4FP8L 4WRLA 3EAKA 3HZYB 4GQPH 4XTRC 5I1LA 1PJ9A 4C4KT 2XA8H 3FQTB 2VH5L 1LWRA 1GGBH 2JB5L 4QEGA 3C9NB 4GUPA 3SN6N 2VZOA 2GI7A 2OJZL 4Q6YA 1DBBL 1MIMH 4Y16D 1KGCE 5FCUH 2VDRL 3D0LB 5F1IA 4Z0BL 3ZDYE 1X5FA 1JPGA 3GI9L 5EOTB 3QDJD 4UB0L 4WW2C 5ITBL 1J0KA 1L7IL 4LVEA 5SWZA 5IBTL 2H9GA 1UCBL 2HAZA 5KG9B 5DS8A 4RAUA 3QDHA 1A64A 2P5WA 1BEYH 4QT5B 3VG0H 4Z7OF 4WJ5A 1HHHA 3V4UL 4PLJC 1G6VK 1F4HA 5DJAA 4NHCH 4OD2B 1X44A 3MV11 1QFUL 3KGRA 5I17B 1SJHA 3AXLB 1P2CB 4J6RH 5T1LD 1KYOK 4ELKB 4MNGE 4KJWD 2CK2A 2B2XL 1CTNA 2XNAA 4Z78A 4MDIA 4DW2H 2GYSA 2OS7A 1MHPH 1CVRA 5HYFA 3BZDA 5IV2A 3D39E 1DFBL 1CIUA 4LVHB 2JLLA 3VFMB 2B0SL 1NL0L 4TN9A 3TA3B 3PWJB 4Z7VF 3QDMA 1KENL 3MGOB 3DECA 4LMQE 4LIQE 4KJQC 4K94H 1ZVHA 1NCCH 1NEZG 4N0CC 3LRSB 2HN7B 3LN4A 3ALPA 4YXLL 5AAMA 1T1ZB 3RJDA 3T2OA 4X4MA 5GS3A 1S7UB 3U4EB 3GSOB 4DGYL 4I0CC 3VMNA 1A7NH 4P46D 5I1GH 1NCDL 4E0RB 5HI3C 5DEFB 5EO0A 1ZGLP 2KDGA 5SX4I 4OZGF 5DJXA 4NQVA 4HGKC 1PKQE 1DQML 4X8XA 4HT1L 3CFEB 3HG1E 2O5ZH 3SDYL 1A1OB 1KJ2H 2DWEA 2VR4A 2X6MA 3G5VA 3O4OB 1TTUA 3QZWG 5DRZB 4HJ0C 3S35H 4I48B 4YR6B 1B3JA 5JIHA 3X11A 1A6WL 6FABL 1CICC 1WCBA 1UYWL 3V5HA 1YNKH 2DQCL 4X6CB 1WT5A 4ZOAA 4KMTL 4PJAF 4NN7C 3F7YA 1XEDA 4XVTH 4R0LC 3JTSB 1HH9A 2RCSH 2W0LA 1W0VA 4PJEE 5CLTA 4GKSB 4GMTH 1MLCA 4D8PA 4XNXL 3FO2A 4HBCH 1ZWIA 3LPGA 5HDLA 5GS2H 2DIBA 1U8JB 1ORQB 3O3AA 1R3LA 3MV7E 4KKNA 4XTRD 4N8VB 5IGXL 4NO2A 5DMKB 1F2XK 1IC4H 1NPUA 3ZMRA 3V4VH 2GITB 1L6XA 2F19H 3I75A 4OCSL 5FYKE 4X4YB 3TBYB 1X5XA 3N1MC 1T22A 1IEBA 1I1AD 2AEPL 3RBSA 5JXAL 4FRWA 2FLRT 2VWEC 5HYQB 2EIZB 3VA6A 1WFOA 2C26A 2VXTL 5ISZA 2PO6C 3EOAA 1FYTE 2WM0A 2H32H 3VD3A 4J3OC 4QF1A 2B4CH 4PLKC 1Q9OB 3BKCH 3PNWB 1IBGH 4XRCB 4PLJD 4AEHL 5E1AA 5AD0A 1JWMA 3RVVC 4JZNA 3DV6B 3MLYL 3NCYS 5ACZB 4MHHG 5FFLA 3UTTD 1OP5H 5DMJB 4FS0A 1NCAL 3QEQE 4Z7UB 2NX5A 2WBJC 3IAPA 4JO3H 4K9EC 4GW5A 1U91A 2ZCLH 3KPLA 3K1KC 2H2PC 3L95A 4N0UE 1U8KA 5IBUB 4P5TB 3MLRL 2KKQA 4HSQA 3BYTA 2ORBL 2D0GA 1ZTXH 2XRAH 4ZAKD 1C12A 1Y0LB 3X12A 1U93A 1MNUH 4N0CD 2DQHL 1DJSA 3Q6GL 5B8CA 4IRZH 2IALB 2DN7A 2R56H 3U83A 2H1PH 3ZT7A 3WD5L 4YHZL 4QRRE 2X4UB 5GS1C 1CF8H 1A6TA 1M71B 3I2CL 4IBLT 1FH5L 2R69L 2FWOA 4JPWL 1QFOA 4QRSB 5HHXL 4OM0H 2FECL 3U0TB 2GSIB 5HI3D 3L7EB 4JE4B 5L8JB 3L1OH 4R7DB 4MNQB 4IS6B 3IVKA 4UDTB 4OFYA 5K9KB 5MERA 4OZFA 1FNEA 2EIDA 5FGBA 1OM3L 3MOBH 4Y5XA 2Q86B 3ULVF 3OR7A 4IIQA 4PRPA 4PJCE 2DQIH 4FQLH 4WTZG 4JKWA 4HJ0D 1MFCL 3LV3B 4MD4A 3QUXD 5AZ2H 4L3CB 1JV5A 3EO9L 5C0RL 2CXGA 2ADJA 2ED7A 1CICD 5DJ6B 2J3SA 3EOYG 1UWXK 5FYKU 4F37F 3UPRA 1ZS8B 3GMLB 5L0QB 4HF5L 2EIBA 3B9DA 2EYRA 1IAMA 3PWUA 2CXKA 4L4VE 4LF3A 4PS4H 5ECJE 3C2AL 5GIRA 1DUYB 2ID5A 4PJHA 1AGBA 1S7VA 3S96A 2P45B 5CIPA 4DK6A 3TN0B 3P4OB 4H5SA 4GAFB 1G7QA 1RMFH 1T7XA 5GSVA 3MOAL 3O3EB 4GW4B 1YEJL 5ETUB 4OZIE 4NZRH 2IWGA 4HQQH 3BDYL 5F1IB 4JO4L 1EEQA 1JPGB 2FGZA 4UUJA 2ESVA 5KOVC 2PO6D 3MNZA 4P23B 3PWVA 3T0EE 1A2YA 3FZUC 4OGYL 4RAUB 2ZG3A 4P2OA 4GBXC 3QEUB 3KPTA 1MCDA 4JN1L 4WJ5B 3DX8A 3TO2B 4JVUA 5DJAB 8FABB 3RVVD 3SEPA 2YZ8A 3ZO0A 3C2SA 2OSLA 1M05B 4F2MA 4CU6A 1SJHB 1J8HA 4NYLA 3OKMB 2MCPL 2IGFH 3DLQR 5EO9B 4CMHB 3BWAA 3HI6H 5FO8B 1JTOA 3O6ML 1QQDA 4J8RA 2WBJD 2XNAB 4JFDE 3QWQB 4M02A 4KZEL 4MDIB 2DAVA 1JZ4A 3FOMA 4JFPA 5BS0D 1CDUA 4U3HA 4UV4H 3ZSTA 3WFBH 3CFDA 5IV2B 1NAKH 5I0ZA 4W4OA 5GSRB 2HJFB 4LHUD 4PJ7A 1XGUA 1BJ1J 4ZS7L 3B83A 2FRGP 1QBML 2IPTH 4YFLF 2B1AH 4I5BA 1CTOA 3EDFA 4I3RL 4G9FA 2BOCA 2VZTA 4R4BA 1G7PB 3VRJA 4LKCB 2GW5A 3QUMB 3BPLB 3LN4B 4Y19A 3TBWB 3BW9A 2F53B 5KOMC 4IMLA 4YHKH 4EI5A 4PBXA 3QG7H 5I16A 3GJFA 5E8DH 4WEUD 4NNPL 4KDVA 5LWYL 3KPSE 1MWAB 5DJXB 1FCCA 1QA9A 1TJGL 2Y9RT 2FEEI 4K8RH 4NQVB 3CVIL 5TDNB 2PYEA 4XCNA 2EO9A 1B88A 5DVKA 1IQWH 3MRHB 4XNMA 1L4IA 4Q9CA 1GPOH 3IFLL 3BE1H 1JN6A 4ONGH 4JQVA 2Z31C 4DOHE 1JGVH 2XV6B 4GQ9H 5FYLL 7FABH 4FMKA 4F3FA 4HIXH 4JHWH 2BHYA 1DVFA 1QRNE 2MPAL 2XZQL 4RZCB 4NC1C 1WCBB 4M9OA 3V5HB 4PGCA 2YD9A 5ADPL 3QI9A 4YHPA 3RAJH 2ADFL 2D0FA 3SE4A 3NFSL 3VE0A 1A9EB 1RJYA 1MCJA 5IVXA 5EOCL 3QO1B 1MLCB 4D8PB 2IPKB 3HE6B 3FO2B 1RJZB 5F9DC 1MCWW 4M4PA 3IFNL 2R0ZL 4JFQA 4XPHL 5T3ZL 1KNOA 3KLHC 1R3LB 5E08H 1QHPA 2Q76A 1MHCA 4TNVF 1DTUA 4YDLC 5CEXA 4CL7A 1IGJA 5JLZA 1JI1A 4PRHD 4LCWD 4IMKA 1D5XA 1HHIA 4OIIL 1PQZA 3A67H 1T6WA 2MHAA 2E9WA 3L5HA 1QSFA 4W81A 1FVEA 3VCLA 3HC0A 1XGQA 2C3VB 4TSAL 3HNTL 1NC4B 4QRQB 3EOAB 4DKEL 2I07A 2DBLH 5F7MC 3AY4C 4GBXD 2OXGA 4O5LH 3MJ8B 4XWOC 1VESA 1K4CB 3QCVL 2X4SA 4WFEE 3P4MA 4Y2OA 5CSGA 3WXWL 2X1WL 1X4ZA 1B0WA 3DVNA 1JWMB 5D6DA 5E5UB 3H8NA 1GHFL 3B43A 4XAWL 3OF6A 1MCSA 3SDAA 4NO0A 2FR4B 1QUNA 5C0CD 2NX5B 4OUOA 4ZUVB 4NJAH 3KPLB 5L2KD 4TSCL 3CGTA 3IJHA 3U9PL 3MRFA 1UM6H 1RZJC 1S9YB 4EBQH 2DI7A 3JV0A 3MREA 4Y8AA 1GZPA 4NUGL 3QIWA 1NKOA 1L0XA 4C58B 4M1DL 1CBVH 1NGPH 2H3NB 3CUPA 1U93B 1JFQH 4FP8H 5BVJB 2R23A 4U6HB 3FQXA 4LSPL 4G7YL 4V2CB 2VH5H 1G9NL 4PP1C 2F15A 4BSJA 3RY6C 1EPFA 2OJZH 2VDRH 5DRNB 3O9WD 1R5WA 3BZEB 3GI9H 3RWHA 4HWBA 1L7IH 4KUCF 4WV1B 4R4FL 1ADQA 2X9XA 2CJUL 3OKKB 3HI1A 3ARYA 3JTTB 5IMOA 1N7ML 3OR7B 4IIQB 4PRPB 5DUPH 2BDNL 2Z31D 4GKOA 5F8QC 5L9DL 5F71A 3BI9X 3VXUA 2G9HA 3IKCB 3SJVD 4GRMB 4WI5A 5CD5D 4PV9B 4JFYA 4OD1L 4P48A 4MD4B 5C08A 2OTUB 4NFBA 3W0WD 5J57B 3OXRA 4L8SA 4GH7B 2ADJB 2D31A 2RHEA 5B22A 4JG1H 1DLFH 3BUYA 3TBSB 3QH3A 5FXCH 3UPRB 1NDGB 4FXKB 5DZOA 2Y36H 4CU7A 1DFBH 4PGBA 4YWGL 4ACPA 2BJML 2EZ0C 3ECBA 2VLKE 2XN9A 2BRRL 1OLZA 2FD6L 2R29H 4PIRF 3FO9A 4P2RD 2D7QA 4WEBH 5GHWH 1U8QB 1S7VB 3S96B 4M7LH 3KLHD 3MX0A 1G7QB 5GSVB 4E42A 3Q5OA 1HYRC 1GL4B 1H3GA 4X83A 4W6XB 4DGYH 3VXMA 1PX3A 4JFXB 1NCDH 4OFIA 5B8CC 2VLRA 4Y1AB 3Q5TA 2A6JA 2VLLB 1FJ1B 1LO4H 4G8FA 3SCMD 4G6AD 3DVIA 1I9RH 4UUJB 3B9KC 1R5VB 3QCTL 1DQMH 4CDHA 4HT1H 3UPAA 5IB3B 5EU6A 1A2YB 2A9NH 3QUYB 2IF7A 1WUNT 5TF1L 4XX1E 5MEND 5BOZG 3BP4B 4I13B 4JQXA 32C2A 4HFUL 2G5RA 3TVMD 4KK9C 4ZTPH 4NNYB 1T0MA 5J12B 5HDQH 3MA9L 4Y5XC 3WFDL 5CMAB 4JFZL 4NYLB 2W9LA 4YHIB 5FK9A 1CIDA 3ARGA 4J8RB 1VFAA 3H42L 4Q0XL 3UTPE 5GJSL 2GAZA 4HXAL 3FONA 4X6CE 4RRPG 4MS8C 4HV8A 1MIEL 1YEDB 1NGYA 4NKDA 1XGUB 2D7NA 3MRKA 1YEHL 1T2JA 3FFDA 4XNXH 5SWQA 5C0ND 1I9EA 1VACB 5TE7L 1TTGA 3UBXI 1YZZA 1HXYA 5KS9E 2BOCB 4BZ1H 4R4BB 4HXBH 5HHMB 4WTXA 4QXGL 2Z0BA 4PP1D 4R97C 4KUZH 3ILPB 3GI8L 3BW9B 3ZDZE 2XI9A 4OLXH 5C9KA 4C54A 4KI5C 1RZFL 4WFHE 5T5NF 1IQDB 5E03A 4EI5B 2EYSB 4ZNEE 3HMWL 1GZQB 3GJFB 3S35X 5JXAH 3WBDA 4JHAL 2EICA 1PKOA 3T4AA 3QHFH 3QBTB 4WO4B 1KCVH 2NY1B 4XWGL 1LO3L 3LEYL 4P3WA 1MCRA 3MJ9H 1EMTH 5ICXB 5DC9B 4ZOEA 2A83A 4M6OL 2EE2A 1A21A 1NBVH 2CDGB 3UZQA 3VXPA 5EIVA 4AEHH 1JN6B 3O0RL 4ZOBA 4PJAB 4K71B 1PLGL 1JWSA 5HYSG 1FZJB 4P2OC 1G9MC 5MHSE 3AREB 1E6OH 5HBBA 3VA2C 4PGCB 3BOVA 3N9GH 3QDAA 4XVJH 3QI9B 1X7QA 3MLPA 2DL2A 3RP1A 2EZ0D 3QUMH 2QSCL 5HPMA 25C8H 5CJOH 3DMMB 5EA0H 1RJYB 2VUOA 4HH9B 4AK1A 1IT9H 1JPSL 3OGOE 4NRXA 3ARSA 4LBEB 4WFFE 2IADA 3V4PH 4MAYD 1OB1A 1MWAH 2Q76B 1RVFL 1MHCB 4MA1B 1TFHA 1X5HA 2R69H 1S9KC 5HHXH 3S98A 3SY0A 2MHAB 1HHGA 1OGAB 3TT1H 1QSFB 1P9MA 1RZGA 1FVEB 3AS3A 2CKBB 4ZFFA 3B9KD 1Q9LA 1N0XL 1T89A 3STLB 1EJOH 1J8KA 1EAJA 1F4XL 2CUIA 4UTBH 1I8LA 3LKQB 4PD4J 4YPJA 1J87A 4P3CL 3CXHK 2R1WB 5L88L 2IH3B 4DTGH 1J1OL 2FATL 3B2VH 3RWDA 1H5BA 1P7KA 1G7LA 43CAA 4LOUC 3O3BA 4KKCC 4JQVC 1NGXB 1JNJA 1MJ7H 1FFPB 2X2YA 3K2UL 1OPGH 4HF5H 4MS8D 1B6UA 4YXKH 2MKLC 4OLZL 3GSWA 5DJ0B 5E56A 3NGBB 4NBZB 4RFOL 5F9AC 5DA4A 3IJHB 4KHTL 3IDGA 4F7CB 1R0AH 5ACLA 3MRFB 3S8WA 1J5OH 1NCWH 5BRZA 1GZPB 1QFWL 1T0PB 5I1DB 3QIWB 3HC3H 3UX9B 1YY9D 4X7SH 2FJGA 3CUPB 4CJ0A 3B9AA 3HUJF 4X6EA 1A4KA 2R23B 3FO1A 3W9DA 4NQTA 4LCIL 2IBGA 5ITFA 3EZJB 5D5MF 1T20A 5EWIL 1EEZA 1U95B 5AUMA 2HFGL 2GUOA 4KI5D 1F6AA 4TVPH 4YC2B 3W11C 5SV3A 1TZHB 3BDYH 4MGXA 2EO1A 4Y89A 3BVNB 2XKUA 3BIKB 3D39D 4PP2A 2AW2A 5TQ2H 1J05A 4OLYL 1C1EL 1TXKA 5FV2A 1YMHB 2VC2H 2X4QB 4IMKC 1MI5B 3CDGB 5DD3H 4MMXC 3OKDB 5SWZE 1YN6B 1HSBA 4Z7WA 5DUBA 3WL9B 2YA2A 5JORB 2P5WE 4AM0A 1FPTH 2XZZA 1OAXH 4R3SB 3VXUB 2G9HB 4XCCH 3LKNA 5HHQA 3WO4B 4G80B 2DQJL 3WUWG 1H9VA 3EJZC 3MJ7B 3O6MH 4ZPVB 3OXRB 1NC2A 4N5UA 3UPCA 2D31B 3RTQC 4K94C 4KZEH 3CFKA 3V6FA 4UIKH 5D6DC 2VTFA 1Y6KR 4L4TD 1P1ZA 5J1SC 4M43H 3T8XB 4RFEA 5DYOA 1QSEA 4PGBB 3CLFL 1GIGH 2ZNWA 5F9WB 4ZS7H 1IGTA 4HWEL 1VFBA 3GMOA 1FORL 3QDME 1P84J 3THML 3UEZA 4GLRI 4KDWA 3FO9B 2R2CA 2DQFA 4NRYB 2OR9L 2QQQA 1FDLL 5I1JH 3S36L 3QIBC 3IJSB 1KJ3L 1FFOA 4X0KA 1IGCH 5CBAB 3VXOB 1G7IB 1HEZB 1KB9J 2BNQB 4MCYB 1CE1H 3L5WB 2IBZY 4X4ME 5T1DH 1AGEB 4U1GC 5TJWK 2VDPH 4S1DC 5F97E 5FKPA 3VXMB 2NPLX 1LO2H 1JNLH 1P7QB 2PYFA 3MBXL 5C0GA 1U58A 5JQ6L 2VLRB 3U0PA 2A6JB 3G6DH 4S2SA 4Y4KC 2YOCA 4CU8A 4G5ZL 3PQYD 3QWRA 4LHJB 3QHZL 5F1SA 5FHBH 5L6YL 3LHPL 5DFWH 3M45A 5EU6B 2WUCH 4OV5A 4XNQB 1LE5A 1MFDH 4NM8L 2JB6B 3SGKC 5F7UA 2BERA 2ZUTA 4ODBD 2QADC 2P8LA 3JBG7 1CDGA 3KNBA 1ZA6B 1F97A 2HFFB 4KKCD 5FYKD 1T1YA 1UZ6F 3OJDB 3KYNB 4JGUA 4DKFH 2XZQH 4BA8A 4BQCA 4MLSA 2BSTA 2CIKB 5FK9B 3ARGB 2UZYB 2X1PA 1AC0A 4KVNL 3D69A 4OGZA 3DUUA 4AT6A 2ADFH 5I1AA 4HV8B 3D9AL 2W65B 3O2VL 4FZEL 4DGVL 1NGYB 1ZVSB 2GJ6A 4NKDB 5C6TH 3T2QA 2GY7B 4RGMC 3GMPA 5KJRL 2XA3A 4S1QL 5IWLC 1LK3L 2EYTA 5CHNB 3QXTA 4OBSA 4JFOA 2R2EA 4AH2B 5E4EC 4P2QA 1NAML 1OAUH 2L0DA 4HFWA 4YHYC 2OMNA 1UWGH 5C2BL 5BQ7A 5CZVH 2Q7YA 3I02B 3QEQD 4F7MA 2B4CC 4EUPB 3MA7A 1N6VA 4OIIH 5IKCA 2XQYK 1N4XL 1SEBB 3SOBL 4ZFOL 3WIFA 2R4SL 2GT9A 3FRUB 3SDXA 1I7UA 1HQRA 1INEH 1FVCA 4UT6L 5T5FL 5ISZE 1CLZL 4DKEH 2O61B 1Z9OA 3JV6B 2V2TA 5H8DA 3BN3B 5D93B 3O6FC 4FNLL 3VXPB 2VLJA 2FO4A 1E4XI 2C7UA 4QRRD 4ZYKA 1JWSB 1CG9A 3EJZD 3BP6A 3Q1SH 4X6DF 1JWUA 3RTQD 1B4JH 2NX5E 2CO7B 1KACB 2AJXH 1BREA 5J6GA 4X8JA 2DQUL 1J1XH 3ZKXB 1X7QB 4MDJA 4LDLB 2N4IA 4KFZC 3ULUL 2ZUVA 1FGNH 4HK0B 1Q0YL 4XMPH 3WO3B 4M1DH 4U1HB 4NRXB 4K7PL 2FX9L 3GJFH 3GO1L 4RGNE 5SV4A 4GKNB 4KQ3L 3QIBD 3R4DA 2IADB 4HJJL 5IQ9A 3MLWH 5FUZL 4JY6A 4QGTA 4XPAL 5JDSA 3S3SA 4NGHL 5FKAA 4S1DD 1Z0MA 2BRQA 2ICWA 3P77A 4O2FA 3BAEH 3SY0B 4PJIF 4Y4KD 4IRJA 4L4VD 1IM9D 4KQ4H 1RZGB 1T7YA 3JUYA 4PJXF 1NJ9B 2YSSA 1Q9LB 1KN4H 1CDYA 5JIKA 2J4WL 4IDLA 5A2JH 2WAHA 5F7DA 1H0DA 3V5KA 4JPKH 2P5EB 4JLRB 3QT2A 4PRPE 3C08L 2BDNH 3U46B 4UNUA 1EFXD 1DEEB 2B1HL 4OD1H 1BJ8A 2CGRH 3RWDB 1F6LL 1P7KB 1UKQA 1V3KA 1XF1A 2RR3A 2ZUQC 5GS2D 3KXFA 5CZXC 2FIKB 3RWJB 2GK0B 4L9LA 4FABL 5KSBF 2BRRH 2V5MA 3T0ED 4U1KA 2VXUL 1F4YH 5BRZB 1AR1D 1S8DB 4PJHE 1GC1L 5JIPA 3WDJA 4U1JA 1M7DA 1LHZA 5E24E 5KVFH 1WBYA 3ORJA 4U4BA 5EBWA 4X6EB 2CKBH 4PGDB 3W9DB 5ITFB 5C8JA 1T20B 3WEXB 1EEZB 1OW0C 5DXWA 2ITDA 4LVNB 5AUMB 2B5IC 2WBWB 3O41B 2GUOB 1F6AB 5DMIH 2BP3A 4DUXA 5CKAA 4TPRL 1SMOA 5FF6A 3F58L 4Y1AE 5IHLB 5F1NA 4YK4B 2A6DA 3ARRA 1T21A 1WVZA 2ESVE 3T65A 2R1YB 5JPNA 5GZOD 2HP4A 2BVPA 3HMXL 5I74B 3R0NA 2NLJA 2AJ3B 4J1UA 3U2SB 1HSBB 1U3YA 4Z7WB 3HFMH 3O6FD 3GJEA 3FT2B 3LSOA 5D7IF 3H9SA 4HIJB 4AM0B 4HFUH 1LEKA 4TUJA 3MRDA 4K3HA 5C3TA 1I8LC 5ID0A 1ZKAA 3RPKA 2XG4A 1EXUA 3MA9H 1ES0A 4NNXB 4WWID 3WFDH 3LKNB 5HHQB 2ZZUT 1J8HE 5IHZB 4Q0XH 4BSVB 1RFDL 3F7VA 4PRAA 1EHLL 4ISVA 2EEBA 2Z8VC 5E8NA 3VWKA 5I8EA 3NTCH 2UZIL 1QLEL 5GRVL 3KPSD 3V7AE 3IDXL 4YDJA 1T5WA 4RFEB 1P5VA 5LKNA 5DYOB 1QSEB 4PJ7E 4JAMB 3GKWH 1KCUH 1IGTB 1YEHH 5EUOA 1VFBB 1JUFA 1C5CL 4TNVK 3HZVA 1TCRA 3ULVH 2DQFB 4G9FE 1IILE 1Z6JT 2K7QA 1KPRA 4BUHA 5E2UL 2YD3A 1EEYB 4G9DA 5F3HB 4HUKB 3RZCB 3ZTNH 2RBLA 3MMEA 5GRUL 1QRND 3GI8H 1YDPB 2EDBA 4OLUH 43C9B 5K9OA 4NQEB 3ILQC 5C0IA 1UACH 3MFFA 4U2YA 1II4E 2AS5M 5FKPB 3P0VH 1BM3L 2C4XA 3P11L 5JQHC 4LSQH 5CZKA 3NMEA 4JHAH 4NN6C 2D03L 4OKDA 4Z0XA 3U0PB 1LO3H 4LVHC 1HHJB 3LEYH 3TA3C 4MNHB 5JOFB 3R1GL 1CLYH 1GOHA 3DGGA 2V7NA 4YLQT 4ZUTA 2PYEE 1JHTB 4M6OH 3C6SB 4Y5YA 1NBQA 4EN3A 4XP1L 4WNQA 4PY8I 4OV5B 1CGSL 3LOWA 1A3RL 1LE5B 4TNWF 3RUGF 5D9SA 4HS6B 4QXUH 1PLGH 4LEOA 2YBRA 1GGTA 4M3KB 3TNNA 4CMMB 5C07A 1JYXA 4WHYG 1B9ZA 5C0BB 5JUEH 1BFVL 4EQ3A 2BSTB 1B0GA 5CZXD 2EDKA 2XYCA 3D69B 3ZYIA 1FC2D 3BPCA 1SM3H 4AT6B 4WUUB 4IRSA 4J3XA 2QSCH 5I1AB 4JJ5B 1AKJD 3GHBH 3LN5A 4OCXH 2VAAB 4FQPA 4HUXB 4G3YH 3LEXB 5FIEA 5IVXE 4POZC 3GIZL 3FTGB 1IEHA 3VG9B 4WCYH 3X14B 1KYOJ 5CCKL 1KC5L 2R2EB 4BM7A 4WU5A 2NY7H 3SKMA 1MAML 2NR6D 3I6KA 2V2XB 1AJ7L 2D9QB 4OF6A 4JRXA 5D7JB 5JPMA 2EDWA 4KH2A 3RVWC 5HYJA 3BIAX 1S7SA 3CK0H 4MJID 4LHUG 4F7MB 4HG4K 1UM5H 3EYSL 5DURB 1DZBA 1TLKA 2AJVH 5BO1H 1SY6A 4ZO8A 2VL5A 1QSFE 3WIFB 4JDTL 2P8MB 3GBLA 1FRGL 2BVTA 2GT9B 1I7UB 1JRHH 1HQRB 1F4XH 3QULB 1PG7L 1TQBB 3RBGA 3MBEB 1ZVYA 1INDH 2P43B 4UU9A 4P3CH 3LQAL 4YO0B 2IBZX 4RIRA 4GXUM 2G60H 4RWYL 4I1NB 1J1OH 2CDEA 2FO4B 1BMGA 1RUAL 2C7UB 4ZYKB 5HHPA 5IFAL 5I1CH 5IMKA 5D1ZA 1UJTA 4BQ8A 3EFDH 2UWEA 3BSZH 3RPIA 4TUOA 3TIEA 3UP1A 2XQBH 5J6GB 1YNLL 3D18A 1WAAF 2EKSA 3O11B 2BSSA 1K3IA 5LXGL 1Q38A 3HI5L 2X1OA 1QFWH 4EUPH 1NEZA 1E28B 4Z76A 1K2DA 5HVFB 3RWFA 1K85A 3RWIA 3CNKA 4LCIH 1AR2A 1ONQA 4K8RD 5E8EA 5GGSB 4JY6B 5EWIH 1LDPH 4A6YL 5H94A 5EOQL 5JDSB 3ILQD 4ZFGL 1FN4A 2HFGH 5E94A 3G08B 3WLWD 3U6RB 3T3ME 1MJJA 3WE6B 4P5TC 2WWKT 3SDDC 3N50A 5DJZA 4OLYH 4IRJB 3BGFB 4I8DA 3TA3D 4XP4L 4HWUA 3PWLB 4YEFA 3W39A 4XVUC 3UC0L 3QZWA 2YS4A 5CGTA 4H8WL 1XGRB 2VQUA 3LDBB 1IMHC 4KHXL 2X7LA 3ZHLA 1NFDA 4P4RA 3IS0X 3VXUE 1BIHA 1ORSB 2DLFL 3MRIB 4P59H 4P5KA 5C08E 3TYGH 4QHMB 4TOYH 5I30L 4IOIA 1T3FA 1FZMA 4EDWL 4GG6F 1RSFA 3IU4L 3HUJB 3U4BL 4ETQA 5F3BB 4R9HA 1UXWB 3D3VB 3WKMH 5DHVB 2XN9E 4YH6A 4NWTL 4POZD 5J9PA 1ETZA 1LK2A 4XXCC 1XIWB 2AV7A 4U1JB 1A8JH 5DO2D 3ZE2E 1KJ3H 3UO1H 1NLDH 1B2WH 4LSVL 2BNQE 2VRAA 3RVWD 4HKBB 2ITDB 2X42A 3VXME 4DN4L 5I8CB 3QRGL 5L0QC 3BD5A 1FGVL 2VLRE 1J10A 1JPTH 2A77L 4HCRL 5F1NB 5DQJB 1U8IA 4LCCB 5MEQA 4HGMA 1D5MB 5GGQH 4PJ5A 4HZAA 2YC1B 2V5RA 3QHZH 4LSUL 3C6LA 3LHPH 1A7PH 2W07A 5EU6E 3RGVB 1XGTB 3P9MB 4GSDH 5A40E 2NY2B 3D85B 5IEHA 1X5KA 4L8DB 4RSVA 3TN0C 1W72A 1H8SA 1VPOH 4D0BA 1LEKB 3SKJL 4LSRL 5E5RB 3NAAL 4XBPB 4YE4L 1FL3A 1ES0B 2XKNB 4I0PB 2HT2C 2ZG2A 5TFSL 3P40A 1K4DA 4WFHD 3N1GC 2AK1H 1QKZL 1NCTA 2XWJB 2BOBB 4PRAB 1N2RA 3MLXL 3ZHDA 3LZFH 5BVPH 3EYVA 5TDOA 3VWKB 1RIHL 5I8EB 3QDGA 1IZKA 4TQEL 4YDJB 1RU9H 3WFEL 3MXWL 4P23C 5E8OA 5HJ3B 3QEHB 2I9TB 4PG2C 4F8TA 5JHLH 5EUOB 3DETC 1YMMA 2W0KA 1JUFB 2BC4B 2R0WL 3KYOA 1AD0B 1E6JL 4L9LC 1KCRL 3H3BC 3STZA 1P4BH 2BX5A 1H15A 3IF1A 5DD0H 5EBLA 1VHPA 1KPRB 4G9DB 3H7BA 2V2WB 3VFTA 1U3HB 3FL7A 1YQVL 3EJJX 3MMEB 1FIGH 4ZPTA 1MCCA 5MHSD 4HJGA 4JB9H 4TRPL 5LGHL 5C0IB 2PR4H 1DSFH 5JTWA 1I85C 5DD1L 4DWHA 1XF3B 3IXAA 1CR9H 4XMLL 2E7LA 1VFMA 1V7NL 5C6WH 4P5TD 3DROA 1RK1B 1YYMH 1FHGA 4UDUA 3O45A 5E8PB 4ODWA 4Z0XB 3TM6A 4DVBB 5T5FH 3VXRB 3V0VA 3JVGA 4EIZC 3B3IA 3NA9L 2FEEL 1ZANH 2IFFL 5F9OH 3NZHH 3L6FA 4XPGL 4WTZA 1JZ2A 2DWDB 3OAUL 5ELIA 4EN3B 1Q9WA 4WFFD 5IG7A 4WNQB 4ELMF 1QO3A 4LRNH 5D9SB 2EH8H 3MRCA 2HJKA 2CMRH 5EDXA 3OX8A 1S78C 3RA7L 3VD9A 1QBBA 2AK4A 1CFQA 3CLEL 5C07B 4QNPF 4NP4L 3LKPA 1AHWB 5DZLA 1L9NA 2DQUH 3NFPA 1AY1H 1EO8L 3FFCA 4MNQD 4DVRL 5GGVL 4IRSB 1W0WB 5GRXG 4EDXB 3C60B 2HT3D 1CK0H 3U9UA 1IAOB 3GSQA 2Z93A 2Q8BL 4KTEL 5IJKC 1MEXH 4DGIL 4OB5L 2D3VA 4K2UL 4K7PH 4N5EC 1RD6A 3NZ8A 4M48L 3DJ9A 4OCMC 1MVFA 1FSKB 4KQ3H 4ENED 4HJJH 1S9VA 4NKIL 4FFWD 4WU5B 1BZQK 1RULL 2J6EL 3SKMB 4NM4L 5ICYA 4MXVE 4NGHH 1WBXA 4JRXB 3HZKA 2R15A 1Z9LA 4Q6IB 1S7SB 5I76B 3O6LH 4X98A 2E9IA 2W38A 4NQDA 2V9TA 2VL5B 3C8KB 1MJ8H 3FB7A 4IOSD 3WJJC 2VO5A 3ZTJG 3RWCA 4R4ND 1IGFH 1QBAA 1F58H 1CQYA 5H37H 3EYUL 3HE6C 4Y2DC 2J2ZA 4UU9B 1LP9A 3C08H 5HHOA 2IMNA 5J6HA 3TN0D 3BH8B 3BPOC 5E5MA 3RVTC 3WIIH 4LAJH 2CDEB 4Y5VA 4Y4HC 2B1HH 4XNYL 2MQ0A 2EDJA 3IU3A 1BGXL 1FZOA 4PB9H 3REVA 2FL5A 1WZMA 4UT9H 3QHTC 4OUUB 2IPUG 4ZS6C 2VDNH 1RUML 3HCVA 4N9GA 5D1ZB 4CGTA 1RIVH 3PV6A 5F7LB 5DEGA 4TUOB 3TIEB 4JHBA 3ARVA 1Q72H 3D18B 1QFWM 2Y06H 4P23D 2BSSB 3H3PL 5DJ2B 2XPGA 4IDJH 4J3SA 2FH8A 3ZDYF 4LLQB 4EZMA 5J06A 5BRZE 1ZT7A 4LLVA 1GC1H 3CSPA 4ODXB 2VZSA 3ARDA 4Z76B 4PJDA 1EZVX 4AEIH 5JW4Q 3OZ9L 1AD9B 2ITCA 4F58H 1RJCA 4XCYA 1FFRA 4XMKH 1MCKA 1ONQB 1YUHA 5H94B 1J0IA 1NGZB 2PW1A 2YD1A 3NFNA 2XWBA 5E00A 4P4KA 3LIZL 5BXFA 3L7FA 3K4AA 5JW4N 4LASH 1NUDA 4TPRH 1D9KA 2OTWB 3OKYA 2ZOLA 1KLGB 4OTXL 2BY2A 5DJZB 3W82A 3B8SA 1U8NA 3V8CA 4O58L 1AO7A 4F57L 1SVCP 4P49A 3CSBA 5B38B 3QZWB 4Z7WE 5IFJA 1T1WA 3OPZL 5FB8A 3QFDA 4FQHB 4JR9L 5K59E 2HKHH 1NFDB 4P4RB 4M8QB 3QPXH 4D0DA 1I8IB 1U36A 1Q0XH 1S78D 2F53D 2BFVH 4P5KB 3RL2B 4BYHA 4IOIB 4LLYA 2EDEA 3QXUA 4LEXL 4P99A 3RVXD 1FZMB 2ZCKH 4FTVB 3EYOB 1QLEH 3K3QA 3RL1B 4HS8L 4PJBA 1HDMA 5L2JB 5CBEB 2NXYB 2NXZC 4ETQB 1QSEE 4U1LA 1ZXQA 3RIFF 4OZFG 1BQUA 2PXYA 2A73B 4N5ED 1D5ZA 4P57B 2JK5B 1LK2B 4F7PA 5E2UH 3EO1A 4YZFE 2DM3A 4YBQC 3TC9A 1G7HA 2APFA 4NQEE 4BSWB 1AGCA 2AABH 1KG0A 3BPNC 3IRPX 1A3LH 2E7HA 3HC4L 1P53A 2WANA 1U8IB 1SJXA 1BBDH 2QJDA 3RDTC 3FQUA 5MEQB 4G7VL 4XGZA 3O3DB 4HX1B 4PJ5B 4RMQA 2Q8AL 1CGYA 1LO0H 4OF3A 3HE6D 4Y2DD 3C6LB 5C0AA 3WNNA 4WHDA 4IJ3C 4YNYA 3U7AA 3SKUD 2VNCA 2Z8RA 1CGSH 2R2BB 1X5AA 2CLVA 4PJEF 3RVTD 4Y4HD 1E4KC 3WDHA 4V1DA 1W72B 4D0BB 2FJHB 5F8RC 5D1QA 5DHVH 4PJ8A 3PHSA 3KDMA 5HYEA 1FL3B 3SE8L 5LBSL 3KPRA 3IDNB 1O7VA 1K4DB 1BD2A 3LMJL 4FQCL 2R1XA 4G6FB 1MFAL 1JGDB 1WZ1L 1F11A 3CH1A 2GEEA 5GGUB 2P44B 1C8PA 1L6ZA 1NC4D 4NO3A 1JPFB 4N0YL 1UJ3B 4YPGA 4YX2H 2UVFA 1JGEA 1UA6H 1WIUA 3AFLA 4TVPD 3GIZH 3QUYC 5IR1A 4MX7B 3EJYC 1MHHA 4XAKE 5EC1A 2CH8A 3SDCA 5IESH 2VSCA 2EEAA 3VWJA 1ZLSL 5J11B 5EBLB 3GGWB 2Y5TB 4P2QE 5J3HD 1FAKT 3VJ6B 3P9WB 4WDIA 4ZPTB 4AENA 4NZTL 1D6VL 1KOAA 2NX5D 3BEWA 4JZJC 4XB7A 1DLHA 1DBAH 2YRZA 2HJLB 1CLOL 4UTAL 4JDTH 4LCUA 4OIAA 2EDDA 3RUGB 4UDUB 3NIDE 3Q5YA 3SDXE 2JF1A 3O45B 5DK3A 5I19H 3O2WL 2MOVA 1INQA 2YKLL 3WHXA 1X5LA 5SWSB 4YXHH 1OAZL 3V0AC 3FMGH 2VIRB 3DV4B 5IG7B 1N5YL 5TPWL 1L7TL 1QO3B 5DHYB 1DQQB 1KPUB 4OQ1A 3BDXA 3MRCB 2HJKB 1YECH 5IFAH 3BFOA 2PTTB 4PYHA 3CZJA 1HILB 2YD2A 3TH4T 1CU4L 3FHQA 4NOBA 3FO0L 4XNZB 1NSNH 2NY1C 5FYJE 2NXZD 1A1NA 5GGTL 3W9EB 1G9NC 5LXGH 2LU7A 3IB4A 3GRWL 3B2UC 4OFYD 3P4LA 5IQ7H 3GSQB 1N59A 5JOPE 4PJGB 4ZO9A 5FUCC 5INCB 4PRPD 4OCWL 1AGDA 4KVCL 3NZ8B 4LSSH 2E8ZA 2FGWH 4XPTL 3SBWA 1FO0L 4K71C 2YEZA 1S9VB 4HAGA 4D3CL 5EOQH 4PJCF 5GZNC 1MRCH 4NRZA 3AREC 3MNVB 1ZHLB 3C5ZB 3HZKB 2HT4C 3GMMB 4H25A 3ZSSA 5E2VL 1BOGB 4X98B 1RURL 4Q9RL 5JHDD 4CKVX 5C0EA 3KYMA 3DSNA 4XP4H 3VFPB 3GK8L 3DMMC 3FB7B 2PTUA 1U41A 4MJ6A 4HKXB 2AGJH 5GQBA 5DGRA 4Z95H 2EC9T 1LP9B 4PJFA 4KHXH 1QTYT 5E5MB 3JVGC 4PUBL 1AGFA 1D5IH 1KTKE 2V17H 4Y5VB 1NAMA 3IU3B 1F13A 2ZUYA 3REVB 4E9LA 4RRPA 4Q58C 1U8OA 4EDWH 1KTDB 2BY1A 4Y1AD 3KXFE 5F7NC 3PP4H 5DUMH 4OZIF 5JZ7C 2WIIA 4MA8L 4I77L 3RVUD 4HUWA 3WN5A 1TDQA 3F12B 2GTWB 4WY7L 4LPVA 4U1NA 4JRYB 3QUYD 3V6OA 3EJYD 3WSQL 2ZOKA 1HWGB 3RX8A 4PRBA 1IE5A 5DDHA 2HKFH 3GBNH 4MA3A 4PJDB 1JVKA 1G7MA 3UAJC 1SY6H 1LNUA 4CVXB 5KBNC 3I6GB 1EAPA 1PDKA 2AKRA 2VITA 2ITCB 2R0LH 3VXSA 4KK6D 4JM2F 2GCYB 4ZDHA 5EH1A 1HIMH 1U2CA 5E00B 3ET9F 3QRGH 3L7FB 5F6HJ 1G0XA 3BP7B 4HKJA 2WBKA 2VE6A 3QFJA 2A77H 2ZOLB 1BECA 3TT3H 1RJLA 3PGFH 4LPXA 4YBLB 5FYJU 2XXCB 4G8GA 1NLBL 2AQ1A 3CXDL 2X4RA 4WWKB 3PV7A 2YD5A 5C9JA 1AO7B 3GFUA 4U7MA 3HAEB 3B5TA 3I9GL 3QG6B 1N6QL 3VH8A 1MQKL 4UT7L 5IFJB 1T1WB 5HYSA 3QFDB 5HHMD 4GG6B 3H9SE 1FL6A 1M6OA 2CRYA 5GS0L 3R06A 4LSRH 4YE4H 3S34H 1CYGA 5JW5B 1HN1A 5TFSH 3EYFB 5IBLD 2W59A 1JYWA 4L1DA 3DURB 3TBTA 1A1MB 4RA3A 5JOEA 3SPVA 3ULVC 3MLXH 4KPHL 4FQXA 2VXQL 5J1AA 4WFGE 4WO4D 5GISL 2NY1D 1PEZA 5DR5H 1J12A 2NY0C 3B2UD 2P24B 3VDAA 1T03H 3CXHJ 4UOW1 2KL6A 5EUOE 4MQXC 4TYUA 4LFHD 4EXPX 4M7ZB 1KCRH 5DMGD 4RMTA 2QQLH 1F42A 3PUCA 3AM8C 4F7PB 2DQEL 5F70A 5I8KH 4CRPA 4NHUB 1YQVH 1QLRB 4LKXB 3VD5A 4ESKA 1S7XA 2WUBH 5GZND 3BKYL 4QOKA 3PF2A 1F8TH 1NMBH 4DN3H 2E6JA 4TRPH 1BWMA 3ARED 3ZHKA 5DJ8A 5DD1H 1AGCB 2X09A 3NCBB 3X13B 4K23L 4WI2A 5D1XA 1HKLL 1V7NH 1MLBA 4KGJA 3QI9D 4X80L 4O2EA 4X4XA 5DD6A 3DMMD 3T1FA 1DN0B 1CQKA 2AJZB 3FQUB 1AE6H 4FZ8L 4XGZB 4RWHA 3SGEH 1G6RL 1OF2B 1OY3B 3OAUH 3PE9A 4OT1L 4YNYB 4CNIA 1GGIL 5HGBA 4OZ4B 5FHAH 3I50H 1Z9SA 4ZXBB 2Q3ZA 4U33A 3T0XA 4X7EC 5E9DB 1J0HA 2IH1A 3RA7H 1ZHKA 2VXVH 5JXEC 5IW1A 4PJ8B 4X5XA 3KDMB 3NVQA 2BNUA 4F9PC 12E8H 3G9VA 4Q97A 3QP3A 5C07E 1OGAD 5FGSA 3UTOA 5JZ7D 1KN2L 4KGLA 3WXVH 3IYLW 1LO5B 1MJUL 2FZ3A 2HRPL 4PREA 5IFHH 4YPGB 1JGEB 4QYOB 3HKFA 3DIFA 2FX7H 3DUSB 3GSXA 5IR1B 4K2UH 1MHHB 3MLZL 1G9EA 3SO5A 2FCBA 1BOYA 3LQMA 3UAJD 1E4WL 1S7WB 3BQUB 3ARBB 3GSUB 2J1KA 4WDIB 3M1BA 4JRXE 2AEWA 5HYJE 2OI9B 3BEWB 4F7EA 1NANH 2QHRL 3Q3GA 1P4LB 4UQ3A 1I4FA 1T80A 2L7UA 4GRLA 4ELMB 1W72H 4U0RB 5HVWA 4E41B 5DK0A 1CD1A 4LNRA 2HH0L 3WHXB 1MRFL 4UMGA 4FFYL 3EYUH 3WNKA 3MC0A 3TO4C 3FOLA 4HIEA 5ILTH 4KAQH 3BKML 1HH6A 1LILA 1ZA3B 5F7YC 3WUWA 3MXVH 2ENSA 4ZODA 5B4MD 2QKIA 2VABA 5HHNA 4OZHA 2FX8H 4MXWL 4DFIA 3G5XA 1NFIA 4H0HB 4NJ9L 3Q6FB 3BDBA 3ULVD 2HLAB 2UWEE 1KCKA 2P4AB 2VDQL 1OT1A 3U0WL 1MI5D 2RIKA 3WYRA 3X3FH 3CC5B 3SE3A 5HSFA 3MZTA 2VXSL 1I3RB 3IDJB 5DT1H 5I73B 5EZJA 3BYYA 4JN2A 4O2CA 3O6KH 4CN6A 1JHLL 3LKRB 1AGDB 3DBXA 5ESAA 3VXUD 1IKNA 2OQJB 1VGEL 3KYKH 1QACA 2YEZB 4JREB 4M6NL 4HGWA 3OGCB 5HHVL 5I71C 5FYLE 2QEJA 4ZSOB 3SO3B 4MB3A 4NRZB 4XI5C 4J2XA 4W70A 2X41A 2OZ4L 4L5FL 5CGYC 3OR6B 2HTLC 3TF7C 2OL3A 1GGUA 4OTXH 1QFHA 4L3AA 4GAYA 3FQRB 3ZKXC 3MROA 2JCCB 4NFCA 1XR8B 1A7QL 4I18A 5FYKL 3S5LG 2Z4QB 4DZ8A 1K8IA 2CO6B 4NKQB 4UAOB 2R2HA 3MCG1 1FNSL 4ZUUA 5F6IB 4LQFH 3VRIB 4Y16A 1LDSA 4DKAA 4PJFB 2XA8L 3ES6B 5A2KH 3S37H 1NFDE 4BJLA 1IARB 2BNQD 1GGBL 4L3EB 4ODHH 5T3ZE 4XHJC 5J1TC 4FQ2L 3WLBB 5FCUL 2JELH 2GJJA 3O8XB 1KLFA 3MLSH 2X70B 3S3JA 4BH7B 4G8IA 4YHLH 3MUGA 1MHEB 1P7QD 5EZOH 4MB4A 2VLRD 4DAGL 1KFAH 4F9LA 4U0QB 4HS8H 2CD0A 5DEZA 3CVHL 4HUWB 5T1LA 3VG0L 3T3PE 4CN4A 1RZ7H 5EU6D 1R3KA 3VFNB 3NCMA 2MQCA 5DDHB 5KANI 5BZWB 4XBEH 4J6RL 2AKRB 1KXTB 1JCKA 2VITB 3T2PA 5JW4M 4WHCA 4DW2L 4HC1A 4IOFC 3ZKNC 3DX9A 4CW1A 3BRGC 3ARGD 3ULSB 3VFWA 2DF3A 3CFBA 2M26A 2VE6B 1UG9A 2UY6A 5CWSA 2HA1A 4PY7A 4EOWH 3VD7A 4G7VH 4X9GA 4G8GB 3VDCA 4PJ5E 5C9JB 2YUZA 4X6CF 5I1KL 3UTSB 1NCCL 1F90L 4P46A 3MNWB 4RBPK 5FA3B 4XPBH 4LPTA 1KCSH 5HYSB 4F33A 1FL6B 1QG3A 5HYIA 5KS9F 1MY7A 2XT1B 2DDQH 5I1GL 4LVNC 1S7QB 5ADOH 5FUOL 1WZ1H 1HNGA 4QHNB 3SPVB 1VADA 1D6EA 3ZDZF 4YK4C 5C3LD 3P73A 3QNXA 3HG1B 3QQ3A 4X6FB 3ARFB 5F88B 2O5ZL 15C8H 1RUQL 1KJ2L 5I74C 3KR3H 1QEWA 1OQOA 4PTUB 4EVNA 1YMME 1E27B 1CT8A 3S35L 1IFHH 4GG8A 2DLIA 3EGSA 3MRJB 2IAMA 4HDIB 3HAEH 4NZTH 3KPMB 4XI5D 1T0NB 3EDDA 5DJ8B 3KLSA 4HWNA 2ATPA 3SQOL 2R0KH 1I8KA 4XVTL 5CGYD 1CLOH 4LVOC 4UTAH 5ID1A 1OOAA 4QHUB 4X4XB 4GMTL 2UV3A 1NGWB 3JWOH 3OKNA 2YKLH 3T1FB 5I75C 1C7TA 1MCEA 1OAZH 3MV7B 4YDVB 2H26B 3PHQA 1CN4A 2FB4H 1IC4L 3MUHL 1PW3A 4WW2A 3RZCC 3RY4A 1LD9A 2EXYC 2F19L 5JNYB 1J86A 3VI4E 5I9QB 3VFRA 3FN3A 4AIZA 4S0TD 1X6LA 5IW1B 5LAXA 2AK4E 1MFBH 1PYWA 1CU4H 2NY4C 4AG4H 1X5IA 1FYTB 5GGTH 4FXGA 3WIHH 1WJ3A 3GRWH 4YFLI 3TBVB 4HCRA 3GMRB 3BKCL 4U49A 1IBGL 2OBGA 3VGEA 5F7HA 3UTTA 2EDTA 4PREB 2HVKA 3PWNB 2AXGB 3BGAA 4PJGE 2P5ED 2F8VA 2B20A 5C0JB 4Z5RB 3QJHA 1A22B 4ONHA 3B8YA 3L3GA 1MCWM 2Q20A 2HVJA 3CVHB 4ZO7A 1ZT1A 4HMEA 4B41A 3E3QE 1WISA 4IOFD 2GFBA 3ZKND 4JO3L 4HWZB 4OF8A 4N0UB 2ZCLL 4ZAKA 5CILH 3DOSA 4G8EA 5E2VH 4ALAH 5L7XL 1BBJA 1H3UA 3TIDA 4KKLC 3Q3GB 3P4NA 3MGTB 2QLVB 1QFWI 3I3DA 3U1SH 5HDOA 1ZTXL 2XRAL 1IAKA 4RMSA 1AIFA 3IDIA 3LS5H 1XMWA 2DTMH 1LEIA 1MNUL 5BRZD 3T4YA 3LB6C 2F74A 3VI3E 5DTFB 3VXQA 2R9HC 4IRZL 2R56L 3FOLB 5HHOE 1LP9E 5FO9A 4ORGA 2H1PL 4LP4A 5BJTA 4HIEB 4WW1A 2VQ1A 2H8PA 3ZL4H 1CF8L 1FFNA 2JJTA 4KUCD 3BN9C 3G6JA 3SE9H 2BSRB 5L8KB 4OM0L 3HLAA 1DBMH 1GC1C 1UWEH 4U6VH 5ANMA 3RIFK 5IEKB 4FQIH 2JJWA 4QXTB 1Y18A 3TH3T 4I77H 2BSED 3CAFA 2E6PA 4WY7H 3GSNL 4M5YL 1F4WL 3LN9A 4UQ2A 1CICA 2DQIL 4JRYE 5KSBA 4FQLL 2NY3B 5EZJB 3MSPA 3UYRH 3OTTA 5D7LA 4Z8FH 4PJDE 3V6ZB 4YDIH 4U1IA 3DBXB 5ESAB 4HPOH 4OLWL 5JO5A 4R0LA 1WZKA 2BVYA 3DTXB 4HGWB 4RBPH 2AJYH 1T83C 4TULH 5I66A 1YYLH 1XZ0B 2PW2B 3UYPA 4PS4L 1GSMA 2OL3B 1BZ7B 1QSED 1QZ1A 3HS0A 1NLBH 1WC7B 5K93A 5CINH 1RQ5A 3EZ8A 1Y6NR 1AO7E 4I18B 1CD9B 1TMCB 3BMVA 3I9GH 4JG0H 1QP1A 1MQKH 3F6IA 5EBGA 3RZCD 3DX7A 5GS0H 2W9DL 5TGBB 4HG4J 2EXYD 5D7IA 2PO6A 5T1MB 3JSSA 5CS7A 4BFEA 4NZRL 2F8OA 2DLTA 2VAJA 3PWPA 4M7JH 4NQED 3KWWA 2J6EA 4HQQL 4PJ9B 2KUTA 3RY5A 2W1NA 1NCBL 4JO2H 3KYAA 4G8IB 5EORH 4HUNB 3MUGB 3NN8A 1MCQA 4YAQA 3HNSH 2FSEB 5HGHB 1BWWA 4HIIA 3VGFA 4D9RE 3BGFC 4APQB 5FO7A 3QWRD 1VA9A 2G2RA 1YEIL 5EFIA 3I3EA 4JM2B 3V0WH 1TETL 2VR9A 3C5JB 2WBJA 3AU1B 3QA3A 3QAZB 3LDBC 1KEMH 2DQEH 4ODUA 4NDMB 3SE3C 1NH6A 2IGFL 3HI6L 3HTLX 4LHUA 5D2NC 4JFDB 2RQ8A 1JZ8A 5TH2B 5C0BD 2OP4L 4UV4L 3WFBL 1A6AB 4LU5L 5CJ5A 4I4WA 3CFBB 2Q1EA 4WUUD 1A7RH 2YN5A 3UXFA 1K3ZA 3MO1B 2IPTL 2UYLA 4X9HA 1RZKL 2WWMC 5GS1A 5E6IB 3FN9A 1G6RH 1XR9A 4XAKD 4M1CC 3LKOA 2MMXA 5LQBL 1J9CT 2R9HD 4P46B 1XIWC 3QNYA 4A2MA 3IGAA 1T4KB 4J3UA 2YD8A 2VDOL 4OCRL 4M5ZH 4V1DE 3BN9D 3O2DA 4QY8A 1CFBA 3Q2CA 1F3JB 4X99B 5D7JD 1C16B 4H1LB 5ALBH 4J12A 5FEBA 5DURD 4XZUA 2NCMA 1RZ8A 3EFFA 4ZOCA 5TE4H 1BD2E 3TZVB 3VFVA 3CZFA 2EIEA 3TWCH 4U6XA 1S7TA 4K8RL 4LCCC 1IQWL 3QQ3B 4PBVC 5BV7B 2Y7QA 3MBED 4D9QE 4ONGL 3RGVC 4EVNB 4DOHB 3L5XL 1U8MB 1JGVL 5M95B 3IT8D 1CT8B 3K8KA 4JQIL 1QD0A 4WI9A 3EGSB 4JHWL 5FOBB 2ZUWA 2XTLA 1G1CA 2IAMB 4LIQH 2EDLA 5JW4R 2LABA 3GSNB 4FMFA 1A7OL 1HHKB 3RAJL 3VGHA 4H26B 2ATPB 2A0LD 1AQKH 2GIYA 1NQBA 4ONOA 4GOSA 4PRIA 3OWEA 1UB6B 3OKNB 1N8ZA 1I3GH 3LS4H 3WHE0 4U31A 1MRFH 2GJZA 5JOPD 4FFYH 3M07A 4PRHA 1U8LB 4LCWA 1YN7A 3V52H 3PHQB 3T77B 5TE6L 1FNHA 4WW2B 5CEYA 1U3HC 1W8NA 2G5BA 3VGAC 4RMUA 1RI8A 2BVOA 5DVNA 1EGJA 1LD9B 3MRLB 3D0VA 3A67L 3ROLB 5EUKB 4NCC2 5IW6B 5LAXB 4GBXA 5DJDB 5KSAB 4LGPB 1HOCA 4N8PA 4U6YB 4IRJD 3MV9B 1I75A 5EU7C 5T1KA 4FXGB 1SJEA 2DBLL 3K7UA 3H0TA 5D70H 4KC3B 4O5LL 2HVKB 3FT3A 3FHAA 1UENA 5CP3A 5C0CA 3VGDA 1JHLH 3QPQC 1DQJB 4YHMH 4AIXA 4M61A 3MRQA 2Y1VA 3QJHB 5L2KA 3L3GB 3HPLA 1OL0A 4G43A 1EUUA 5MEOA 1DQLL 5KN5B 5FDWA 4NJAL 4H8WC 3E6FB 1AHWC 2OZ4H 4G8EB 4L5FH 1KT2A 3GB7A 4Y4FB 4X9BA 5DC0A 3NCEB 1UM6L 4EBQL 3D3VD 1AFVH 1DQDL 1WIOA 2JCCE 3VDBA 3C60C 1A7QH 2EH7L 3HE7C 5D8JH 4PGEA 1Q9KA 5FECA 1OP5K 1AIFB 1NGPL 3K81A 4M1CD 4UV7H 1AXSB 1LEIB 1OTUD 1MCIA 3TJEH 1XIWD 3VXQB 4ORGB 4PJFE 5BJTB 1JTPA 3UBXA 4Q9QL 1KB5B 2VQ1B 1FFNB 4PJHF 4L3EE 1FBIH 4KU1A 3TCLA 4FQ2H 3G6JB 2WINB 4NSKB 4Q6IC 1I1AC 1KJMA 3DSFL 5AYUH 1PX4A 4XNUH 4DAGH 2EDOA 5ANMB 2LVEA 4HBQA 2Z31A 2W60B 4RAVB 1S9XA 3CVHH 1PZUB 2X1XR 3CPLA 3W0WA 1HXMA 3ZDXF 3RGVD 3BKJH 5DUPL 1M4KA 3V6OE 5TDPB 5C7XL 2NY2D 3D85D 2A6KA 3G5YB 1OTSC 2BCKA 5D7LB 3L3JA 1FLRH 3CFJB 4U1IB 5JO5B 5CD3B 4R0LB 5F72S 4NQSB 5IMLA 1RUKH 3L3KA 3MJ6A 4I0PD 2G75B 3GMNB 3BWUC 5FGRA 4JG1L 1DLFL 2Y36L 5I0DA 4P2RA 3PGDA 1MOEA 3VWKD 1I1FB 3S37X 2VLKB 3UMTA 4HZLB 3MRGA 3LKSB 3QIUB 2ADIB 2YHGA 3HS0B 2R29L 5JW3H 4ZAKC 4G8GE 4WEBL 4KJQD 3QXDB 5GHWL 5I1KH 1Q94B 1F90H 3UTSE 3BRFA 2D4FA 4L8BA 4M7LL 2Q6WB 3ULUE 3OKOB 5F89A 4PJ7F 4I3GA 3SCMA 3W81A 2AP2A 1U3HD 2V7HA 5EZLB 1BVKA 1T7WA 2PO6B 3PWPB 3KWWB 5KAQF 1WWCA 3AY4A 5FUOH 3SKNB 1OLLA 3QQ9D 4L1HA 3KVQA 1LO4L 5MENA 4Y8DC 2NTFA 1I9RL 2JJTC 1IJ9A 2VZ3A 3C87A 5ESQA 3VXRD 2PCPB 5FO7B 1RUQH 2A9NL 1A3QA 4LLMB 5I1IH 2O93L 4R7NB 5EFIB 4R96B 1GAFH 4QHLA 2ATKA 1ZEAH 4M1GH 4EN3D 4ZTPL 3QPQD 3GUTB 4B5EA 5HDQL 3QUXC 4UIMB 5FA4A 3L5JA 2OL3H 3FT4A 4ODUB 3HPJA 1U92A 4NQCA 4S11A 4QOKE 5C07D 2D4DA 5JA8B 4LQ1A 3WS6C 3SQOH 3X17A 3B5GA 4GFTB 2V9RA 2NQCA 3IETB 4IRSD 3C60D 3HE7D 5EU3A 1CFSA 2UYLB 5KS9B 3WJLC 1XR9B 2J5LB 3RY6A 4X9IA 3LKOB 4BZ1L 3CMOH 4HXBL 5HGAA 1YEKL 4M9PA 2QR0A 2AJUH 1ZAGA 3OKEA 3MODH 3QNYB 4Y0GA 1EO7A 1I1YA 4KUZL 5IVXF 1EBAA 2UVEA 2V5SA 4OLXL 5KTEH 4JRXD 2H6PB 1SYVA 1WTLA 2W0PA 3QHFL 4FA8A 1KCVL 2YZ1A 3VFVB 3CZFB 3PL6C 4HMCA 4Q2ZB 5EB9A 3MJ9L 4U6XB 2ARJB 1EMTL 2DD8H 4OAWB 2DKSA 5D4QA 4Z77A 1NBVL 1F5WA 1Y6MR 2Y7QB 4P5MB 2CIIA 1UVQB 2DKMA 2Z9TA 1IL1B 1OTSD 5BZDA 5HGDA 3BIBX 1IC7L 2XWTA 1E6OL 2LTQB 3B6SA 3N9GL 5D1ZD 4XVJL 1PZ5A 2F5BH 5L7XH 3OBAA 5LGJB 5DZNA 2W0FA 3NIFE 3QUML 4F8QA 25C8L 5CJOL 5EA0L 4LFHG 4HLZG 1IT9L 4W4NA 2JIXB 4PRIB 1JHKL 2C5DC 4GAGH 4H1LH 4KK8C 4ORZC 3PABA 4CVZB 4YIQA 4M6MH 1YN7B 3V4PL 3A0OA 1EO5A 3AB0C 1CDJA 2NNAB 3BZ4B 5I2IA 1MWAL 5F9JA 5J11C 4S1SH 3L3DA 4MYWB 3FRPA 3KPQB 3B9KA 3EDKA 5BV7H 4OZHE 3L3OB 4NKMB 3OKLB 3OHXB 3TT1L 2GSGA 4NCC1 1A14H 3UZEA 5B39B 3MRPB 2OCFD 1HOCB 2A6IB 4GS7C 1EJOL 1MCBA 1A6ZB 1MPAH 2X4PA 4H0IA 4UTBL 1KIUA 5HY9B 5T1KB 1SJEB 4L29A 3EKCA 3GSNH 2A1WL 4M5YH 1F4WH 1KIPB 3T3MF 5BW7C 2ICEA 2ZSWB 4AMKH 2NZ9C 4DTGL 4C83B 2KQMA 2DQDH 3B2VL 5CSZA 2QSVA 5FM8A 4C56A 3GEWB 1MUJB 3K2MC 2DI8A 4OLWH 3MRQB 1X5JA 1T6VN 2DQTL 3VFSB 1KJVA 4KTYA 5IT2H 1MJ7L 4JDVA 1OPGL 1D5BA 1MY5A 5FDWB 1WSST 4LLAA 5ICZA 1K8DA 4YXKL 1IAIH 4FTVD 2RFXA 4MSWB 3QUZB 3B9EA 2APVA 3TESA 4XNZC 1T5XA 4I9WD 1KT2B 3GB7B 2QSQA 1R0AL 5EIIA 2NXYD 1VKXB 1J5OL 3TFKC 1NCWL 2YPVH 3F6LA 1ZGLB 1TZIA 3CU7A 5IB2B 4PGEB 5DRWB 4MZ2A 3CCHA 3UROR 1Q9KB 3VFGL 3HC3L 3RNKA 3FB6A 4X7SL 1BZ9B 2BXYA 2CPCA 5I1LB 3BO8A 5IIEA 3EBAA 2AERT 2W9DH 4TVPL 4GUPB 2XY1A 5MEPA 1WLHA 2P8PA 3C5ZC 4GJTB 5IB1A 5KANG 2XTJC 1NCBH 2BNRA 3ZE2F 5TQ2L 4YHOH 3BJLA 3VRLE 4K7FA 3PL6D 3IRZA 2VC2L 5FM4A 5SWZB 1EFQA 5DD3L 2H9GB 1S9XB 3S7GA 1JZ7A 4OQTH 4PJ5D 5DS8B 4URTB 1YEIH 2P5WB 3CPLB 1HHHB 1TETH 3C6LD 5GRJH 1FPTL 1JE6A 1OAXL 4KV5E 4XCCL 4L4TA 3REWA 4O51A 3L3JB 4LRIC 5K9QI 4JGJA 1QHOA 4OI7A 4AZ8A 4Z78B 3PIQA 2WLZA 1N64H 3LRHA 4UIKL 1OGTA 2OP4H 3ELAT 3NCJH 4UI2A 4LU5H 4G6FD 4M43L 5K9JH 3FN0L 3E2HB 1GIGL 4JY4A 3VFOA 4WI7A 3QDMB 1KB5H 3MYJA 1RZKH 4KK8D 1VERA 4YDLB 2FDBP 4X6BA 4JM4H 5LQBH 5I1JL 1WFTA 3JUZA 4L8BB 4XP6L 1IGCL 2VDOH 5F89B 4OCRH 4NQXA 1JNHA 1QSZA 5J89A 1CE1L 2Y4SA 3I3BA 5T1DL 3PQYA 4P3DA 2V7HB 2VDPL