1R24A

Fab from murine igg3 kappa
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
206
structure length
206
Chain Sequence
DIQMTQITSSLSVSLGDRVIISCRASQDIGNFLNWYQQKPDGSLKLLIYYTSRLQSGVPSRFSGWGSGTDYSLTISNLEEEDIATFFCQQGKTLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IGG3-KAPPA ANTIBODY (LIGHT CHAIN))
publication title The role of homophilic binding in anti-tumor antibody R24 recognition of molecular surfaces. Demonstration of an intermolecular beta-sheet interaction between vh domains.
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 206
sequence length 206
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r24A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r24A01
3F5WB 5D7LB 3MLVL 2D03H 4OGXL 3ZDZF 1U42A 3LH2L 3V8OA 1YC8A 3KJ6H 4F3FA 3JTSB 4NQCD 4XP5H 4D0CA 2EEDA 2DQHL 3UTZA 4BELD 5FO8A 5ANME 5IROA 3KLDA 4XB7A 5I9QC 1VENA 1NAKH 4NFDA 1UQSB 3I50H 3ILQC 4QTHA 4TUJA 4WUKL 5DK3A 4QNPF 1LO0L 1D6VH 1S78D 2DTML 3WHXA 4ELMB 3RQ3A 2Z91A 4R0LA 1CDHA 2HMIC 4UILL 1MEXH 3BI9X 2CDEB 3DUSA 2XFXB 1U2CA 1XIWA 1T1XA 4XPHL 1Z5LB 3SOBL 1I8IA 1KPVB 5IROC 4K07A 4YXHL 2F74A 5KAQG 2F54A 3N1QC 3PGFL 4FQCH 3MPCA 1NUGA 1RQ5A 3O3BB 3PHQB 4R0LC 5A1AA 5I8EB 3JTTB 2YMXL 3WIFA 2P24A 3SBWA 4PRPE 3W0WE 2IANE 4BZ1L 4F15B 1IGMH 1C5DB 4Y2OA 4R7NB 4E5XA 4R26H 1LE9A 5CJOH 2WP3T 3WFHB 3EHBC 5C0RL 1IFHH 3CJJA 5T3ZE 2D7NA 1CVRA 1DP0A 3KYKH 4LLUA 4JRYD 4S1DD 3T0EC 5L2JA 3SDDD 3OAYK 1FN4A 1J88A 4HS8L 5JW4N 4N8VG 4JFDB 1DN0A 1HOCB 4F7TA 5FM5M 5IVZA 1HWHB 3ALXA 1O7VA 1CGWA 1P4BH 4TTDD 1UB6A 4M8QA 4K7FB 1YEHL 2OM5A 2F53E 3S3SA 2SEBA 5EC2B 5F7YC 3NIGE 5CIPB 4M7LH 4RISL 4X7SL 2C7UA 4G3YH 4PJGE 3SY0A 3BWAB 1IM3B 4FQ1L 3EDFA 4CADB 4L3EA 4MLSA 4AM0A 2EIZB 4GKSB 5F70A 4YEFA 5FUZL 1YNLL 5EOCJ 3HPJA 1B9ZA 1KJVB 5IG7B 5DURB 3VRIA 4YEEA 4MJIB 4EN3B 2CK0H 2YKLL 1FE8H 2ORBH 3UEZA 4HEPG 3AM8A 3VFUA 5BJTB 2CQVA 5FB8B 4D3CL 5I15L 1TJHL 3UMTA 3EYVB 3MCLH 3SE8H 5ICXA 1AFVL 3UYOD 2MPAL 1NGZB 2O5XL 2HVJB 2IFFL 3L7FB 1PJ9A 3AM8C 1C16B 1XCQB 4HKJA 1RUQL 2CLZB 2DYPD 2O5ZH 1GGUA 4K3GA 4RFOL 3OB8A 1ETZA 5EOCH 4ZFGH 1KN2H 1MF2L 3EFFA 1QTYT 4FQLL 4YLQT 1JN6B 4QHLB 4P9MH 3GI9H 1EZVY 5KVEL 6FABH 2C5DC 3QDME 3ULVH 1GAFL 3GB7A 2XWTA 3L1OL 1LO2H 4HW6A 1JF1B 3HCVB 3QCUL 2DWEA 2NNAB 5ALCL 3MGTB 3GBNH 5F1IB 2IAMD 4OM1H 5T1KD 3T0WA 4KZEL 3MRHB 4Y1AD 5J57B 4HLZH 5I18L 1N64L 4WUUD 3FOMB 3ZE1F 4XAWL 1XF4B 2BXYA 3X3GH 3L3DA 3WS6A 4R4ND 4PGJA 1I4FB 1BFVH 5IHZB 2CJUL 2DWDB 5F9DC 4HGWB 4BFGA 1D5BA 4JKMA 3MXVL 3CGTA 4LAJH 4N0UE 4U6VH 4MNQD 1DJSA 5ADOH 2CR3A 3EO9L 1PYWA 2H9GB 3BEVB 2BRQA 3BGMA 4DQOH 2IG2H 2ZCHL 2IH3B 3VG9B 3O0RL 1KCRH 3O6MH 4RMTA 4GKOA 5ICZA 4HKZB 1LDPL 1CICB 4OFYD 5JDSA 1UJ3B 1I85A 5D5MF 1FZKB 4S1QL 1IGCH 3QUXA 2E7MA 2MCPL 3TH4T 1D9KD 1MCDA 5CJQL 1TZHB 4J12A 3R06A 4NM8L 1EUTA 5GRZA 1EX0A 1BD2B 4Z77A 1QSEB 1KACB 1XF3B 4Y5YA 1NFIA 3X13A 5I1HH 1X5IA 3GMLB 1BQLL 1I1AA 1K2DB 1I85C 4KJQC 5GJSL 3MOBL 4PJDA 2FYYA 4Y4FA 1EO5A 3QUZD 1JPTH 4ZFZB 1KB5H 5FA3B 4C83B 4P2YA 3DGGB 5B3JF 4L8CB 5EU6E 3RA7L 3BJLA 1DQDH 4LF3B 1JHTA 1QSFB 1AD0B 2GITB 4Y5YC 2C3VA 1AGFB 4QOKE 1J8HB 4U1IA 2OQJA 4G6JL 1ES0B 4JGMA 1T4KB 3GZKA 4ZUSA 4D0BA 4M6AA 4UTAL 3WFEH 5GZND 2HH0H 5DRWA 4ISVA 2NX5D 4NZUH 4HF5L 1KB9K 4JPWL 1UACH 1NKRA 3NAAH 1AKJA 1K5NA 3RI5K 3T04D 3UJJH 3WFBL 4ODWB 1QYGL 5DJCB 4FFVD 3P4MA 3MLUL 1HXYA 2PTUA 2OTUB 5F6IC 2P5WE 1K3ZA 1RK1B 4NRYA 2UVEA 4PJIE 1WTGT 5E8NA 2CH8A 4MYWB 1J1PH 1X44A 4FS0A 4ODHH 4ZFFB 3OTTA 1ACZA 3QO0B 3RTQB 5DRNB 1F4YL 2QADD 3WIHH 5BO1L 4X83A 2V5RA 1D5MB 1JWUA 1LP9B 3NCYS 1J18A 4DUXA 5ACZA 2Y4SA 1A7OL 1CFTA 1AGBB 3WO3B 4WFFD 3QCVH 3HMXH 2VN7A 4DAGL 2XTLA 3P0YL 4HQQH 4LPUA 4AYFA 1KC5H 2FSEA 2H2PC 4RMQA 3V7AE 3KPLB 4LSQH 3WKML 1QO3B 5I8OH 1ZWIA 4APQA 4Z78B 2FJHB 4XVJL 4JANB 5K9JL 2D2OA 3C87A 1FGNH 4JFEA 3QH3B 3M45A 4OKVB 5IEKA 5L6YL 1CD0A 4DFIA 1QVOA 5BW7A 4M7JL 2R1YA 1F5WA 5F8RC 4APQC 3G5YA 3BH9A 4XNZB 2X40A 5IB3B 5JHDD 5LQBH 2EKJA 1A3RL 1EO7A 2XG5A 3TBSA 4BYHA 2YSSB 2APVA 3GGWA 5IQ9A 4HWZB 3L6FB 3BUYA 5BW7C 2YUXA 2PW2B 4P2RE 2V7NA 4X4ME 1F11A 2J3SA 1U8MA 1KN4H 3WUWG 1BJ1J 1UWGL 4NN5C 5TE4H 5GS0C 1OWRM 1JGLH 3D18B 3MRJB 1NJ9B 1ZS8B 3F12A 5CS7A 1BIIB 1V7MH 4LNRB 4CAGA 3GUTA 4Z7OF 4RA0C 4MDJA 5C2BL 4KJYB 1AR1D 4N5EC 5F7FA 4G6KL 4WHDA 1JI2A 1H8SA 3OL2A 1U8QA 3DX8A 1ZV5A 3U9PL 1IEAB 2EIEA 5DS8B 3QA3A 4NJAL 1KCLA 2BHYA 3M17B 5FYLL 1RIHL 2X4NB 2Q8BL 4F57L 5GS2H 4W6WB 1Y6MR 4LSVL 5ACMA 4H88H 3CC5B 3HLAB 2EXYC 4KAQL 5HHOB 1PD6A 3VDCA 2GSIA 5HYJE 4KVNH 1BJ1H 4U1JB 5HHVH 2LVEA 1EJOH 4M43H 2VZSA 3KLAB 1F3JB 4YDKL 5HHMD 3UTQA 2I9TB 5DFTA 4WI9A 2DAVA 4GRWE 3ULVF 3S96B 25C8H 2ITCA 1J1XL 1P7KB 3MYZA 4G80B 4NN7C 5CP7A 1ZLSL 2E6PA 3WLBB 3B9KD 5ANMA 1A1MB 1ZK9A 3C6SB 3ZL4L 5LKNA 4JZJA 4D8PB 3MRNB 1NEUA 4KHXH 4F8TA 3IGAA 4AMKL 5CZVH 1VKXA 4GBXB 2Z92A 3VD7A 4HKBB 1L6ZA 4Y5VB 1I7RB 1JHKH 5M95B 5F7EH 1FVEB 1KBGH 2DD8H 2AXGA 4DVBA 4L8SB 4E0RB 2I07A 3MNZA 1KXTB 4P3CL 3O9WD 4PYGA 2GK0B 1Q9OA 3AREA 1TMCB 1LO5B 5IV2B 1YYML 4WJ5B 3KXFD 3K8KA 4A6YH 1U3HA 3F7YB 1JMXA 1AGEA 5KTEH 3VGHA 2VXQL 1TFHA 3MBXH 4PRPA 2IANA 5J6HB 3BD3A 1HH6B 1UA6H 1FZJA 4M02A 2EO1A 3AREC 4HUMB 4GRLB 4H20L 4ZD3L 3GJEB 1MFAH 5D2LB 1GOHA 3NTCL 4TPRH 1F45A 2OS7A 5HI4C 3A6BL 2CMRL 4Z7WE 3TBTA 5ESAB 1MHPL 4AT6B 4P59H 1U8JB 2DTSA 5FHAL 3KVQA 3C6LA 4MXQC 4U1KB 1NC2D 3TA3D 3HG1D 3DURB 4UDTB 1D5IL 2Y06L 1FBIL 3DI3B 1T5WB 4J8RB 3ZE2E 2R9HD 1XGPB 1JPSH 4FQXA 4KKBC 3O4LB 1A7QL 4XHQA 4R4FH 2F53A 1AXIB 3T8XB 4GQPH 4GW5A 2WWMD 2H32H 1R24B 3C6LC 1A1OA 4YJZL 2BVPB 4GQ9L 3QUML 4PJGA 3W9EB 3H0TA 3OR7B 1KGCD 3CH8A 1A7RL 1R3LB 4QRRB 3VXME 4LDEB 4FQXC 1T2QH 4OB5L 4DCQB 2CDGB 3RDTA 2EIBA 3UTSB 1N6QL 4FZEL 3D39D 4JQVA 5E9DE 1K6QH 3T2NH 1W8NA 3IDJA 1A9EA 5DHVB 2VLKD 2FD6H 3ZTJG 3CFCH 5C2UB 5EZLA 4HAFA 4NC2B 3G5ZB 15C8H 2Q8AL 4X99B 1IC4H 4DN4L 3R0MA 4XMPL 3HZMA 5GGVY 1KJMB 4WEBH 1NFKA 1H0DB 4JQVC 1ZLUH 2J4WH 4GLRH 1FLRL 4XCFH 4JY5L 2NZ9C 3QXAA 4IMLB 3TIEA 5DMKB 4N8VB 4JM4L 1MWAB 3BVNA 3BZ4A 2W60B 5DVKA 5JMOC 4DVRL 3A67L 2OZ4A 3MLYL 4E41E 5L88H 2V9TA 2VDOL 1MLBB 3DTXB 3L3JB 3HPLA 3NIDF 3V8CA 3WIIL 3C9NA 5F88A 5MHSE 4JPIB 2VLLA 4KDWA 5LBSH 1QNZL 3V5KA 5C0BE 2EKSB 4ODUA 3MCG1 3QDMA 4Z5RB 3DNKA 1MRFH 5E2VL 4K23H 4PJXE 1VSCA 1JGUH 3MFFA 1IQDA 1UGNA 4FABH 4L5FL 1S9YB 1MLCA 5KOVC 1CFVL 2ICCA 1QHPA 2ZNWA 3QISA 1OTSC 4H5SA 5DRXB 3OPZL 1WQVT 1YJDC 3GSXA 3DUUB 1JFQL 1J5OH 1I8KA 3JWOL 2C3WA 3MLVH 4WU7A 4Z95H 4OGXH 3VXSD 1AC0A 5EC1A 4N0UA 5DJ6B 2V2TB 2DQHH 1T5XB 3CDGB 3KPRB 3T65A 4R7DB 5BRZB 4K8RC 5BZWA 5FYKE 1KIPA 3R1GL 4WUKH 4OBRA 4NPYA 1LO0H 2DTMH 2VDRL 2JCCF 1KLGB 3ILPA 3GSOB 1G7JB 4TVPL 3SDXB 1QLRA 2OSLB 2I5YL 3IJHB 5E0QA 4UILH 4G8FA 5TE6L 3CNKA 4OAWB 5CJ8A 5B38A 1OD7A 4WFED 3C8HA 4XPHH 2RCSH 3SOBH 4HULB 5C0IA 2R23A 4F33A 4YXHH 4PLKD 5I75B 4WIQA 4OZGF 4O2CB 2V9RA 3PGFH 3VU2A 3BKCL 2Z35B 4WU5B 4JZOB 2NTFA 2HAZA 1VFAB 2YMXH 4NNYA 4BZ1H 4GW1A 1CD1A 3VXUB 2X4SB 1JZ3A 3L9RA 5FHBL 2WP3O 3IXTA 5I17A 1YN6A 3KPPA 3HN3A 2YBRB 4RNRB 4YH6A 1U8OA 5EU6A 1P5UA 2G5BB 2VE6A 4D9QE 3PP3H 5TDPA 2AV7A 1ZLVK 4I48A 4R96A 3BO8A 4QOKA 2WQ8A 4KHTL 1OAQH 2ZUVA 4M1DL 4HS8H 4ZOAA 3B43A 5EBLA 1EEQA 3CIQA 4CGTA 2HLAB 5LGJB 2EYRA 2Y5TA 1IMHC 1MCJA 1QP1A 1G0XA 4Y5XA 3MR9B 4EIGB 1YEHH 5KS9F 2Z93A 4X7SH 4G8EA 5ESQB 2P5WA 2EE2A 1EUUA 4PJIA 5F7MC 4ELKB 1MI5B 3MV7D 1X7QA 2BMKB 4FQ1H 4CU6A 5I1KL 1R3HA 1QG3A 3ZKXB 1CLZH 1S7WA 2APXA 3HS0B 3RVVD 4C58B 3OJVC 5FUZH 1EEYA 4GSDH 4R4BB 3RVUC 4OZIF 2EE6A 3KPMB 3V0WL 5E08L 2YXFA 4X7CC 5EIVA 5SV4A 4Z6AT 2CGRL 3OKOB 2YKLH 4LLMB 1GZPA 3DSFL 4AEEA 4D3CH 1JMZA 1RUPL 3RVTC 2O5YH 3EFDL 1TJHH 1UZ8B 1YPZE 3SQOL 3L3HA 3VXRE 1EBPA 3CXHJ 2R4SL 3EO1A 2ICWJ 1AFVH 5DI8A 2MPAH 3LEXA 4MD0A 2O5XH 2IFFH 3NABH 3OG4B 3LPFA 4PPTA 5J11C 2GAZB 3TBVA 4PJ7F 3TFKC 3ARFD 4QRSA 4POZC 1KULA 2OL3L 3KPOB 5I8CA 2VISA 4V1DE 1TCMA 1ODAA 3MRLB 2FHCA 4YHNB 2VDPL 5SWSB 2DM3A 5KVEH 3BPNB 1CE6A 1GAFH 3V5DB 1VFMA 3L1OH 2DQIL 3QCUH 4LHUB 3BW9A 2XTJE 1FH5L 3DIFB 1XF5B 3CH1B 1A6AA 1U3JA 2RGSA 3HAEA 3QFDA 4BKLA 1OTUC 3PDGA 4KZEH 4P2RA 2HT3D 4X4MA 3PJSB 1WGOA 5I18H 2RFXA 4PGCA 3S36L 1N64H 5MEPA 3PABB 5EU7C 1JV5B 4XAWH 2K1MA 1HQ4B 4MCZA 3L3KA 2CJUH 3TN0A 1ZGLM 3L7EA 3GSRA 2H6PA 5EO0A 2MJWA 3EO9H 4GAFB 3O8XB 3RL2B 1RZFL 3PDOA 4LGRB 2ZCHH 1GPOL 1T66D 5AUMA 1BWMA 3O0RH 4ZO7A 3GSNB 2Z31A 2FEEL 4FXKA 1OOAA 4WFGE 3SPVA 3MRGA 4ELMF 5CD3B 4XT1C 1FG2A 5D7JD 3TN0C 4PBWD 1LDPH 3V0AC 2P4AB 2NY4B 3ZKND 4PREA 1AO7E 4RGOL 3TCLB 2X4RB 1FAIL 5E8OB 4S1QH 2MCPH 4NQEB 3CDFA 5HYJA 3ARBC 5CJQH 4NM8H 3JVGA 4S0TD 5DUBA 2YPKA 1PZ5B 4AH2A 3ARUA 4OF5A 3BIKA 3RVWD 1L7IH 1BQLH 3WDIA 1BFSA 5IEHA 3WUWB 4ESKA 2YUVA 5FA4A 3PWLA 1RD6A 2HLFD 3GDBA 2BVEA 2ESVD 1H15B 4BFBD 3RA7H 3DUHA 1JRHL 3RP1A 4KUZL 4ERSL 3B2VL 2FHBA 2KKQA 2E27L 4PJEF 4G6JH 4MZ2A 1T1ZB 4LKXB 4UTAH 4YX2L 1RJZB 3WNPA 4FXLA 5E2UL 5DHXB 1I7TB 1T7ZA 4HF5H 4JPWH 2OXGA 1WTLA 2R2CA 1N3NA 5C0JA 2Q7YB 5IOPB 4UT7L 3C5ZD 4LCWB 1W72B 3GMQB 2OI9C 1K4CA 3WFBH 1QYGH 1KSRA 1DQJB 3MLUH 2UZYB 3VCLA 4ZQKB 3GMPB 4F2MA 2GKIA 4LSPL 1MVUB 1YEEL 2VMFA 1N8ZA 2X4TA 3L5XL 1UC6A 2CR6A 4PJBB 1F4YH 2AQ2A 5BO1H 2YRLA 5ID1A 4PBVC 4Z7WA 5CMAB 3QIBD 1BZ9A 2ATKA 4XCYB 2XACC 3GM8A 4ZFOL 2PO6D 5E00A 3TZVA 3QDGD 1A7OH 1W2KT 3RVXC 3KPSB 8CGTA 4DAGH 5K9KA 4NO5B 3P0YH 5D1ZB 2I25N 2VN4A 3QWRA 4AIZA 2EZ0D 3WKMH 5CHNA 3S8WA 32C2B 1JNHA 4NQSB 4BK4A 3D69B 3OX8A 4MCYA 5F96L 4ETQA 2MKWA 3MJ7B 5HDBE 4LEOA 4XVJH 3TZVC 5K9JH 2NXYD 5K9QG 3ESUF 4NRZA 2EO9A 1UXSA 4P3DB 3VXMA 3LVEA 4NZTL 2HKHL 4JFPB 3B9VA 2HT2C 3DVGB 5L6YH 5L2KD 4H1LG 2G60H 3NH7L 5E9DA 4M7JH 2JIXA 1CLYL 1H8OA 4XP9H 2P5EB 3ULVE 2Q86A 4AJ0A 1EFXA 2Y7QA 1S9XA 2D9CA 1A3RH 1WCBB 4QHUA 4X6CF 5GPRA 4LASL 3N85L 1CDCA 1FYTB 3MCKA 3L3GA 4X4YA 3ARGA 4Y19D 3KHOA 1RJCA 2JELL 1VESA 2APTA 4NRXA 2ZSVB 1T21B 3QUYD 1DE4B 1K8DB 1OGTA 5CLTA 2HFEA 5HHNB 5F3HA 4E41A 4X5XA 4YHPA 1Y6KR 1UWGH 1ZHLB 3CFJB 3KWWA 3O2WL 1HQRB 1A2YB 2A6KA 3O41B 3SCMC 3ARGC 1IRAY 7FABL 3FZUC 1E27B 3DHMA 5C2BH 4G6FD 4U6XB 3O6FD 5C0BA 2R1WA 4E9LA 2J8UA 4JE4B 5DJZA 4HUXA 4XWGL 5E70A 2VABA 4F3FB 4D0CB 4HG4J 3UTZB 1CZ8H 4F7MA 3JWDL 2VZOA 4NJAH 5HDOA 5EFIA 5FYLH 1RIHH 3H6JA 2X1WL 4PJXA 2Q8BH 4QTHB 4TUJB 2XN9D 4F57H 4V2BA 2FJGB 1DFBL 2NY2C 5CGYC 3MMEA 4FQIL 4LSVH 4PJ5D 2Z91B 3BPOC 1UT9A 4OCLC 4YFEA 5CSBA 3EZJB 1XIWB 1I8MA 2CD0A 1T1XB 3WO4C 5C1MB 2DN7A 4HXBL 1I8IB 1K9TA 3KS0H 1RZJL 2F74B 2VITA 4YDKH 2F54B 5HXMA 2Q3AA 4MSWA 1J1XH 1JHLL 1ZLSH 2YXMA 2P24B 4J23A 4AMKH 3EUUA 1RIUL 4ZSOE 4FFYL 4E5XB 5F89A 3BDYL 3BRFA 1XR8A 3I6LE 1MFCH 4P3CH 1PZUB 4PV9A 1ORSB 5F97E 4LLUB 4H25A 2HG5B 1A02N 1YYMH 5L2JB 1C7TA 5JOFB 5CGMA 1DN0B 4CMMA 1N4XH 4U0QB 4F7TB 4FN0A 2VXQH 2EIDA 5IVZB 3MBED 1KPRA 2ZWLT 1UB6B 4M8QB 3CUPA 2SEBB 1HI6A 4JKKA 4H20H 1G9NL 1Z3GL 2C7UB 3ALPA 4KI1A 3NTCH 5FYKU 3SY0B 1U8KA 4PGEB 4U4BA 4L3EB 1G9ML 3A6BH 1KFAL 4AM0B 2CMRH 2OK0L 3JSSA 1MHPH 5FHAH 4P23C 2YRPA 1R6VA 3VG0L 2ED9A 2BOBB 2Y06H 1QFHA 1FBIH 1IEBA 1LP9F 1VADA 3VRIB 2EDEA 1S7VA 1WZ1L 4P46D 4BSWA 2NW2A 5CP3A 5K9QI 2E9WA 1NCAL 4X6EA 1M6OA 3VFUB 1HSBB 4B0MM 2PW1A 3OXRA 4JM2A 2XI9A 4QYOB 4GQ9H 1XR9A 1JGEB 1A7RH 4OCYL 5ICXB 1WIPA 1FNGA 2YD4A 3LS4L 4OB5H 3GEWB 5ICYA 1R3IL 1N6QH 4FZEH 3FQTB 1NGWA 4HKJB 4N0CD 1PVHA 4FZ8L 3V4UH 5J89A 1IQWL 4JM2C 2O93L 1ETZB 3X3FL 1G7HA 4IIQC 5J12B 3VMOA 1ZAGA 2Q8AH 4FG6C 3L5JA 1PG7L 3EW3B 3SO5A 5B38G 4XMPH 4QXWA 3TNNA 1MREL 3LKOA 4I2XE 4X6BA 3CFDA 1YPZA 3X12A 4OV6F 5L0QC 4TSBL 1FLRH 4JQXA 1JP5A 4JY5H 4G9FD 3GB7B 2XWTB 5SWZE 3UTTE 5FYJD 4JM4H 1N5YL 4ODXB 5JOPD 3BYYA 3KJ4C 4S1SL 4DVRH 3A67H 3MLYH 5FKAA 6CGTA 1A3LL 4NHUA 1ADQL 4OZGE 4XNXL 2Q87A 1Q9KA 3FB7A 5DFWH 3SDDC 3WIIH 1DBML 4NC0B 3DXAD 4JQXC 4V1DA 4F7CB 1J86A 1LK2A 4U1MA 4DK6A 2NY6D 3L3DB 4W68A 5FDWA 2VLRE 1I3UA 1EAPA 1D5BB 3UYRL 4NQDD 1PYWB 5E2VH 4DGIL 3BGMB 1C5BL 5JW4R 3Q1SL 2MQ3A 2VXTL 3WJLA 1S7TA 4L5FH 4ALAL 1CFVH 3OGCA 4NUJA 5GSVA 2NY0D 3QJFA 1OHQA 5ICZB 1L0YA 5C08E 2X70A 3OPZH 2D31A 1U8IA 3CX2A 4QHKI 5JDSB 1JFQH 5DJ8A 3JWOH 2XTJC 4OCSL 5CEXA 3QUXB 5FO7B 1ZE3C 3WJLC 4BFEA 4Z7UE 1HH9A 4NUGH 3R06B 1TDQA 4Q6IC 5DUPL 3BOVA 5T3XL 5JQHC 2OJEA 4Z77B 4KGJA 4B7LA 4NCC1 5F21B 5GRYA 1NFIB 3R1GH 3X13B 1NUNB 2FZ3A 2VDRH 1XF2A 3VXPA 1I1AB 5E6IB 4TVPH 2FYYB 4Y4FB 2ERJC 1A6WL 1R5VA 2CRIA 5TE6H 2QSVA 1TZIA 3VXTA 3IFOB 1CXLA 4GAJL 3SGEI 3WL9A 1BMGA 2VDNL 1AO7A 1JHTB 1RVFL 4OJFL 3GSQA 2JB5H 2ATPA 2C3VB 1BZQK 4ZG1A 3BKCH 2OQJB 4XBGA 3PQYE 5JXED 4XB8A 4ZUSB 5ETUA 3ROLA 4OD1L 3K4AA 2YWYA 1D6EA 5DRWB 3BIBX 4ISVB 4LLQA 2HTLD 2NX5B 3PWPD 1A8JH 1MCQA 4RFNB 5FHBH 5IHBA 3SEPA 4QKXB 2LFGA 4WTXA 5FF6A 3MLPA 3IYLW 1HXYB 3K8LA 3RRQA 1AR2A 4JRXE 5GS0L 2LU7A 2YD8A 5D2LF 5E8NB 4ZNEE 3HI6L 3BPCA 1UZ6F 2EXWC 4HS3A 2BNRE 4KHTH 3RZCD 3LV3A 4M1DH 1RUKH 3MJ8B 3HAEG 4PRBA 2ADJA 2FB4L 4LDLB 5ACZB 1FNLA 3T4YA 5GQBA 4IJ3B 2ARJA 3TC9A 3SDAA 2WUCL 1VEPA 3DBXA 1KOAA 5I1KH 2CDFA 4APQB 4NP4L 3U1SL 4Y4HD 3MYJB 1WWBX 3FT2A 4JFEB 3DO3A 1YN7A 1ZT4A 3V0WH 5IEKB 3SDAC 5E08H 1MHHA 2CGRH 3I85A 4WW1A 1QA9B 1QPPA 1YQVL 1QVOB 2YD5A 3DSFH 2R1YB 2LU4A 4HH9A 3G5YB 1FNAA 3BH9B 1RUPH 1TQBC 4GXVL 1JNJA 3EFDH 4DOHB 1FNHA 3GSVA 4QTIH 5JHDB 2R4SH 2BOCA 2D7TH 1G6RB 3GGWB 2NW3A 5IQ9B 3U7YL 3T3PF 2FX7H 3BUYB 4MB3A 4PUBH 1CDBA 5C3TA 3HZYA 4H26A 4RWYL 1NUDA 2V7NB 2XNAA 1G7IA 4FRWA 5D7KD 1F11B 1U8MB 3WFZA 3GBML 1T0PB 3PV7A 1P9MA 5GZNC 3SKMB 1H3WM 3F12B 4U7KA 2RB8A 2VDPH 3ZSTA 4AQ1B 3F6IA 3GUTB 1XF1A 5JNYA 4MDJB 2DQIH 3TT1L 2G2RA 5DD1L 1X4XA 1U8QB 2UYLA 2R2BA 2X42A 3DX8B 1FH5H 5EZIL 2K9UA 3ARYA 1TNMA 2YR3A 1P9MC 3QA3B 5JW5A 1AD9A 2MSPA 3ROOA 4L9LA 5ISZD 4NM4L 4PJEE 3WDHA 2WIIB 2JJWA 1PG7W 3S36H 2QADC 2C4XA 2X05A 4NN7B 2D9QB 4XMKL 1EEUA 2GSIB 4G7VL 3R8BB 2C3XA 1TIUA 2MCG1 1L0XA 2PCPA 4L9LC 2XZZA 2AEPH 1K8IA 1RZFH 1TITA 4X9GA 5I19L 4NQVA 3UTQB 35C8L 3OAUL 4MNGA 1GPOH 3VFPA 2DLGA 2ITCB 5CP7B 4H1LB 3BD4A 5ANMB 2OJZL 1KJ2L 4K3JL 4G43A 5DC9B 5EZJA 4JZJB 2BNQD 3IFPA 3FHAA 2Z92B 2H3NA 2DQTL 1I9JL 3CPLA 3L5HA 5C8JB 3WE6A 1FAIH 1UH3A 4PBXA 4D9RE 2AXGB 4DVBB 2HTKD 3MNZB 5DZLA 5H94A 4JDTH 1W0VA 1Q9OB 3MV9E 4R8WL 3QJHA 4O9HL 4LFHG 4HV8A 1F6LL 1CF8L 1U3HB 1KB5A 1UM6H 1AGEB 3KXFB 1NLBL 1KIRB 1XGUA 3OB0K 3DVNB 2DL2A 4PRPB 3W0WB 3GJFH 2IANB 1SQ2N 1FZJB 3CDYA 5IFAL 4KXZH 4LP5A 4ZSOA 3U7WL 1JRHH 4ONHA 3SE3A 4YHKH 4KUZH 4ERSH 3B2VH 1KLFA 4MQXC 4ZUTA 4MVBC 3OKMB 2E27H 2A6JB 3QI9D 5I1IL 3S34L 5D1QA 3JV5A 1PBYA 3TBTB 2WBJA 5J06A 5E2UH 3QWOA 1XGQA 4PY8I 4X6CE 4I1NB 4TRPL 4JFYA 1AR1C 3HE7A 4UT7H 3SE3C 3EO0A 2XZQH 4EI6A 3LSOA 1CVSC 4JY4A 3SJVE 2F53B 2WBJC 3WIHA 1DLHA 1YEEH 1A1OB 4XC1L 4PJGB 1BEYL 3L5XH 4NWTL 3H0TB 2VO5A 1S7SA 3HE7C 1RFDL 5IMMB 1NPUA 4KKLC 1PKQE 3H9ZA 5F9OL 5GRXG 2APWA 3RDTB 1HKLL 4H8WC 4QY8A 5HI5D 3K2MC 2VKXA 1EV2E 2WBKA 2YZ1A 3RGVD 2FR4A 4KK9C 3TJHD 3IDJB 3S88L 2X1OA 4O2EA 4BZ2L 1MIML 5EZLB 3I84A 5EO9B 1MPAL 1MFDL 4YDJB 3GKWL 5F96H 3HZMB 1DSFH 4MQTB 2X44D 3CLFL 5E8DL 1U58A 3D3VE 4BZYA 3TIEB 4ZO9A 4YZFF 4JFZL 4NZTH 2HKHH 3BZ4B 2YHGA 3MO1A 3U2SA 5MEND 1KTDA 5JW3L 3NH7H 1Z6JT 5FK9A 4YC2C 4N0RA 1CLYH 2VC2L 1QRKA 2B5IC 3HPLB 4KRPD 5E4EC 3TIDB 1I3RA 3VWKD 1G9EA 3C9NB 3RAJL 2VLLB 1BP3B 4J4PA 1WEJH 4LASH 4EXKA 4LSUL 4JFXB 2VSCA 3MNVA 3BKML 2Y6SD 4I2XA 5CJBA 1FVCA 3QDMB 2CRMA 2JELH 1OF2A 5SWZA 3UTTA 4HEME 1I1FA 3ZKMC 3J7HA 3G6JB 3H9SE 5E99L 1FHGA 3MFFB 1IQDB 2DQFA 4M6ML 4J4PC 1OW0A 1MQ8A 1PQZA 4OZGA 4U3CA 1MLCB 5HD8D 4BSVA 4KKNA 2X4QA 1A4KB 5IT2L 4TUKL 3O2WH 3RIAF 5AAMA 4OZFH 3TA3C 4DJMA 7FABH 4N90E 1I8KB 1JZ8A 3ZZ1A 4XBPA 3LKNB 2ZUQC 3MJGX 4WU7B 1BPVA 2VLRA 5EC1B 1OW0C 2CRZA 4XWGH 4M6OL 5BS0E 4N0UB 2QQLL 3VI3E 1NANI 3JWDH 4UUJA 1FFQA 5TQ0L 3T65B 1YEKL 5BZWB 3W5NA 1KIPB 1DFBH 2WV3A 2W0PA 4FQIH 3ILPB 5IGXL 3DSNA 4B53A 1QLRB 1DDHA 4G8FB 4DKAA 5C08A 5B38B 3GO1L 5CUSL 3MLWL 4NIKB 1QR4A 4PR5B 5JIKA 5C0IB 2R23B 1RZJH 1J8KA 4U6HB 2F19L 4Z7UA 2VQ1B 4NNPL 3P30L 1JHLH 1GGBL 1C12A 2NTFB 1B0RA 1W8OA 4NNYB 1LO4H 1M71B 4GW1B 1CD1B 2FGZA 2QQNL 1V7NL 2EICA 3L9RB 1RIUH 4FFYH 4Y88A 4JVPA 3IXTB 2GQHA 1YN6B 3ULUF 3KPPB 4JO1L 3BDYH 5DD5L 1FDLL 1MJ7L 5EU6B 4A6YA 2VE6B 2AP2A 4XXDA 1PY4A 5TDPB 2BERA 2AV7B 5IVXE 4I48B 4R96B 3BO8B 4QOKB 1CFSA 3QIWA 5J1AA 3PQYA 5F7KC 4XVUD 1MHCA 3C60D 5EBLB 3ARDD 1NGPH 1IAMA 4EZMA 3QEHA 1CTOA 3HRPA 2W0FA 3FQXA 2EYRB 4F7EA 2Y5TB 2R2EA 1NGXA 4GKNB 3EDJA 5T1DL 4Y5XB 5CEZH 3OF6D 2LAAA 3C09C 3OAZK 1EGJL 1G9NH 1Z3GH 4G8EB 1GGTA 4N0FB 3OMZA 5DD0L 4JRXA 3CK0H 4PJIB 3C08L 1MFBL 5E2TL 1X7QB 3FFDA 4ZNEA 5JO5A 1NC4A 5AWNL 4GG6E 1KFAH 2OK0H 4X98A 4XTRC 3D2UA 1S7WB 2BNRA 4PFEA 4PJBF 5H2BA 4EI5D 1MCKA 4HBCL 1EEYB 3ARWA 3VG0H 1ZANL 3QT2A 1BOGA 1EEZA 2DMBA 4LSDA 4G5ZL 2VLMD 3QEQE 1WZ1H 1OAUL 2H32A 3TVMD 1MCRA 5F1SA 1GZPB 3U4BH 4KRNA 1NCAH 1KV3A 5J11B 4NYLA 3K1KC 5TDOA 2VOTA 2D7PA 1QACA 3WMSA 3AAZA 3L3HB 4Z0BH 4WWKD 5JXAL 4OCYH 3EDDA 5HI3D 1MCNA 2G9HB 3EO1B 1QEWA 3JV0A 2YPLE 3D1MC 3LHPL 5DI8B 3LEXB 3RNQA 2HN7A 4FQJL 2CPCA 3LS4H 4OIAA 4MD0B 1R3IH 3IJSB 5F7LB 3HR5B 5C0EA 3PL6A 4PLKC 3TBVB 3I3EA 5D7LD 4FZ8H 4OCMC 5A43C 2Q76A 4LSRH 1ND0A 4WVRA 3RY5A 3U0PA 4QRSB 2R2HA 1AGCA 2VISB 3X3FH 1XH3A 2DBLL 2FGWH 5KVDL 2GW5A 5SV3A 1IKNA 3TH2T 1PG7H 1ZA6A 3VRLE 1S9WA 4QXGL 2Q1EA 3RBGA 3ALWA 5KSAA 1MREH 2DL9A 3PL6C 3ARPA 4TSBH 1YEJH 1CE6B 2AI0L 1R3KA 3CFEB 3B6SA 1N5YH 1UYWL 3BW9B 1UKSA 4LP4A 4XAKD 1OL0A 5FGSA 4S1SH 4X7DC 1P6FA 1IKNC 3HAEB 1FRGL 1ADQH 2ZG3A 3QFDB 4XNXH 4BKLB 4P2RB 3R0NA 5KSAC 4MAYA 4WEUD 3VFOA 4ENEC 1DBMH 2RFXB 2VNCA 2VR5A 4PGCB 4POUB 2YOCA 1ZT7B 3H3KA 1RMFL 3QNXA 4MCZB 4MMZC 1MCEA 3L3KB 5FYLE 3TN0B 3L7EB 3UYRH 3GSRB 2H6PB 2X4UA 5EO0B 2PXYA 2RAMA 4MAYC 3PDOB 2EE9A 1C5BH 3Q1SH 3N1PC 4ALAH 5AUMB 2Z31B 3UZVB 4FXKB 3AUVA 1OGAE 3SPVB 3MRGB 1XAUA 1ZGLB 1FG2B 3B8SA 1QFWI 5HGDA 2PXYC 5I1JL 2XPGA 5C09E 4PREB 5B22A 3WXWL 4PJAE 2IBGA 4OCSH 5C6PB 5HYJB 4EVNA 3QPQC 4ZPTA 3RX5A 2IPTL 5DUPH 4Z76A 4N1EA 5DUBB 5A2KH 1DANT 2Z8WC 1OTTD 4GRWB 4EEEA 2YPKB 4AH2B 3EJYC 5HHPB 4LLYA 1U93B 3BIKB 5IEHB 1F3DH 4XRCA 4FTVE 5FA4B 1A6WH 1UVQB 2DQGL 2OR9L 3DV6A 4GAJH 2VDNH 4JDVA 5DURD 2WUBL 5F1NA 2GJ6E 2QLVB 4MJID 4EN3D 3AROA 4HWNA 5I1CL 2OI9B 5D9SA 3RWCA 1JGVL 3MV9A 4AZ8A 4AEIH 4NKOA 5A2LH 3BGFB 4OD1H 1MJUL 4XWOC 1KCVL 5C9JA 1OAYL 4X7EC 2E8YA 3I02A 4PJ8A 1UKTA 5I30L 1N3NB 4S2SB 5C0JB 3DPBA 4ZUUA 1OP5K 1YY8B 1N0LA 1K4CB 3MJ6A 4PRHE 3VCLB 1P1ZA 2HT3C 1BOYA 3THML 5GS0H 3HI6H 1CG9A 2GSGA 1CDYA 1LEGA 4KRMB 1CS6A 2KPNA 3FB8B 2ADIB 1N8ZB 2X4TB 1W72L 5INDA 3MUJA 1EXUA 1ZA3B 4L4TE 5JZ7C 5ID1B 4Z7WB 4HD9A 4J7RA 4J3SA 4X6CA 5CKAA 1BZ9B 2ATKB 4HLZG 4I8DA 1BF8A 1RIVL 3CFBA 2ZUSA 3M1BA 1IBGL 2FB4H 5E00B 4P5TA 3TZVB 1A7BA 4XP1L 2PO6B 4QRPE 2ZJSL 5DVOA 3NBNA 2K7QA 5K9KB 1LEIB 1U9KA 2AXJA 2WUCH 2UUDH 2VUYA 4AIZB 1FNEA 3QP3A 3SJVA 3MJ9L 5CHNB 1UCBL 1JNHB 4CVUA 5D7JC 4YBLC 5FIEA 3OX8B 4MCYB 3TESA 1CFQA 4KU1A 4ETQB 4NP4H 3ZKNC 1ZVSA 3FN9A 3U1SH 5J0BA 4LEOB 4P5TC 4FFZL 5LAXB 5J7CC 4NRZB 2NXYB 1PKQA 1UXSB 2EDQA 2DB8A 3VXMB 2EDNA 2BSRA 4IDLA 2A74A 3TYGL 3IKKA 3LS5L 3O3UN 5E9DB 1YQVH 5B21A 4G8GE 2JIXB 3QUKA 2P7TA 2Q86B 3RVWC 3DGCR 4GXVH 5DXWA 5I66A 1EFXB 4WO4A 1S9XB 5AYUL 4QHUB 1BM3L 1KUMA 3FQWB 2WW8A 2HLFC 4U1HA 1CICD 1PSKL 5T3XD 2IF7A 3U7YH 3MCKB 1NCWL 4X4YB 3ARGB 4HPYL 4Y19B 4NRXB 1DEEA 4HAGA 3WUZA 5DFVD 1OGTB 3IDGA 2HFEB 5F3HB 4WO4C 1B4RA 4E41B 4X5XB 1ULVA 5B3NA 4YHPB 2VL5A 1EFQA 3AXLB 1BD2D 3GBMH 3PIQA 1QSED 4OF6A 3KWWB 2A6KB 1B6DA 4HIEA 3IB4A 4KVCL 2NY2B 3UPRA 3C5ZC 3P3YA 4I3GA 5GZOD 4YDIL 3TT1H 1PAMA 2ICWA 5C0BB 4PG2A 2R1WB 5B4MD 3HR6A 4M9PA 5C0AE 5I76A 5DJZB 4HUXB 1P7HL 5EZIH 2VABB 3RL1A 3EYSL 1MCLA 4F7MB 5C0CE 5EFIB 5DJ0A 1J8HD 4NM4H 4PJXB 1ZLUK 4MXWL 3BMVA 4MDIA 4LPXA 3LQMA 3MMEB 1ZVHA 5J13C 3FOLB 1U95A 3RNKA 1UFUA 4XMKH 5HGGS 3QIBC 4CBPA 1DTUA 2MHAA 4G7VH 5K9OA 3OJ2C 4XCCL 1CDIA 3P40A 3BZDA 1I8MB 1D3CA 1SVZA 1DR9A 2DJSA 2V17L 5I1AA 2VITB 4TVPE 5I19H 2E9BA 3S36X 5ADPL 1OD9A 4N68A 4FQPA 4MSWB 2KH2B 5DA4A 1RZ8A 4I77L 4ZS6D 2I9LA 1KJ2H 4K3JH 4IHOA 4LVEA 5I6XC 4XNUH 1MCIA 4PJDF 1A6VL 1TVBA 2W0KA 1X4ZA 1Y0LA 2DQTH 5CKGA 5I8KL 1I9JH 1U91A 3REWA 1S7XA 4DFHA 2OTPA 5F89B 3Q48A 4JPVL 5CD5D 3RPIA 3FTGA 5DT1L 3BPLC 2M8XA 4PV9B 3QUYA 2CKBB 4R8WH 4O9HH 1B0GB 5I74C 2LQRA 3QIUA 3TGXA 4H25B 4UDUA 1CF8H 3T0DA 1VB9A 4XGZA 2J2ZA 1NLBH 3S35L 1EMTL 4CMMB 3BP4A 1NMCC 4NHCL 1QLEH 1KPRB 1EK3A 5IB1A 3QHTC 5IFAH 3QUYC 2WIMA 3U7WH 3CUPB 1RULL 3QIUC 1HI6B 3VFWB 2VZ1A 4WEMB 4CN6A 5I1IH 3S34H 5IVXA 1CDUA 4R97C 2OZ4H 4M8VA 4BUHA 5H37H 5BXFA 4TRPH 5ERWA 1PX4A 2BVOA 3S5LA 1VADB 3SN6N 5I0DA 1F4XL 3P73A 4KI5E 3KR3L 4BSWB 2NW2B 3P9WB 4X6EB 4HDIA 1M6OB 3LKSA 2PW1B 4RSVA 2NYYC 4JM2B 1BEYH 1RZ7L 1XR9B 4NWTH 5A3ID 4LHJB 1RFDH 3ZT5A 5F6HJ 4GG6A 1FNGB 5F9OH 1NCBH 1NAML 5ICYB 1HKLH 2F9BT 1AGDA 1NFDA 1NGWB 4KKAD 1WAAA 3QEQA 4HPOH 4N5UA 4BZ2H 1MIMH 2RBLA 1G7HB 1MPAH 4M1CD 1A0QL 1LHZA 1HDMA 1JK8A 5C86A 4B7IA 3TNNB 3LKOB 4X6BB 1BGXH 1YPZB 3VXRB 3X12B 3ZSSA 5DHVH 3CLFH 5E8DH 4PB0L 5HHOD 2YPLA 4MWFA 4MD5B 1F02I 3RWHA 5HPMB 5JW3H 2VIRA 4X8XA 1C8PA 4NHUB 3QBTB 5ID0A 4Y8DC 2VC2H 1Q9KB 2DICA 3FB7B 4LVNB 4KUCF 5CJXA 1T2JA 5KJRL 3MRRA 3F58L 3RAJH 2QHRL 2VZTA 4V1DB 1LK2B 4U1MB 5CBEB 4LSUH 2A1WL 2DDQL 3BKMH 3AGVA 2GTZA 4LMQE 5FDWB 3QHZL 1WZMA 4LPCA 1EAPB 3WLWD 4LCYA 3T3MF 2H41A 1EHNA 2XTJB 4X7TA 1Z0NA 1CXIA 4DKEL 4M6MH 1S7TB 3ET9F 4JAMA 1CXKA 3KDMB 3SO3C 2HT4D 1KTLA 1YUHA 2B1AL 3OGCB 4NUJB 5IT2H 3QJFB 4XBEH 4TUKH 3DMMA 2NY0B 3GSWA 3TO4A 2X70B 1GC1L 2D31B 1U8IB 4EBQL 1OVZA 1S7UA 5DJ8B 4GH7B 3HE6A 5D7IE 3GMRA 5DJDB 1AHWB 4RDQF 1HH9B 4M6OH 4UOW0 4BQBA 2E7LC 2QQLH 2OJEB 2C3GA 2DQEL 2ILLA 4GRLD 3QRGL 5TQ0H 1JZ7A 3TO4C 2QBWA 1YEKH 4NZDA 4KPHL 2ZZUT 2EC9T 5LJYH 2FZ3B 3VXPB 4RCAA 3IDMA 5IGXH 3HE6C 1NKOA 1OGAA 1R5VB 4QHNA 1TZIB 2BHZA 4PRDA 3VXTB 3GO1H 5L8JB 3CXHK 5CUSH 3EYFA 1LD9A 5C09A 3LQZA 1AO7B 2IALB 4PJAA 4O4YL 1G7PA 4L8BA 2ATPB 3O4LD 2F19H 3GNML 4NNPH 3P30H 4XBGB 2DI9A 1GGBH 3LRSA 5ETUB 3ROLB 2VLJE 4Y2DA 1T04A 4HK0A 4NCC2 1D6EB 4O00A 4LLQB 3DXAA 3TM6A 2QQNH 3IDIA 1V7NH 4YAQB 3G04A 4QRRD 4FTVA 4OLUL 3ABZA 3FAXA 1C7SA 4JO1H 3UTSD 4YXLL 5DD5H 2CIIA 1IE5A 1FDLH 1MJ7H 5JQ6L 3AU1A 3H3BC 1JJUA 2GJ6A 4Y2DC 3QG7L 4I3RL 1YECL 3BPCB 3MOQA 4HS3B 1M7IA 3LV3B 3DX7A 4EDXA 2NY6C 3ESVF 4YIQA 4KROC 2Q6WB 2FEDC 2EECA 4WI8A 5IBLC 2EDHA 4PRBB 1UM4H 2ARJQ 4HFUL 5EU3A 1A6PA 3N9GL 3OKEA 3Q5YA 1BAFL 5HVGB 3T4YB 2ARJB 2GCYA 1EGJH 5MI0B 4PRHA 3NIGF 2HJFA 5DD0H 4HCRL 3C08H 3DBXB 1MFBH 5E2TH 2QTEA 4PJGF 5AWNH 3QXTA 1WBYA 2P45B 1P7QA 1M7XA 1TQBB 4HBCH 5EORL 1ZANH 3BAEL 4P4KA 4TNWF 3S37L 4L4TA 5C07E 1YN7B 5I1DA 1ZT4B 2QEJA 3EDEA 4G5ZH 1MHHB 1OAUH 4DEPC 3QUMA 4QRPA 5BZDA 3NACL 5CSGA 4HH9B 2YD1A 3IDNA 4P4KC 5F9JA 3GSVB 4DTGL 1UWXK 5JXAH 4NO2A 5FOBA 2BOCB 2A9NL 4LCUB 3LHPH 2NW3B 4FQJH 3SQBA 4JFFE 3HZYB 3GIVA 4H26B 1OY3B 3L3IB 4Q6YA 2WAHA 2XNAB 1G7IB 3OQ3B 5FOJA 5C3LD 3IAGC 2YEZA 4OD2A 1G6RL 2DBLH 3A6CL 5KVDH 3KPRD 4G8GA 4HT1L 5BRZD 1IM9A 1WITA 1FZMA 5DMIL 4QXGH 3EIFA 3T0EE 1D5ZA 4RAHA 2AI0H 1EVUA 4L4JA 1YMME 2G2RB 1UYWH 2UYLB 3S97C 2R2BB 3JV6A 1PG7X 3MLSL 1FRGH 5JOEA 1AD9B 1YEDA 3ROOB 5DA0B 1BVZA 3RZCC 3EZ8A 4CDHA 5F3BA 1H3PL 1U6AH 2RJMA 1DVFA 3HB3D 5T1LA 2XRAL 3EGSA 5C0ND 3VFMA 3OHXA 1RMFH 4PP2A 4NC1C 3VXUD 4A2LA 3QZWA 1AXSA 1K8IB 5C0AA 2R1XB 1FC2D 1T6WA 2X89A 4U31A 3VFPB 1ZXQA 1DVFC 1RV6X 3D25A 4K71C 1YEGL 3FN0L 5GSRA 3G6AA 5C0CA 1F4WL 5E5RB 4G43B 2WQRA 5AG8A 3DETD 3QULA 4Y4HC 1CXHA 5EZJB 3IFPB 4H8WL 2BNQB 3DRTA 2H3NB 1MCWW 5KVGL 3CPLB 4W6YB 4DZ8A 4KMTH 4HX1A 3WE6B 4WNQA 3E8UH 5INCA 3WXWH 5DHYA 1MQKL 2O61A 5H94B 2IPTH 1W0VB 3QJHB 3JWOC 3B5TA 4HV8B 2IGFL 1MI5D 1KB5B 5JLZA 2ITDA 1XGUB 4GG8A 1WFNA 2DQGH 2OR9H 4OFKA 4XNQA 5IW6A 5EUKB 4ZSOB 4ONHB 3OKKA 2WUBH 4UV4L 3NZHL 3GMMB 5I1CH 3IJYB 4ZUTB 4Q9BA 5EPMA 3SGDI 1OAKL 3FFCE 1JGVH 4HMDA 5CEZE 3GI8L 3FB5A 1JVKA 2HRPL 1MJUH 1KCVH 5D1QB 4RZCA 1OAXL 2VDKL 1LE5A 2WBJB 2IQAA 3QWOB 1XGQB 4J3XA 5I30H 5D6CA 1WISA 4I0CC 4JFDE 1FL5A 4Y16D 3VGBA 3HE7B 3RU8L 3EO0B 4EI6B 3NPSC 3Q3GA 3LSOB 1INQA 5FGRA 4ZTOL 4JY4B 3THMH 3FB6B 1ERNA 1OB1A 4PJIF 4HG4K 3WEXA 1DLHB 4RGNE 5L8KB 5E6ZA 2P47B 3SE9H 1VGEL 5F1KC 3QQ4A 4NQTA 1B6UA 4N1HB 3U82B 1H3XA 2BNUA 2EDYA 2FECL 2X1XR 4X6DF 3MRBA 4OKDA 1RIVH 1IBGH 4QY8B 3RX7A 4LHUD 3LN5A 2FR4B 2ZJSH 2D0HA 4OCWL 5J3HD 1R5IA 1E0OB 2DQUL 4O2EB 4P5KB 3MJ9H 4YC2B 1UCBH 4JKLA 1A6TA 5I2IA 5GS3A 5E4EB 2B5IB 3AS3A 4JVWA 1FVDA 4UU9A 3ZKSD 4OLEA 3S9DB 4FFZH 1U58B 4J3VA 4L1HA 2VXSL 4KI5C 2HTKC 5HYSA 5JIIA 4PJ9A 1J1OL 2FX9L 4WI5A 3MO1B 1UB5B 3U2SB 1KTDB 4PLNC 4JLRB 3LS5H 1NCDL 5FK9B 3O8XD 4UBDC 1I3RB 4ONGL 3VH8G 4L4VE 4X8JA 3ARXA 1KEML 1JNLL 2OX5A 4KJPD 4U6YA 1BM3H 5AYUH 1FIEA 3MA7A 1X5XA 2PYEE 4ZODA 1PSKH 3MNVB 4PJ9C 2NY4D 4WCYL 3PHOA 4I2XB 1CT8A 1HKFA 1Z9LA 4PLJD 2OCFD 1FVCB 3QDJE 2OL3A 3CSYA 4UIMA 1WZKA 2OTWA 3QFJE 1OF2B 5SWZB 3UTTB 1HHIA 1I1FB 1E4WL 2W9DL 3QQ3A 3WSQL 4Z18A 2DQFB 1PQZB 4OZGB 4BSVB 2FBOJ 5E7FA 5GJTL 4UZGA 3VGAC 2XKNA 4GMTL 4KVCH 3E0GA 4YDIH 5KZCD 4UV7H 1JI1A 4XBPB 3VE0A 1ZHBA 1BVLA 2VLRB 3ULUD 3B5HA 3E6HA 3V5HA 2C1PA 1ZGLP 3MRCA 4JZNB 1KCSL 3EYSH 3DECA 3NCYP 4WHYH 3CSPA 5IMOA 3UX9B 2Q7NA 4MXWH 4D2NA 4I9WD 3LMJL 2A0LD 3S5LG 5KBNC 3D48R 5JORA 5C08B 3VDBA 4XCCH 3IS1X 3QXVA 4ZNCD 4LCWD 5JA8B 4OF7A 4RRPG 4KV5F 2ZG1A 5D96C 5D7IA 1TZGL 2V17H 4Y4KA 2VQUA 5ADPH 4JPKL 4Z7UB 4CVZA 1N2RA 4WTWA 4GRWF 4I77H 1HHHA 1C12B 1EERB 3IRPX 3VWKA 4OLYL 2Q20A 3V6BR 1EPFA 3IKCA 1A6VH 3CZFA 5I8KH 2VH5L 3PWNA 4QO1A 4Y4KC 3FO9A 4MA8H 4JPVH 1ORQA 4PRNA 3RKDC 2NLJA 5DT1H 1IL1B 4A6YB 4NWUL 1QSFE 1IAKA 4XXDB 1Q72L 1R5WA 3L5WA 3VWKC 1HXMA 5D1ZD 3C09B 2ZOKA 5IMLA 1CFSB 2XZAL 3K74B 3QIWB 3GJFA 5J1AB 3PQYB 1MHCB 2BCKA 3S35H 2VLJA 3QEHB 4GXUM 4ORGB 2W0FB 2Y1VA 4N0YL 3FQXB 4F7EB 2R2EB 3JBG7 1NGXB 4YE4L 3U30C 2VB5A 4F9PA 2LU3A 3H3PL 5D8JL 2ICWI 4U7MA 5LVEA 4G9DA 4KKCD 1QUNA 4L3CA 4P2QE 2Y25A 4JDZA 4DUVA 1WVZA 1OCWH 4PJ7B 3KAAA 2CLRA 4ZYKA 5KVFH 4JRXB 5F9WC 1KG0A 2P5ED 3FFDB 4I4WA 5JO5B 5DEGA 3G5VA 5T33L 2B7DT 1INEH 4X98B 3D2UB 2BNRB 2NXZB 4M9OA 4F9PC 4PRID 1CL7I 4JFOA 4Z7WF 3X11A 2QV2A 4OSUL 4DZBA 1BOGB 1UG9A 1FYTD 1BQSA 2A73A 1EEZB 4HJ0D 5FAAA 4JHAL 1F4XH 4XX1E 5KSBE 1CN4A 5MP6L 4QRTA 4OLZH 3ZE2F 1X5KA 2XQBL 4KK8C 1LILA 3K8MA 2XKUA 4NYLB 4WV1A 1QBML 2ZOLA 3VFTA 3KLHC 5TDOB 4GAYA 3BGAA 3AAZB 3AC0A 5J9PA 5EBMA 4ZFOA 3LD8B 2AKRA 4WWKB 1QEWB 1JWMA 3VFRB 3RNQB 2HN7B 3ILQD 1NAMH 1TQCB 3QXUA 5C0EB 3PL6B 4HUUA 4ZMAT 2M2DA 4WV1C 5C07A 3V0VA 2Q76B 1ND0B 3U0PB 4C59B 1C1EL 2ZSWB 3HMWL 2R2HB 4PG9A 1XH3B 4QLRA 3W9DA 1D5XA 3QNZA 1ZA6B 1RHHA 4PJFE 5KSAB 3FRPA 3O2VL 2NY3C 3HZVA 4K3EL 3SE4A 4PB0H 1R3KB 2PNDA 3ZYJA 2IADA 2YD6A 1XIWD 1IGJA 3RWFA 1T1WA 4JFFA 4HIJA 2F54D 2B4CL 1FL3A 4R3SA 4MAYB 1R0AL 3VFOB 5KJRH 4PRAA 3F58H 3SE4C 2QHRH 3EHBD 2W0LA 5D1XA 4LKCA 2A1WH 2DDQH 2KUTA 3BDXA 3AMLA 2I27N 3QNXB 3RIAK 4IDJL 3VGGA 3T0EA 5HVWA 4HJJH 2J8UF 2PXYB 3ZYOA 4AENA 4OQTL 1YMMA 1FFRA 4U1NA 1FJ1A 4KK6C 1NSNL 5DF0A 4DKEH 2COQA 4OZFA 5D1XC 4WTZA 4PJXF 3LEVL 4PJEB 5HGDB 1GC1H 4FNLL 4EBQH 1Q8MA 2FBJL 2XPGB 3E2HC 3U46A 4IRSA 4OGAC 1F97A 3TVMC 4KC3B 4NCDA 4EVNB 5L8LB 4ZPTB 2DQEH 3QRGH 4KPHH 4LLYB 3B9DA 3OWEA 4L3ED 4YFLF 4IRSC 4LPVA 5IFHH 4PGBB 4XRCB 2K3TA 3JWDC 2DLHA 3PXHA 2WLYA 5J6GA 2Q3ZA 3DV6B 1N6UA 2KZWA 3NGBC 4BH7B 2VKWA 4JDVB 5F1NB 4O4YH 4N8CL 4ZPVB 4I0PA 2AV1A 3BT2L 4KMLB 3GNMH 1KPVA 5D9SB 3S4SA 3RWCB 4IMKA 3HNSL 3MV9B 5DQJA 4NKOB 4X80H 5C9JB 1RZJC 1U0QA 4MA1B 4ODTH 3AS0A 3I02B 4PJ8B 1HIML 4U1SA 4ZXBA 1AY1L 4HSQA 2JE8A 3G9AB 4OLUH 2WZPD 4I0PC 4ZUUB 3U0WL 4P99A 4ZAKA 1CLOL 3I3BA 4IMKC 4JHBA 5JQ6H 4GKZA 3UPCA 1P1ZB 1PX3A 3VFSA 2X7LA 3QG7H 1CG9B 4I3RH 2GSGB 1YECH 1LEGB 3BJ91 2BK8A 5B39A 4ZXBC 5INDB 3FFCA 3FAWA 1IAOA 4YDLB 3IVKB 1CFBA 1EXUB 2J6EL 2AK4E 1F4HA 5IMKA 1J87A 2AJUH 4ZAKC 4IBLT 2I60L 4YBLB 4X6CB 3PGCA 4CVXA 2XWBA 4QHMA 3CFBB 2C4FT 3M1BB 4JFDA 4UNTA 1C08A 4XPAH 4P5TB 4HFUH 3N9GH 5HGHA 1EAJA 1XFPA 4L29A 3ZO0A 5C6TL 4OUOA 1HHKA 1T0NA 3QYCA 1FNEB 3SJVB 4HCRH 5KSVA 5CLWA 4JM2F 5HYIA 3W11C 3STLA 1CFQB 1G9NC 1ZVSB 2NY7L 3GMNA 2XA8H 4XI5C 4NZRL 4XP6L 4RIRA 1ZSDA 3BAEH 5EORH 3S37H 4LRNL 1PKQB 1A7PL 1G9MC 2KL6A 2BSRB 4S11A 5T5FL 2A74B 1GGYA 2DQJL 3QUKB 4RGNC 2P7TB 1MFEH 3JXAA 5I66B 4WO4B 4DTGH 1FCGA 2A9NH 1YPZF 4JJ5A 3S6CA 5C0GA 3UTPD 3OGOE 4KJQD 3D3VB 4YO0A 4DGVL 3QUXD 4YK4B 1NGZA 2HVJA 4X0KB 1ED3A 1G6RH 3MV01 3WHE1 2VL5B 3A6CH 3PIQB 2XV6B 4HT1H 2YA1A 3O3EA 5DMIH 4L4VA 4HIEB 1IKFL 1I1AD 5BVPL 5E6ID 2YD9A 3UPRB 4Y4FD 4QHLA 2HKFL 3CSBA 3OKDA 4GS7C 5J13B 2ICWB 2PYEA 1ADQA 1DN2A 3VRJB 5I76B 1I7UA 3QDJA 4AEHL 3HCVA 3RL1B 3QFJA 2NNAA 3MLSH 1GZQA 2A83A 5EUOE 3X14B 3DHJA 5DJ0B 3H9SB 1U3YA 4ODVL 4MDIB 3UZQA 3MRHA 1H3PH 2ZUXA 1U95B 3RNKB 1J11A 3UYPA 2XRAH 2MHAB 3MUZ1 4MNHA 5C6WH 1YMHA 1X6NA 3MV8E 5I73B 5K9OB 2EH7L 4M4PA 3W39A 4LVOC 3QO1A 1XF4A 4UQ3A 3VA2C 1WZLA 1AKJD 1IAIL 5I1AB 1CGVA 5BS0B 3I6GA 2X9WA 2F8VA 4NJ9L 4KK5C 1YEGH 3FN0H 2I9LB 1F4WH 4IHOB 5KG9A 2IH3A 4Z0XA 5I74B 3HRZA 1S7RA 2XYCA 4O5LL 4URTB 4CJ1A 1FSKC 2KQMA 4H8WH 1TVBB 3OKNA 3VH8B 3P4NA 1Y0LB 5KVGH 5JTWA 1U91B 3REWB 1S7XB 4JFHE 2YK1L 4LHUG 5D71L 4X6DE 3WV0A 5LG1A 4G8IA 2L0DA 3E3QC 1MQKH 3RPIB 3H7BA 1NMCB 1XZ0A 2P48B 4F80A 3VG9C 2IGFH 3QIUB 4UDUB 3LRGA 1NL0L 3H9HA 3QR2A 4XGZB 4G42A 3LQAL 5JPMB 3LAFA 4RAUA 4APQD 5E03A 1X6LA 5HYSG 4GO6B 1U3ZA 1K2DA 2CKBL 1KTKE 3NCJL 4JFED 1GJIA 4UB0L 1U36A 3DYMA 1YC7A 4G6AC 4OCXL 5EOTA 4UV4H 3BEWA 3NZHH 5DZOA 1A22B 3P0GB 3KGRA 1UWEL 4FFWD 4PJCE 1OAKH 4LARL 1QSFA 4YHYB 1AD0A 5IHLB 1SM3L 2HRPH 2V2WA 5IVXB 1OAXH 1ZT1B 2VDKH 1ES0A 4HIIA 1T4KA 3QHFL 5BXFB 5GZOC 5ERWB 2BVOB 3RU8H 5EU7E 2JK5A 3S5LB 1URLA 3MRKA 3P73B 3T0XA 2WLZA 2DKMA 5ELIA 4ZTOH 1E4XL 2F58L 4P2QA 4RGMC 1GH7A 4N5ED 1DUYA 2HFFB 4TQEL 5BV7L 5CCKL 1A9BB 1UKQA 5LXGL 2NY1B 1VGEH 4KUCD 4WFHD 3MGOA 4GG6B 3RTQA 3O2DL 1AGDB 4P5MA 5EU4A 5MEOB 1S5HA 2EXYD 1QFWL 3FKUS 5KSBA 4OCWH 3QEQB 5BMFH 2DQUH 1JYVA 4ZS6C 1QLFB 3KYAA 5DWUL 1HDMB 1NCUA 1JYXA 3E6FA 4YBQD 1AP2A 1FORL 1X5FA 2IH1A 3O4OB 3RTQC 1JWSB 5GRVK 1NMAH 4YHMH 3MLXL 3T2PA 1V8HA 5HDBF 2VXSH 1FLTX 4MWFB 1CDGA 1K4DA 1J1OH 5EA0L 3RWHB 4KV5E 1DUZA 3DX9B 2VIRB 2JJUA 1NCDH 2M26A 3QDHA 5ID0B 3LY6A 4ONGH 3SGEH 1NBZA 5E94A 1WWWX 5F72S 4EUPH 4YHIA 1KEMH 1JNLH 5FYJL 1T7VA 1WSST 4K94L 4JY6A 2E8ZA 5SWSE 4PJFA 5TQ2L 4WCYH 1MY7A 2GTZB 2WM0A 3P9LA 4M48L 5FGCE 5EIQA 4LCYB 1I3GL 2W9DH 1E4WH 4ONOA 4X7TB 3FN3A 1WLHA 3HC0A 4JAMB 3VWJA 3TPUA 1DQTA 1KTLB 3EYUL 5GJTH 3DMMB 1UM5L 4HUWA 3GSWB 3TO4B 1U3HD 4HZLA 1R3JB 1VPOL 1Q38A 2CIKB 1PY9A 1S7UB 2JF1A 3BZFA 5DD6A 4TULL 5HI4D 5TE7L 1MFNA 3HE6B 4PRPD 4Z7VE 1KELL 3W0WD 2IAND 5JPNA 3GMRB 3LZFL 2DQDL 1UH4A 3P4LA 3MRFA 3VWJC 4KJYA 2OR7A 3LPWA 2D03L 1FO0L 2YUWA 4OFDA 4PJHE 4EKXA 5DS8A 5A3IC 4KKBD 2G5RA 4OIIL 3LMJH 3PWVB 5T3ZD 3IDMB 1NAKL 1OGAB 4OBSA 4QHNB 1D6VL 3P11L 3C6LD 1SBBA 4OQ1A 5BQ7B 2G75A 3G08A 1LD9B 3X17A 2GEEA 5C09B 3LQZB 4Q97A 5HYQA 1B2WH 1TZGH 1G7PB 4NQEE 1WBZA 4UIKL 1KJ2A 4FQXD 4JPKH 3BN9C 1FYHB 4JO4L 2F53D 4OF3A 1FV1A 3LRSB 4XNMA 4QWWD 5IB4A 4LQFL 2DLFH 1T04B 4HK0B 1A64A 4OLYH 1IT9L 5IW3A 3WLBA 5GRWA 1Y6NR 4K7PL 2ZCLL 3IDIB 3C6SA 1F00I 1CR9L 2VH5H 1A7NL 3G04B 4P4RA 4FTVB 4XPBL 4KROB 3WNNA 43CAA 4GBXA 2ADFL 3RDTD 2I26N 2VQTA 2CIIB 4GFTB 4R26L 2NZ9D 4IOIA 4NWUH 4JG1L 5EN2B 2GJ6B 4L8SA 1G7QA 1CFNA 2XZAH 1M7IB 1IFHL 4NO0A 3DX7B 4EDXB 4I5BA 2YN5A 4YIQB 4GBXC 4N0YH 4C56E 4Y5VC 4YE4H 5D93B 3H3PH 5D8JH 2V7HA 1D7FA 5CAYB 4L8SC 4LCCA 3BZEA 4ZDHA 1RAMA 5F7DA 3OKEB 4QF1A 5J6HA 1KTRL 4Z7QE 2GCYB 4PRHB 4QEGA 2HJFB 3PDDA 1LEKA 5T33H 1FPTL 1P2CA 3A0OA 1PLGL 1WBYB 1P7QB 1MAML 2F8OA 4LCCC 2AK4A 4OSUH 4P4KB 1LO3L 3TCXA 4L4TB 5CJ5A 5ITBL 8FABA 5IR1A 2X5PA 4JHAH 1B3JA 1NDMA 2CRYA 4TSAL 3QDMD 2J8UE 5MP6H 1ZLWH 4UOJA 9CGTA 4GRLC 4JEGB 4QRPB 2XQBH 3KPSE 2FEEI 5BZDB 1AJ7L 4LGSB 1QBMH 3BQUA 2FLBT 5AYQA 5ENWB 5I1LB 3FQRA 3IDNB 3WN5A 5F9JB 5GRUL 2J1KA 1P6AB 5FOBB 1QRNE 1WC7A 4HUVA 3SDCA 1YQ2A 4K8RD 4FMKA 3LN4A 2V2XA 5CZXD 4U1LA 3NA9L 3N06B 3PV6B 4ORZC 3BQUC 1JF5A 2EEBA 4K3DL 3IDYC 1TETL 4LPTA 2MWCA 1BFOA 1C1EH 1SJHA 2Y07L 4OD2B 3HMWH 3LH2H 3WN5C 5DSCB 4KTDL 4G8GB 3OV6A 5DHVA 3SDCC 1FZMB 4QGTA 3T77A 3O2VH 4OM0L 1D5ZB 3MNWA 1MCFA 3ZLQC 1L6XA 3OSKA 3NMEA 3S4SG 3ULVL 3JV6B 1XCTA 4IMLA 1LO2L 3HNTL 2BY0A 1CTNA 1YEDB 3DARA 2B4CH 3NFPB 1LWRA 2VWEC 1R0AH 5F3BB 3IF1A 4MGXA 4HIXL 1DVFB 1T03L 3W82A 5T1LB 4P9HL 3DVFA 2OLDA 1JZ4A 5E4IA 2VERN 5LWYL 3OHXB 4JPIA 4PP2B 2UV3A 3ISWA 3GRWL 4BM7A 2N7AA 3IAPA 3QZWB 4CDGC 1AXSB 1BFVL 4OQTH 2BJML 3VA6A 5B39G 5C0AB 1NSNH 5EU6D 1OQXA 4Z5RA 5ADOL 3L3OB 4NQCE 2YRZA 3TPKA 5EUOA 5TDNB 3LEVH 5C0RH 5GSRB 3G6AB 5C0CB 4QOKD 1KXVC 2FHFA 1AH1A 1KJ3L 1CXEA 3BIAX 2P8LA 5BVJA 4FNLH 1KCRL 3DRTB 1BF2A 1WUNT 2FBJH 4HIHA 4HK3J 2XA3A 5IK3A 4DZ8B 4HX1B 4WNQB 5DRXA 3MV8A 5INCB 2NY5L 5DGRA 3S3PA 2DBJA 5DDHA 2DJUA 3RVUD 2WK2A 4Z7UF 2RIKA 2APFA 2AW2A 4RISH 2P5WD 3H42L 2FIRT 2MKLC 4AG4L 5JLZB 2ITDB 1JZ2A 4DW2L 4GG8B 2E6JA 3NFSL 4LLWA 5IB2A 3CFIC 3HC3L 3A6OA 5I1HL 4XNQB 3GSOA 5IW6B 2OSLA 1YNLH 3VD5A 5HHQA 4X6FA 4RMWA 3OKKB 4X6DA 1J0YA 1WV7T 3BESR 4N8CH 4Z7NE 3BT2H 3NPSB 3HNSH 4CKVX 1VFBA 1YNKL 3TFKD 2Z35A 5I15H 3O6KL 1LE5B 4JRYE 2IQAB 4POZD 1IC5L 2NPLX 4YXKL 1HIMH 2BC4B 2NR6C 1AY1H 2ICEB 4YHZL 1FL5B 4B41A 3GBLA 3VFVA 4RX4A 1M7DB 4Y16B 3U0WH 4OIBA 4OTXL 1CLOH 1T7YA 1HHGA 3P0VL 1T7XA 5JDJA 3Q3GB 1MNUL 1INQB 1RUQH 1S3KL 1OB1B 4NQXA 4IRJA 3WEXB 4RFOH 3BWUC 2UY7A 4O2FA 2R15A 3CVHL 4PJCA 3QQ4B 5JR1L 4K3HA 5KANG 5F9AC 4MJ5A 1MF2H 1OSPL 2J6EH 1OTUD 5C0NC 1J1PL 1MOEA 4FQLH 2BNUB 2I60H 2BRRL 3QDAA 1EGJA 4ODHL 3MRBB 2ZP0T 1N5AA 3QNYA 3T4AA 4TNWK 4JR9L 3LN5B 5DMGD 3TF7C 4HKXA 5HJ3A 4IRJC 3LRHA 5ALCH 4M61B 5C6TH 4GJTB 3T08A 4OI9A 1YY9C 2VZ3A 3HMXL 4P2RD 3FQUA 1BREA 1H3GA 1A6TB 3RWEA 5I2IB 2APBA 5ESQA 5D6DA 1KPUA 1ITCA 3CMGA 5DQDL 4JN1L 4HHAA 2BMKA 2NY7H 1NANH 4NZRH 4XP6H 4HH8A 2C3HA 5ITFA 5DUML 4LRNH 5B8CA 2FWOA 1A7PH 3GMOA 3D5OF 2AJXL 3TN0D 3EBAA 5HYSB 3LCYA 4PJ9B 3KPMA 3MXVH 3U0TA 2DQJH 3DX6A 5D6DC 1T22A 4YGVA 4X8JB 3S37X 1RZGA 3V6OC 4NKDB 3ARBA 3D9AL 1I9RL 2Z31D 3MZGB 5B8CC 4U6YB 1HSAA 2XG4A 2B2XL 1FFNA 3C2AL 5FV1L 4N9GA 5LQBL 3PHOB 3VGAB 1CT8B 1WICA 3O6LL 3CSYB 2LV4A 4UIMB 4DGVH 1HHIB 5HYJD 1ZHKA 3KYOA 4GT7A 4CW1A 4Y1AE 2XKNB 1CXFA 3T2OA 2IWGA 1IKFH 5BVPH 3MRQB 4E42A 4YDVB 4WUUE 1JGLL 5GJSH 4X9BA 3MOBH 5SWSA 5KZCB 4IS6A 3VE0B 1ZHBB 1BVLB 2ZUYA 3BYTA 4AEHH 1OPGL 2PTTB 2C1PB 4LLVA 4MNQE 2B0SL 3MRCB 4MX7B 2H8PA 3NIFF 1XF5A 2IJ0C 5FUOL 3V95A 5IMOB 2OYPA 3FMGL 3DROA 1FFPA 1LDSA 2A77L 4R2GB 2GJJA 2BDNL 3GSUA 5JORB 3UDWA 2EH7H 1JZ5A 4H88L 3VFNA 2X2YA 3RJQB 4PLOB 3V9FA 4Z7VA 1IAIH 5D7IB 4Y4KB 5JIHA 3D85A 4ZOCA 4M43L 1N2RB 4F7PA 4NJ9H 3QQ9C 1HHHB 1V3JA 4PJHA 1SHMA 3UDWC 4O5LH 3IKCB 1T1YA 2ADGB 3CZFB 3TNMA 2YK1H 5D71H 4WHTA 3FO9B 1MCBA 4KRLB 5CZVL 4W81A 1ORQB 4PRNB 1JHKL 3TZVD 2BSED 2NLJB 3U30B 5E8OA 1IAKB 4NQEA 1R5WB 3L5WB 1HZHL 2FLRT 1HXMB 2HT2D 3QWRD 5IMLB 4EJ1C 1NL0H 4NKIL 3LQAH 2BCKB 2J12B 2VLJB 1PZ5A 2NY4C 4LFHD 3HC4L 4PLJC 1U8NB 2NX5E 3NCJH 5KANI 1OAZL 4RDQG 4UB0H 3VXMD 4G9DB 4L3CB 4JDZB 1E28A 3UBXA 5E9DD 1T80A 1UWEH 2CLRB 4LARH 2JIXD 1KG0B 12E8L 1SM3H 1PGRB 3R8QA 3SKJL 1EFXD 2JJSA 4JFOB 3QHFH 1Y18A 1ZHNA 3X11B 4PRIB 1CD9B 4ZTPL 4OLXL 4DZBB 1KT2A 2A73B 4JKWA 4HFWA 4C56A 1OWWA 1KEGL 5DQ9A 4OGZA 1MRCL 2FH6A 3ARGD 2YC1A 5I1EL 4M00A 4QRTB 3FZUD 3SCMA 5HDLA 1E4XH 3ZHLA 1W72A 1X4YA 1TXKA 2FCBA 1P5VA 4ZO8A 4XXCA 4WV1B 2ZOLB 4WFFE 3VFTB 4GAYB 1JPSL 2QR0A 2VL4A 4TQEH 2JJSC 5EULV 1I1YB 3VGFA 4E41D 5BV7H 5CCKH 1ZKAA 5LXGH 2P1YA 2W65A 3VMPA 5J9PB 2EYTA 3QSKB 4MB4A 5EBMB 3R4DA 4ZFOB 1MVUA 3U9UA 2AKRB 2AXHA 2CUHA 3JZ7A 2FL5A 3KS0J 3CCHA 1JWMB 3LKPA 4MXVE 5DJXA 5MHSD 5I9QB 3BP5A 3H7LA 2NY2D 5DD3L 5DZNA 3O2DH 5GGTL 1BQUA 3DJ9A 4HUUB 3PG2A 4XXCC 5C07B 2NY3B 5C0BD 3V0VB 4YHLL 3MJ9A 1QFWH 1Q0YL 4RBPH 3S98A 3OKLA 4G6KH 1RZIA 4FQQA 4OT1L 2J5LC 4PG9B 1PDKA 4MNGE 1N7ML 3NFNA 3U9PH 4EQ3A 3C5JA 3KPSA 5DWUH 4Q9RL 1V3MA 2D7QA 4NO5A 3FT4A 3W9DB 5FO8B 5I71C 1D5XB 3CFCL 3QNZB 1YZZA 1FORH 4N8PA 5IJKA 4M7KL 2DLTA 5JHDE 3HZVB 3WHXB 1QRNA 5C9KA 4R0LB 4HZAA 1N26A 4JO3L 4KAQH 2IADB 5SWQA 3DUSB 1IGJB 5EA0H 3RY4A 4XHJC 1T1WB 4JFFB 3KHQA 1TCRA 3RIFF 4HIJB 4AEFA 5ALBL 2AS5M 4PGDA 3P4OA 4O58L 1FL3B 5IJKC 3BKJL 4R3SB 5L88L 4PRAB 1FAKT 1SVCP 5FYJH 3M8OL 4LKCB 4P2OA 5FYKD 4K94H 3ZL4H 4PP1D 2VAJA 3WIFB 5TQ2H 3BXNA 3FL7A 3T0EB 2D0FA 4M5YL 1I3GH 3E2HB 4AENB 1YMMB 1FJ1B 1LE9B 5E2JA 3PWUA 5HBBA 2C1OA 2JKXA 4OZFB 3RY6C 4NSKA 1IZKA 3RWGA 4P2OC 1K8DA 3EYUH 4JGUA 2R0LL 3MZTA 1VPOH 1FN4B 3U46B 1HQRA 3O41A 5TE7H 1OLZA 4IRSB 1KELH 2F5AL 3LZFH 2DQDH 2CLVA 3FQNA 1IGIL 4WW2A 5H37G 3CX5J 4KDTC 4P23A 3NGBB 2H45A 2ZPKL 3OB0H 4Z95L 1FO0H 4PTUA 5HHME 4U33A 3SKUD 3VI3F 2YZ8A 4ZD3H 3IRZA 4NQCA 4D9QD 4OIIH 4C4KT 4S10A 2FJGA 3P11H 5J6GB 4WW2C 2X6MA 4FOMA 3WCYA 3RZWA 2IPUK 1Q9LA 3HPJB 1D5IH 4YPJA 1YDPA 4I0PB 4UIKH 5CWSA 2AV1B 1DQQA 2ID5A 2RCSL 4TVSa 4UI2A 4NOFA 4JO4H 3S4SB 3FCTA 4XVTL 1FC1A 1A7QH 1W0WA 3QXDA 5DQJB 2P8MA 2DIJA 3LKRA 5FXCH 3QPXL 4LQFH 5CINL 2WINA 4JM2D 3PE9A 1IT9H 1S78C 1YA5A 3KXFE 3QUMH 5K93A 4K7PH 2ZCLH 4U1SB 4ZXBB 4KY1L 1CR9H 4XH2A 5E5MA 4IIQA 1A7NH 4FG6D 4XPBH 1XIWC 4Q2ZA 2ADFH 4ZAKB 2D4FA 2EEAA 2B8OT 4MJ6A 3BUTA 4YHOL 4GKZB 1FG9C 1O7SA 1SJVA 4LU5L 4JG1H 3VFSB 1T20A 2X7LB 1EHXA 3F6LA 4QCIA 5B39B 5IVXF 3FFCB 3OBAA 1IAOB 1ORSA 3NCEB 3SBWC 3EFFB 2HG5A 5IMKB 5IESL 2IQ9L 4DN4H 1OAQL 3F62A 4MD4A 4JRYA 5A2FA 3FRUA 3VXRD 3SDDA 1IGYA 5JOFA 3PGCB 3BX7C 2XWBB 4CVXB 4QHMB 5FCUL 1C08B 1QFUL 3HG1E 4TTGA 5HGHB 2DWEB 4YPGA 4L29B 4NT6A 4NBZB 1HHKB 1T0NB 2VDOH 5KSVB 5DEFA 2PR4L 3MXWL 4S1DC 1FPTH 3STLB 1PLGH 1F6AA 1J7VR 4RGNB 4BH8A 4HS6A 4PGEA 3HUJE 4V1DD 4GG6F 5FDYA 3GMNB 1MAMH 1KGCE 1ZSDB 3MRDA 4RIRB 1LO3H 1QNZH 3ARVA 1CLZL 5ITBH 2LTQC 1BLNA 1NFDF 4TTDC 1WT5A 5A16A 4GSDL 4TSAH 1UH2A 4X9IA 1T89A 1WAAF 2IBZX 2BOBA 2ZNXA 3D39E 5HSFA 1OLLA 3DRQA 3U7AA 1AJ7H 3PF2A 2XTJD 2VLKE 4HUNB 4L1DA 1NAMA 1HSBA 3EYOA 1RUAL 5GRUH 4Q6IA 4QYOA 1WT5C 2O5YL 4JJ5B 1T89C 1JGEA 5C0GB 4R90L 2W1NA 3NA9H 4LBEA 4X4ZA 4YO0B 3TEUA 4GS7B 2GI7A 2J88L 4K3DH 1TETH 3NABL 1XGRA 2Y07H 1ED3B 3FQTA 3ZDXE 4KTDH 1QQDA 2DYPA 3O3EB 3TV3L 4L4VB 4Y5YB 3VRLF 1F8TL 1MCWM 3DV4A 1CQYA 4OM0H 3KPQA 4UT9L 5GRJL 5E1HB 4WFGD 3OKDB 4PJDB 2PYEB 2I5YH 3I6KA 5E24E 5FV2A 1SJXA 2PETA 2PKDA 1I7UB 3K2UL 1AO7D 3QDJB 3HNTH 5FM5O 4LVOB 1GCFA 3QFJB 4P2CG 1GZQB 1MAJA 2A83B 2AJSL 4ODXA 5IVNA 1F42A 3G6JE 4Y8AA 5J12C 2P8PA 3V7AG 1G6VK 2IAMA 4U1IB 1P69B 2GHWB 4HIXH 5T1KA 1OP3K 5F6IB 5JHLL 1T03H 4D0BB 1JF6A 4P9HH 4Y1AA 4MNHB 1YMHB 2GJZA 1HNGA 5LWYH 2EXWD 4RWHA 4F7CA 2YWZA 3CD4A 3W39B 3GRWH 1F2XK 5HVFB 3QO1B 4W4OA 4WUUA 1FSKB 4UQ3B 3WFCL 4CU7A 4LSSL 3H2WA 3B4NA 3HI5L 3NCBB 1AKJB 1K5NB 1EVTC 2BJMH 1CL7L 2ZCKL 3VXSE 2IAMC 5CZKA 3P4MB 1RPQA 3ARSA 3I6GB 2EDJA 1CDJA 4MNQA 4NRYB 4HWBL 2YPVL 5KG9B 4Z0XB 1KJ3H 1QR1A 3HRZB 5T1MA 1S7RB 4NOBA 2YA0A 1DZBA 4W4OC 1WBXA 3OKNB 1FL6A 3P4NB 3WS6C 2DM4A 2UWEE 2OP4L 4R4NC 43C9A 2EH8L 2NY5H 3SKNA 2BSTA 4LK4A 4G8IB 4OFYA 3BRGC 4PJAF 1GC1C 4WFEE 3H7BB 1XZ0B 1JWUB 3VI4E 1PFCA 4EQ2A 5FO7A 2B39A 1CFTB 3SDAD 1D9KA 1AI1L 1JIBA 3FO1A 4L3AA 3H42H 3H9HB 4AG4H 2FSEB 2XQYK 4G42B 3KPNA 4NO3A 3QAZC 4DW2H 3B2UD 3NFSH 4RAUB 3HC3H 1NCTA 1ZWIB 5DJAA 3OAZH 1L7IL 1QSVA 5E6IA 1PEWA 4BUGA 1XGTA 4X4XA 3QUXC 5F6HI 3IFOA 1Z9OA 1D9KC 3QUZA 5EOTB 3BEWB 5I0ZA 5DK0A 2IMNA 2DLIA 1WFUA 3GK8L 2OMNA 1H3VA 1E6OL 3DO7A 2V2WB 1YNKH 4RGMB 4WDIA 1I1AC 3O6KH 5E6IC 4D94A 3K4ZA 1BX2A 1IC5H 4HIIB 2DMCA 4YXKH 4Y4FC 3JV4A 3SQOH 3OZ9L 4YHZH 3OJMB 4Y0GA 3QUZC 3TBSB 3IU4L 4NN5B 2JK5B 5F1OB 4OTXH 1RJYA 3MRMA 4NBYB 3MRKB 4HK3N 2NX5A 3P0VH 1WIUA 1MNUH 3MLTA 4J3WA 1T83A 2DMKA 4P2QB 3U4AA 4BQ9A 1S3KH 1DUYB 2Y36L 3CVHH 1XGYL 2OL3H 5JR1H 3ULVD 3MV7E 3MGOB 1OSPH 2IPUG 4XPGL 5ABDE 4OZHE 4JKPL 2BRRH 4RFNC 1T83C 4P5MB 1P4LA 5EU4B 1OM3L 4HCRA 3MJ8A 4JR9H 1S5HB 3PWJA 4FFVC 1OT2A 4C57C 5KSBB 3I3DA 2QQQA 2BSSA 2BFVL 1BHGA 2IPKA 4UTBL 3HA0A 2P46B 3K3QA 3NIFE 2YN3A 1SJEA 2QSQA 3E6FB 2BVUA 2JB6A 1AP2B 2EC8A 2IH1B 5DQDH 4JN1H 3U79A 4D0DA 3IS0X 4KDVA 5DUMH 3MLZL 3MYJA 2AJXH 1K4DB 1DUZB 4IJ3C 2MTPA 3ULSA 2FATL 2OXHA 4QRUA 4FP8L 4LOUD 2G60L 1NBZB 1QA9A 1Z9SA 5E94B 5EDXA 1AQDA 1CE1L 5CFHA 3D9AH 5FEBA 1I9RH 4YHIB 1W0YT 4XP9L 3STBA 4JY6B 1FZOA 2B2XH 2MQCA 4PJFB 3C2AH 4MA3A 3IGAB 5JHDA 5E8PA 1VKXB 3OXSA 4NKMA 3P9LB 3O6LH 1G6RA 5IKCA 1GYAA 4RGOH 4WGVB 4EXPX 3MREA 3VXQA 4FFWC 1GVIA 3VFGL 2VR4A 4OCRL 2I07B 3HC0B 1ZMYA 5T5NF 3VWJB 3TPUB 4I18A 4M5ZL 3U4EA 1L9MA 3AREB 4MQXD 4DK3A 4HUWB 4HZLB 4MVBD 1GSMA 3B83A 5EG6C 2AABL 2AJYL 3BZFB 5DD6B 3SKMA 1A47A 2FJFA 2Z0BA 4NKQB 5DO2D 3VXOA 5JPNB 3NPZB 3UBXG 5DR5L 2HYMA 1HHJA 2W07A 2BY2A 3MRFB 3V6ZA 5CEYA 1OPGH 4I18C 4OFVA 2GFBA 2LE9A 3F65A 2B0SH 3I6LD 2AJ3A 1QBLL 5FUOH 4M3KB 3FMGH 1MCSA 1CZ8L 2E7HA 2A77H 1SBSL 5D1QD 3O3AA 4GOSA 2WBJD 2BDNH 2WIIA 4YX2H 4MHHG 3C6LB 2G75B 1MJJA 3G08B 3HE7D 3RUGE 4CJ0A 2VDQL 4IOFD 4KKLD 5HYQB 3HTLX 1WBZB 1KJ2B 5KVMC 5TF0A 3MRPA 4FQXB 3RHWF 1FV1B 3EYQD 3OJDA 4YBQC 5GGRA 4KK9D 4XNMB 5IB4B 3NZ8A 1OP5H 1UXWA 4GW5B 3P2TA 1X3DA 4LSPH 2ENSA 4H1LA 5JUEL 1QFPA 3B9KA 2F5BL 4P4RB 2LAGB 2HFGL 5SX4H 43CAB 2HJKA 1IARB 1VACA 2D7MA 5C8JA 2ESVE 1NLDL 2FX8L 1JNNL 4IOIB 1HZHH 4QRQA 1A9EB 1YEIL 1MFCL 1G7QB 4M62L 1CFNB 1QD0A 2E9IA 3O9WA 4NO0B 2W9EL 4NKIH 3B9KC 1FFOA 1YEFL 4I5BB 4JZJC