1R24A

Fab from murine igg3 kappa
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
206
structure length
206
Chain Sequence
DIQMTQITSSLSVSLGDRVIISCRASQDIGNFLNWYQQKPDGSLKLLIYYTSRLQSGVPSRFSGWGSGTDYSLTISNLEEEDIATFFCQQGKTLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of homophilic binding in anti-tumor antibody R24 recognition of molecular surfaces. Demonstration of an intermolecular beta-sheet interaction between vh domains.
pubmed doi rcsb
molecule tags Immune system
molecule keywords PROTEIN (IGG3-KAPPA ANTIBODY (LIGHT CHAIN))
total genus 38
structure length 206
sequence length 206
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r24A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r24A01
4G8EA 1T4KB 4QOKA 5IKCA 4KVCL 5I1LA 5CZVH 3VE0B 3JZ7A 2KZ1B 1N6VA 1D5MB 5J57B 5JHDA 4K71B 4EVNA 1HXMA 1T1XA 4LCCA 5FM8A 3S4SA 2OK0H 3LSOB 1WFOA 3DV4B 2XTJB 1WWAX 4PG9B 4W6WB 3MRJB 5JOFA 3TBTA 4YHLL 4UUJA 2DWEB 4AIZA 2V17L 2VRAA 5EO1B 2C9AA 1JP5A 3DUSB 4OLZL 4G7YL 1OAYH 1RZGB 2ZOKA 1R3IH 4X7TA 2IGFH 4YAQA 3CFCH 1WAAE 5B3JF 3LQAH 3VD5A 2R56H 3OR6A 3QFJA 2R0ZL 3FB6A 3EW3B 4MJ6B 5D2NB 3WIIH 1T1YA 5C0JB 3FO9B 4WUKH 3BIKA 3WLBA 3G5ZB 5FYJU 5HHQA 1CYGA 3DHMA 3GSVB 3IJHB 4UAOC 1B4JH 5D1QA 1D5ZB 1C1EL 1QD0A 1JFQH 1SEQH 2EYRA 3B2UD 1T2QH 3TO4C 1DUYB 1QSVA 4XXDA 3IDXL 5I16A 1ZHBB 5TQ2L 2HA1A 1RIUH 3P0VH 1H0DA 1U95A 3RZCA 3B4NA 4MZ2A 3SE4C 3X17A 5F7EL 5SWZE 1XR8A 5H35A 1MCJA 4ZUTA 4Q6IB 4PJIE 1WCBA 4KJWC 4XPAH 4L4VE 4NRYB 4YHML 2OR8A 3RU8L 3O6LL 1AD0A 1C12B 3VXUD 1KJ2A 3QUML 3L9RA 4LF3A 4Y5VB 4KMTH 5IWLA 3MACL 1CICB 5D71H 5AUMB 4U1NA 3W81A 4Z0BH 5DMKB 2VABB 4L8DB 4JFDA 3H0TB 3QQ4A 4PJFB 5K9JH 2OSLA 1QTYT 4IRSA 2OJEA 2AJ3A 4H26A 5BJTB 2OMNA 1SJEA 2M1KA 3MO1A 1R3KB 1CR9H 4EZMA 5H94A 1F6AA 2UUDH 5L6YH 1TQCC 1AQDA 3A6BL 5HBBA 1PDKA 3UPCA 2OXHA 1R3JB 1V05A 3UX9B 2PYFB 1R0AH 1KB5B 3VG9C 4XWOC 2P42B 2F19L 2Z35A 5D7LE 4ODTH 3TLRA 1OVZA 1JWUB 1LDSA 5IVZA 1WBZB 3MLSL 2FYYA 3MRCB 1RAMA 2QSQA 2H6PB 5HHVH 1EFXA 1G7MA 3I02B 3PWPE 3U6RA 5CCKL 4IMKC 4JR9H 1D9KA 4K55A 2AEQH 4YPGA 3RGVA 1S7VA 3WE6B 2XKUA 4MDJB 5GRWA 1GGUA 3L3IA 5ESAA 1NLBH 4QOKD 3U7WH 8CGTA 4DAGH 1PVHA 4X0KB 3DXAD 4GRLB 1S78C 4LP4A 3LEVL 1P7QB 1DUZB 2X89D 3CC5B 2GYSA 4U1JB 1ZGLP 4JG1H 3PXHA 2Y6SC 1CDBA 4FG6C 2C1PA 3MBXL 3U30C 3RJDA 4CMMB 3EFDL 2VZTA 2HTKC 5A1AA 4YC2C 4J3VA 3HZVB 5J11B 5D9SA 2CGRH 1HYSD 2NW3B 3D9AL 1RUPL 4MJID 4PRPD 1NBQA 4O51B 1ZKAA 4JKWA 12E8L 3SOBH 1PKQB 2VDML 4HWZB 2P24A 4F7MA 3O11B 3FOMB 3NTCH 1Z9OA 4LAJH 4OIAA 1NFDF 4HJ0C 2B39A 3C6LA 2R8SH 3CU1A 5A16A 3VI3F 1DR9A 1J8HB 2LVEA 3FQTB 5JXAL 5E2TL 1BQUA 4FQ1H 2H32H 2HFEB 5EU5B 2NZ9C 3SY0B 1VA9A 3LHPL 1ED3A 2FL5B 2N56A 3QDJB 4FFZH 4OLVL 3SCMC 3MNVB 4Y5XC 5GGTA 3VWKC 2ZCKH 5MEQA 3GMMA 3LDBC 4GKZB 4PBXA 4LLDB 1FLTX 4LCIH 1BQHG 4GRMB 1B0RA 5KVGH 3N1MC 1U8KA 1A7RL 5CEZL 4OLYH 3ZE1F 4ACPA 4RX4A 4U1NB 1YEHL 5JNYB 4J3SA 3OQ3B 3WFCL 4YDLB 2NZ9D 4JPVH 5DZLA 3HNVH 3TCLB 4H20L 1SY6L 2PTVA 3FZUC 4MD4B 4F7TB 4M5YL 1XF2A 1OGTA 3GJEB 3GSXB 4JZNB 1K4CA 3OZ9H 3QQ9D 4P9ML 3BHBB 5L2KD 5KSBA 1TNMA 3QR2A 4JFHD 2GTZA 1CDIA 2XWJA 4LOUC 1MI5E 2X9XA 3D18B 2IFFL 4R4FH 3BPCA 3QI9B 1B0GA 3GO1L 2Z93B 1BMGA 3IJHA 1IMHC 3VFTB 1S9KC 3BW9B 3KPSB 3N1QC 4PY8J 2UWEB 5FHAH 2NY4D 1OAUH 2W60A 5I1GL 4X4ME 1N2RB 2BNUA 1S5IL 1MREH 5FKPB 1E6OH 3TNNB 3N9GH 1MI5B 4P57A 3OKNB 3GI9L 3SO3B 3IVKB 3O3DB 6FABL 4NQXB 1VFBB 1AFVL 3SQOH 4MJ5A 1J10A 5T3XD 1FJ1A 4LGSB 2Z31B 2OI9C 1N3NA 5EIQA 3MRIB 4P48A 3SDXF 1ORSB 1MVFA 1CFSB 4OI8A 3HRZA 2H1PL 2Q7NA 3T0BA 1DBMH 3MJ9A 4L3CB 1JYNA 4PRHB 3V4VH 1MHHB 4JLRB 5E8PB 4HKXB 3MCLL 4PJXE 1J0ZA 1EO5A 3LN9A 5FFLA 4MNQD 4YHZL 1NCBH 2EDXA 5DUPH 4Y16A 1YEGL 2Z9TA 3W39B 5IR1A 5D6DC 4M6ML 2RR3A 2WBJC 3NZ8A 1QBLH 4R7DA 4M7LT 5EU4B 2R0KL 1ZA6B 4WWKB 1QPPA 4Z8FL 1S8DB 3DVNA 2Q7YA 4IJ3C 4WI8A 1N3NB 3GMOB 1R3HA 5GXBB 1KLUB 2OTWA 2XWTA 1P4LA 1CGUA 2JCCB 3DURB 1OSPL 1A4JA 1LD9A 1H3PL 4S1SL 4UT7L 3MJ9L 4KKBD 3BRDA 4HWEL 4JHAL 4GG8A 4HUWA 4OCWL 5IB3A 1MI5A 4GMTH 3LKSB 4Z77B 2XNAB 2BNRD 4GBXD 3FOLB 3ZKNC 3DWTA 5JTWA 2XQYK 5EN2A 1BAFH 3DURA 3KPMA 2I5YL 2CLZA 2VB5A 4JZJB 1G0XA 4EUPH 1TZGL 1AXSB 4GAYA 4NKOA 3LRGA 3VG9B 1DLHA 2DM7A 1M6OB 1G6RL 2MFNA 4DK3A 4WW2A 3WNOA 2XWJB 4R7DB 2NY5L 4FZEL 1GC1L 4J3OC 4IIQB 1A14H 3IU3B 4WFGD 1QNZL 5ITFB 4X6BB 3RZWA 5DSCA 1LP9B 1A6PA 1KBGL 5DJ2A 4KJQD 4P3CH 4APQA 3HR5B 3KPNA 3U9UB 5L8JB 4ZUUA 1Z2KA 3OHXB 4JLRA 1FIGL 4B41A 3BKYH 3J8F7 3C60C 1KPRA 5BS0A 3RGVD 1YZZA 4AL8L 1H3UA 4R7NB 4RFOH 1Q38A 3S37H 2NQCA 4JREC 3SPVB 2BJMH 1ZEAL 1FDLL 2WP3O 4LIQL 2IPUG 5ID0A 4U1HB 1NAML 1CK0H 5IMMA 5JA9A 5DHYA 1DQDH 1FYTE 4LRIC 4P9HC 1F4XL 2DBJA 3G5XB 3MNVA 4PJDB 2VQUA 1IAIH 3MRFA 4Z7QE 5HDQH 1T89A 1JNHB 3QUZB 3MGTA 1TITA 3FT4A 3FFCB 1MHPL 3PGDB 2QHRH 4OLEA 3B3IA 4BK4A 2W60B 4MQ7B 3KPPB 4YHIB 4ZFFA 1MCEA 4Y4KA 3LKSA 4BFEA 4ZSOB 4NO2B 4PBVC 5M94B 3U7YL 3KDMB 2YRPA 4JHWL 2LU3A 4G6MH 4KZEL 4OT1H 5C86A 3MGAA 1C5BH 3V0WL 1HIMH 4JGJA 3V6BR 1CDGA 1BIIB 1R24A 4JE4B 5HHOA 4YDLC 3FRPG 1K4CB 5EO9B 1A6WL 3L7FA 2FD6H 1YPZF 5D7IB 4G9FD 4LMQI 4XPFH 1VDGA 5J6HB 2J6EA 4HQQH 1EFXB 5BMFH 5A2LH 4PJ5B 4PGDA 5KANI 4KGLA 4ZOBA 3TH4T 5IBTH 2FX8L 1S7XB 2Z8RA 3MX0A 4OM1H 3IXTB 3HLAA 2XN9B 1YJDL 5DJCA 4L3CA 5E6ID 2HFEA 5BXFA 2D0FA 1T20B 5D7KE 2R56L 1T1ZA 3MA7B 1HSBA 2R0ZH 2AJZB 3QPQC 5I74B 5CP7B 4P2QB 4O2EA 1NGYA 1T89C 5CJQH 2VOTA 3FFCA 5D96C 2J88H 4M43H 2KUTA 1JYVA 4DWHA 4PJFA 5DK2A 3RPIB 5F6IC 1A6TA 3IGAB 4EOWH 1VFAB 4FABH 1E28B 1B88A 3HUJE 5I1IL 3MRDA 4WDIA 1JUFA 2PYEE 4OGAC 5DHYB 4PIRF 3VDBA 2YSSA 4GW5A 5DYOA 1UH3A 5ID0B 5MI0C 1IFHL 4N0UE 4QRTA 4GAJH 5DO2D 1AGCB 4TNVF 3HI5L 5F7YC 5J6GB 1FZOA 2DYPB 4Y16C 2HJKB 4R3SA 4Z7WB 5ELIA 3ULVE 2D7TL 3R1GH 1HXYB 4ERSH 5I18H 3WUWB 1YMHB 1KFAH 3QI9A 1VKXB 1UZ6F 1S7SA 1TTGA 3RPKA 3F5WA 4JM2F 5LKNA 2E7CA 3RIFK 4P23A 1D9KB 2VR5A 3ISWA 5EO0A 4YBLC 3TZVD 1H5BC 3DX7A 5JO5B 4RGNB 4ZAKC 5F6IB 4XCCL 1MFBH 3CAFA 4JZNA 2HMID 3QXDB 4YXKH 1ZWIB 4C59B 1DLHB 1PQZA 2A83B 3F7RA 3W82A 2HJLA 4YHNB 1A4KA 4ZQKA 4Z95H 5GGSA 1MLCB 2FSEB 3B9KD 3OWEA 4PRAA 2J7LA 1VEPA 3I6GA 1NDGA 2CIIB 3QJFA 4X6FA 3FOLA 3IAQA 1MCWM 3MRJA 4EDWH 1U8NA 5DMKA 3T0EE 3TPUA 4OKVB 1T1ZB 4MB4A 4UU9B 2ICWB 1NAKH 5FUOH 2XV6B 2A6JB 4PJCA 5F70A 4Y5VA 4H1LB 1F3DJ 1A6VL 2UV3A 2HJLB 1C12A 4RA0C 1TJIH 2NMSA 1KLUA 4YHLH 3BESR 5EBMB 1S7XA 1PQZB 1T4KA 3U7WL 1FFOA 5KAQG 1XR8B 4TUJB 5D2LE 1XGUB 2C7UB 1OAYL 2FLRT 1T7YA 4JO1H 3QG7L 1XIWB 5AD0A 3UTOA 5EU4A 3ZO0A 1OCWL 3F12A 1FV1B 3HHRB 2A2QT 5FM4A 2ADIB 1CICD 3U9PL 3O2DA 4HV8A 1GZPA 4X98A 3L3KA 1ZTXH 2A9NH 4OSUL 4I1NB 3KPRB 2AXFA 3LKPA 1LO4H 3TJHD 3BDBA 1UM4L 3VXSB 3AB0C 4R26H 1CZ8L 5J3HC 4GW5B 5DYOB 3KDMA 1P4BL 3WXVH 5JXAH 3MRDB 1OP9A 1KACB 2GW5A 5IBLD 2PETA 5CZKA 4FFZL 3W11C 1UJ3A 3GNML 3DMMC 3ET9F 2YZ1A 5DRWA 3RWEB 4FS0A 3EZJB 4KK6C 3QUXB 1MWAL 5SX5H 3AREC 5D4QA 4F15C 2QKIB 2XN9E 1LEKB 1VACA 3WS3B 2GY5A 4HEPG 3O6MH 3JV6A 3Q1SH 1I1FB 2FO1A 4W6YB 4HC1L 3GMLB 2PW2A 5E8NB 5HHXL 4TSCH 4PJBE 1HI6B 2R4SL 2WWKO 1X5AA 2LAGB 2NZIA 2RGSA 1FIEA 1NMCB 4F33B 3F6LA 2NY2C 4PD4J 3QQ4B 1FVCB 4CUCA 3VGFA 2P8MB 4NO3B 1PGRB 5TE6H 2F8VA 1ORQB 1OLLA 4GQPH 5D72L 2NR6D 2XWBB 1FVEB 2AXGA 3FQWA 5I17A 3HZMB 4WWKC 1RUML 2WANA 4QRSB 2Q1EA 4MAYA 4RMRA 1G7HB 1I7UA 4F15B 3JWOH 5EUKA 5D7JD 1JPFB 4LVHB 1IAKB 1HHGB 1JZ2A 4LCUB 4BSWA 5HHVL 2DS4A 1AGBB 2GY7B 2C3GA 1VGEH 3ARUA 1A7PH 3IAPA 2XWBA 2Q8AL 4J23A 4ODVH 4WFHE 4IS6A 1MFEL 3K0WA 3ARDD 4MX7A 1HOCB 1QLFA 4NKOB 4FFVC 5J3HD 1FVCA 3CLEH 3D69A 2B5IB 1YMMA 4LGRB 1I85A 4DAGL 4EBQH 4M7LL 4LLDA 3NACL 5SWZB 1KJ2H 3MRGA 1S9WB 4L3EB 4UINH 3M45A 3WIFB 3LQMA 1LK3L 5E8NA 5EBWA 2C5DC 3OXSB 5E8EB 5I9QC 4K71C 5I0ZA 1C5CL 4R90H 4PRHE 2DQIL 1CQKA 3WFHB 4D0BA 4L5FL 1BGXH 5ETUB 4LU5H 2VDMH 5E4IA 4XPBL 4ZO7A 4U1SA 4GG6A 1IQDA 4DGYH 2WWMC 5IMMB 2O5YL 2VIRB 1RZ8B 2VDLL 1BFOA 3AAZB 2IF7A 4DKAA 1P4IH 4WWKA 4NT6A 5JHDB 4WFFD 3C09C 3VXSA 4JKLA 3DMMD 4UIKH 2MSPA 1VGKB 4NZDA 3RGVC 4WRLA 5I9QB 1QFWH 2P49B 5DJXB 2DQCL 3CDCA 5IEHA 2D03H 2FJGA 5CMAB 1P7KA 2Y06H 1FCCA 1NCWH 2X4SA 3QQ3A 3RHWK 4WUUA 1U8HB 5DJZA 4FN0A 1P53A 3RY6A 2VDOL 5GRUL 3VWJB 5JHDE 4PJHF 1IQWL 3QHFH 3GUTA 2NY1C 3UZQA 2ARWA 2E6QA 4TUJA 4TRPH 1GVIA 2K3TA 4OUOA 3IJYB 4P9MH 4PJCF 1WEJH 2DQTL 4P5KB 2Z35B 3MUGA 3WV0A 1JNLH 2X1WL 1W8OA 4R97C 4H1LA 3BKJL 1GPOL 4XNQA 1U3HB 5L8KB 5IFHL 3EYSH 1N0XH 1BF8A 4PJEE 4PRID 4RBPK 5A3ID 5BZDB 4GS7B 3L6FA 3U4AA 5TH2B 2R23B 3MQIA 4H26B 1OAUL 3STBA 4LQFL 4YXLH 5C6WH 1JPSH 1IKFH 1NKRA 5E70A 3CCHA 4M9OA 5KS9E 1CL7I 3IT8D 3NABL 5LQBL 1H3XA 3IFLL 2OTWB 2XWTB 4XMPH 1OM3H 1NC4A 3GMOA 1MIEL 3KPSA 5FO7B 2Z93A 5DD3L 3VXUB 3SE4A 1B0GB 4MX7B 4IJ3B 5ESQA 5CBEB 4PG2A 1ZK9A 4NO5A 4WUUB 1T7XA 1XEDA 3ZL4L 2IADA 4XI5C 1PSKH 4Z7UB 4NM8H 4PRPE 4OQTL 4OF7A 5IROA 3WMSA 2VE6A 3NIFF 3QFDA 3WN5B 2CIKB 4NZTH 2AXGB 3FQWB 5E2VH 5I17B 2XPGA 3BPOB 5C3TA 3H2WA 4YEEA 3MV9E 1JTPA 2FBOJ 1OAXH 2PO6C 3VRJB 1F02I 3QQ9C 4N0CC 1MJJB 4QT5A 3L3OA 5HHMD 1ZGLA 3GJFK 4GKZA 5IBUG 2GJ6B 3P0YH 4FFYH 3HNSH 3WFBL 2CRMA 1RFDH 4PGBA 4HZLB 5SWSD 1JL8A 4JY6B 4XNUL 4G9DA 4NQDA 5IVOA 4L29A 2DL2A 3MJ6A 2OL3L 1D6EA 4OJFL 2OL3A 3VJ6A 1QVOB 2W9DL 4LCCC 3U36B 2LABA 1JGLL 1OSPH 1HIML 2P43B 5CP7A 4H5SA 2R2EA 3QDMB 1AP2B 3I6KA 2XN9D 5E6IB 2IG2H 1QBBA 1QEWA 3IU4L 4P23D 4XMKH 4U2YA 4HUXB 5ISZB 1NL0H 1T5XA 1PY4A 3MCKA 4I8DA 4QHNB 3C5SB 4NQSA 1IGML 3MC0A 2EDJA 1LQSR 4PJ5A 3FQUA 4G5ZL 2J6EL 3P30H 1HSAA 4KV5F 2Y7QB 3VRLF 1XIWD 1GOHA 1CI5A 5DJ8A 2XOTA 4E9LA 3OKEA 1G9MC 2FLBT 2OK0L 5GGVL 2VC2H 1FV1A 4NQCA 4MMXC 1R24B 3FZUD 2XZZA 3LN4B 2DJ4A 4OI7A 5EU6D 1MAMH 3EOYG 4MA8L 4RBPH 4OGZA 4LSSH 5CZXC 1QLRB 3T09A 3N0PB 4L4JA 5L9DL 3MCKB 2F8OA 1RIHL 5KSVB 4Q9CA 3K1DA 4RFOL 5I1IH 3SE9L 5E6IA 1BIHA 1ZEAH 4XH2A 4RWHA 3DYMA 1G7PA 3PGDA 4N0FA 4HMDA 2AJVL 5F3BB 4CN6A 1KCSH 4OI9A 4WV1C 1U42A 4P59L 1YUHB 4ONOA 3GFUA 2EXYC 2IALB 5DD6A 3T3ME 4JDVA 1B4JL 4LEXH 1DZBA 4XZUB 4OTXL 1E4WL 3OB0K 1N8ZB 3FO2A 2GJZB 3SDXB 4JVWA 3IFOA 4GRLA 1BQLL 4F57H 4NZUL 4F9LC 32C2A 4YDKL 5FYKH 4ZS7H 1A3RH 1J7VR 3JWDC 3RTQA 2XG5A 4GBXC 3IXAA 1J87A 2V2TB 4O2CB 4ELME 3PWVB 4Y1AE 3ZKXC 5JR1L 2IGFL 3DRQA 2L4OA 3GM0A 4HGKC 1FO0B 5C9JB 1CXEA 4UILL 5EUOF 3RWCA 1KJVA 4X6BA 3C8KA 1HHJB 3G5ZA 4HIXL 3UCRA 4AT6A 2XG4A 4QRTB 1FFOB 4JG0L 3QFJB 2BY3A 4RDQG 5C0AA 1FPTH 2O93L 4PREB 4F80A 5DRXA 1HH9B 3R8QA 4JVPA 3SGJC 5F7DA 1G9NC 1I7RB 4P2OB 5IESH 4BSJA 4HAFA 5C07E 3SGDI 3MRRB 1XAUA 3MRPB 3KYKH 4FQXC 2DIBA 4I4WB 3QG7H 3BKML 1U2HA 4NKQB 2YXFA 2FSEA 3NCBB 1JPGA 1TENA 3ZT7A 5BRZA 3U0TB 3GM8A 3QIWA 4Y4KC 2VKXA 5GRZA 5DJCB 2JKXA 5KW9L 4YHYC 2JJTA 2A9NL 5DUBA 1RJZB 2Q7YB 3VXNB 4Y4FD 4Z9KB 1MAJA 1R3LB 2EXWC 2E8ZA 3WNKA 4HFWB 5IB4B 5SV3A 1AY1H 4KMLB 3QXWA 3EFDH 5DMJB 2BERA 3NCEB 4CJ0A 3JTTB 2OTPA 4F8QA 2APWA 4PV8A 3U48A 3MLTB 1GCFA 1WTGT 3U83A 4JGMA 1PLGL 4X80L 4OF3A 1AGCA 3H6JA 5C0JA 4LKCA 1NEZB 3FB5B 1C1EH 2VKWA 4PJ7B 1G84A 2QV2A 5IM7A 4WDIB 1A6ZB 2ESVA 3BN9C 1CFBA 3C5ZB 4XCCH 4ZO8A 4NZRL 5HHXH 1BZ7A 5K9QI 3CX5J 1IQDB 3E3QC 2L7JA 3CFKB 5D8JL 1WWWX 3ZE0F 4OZHE 5HYJB 4F37F 3TZVA 4QY8A 4ZODA 1A1MB 4Q0XH 3JWDL 3U36A 3FCTB 3FT4B 1KB5L 2WWKT 1W72L 2AVGA 4LHUB 3WKML 4TQEH 1F4AA 4U1MA 4JPVL 4D2NA 5B39G 1UYWL 1N5AB 4H20H 4O9HH 2D9CA 5EWIH 3JV5A 2BVEA 1OGAD 4WHYH 5HYQB 4BQ8A 1CT8B 1TJGH 3ZHDA 1CR9L 1FNAA 1JMZA 1YMMB 5EOCJ 1MJJA 3RVTC 3GIZL 1FAIH 4ODBD 4Y19B 4ODVL 2YZ8A 1HEZB 2MJWA 3HE6D 2OJZH 1DFBL 4WHCA 4C54A 1A6VH 4KXZH 4CGTA 5JORA 5F9JB 3MJ8B 2Q20A 3VCLA 3MV9D 3V7AE 1RJYA 4RAVA 3T1WA 2YMXH 3L7FB 3HAEH 3VI3E 4AENA 4X6EA 1LP9A 1I8LC 1Q9OB 1A1OB 2EC8A 3FONB 4PJ7F 3WIHH 4QRSA 4DQOH 3G9VA 1BVLB 5DEGA 1RZFL 1FYTB 5E8OB 3DXAE 4Y5XB 3WFZA 5JIPA 43C9B 1CDCA 3ZE1E 4GAYB 1BQHB 4HG4J 1UB6B 4YO0A 2QHLA 1F4WL 5T5NF 4QRPD 4RISH 2F53D 3P77B 5C0IB 4XAKD 3T2PA 5CINL 3QSKB 1OTSD 4WHTB 1F3JB 4BQ6A 3O3BA 1J0YA 3OKMB 1RZJC 3HN3A 3MNZA 1U8IA 2HT3C 1A3QA 5DHVB 1YEEL 4K7FB 4KHTL 1PBYA 1EMTH 3AM8A 3PXJA 3QIBD 2OLDA 4LVNB 4CMMA 3VXME 3KHQA 3WDHA 4LLQB 2AEQL 2GIYA 4P5MA 2EDDA 5C07D 1UWGL 1UKTA 3OSKA 3RWHB 1U8HA 2ZCKL 1KPRB 5FDWA 4M3JA 2AV1A 5J06A 3SDCB 5HTSA 3STLA 1Q9LB 2AI0H 4PJAE 1CD1A 4FTVB 1EEZB 4PP2A 3WNNA 2D4DA 5C0RH 5HGGS 1YN6A 3EOBB 4WU5B 5EFIB 2XIDA 4HPYH 1XF4A 3VD4A 4UV7H 3M1BA 3O2WL 1SY6H 1I1YB 2C4XA 4OZ4A 3SDDA 3L7EB 5CBEA 3JWOL 4PJBA 4EUPG 4YHPA 1EGJH 1KTRL 2A6KA 2ITCA 3ULUH 1RQ5A 1NC4B 4HIJA 1F2XK 4OCXH 4Y1AD 5FGSA 3UJIL 1ZOXA 1QQDB 3IFLH 4P2QE 1BJMA 3ARSA 1VFMA 3RVVC 4P2OC 1QSEE 1UZ6E 2NY3B 3RUGE 4DOHB 1YY9C 2CXGA 4C56A 1OGAA 3BVNA 3VGGA 2YPVL 3SE3A 2LE9A 1OWRM 4UQ2A 3I3BA 3FN9A 3I75A 4C83B 2R1XB 2X4RB 2NY5H 2VZUA 5F9OL 2BOCB 3EOAA 2OSLB 4Q9QH 1A14L 1BVZA 1BJ1H 1QNZH 1ZA3B 4AEEA 1QPXA 3MRGB 3SCMA 3AY4A 2R0LH 4ZOEA 4RGOH 4FQCH 3ZTJH 4S1SH 5DJDA 3TWCL 1S8DA 1GGCL 1BGXL 1C08A 1HOCA 1I9RL 1RZJH 1KLGB 2EO1A 2MWCA 5KOMC 1YPZE 1OAXL 1VEOA 1OPGH 4OZIB 3GSQA 1ZHKB 2X42A 3ZE2E 3VI4F 5C0BB 5CSGA 4XHQA 3RY6C 3UC0L 1TJHH 3Q6GL 1U2CA 4KPHH 5I16B 4GRWB 3RIAF 1A0QL 4JFHE 4TTGA 2ZPKH 3RFZC 5E8DL 4NFDA 4XP4H 1TZGH 5E8PA 4MAUL 3K2UH 1GGTA 5DVLA 5JOEA 5E08L 2HJKA 4R3SB 3MCLH 3RVTD 4M9PA 2P8MA 4NO3A 1MFCL 1MCLA 2P7TB 4G42A 4P0DA 5DD1L 5FGCE 4FQ2L 1LVEA 3GJFA 2Y1VA 4POZD 1GIGH 2HKHH 2VXUH 1JGDA 4OFYD 4OM0H 5M7QA 4PBWD 2GK0A 3RVUC 2C1OA 1FGVL 4MDIA 4Z18A 3TH2T 2GSIB 2YD1A 1NBYB 1DLFL 4AJ0A 1AC6A 4MNQA 3UTSE 3CSYB 1DDHB 3E2HC 3N50A 5GS3A 5D7SL 2BJML 4BKLA 4XAKE 5J1SC 3FOMA 2LTQC 1DQJA 1ZANL 4XNZC 1CIUA 1I3UA 1WFUA 5C0DB 3EJZC 4U0QB 3RAJH 4HKJA 3C08L 1ZT4A 1KLFA 3K80A 5GIRA 5D5ME 4PRDB 3VXTB 2VL5A 3W0WD 4FFVD 1BAFL 1TZIA 2FEDD 1CCZA 1SVZA 1K5NB 1AGBA 5H37H 4L1DA 3CFBB 4I3SH 5D6CA 4QNPF 5DQDL 7FABL 5EUKB 4EI5D 3ALPA 3RVWC 3FB7A 4MD4A 43CAB 4XVJH 3AFLA 4PJ7E 4UV4L 4M6NL 5H37G 4F3FA 1ORQA 5BZWA 2AJVH 3P4NA 5I1EL 2EYTB 3MZTA 4G6ML 2COQA 3B2UC 4KZEH 5J12B 4HD9A 4PLJD 2XZCL 4MLSA 1KSRA 3LOWA 2DKMA 4UTAL 4NZTL 3CGTA 3MJ9H 3F8UB 5E1HB 2V2WB 4P2RB 2CKNA 4OCWH 4U6HB 3O0RL 4GQ9L 5IF0A 5C0AE 3LMJL 2ID5A 5ISZD 1JZ3A 4HBCH 5GPRA 3DO7B 1I9JH 1INEL 4PJ5E 3WXWH 4Y4HC 4GAFB 2ZCHH 2OL3B 4MQXC 2IPUK 3GKWH 4MAYD 5DQJA 2GITA 3PQYD 1D5XB 2B4CC 4M00A 1MLCA 5GRJL 3QZWB 4XX1E 1UJ3B 3KLHD 4ZQKB 2R15A 2VDRH 3HZVA 1YJDH 2R0WH 1SQ2N 1FFNB 3MA9H 2Q87A 3V5HB 1IAOA 1JK8B 1QO3B 5GGUA 1MEXL 1LWRA 3RKDD 1ZWIA 5IFAL 2QHRL 2JTDA 4RGMB 1CD0A 4MLIA 3GSUB 2LV4A 4XC1H 3M07A 2YBRA 3FRPA 3L5HA 5JDSA 3MTRA 2KQMA 3BRFA 5F9DC 4DEPB 1A6AB 2P8PB 4NQDE 1KXQE 2XTJC 2NTSP 4JO3H 3LKNB 4OD2A 3BMVA 5FCUL 2V5YA 1UM6L 3PQYA 1JHTB 3VXRD 1JZ7A 5T1DH 4QRQB 3U6RB 1N5YH 4GAGH 1RURL 2CR6A 3NCJH 3LZFL 5D2NE 3WLBB 5LWYH 1T1YB 1TETL 5I1CH 4XNXH 4IOIA 3SKNB 1I1AA 2PR4L 3W9DB 3RX8A 4Z7WE 1OHQA 1VENA 1X6NA 1EO8H 3W9EA 3WFEH 2YK1L 3OR6B 4WHDA 4NBZB 3NZHL 4OZGB 1ROWA 5I15L 2KL6A 1Q1JL 1UH2A 4NGHL 1RIUL 3P0VL 1I8KB 1H8NA 4M4PA 2BMKA 4V2CB 3CSGA 3NA4A 1NUFA 1ZMYA 1H15A 1I1RA 3QCTH 5GRXG 4ZFGL 4DVRH 3MRLA 3RI5K 1LO0L 1KELH 1E27B 3EIFA 1U3HA 3CLFH 3LY6A 5C0CE 5HGBB 1OL0A 2A9MH 3QHZL 3CXHJ 2A83A 2FX7H 3F58H 5T3XL 4KRMB 5CZXD 3TVMC 4YDVB 5DQ9A 5C6TL 4Y4HD 3IJYA 1YY8A 5L2JB 4Y5YB 2EH8L 3TN0D 1VFUA 2HT2C 3MXWL 1I8LA 3ARRA 3IDNB 3LB6D 1KF9B 3T8XB 5L6YL 5HI4D 4HT1L 5EIVA 1IGTB 4OLUL 4PY7A 3DTXA 5AEAA 3W39A 5IR1B 1SBSL 1YQVL 1S9YA 1NGQH 2NY0B 5IBTL 4BELD 5J6GA 1ZT7B 5F72S 4X8JB 5HXMA 1IC4H 4LSUL 1J1OL 5D2LF 3D3VB 1OCWH 1SVCP 5MENE 1OLZA 1CFSA 1NCUA 1ORSA 1RZ8A 1NGWA 3QDJD 5DA0B 5FECA 2NY6D 4J8RB 4Y5YA 5E2JA 3KLHC 1EAPA 5C09A 5IB1A 2Z31C 2VLJA 4FQIL 5D5MA 1U6AH 4G80B 1F11B 2EDLA 1JGUL 4XNZB 2FEEL 4OFVA 3H9SB 2B2XH 3DV6A 2IEPA 1I7TA 3S5LA 2AKRB 4S1QL 4JRXA 1MHCA 1T20A 4PJIB 2BFVL 2DLIA 1HXMB 4LCCB 5E8EA 4PB0H 1EGJA 4PP1D 1L7IH 3WIIL 3DUHA 5BV7B 4Q2ZA 5DF0A 5J9PB 3EYFA 3HC3L 3FT3A 2CKBB 2HRPH 2VQTA 3FN0L 4CVZA 4NC1C 3A6CH 1FYTD 4QHLA 5TQ0H 4PLJC 2PYEB 3DMMB 4YXHH 1RK1B 2V2XA 4YHKH 4N8CL 1WAAF 2ADFH 3KPSE 1NBVH 5CD5C 4EQ3A 1UA6L 1IC7H 4JHZA 3E0GA 4YXKL 4WEMB 4DTGH 1A2YA 4S2SA 5SWQB 4UNVA 4KU1A 2FJHA 3SN6N 4JPKL 4OAWA 3LD8B 4N9GB 3NPSB 5K9KA 4CRPA 5JNYA 5D71L 1HKFA 4R96A 1JF5A 2BRQA 2J8UF 2C3XA 1ZTXL 3HNVL 1JYXA 5F89B 4GRMA 3B83A 4X80H 1T0MA 4FXGB 5FHBL 2C4FU 2ICES 3EDJA 2L7UA 3LS4L 1WGOA 1PG7W 3F62A 4KK9C 4CDGC 5IHLB 3A6BH 4NBXB 1KCVH 1YYLL 3QIUD 4OZGE 2H3NB 4M3KB 1PG7L 1X5KA 1XCTB 1T2QL 1T03H 1EJOL 3CVHH 4GG8B 5IGXH 2HLAA 2VMFA 3C87A 4LSRL 4OCLC 1AD9A 1AGFB 5JIKA 1MRFH 4LPUA 1SYSA 1JWMB 3MLWH 3GK8L 4U3XA 4C56E 1S7QA 2H9GB 5ILTH 2C1PB 3BPOC 1A7NH 2XQBH 4MXWH 5GHWH 3MV7B 3BP5B 4FXGA 3MV8B 4J3UA 3P3YA 3HPLB 1FC1A 2V2WA 4P2RA 2QQNL 2ZSVB 4A6YH 1NLBL 4XC3H 1FGNH 2Q76B 3MREA 4YJZL 5LVEA 2A1WH 1S7RB 3RWIA 4R26L 3TCXA 3N1PC 4ALAH 1R5VA 4FA8A 3KAAA 1DVFD 3VU2A 1MI5D 4PRHA 2H41A 4XCYB 2IAMC 3WBDA 1R0AL 1ZVYA 5C6PB 2J2ZA 2EH7L 2KZWA 1KENL 5IMLA 1UFUA 1FVDB 4UDUA 1Q94B 4PPTA 5GGSY 2V9RA 3RL2B 3VXMD 3NVQA 1LE9B 4I18C 3IDGA 1P84J 5KTEL 2YD6A 2OR9H 5DJYB 3BMWA 5CJBA 2R0KH 4Z7VF 3X13A 4BH8A 2X4PA 4IDJH 5HYSA 1TQCB 5C08E 5CGTA 5HI3C 1LP9E 4JN2A 3W5MA 3BXNA 1LNUA 2CR3A 5FCSH 3GI8L 4UZGA 5KSUB 3C6SB 1FG9C 4HXAL 5AUMA 3VXRE 5JMRA 4X6DB 2JCCE 4K7PX 5IOPA 4MCZB 3BKJH 4OIIL 5KZCB 2V5TA 4PJCE 3T2NH 4Y5YC 1UXSB 3V4PH 2ZWLT 4WJ5A 2NXZD 1OAKL 1TCRB 1S7WB 3X3GH 3VXMA 1YEEH 3U46A 4DZBA 2MHAB 1L7TH 2H26B 5IVXE 3FQXB 2HYMA 3MV7D 4Y0GA 12E8H 2G60H 3O81A 3P4MB 4AM0B 4GBXA 4S0SD 3PL6B 4X6CA 1MF2L 2VZ3A 4HJGB 3PP4L 4PJGE 4BQCA 3EOTL 2DQUL 4HGMA 3GO1H 3ALXA 3HTLX 1Y0LB 3SKJL 2HT4D 3B43A 3JWNC 3KPSD 5I74C 1NC4D 3QPXL 2R29H 3RL1A 3FO9A 2YSSB 1NFIB 3HKFA 4LKXA 5EBLA 2Z31A 3QP3A 2BOBA 4PRNA 4U4BA 4U7KA 5ECJE 2HT2D 5J1AA 1AO7B 3ARGD 2MHAA 3T4YA 4ETQB 3O3DA 2Q6WB 3IVKA 5FK9A 3HE6C 4QHUB 5ESVA 1IAII 4RRPG 4HKBB 3WJJA 4YDVA 5DQ9B 5JOFB 1LGVA 3HCVB 5CEXA 2D4FA 4NKIL 3UROR 5IG7A 4HMCA 5ICZA 1IRAY 4MB5A 1J05B 2BHZA 5K93A 1AJ7L 5T1LB 2NY3C 1DBBL 2V7NB 3VXRA 3EDKA 3DIFB 3INUL 2X1OA 4IRZH 3MODL 3S88L 5GGVH 3HZKA 4HK0A 5EZJA 3BPCB 3B9KC 5E2WH 5GZOC 3PV6B 1MAML 1IGFL 3FFCE 1OM3L 3RL2A 4NKMB 2HLFC 1OQXA 4I3RL 1IJ9A 1UEMA 5LGJB 3RX7A 3IDJA 5GSRA 3LKQB 5F8QC 3RBGA 3QISA 1ZLWH 2UZIH 1WZMA 4GQ9H 1GAFL 3L3HB 4NCC1 4M5ZL 5JPNA 1IQWH 2X40A 3QHFL 2CDEA 3GI9H 1HDMB 2J8HA 1IL1A 4YR6B 3TBYA 5MEOA 3EOBA 2F58L 4XCFL 1AGEA 1NJ9A 4U1GC 1M05A 4Y4HA 1H8OA 4HLZH 1JWUA 3EHBD 4CN1A 1CD1B 4PY7B 4W81A 1YYML 4UOJA 3ROOA 3H9SD 3BGAA 1CLZL 1FN4B 4NO2A 5EPMA 4RMQA 4WFGE 4K3JH 1GHFL 5D7IE 5DI8B 2VZ1A 4ZMAT 1NGZA 5IFAH 4RNRB 1B9ZA 2EKSB 1FNGA 5BO1H 3AGVA 4GW4B 3V7MA 1ZLUK 1BQLH 4P4KC 3RWJB 1FGVH 1JNHA 1OTSC 4E41E 4I2XA 1WISA 2DF3A 1QRNA 2NW3A 3GSRB 2GQHA 1CICA 5DMGC 2DLFH 4KKLC 1Q9WB 4KJYA 4HH9B 5I8KL 1HWHB 3VA6A 1CLYL 1MJUL 1ZANH 1FNGB 3HFMH 2ORBH 1BJ1J 4OQTH 5HYJD 2Y6SD 3I3DA 2ICCA 1RHHB 3BWAB 4XP1L 4JKPL 1U9KA 4EQ2A 1Q0XH 2WINB 1UC6A 1QSED 4OGYH 1PEWA 5BRZE 4LHUD 3VFWA 4QRRE 3FQRB 1DUYA 2BVOA 4K07A 4XXDB 3RGVB 3BEWA 3HI1A 4MA1C 1PZ5B 1JN6A 4PJ8C 4OCSH 4HDIB 4G9FA 4D0DA 1TLKA 4V1DB 2CXKA 1S7UB 2AGJL 2R1YB 1NAMH 2GKIA 2VDNH 3TBYB 5MEOB 3QUXC 2F9BT 5IT2L 5MERA 2JIXA 3MOQA 3PQYB 5INCB 2AJUH 2YRZA 4MJ6A 3ZE0E 1G6RB 1UVQA 4KJQC 3CVHA 1UEYA 4GKSB 2P8PA 1AXSA 5D7LB 3CLFL 4H0HB 3OGCB 2PYEA 1S9XB 3REVB 4NKMA 1K5NA 3L3DA 5HDOA 5DJ6B 3T0WA 1U8MA 4Y4KD 4RZCB 4ZTPH 2Y23A 3FO1A 3RNQB 4DEPC 5BV7C 1J5OL 2ZJSL 1A8JH 3KXFB 4E0RA 1JHLL 2AJ3B 1ZAGA 3TBTB 2CMRH 3HUJF 4PJDE 1AXTL 4Z7VB 2YOCA 3PGCB 1N7MH 3BKCL 4ELMA 2F53E 1RZIA 3MRHB 1T1XB 1YEJH 2R9HD 1P1ZA 2EDEA 1UXWA 1KJ2B 4Z95L 3MUHL 3BPNB 5I1LB 1T7ZA 3V0WH 5HYIA 5TJWK 3QEUA 5IWLC 5I19H 4OFDA 2DKUA 5C0GB 3CFKA 5FECB 3PDDA 2IJ0C 1J1OH 4CVXB 1DBKH 1NGWB 4BK5A 1FN4A 3EGSB 1M71A 3DO3A 4M8QA 5SWSE 4HQQL 4LP5A 2VAAB 3LKOB 3MFGB 4NYLA 4P4KA 5D1QB 1SHMA 4BM7A 3R0MA 5JXEA 4IRJB 2GHWB 2JF1A 3SJVE 5HHQB 5CJ5A 5HHOE 1IM3A 5I73C 1MSPA 3ARPA 2PYED 4K94C 2F74A 1TVHA 2O26U 1UZ8B 4YBHA 1D5IL 1CFNB 1E0OB 1V7MH 2DQHH 1MNUL 2VXQH 3CFBA 3FMGH 4P46D 2EDTA 2YHGA 3G6DL 4K9EL 1U8LA 1R3LA 2DWDA 2DMBA 5DMGD 2H45A 3X14A 4J2XA 1DJSA 4JG0H 4OSUH 1Z3GL 1N64H 2V9TA 3U46B 5EZJB 4E42A 4KKCC 1ZT4B 4WENB 1KPUA 2QL1A 4G8GB 4UT6H 5FKPA 2G5RA 1T21B 2DQGH 1W0WB 4YHKL 4K23L 3CD4A 1I85C 2BY1A 3GSOA 4TSBH 4LCWB 5C7XH 5DXWA 4EEEA 4TUKL 3Q2CA 4LVOC 1GOFA 1IC7L 4G6JL 3VE0A 3ZTNL 1BX2B 4F57L 2WUBH 2CDFA 3TP4A 3GBLA 4MNQB 2A77H 4P2OA 3Q3GA 3PP3H 4KKBC 4Z7QF 1LO0H 5J89A 3QWOA 3DETD 5E6YA 3BQUD 3L3DB 1G7QB 2BX5A 2OXGA 4PLKC 2W65B 3H3PH 3O6ML 4PTTB 4BH7B 3GJFB 4TNWK 4LKXB 1IARB 5EBLB 3CVHB 2CDGA 2ATKB 2R4RL 2IPTH 3AU1A 3MUY1 1HE7A 2ATPB 3AM8C 2PXYA 3WJJC 2G2RA 4MNGB 4LSPL 3D39A 4XCYA 3DVGB 2V17H 5KG9B 5E95B 4G6KH 2AJSL 2HN7B 5JHDD 3L3JA 4MHHI 4RFEB 1Q8MA 2F5AH 1DFBH 2X09A 4L9LC 4O02H 4I5BB 1UWXK 2Q8BL 4XCEA 4GBXB 5IGXL 3QDGD 4FTVA 2YPKB 5B3JE 2IBZX 3KYOB 3SDCA 3MV7A 3ARYA 2BRRL 5IFJA 4JKMA 3MV9A 1AR1D 3V5KB 1YEKL 3KR3L 4X9IA 5D96B 3VXMB 5E2UH 3VFMA 1G9NH 1YNKL 5BW7C 4MWFB 4XVSH 1RZFH 4NSKB 2JB5L 1QFOA 5KVEL 3WD5L 4YIQA 4JY4A 2XA3A 3S34H 4Q9RL 4GXVH 5D8JH 3GSRA 4C56D 3IDYB 3SCMD 3IB4A 4S1DD 2R69L 1G1YA 4K7FA 4XNYL 2YPLA 2H8PA 2ARJB 2EYSB 5DUMH 4ZPVB 1B3JA 3QWRA 1AHWC 4M93C 4U1KB 4PJ9A 3STZA 1KEGL 4M6OH 4LBEB 5F96L 1UYWH 4W6XB 3O2WH 4YHMH 4PRHD 4KMTL 3H7LA 3SDCD 2WBJD 4UDTB 2Q86B 3ZKSD 3IAGC 3KYOA 2VLRE 4YZFE 3CFEA 3ROOB 4GKNB 4PJ8B 1X5JA 4QHMB 4DN3L 4ZDHA 2X4QB 4HEME 1U91A 5I8EB 4XCEB 4H88L 4K9EC 3G5VB 4W70A 1UB5A 4LLAA 4XWGH 5FYJH 2HN7A 3G08B 3D0VA 3OX8A 1CFTB 4DW2H 1AE6L 1A2YB 4JN1L 1K2DB 4S2SB 5GS2H 5C08B 1ZGLM 5DJ8B 1S7RA 1Q9OA 2ADJA 2VDQL 4HMEA 1WBZA 5F9OH 1NFKA 5I76A 4WW1B 4PP2B 2P1YA 4ZDHB 3VFGL 2XZAH 4ZTOL 3FQUB 3MV8A 3EYQC 1L0YA 5K9OB 4DKEL 3U0WH 4S1DC 1NANI 3IJSA 4FQCL 5HHPA 3C09B 3TNMB 3C5SA 5EZIH 4M62H 4P49A 2JE8A 1HINL 3PWPA 3ME0A 3Q3GB 2EEAA 4OQTA 5CLWA 1MRCL 5GRUH 3UBXG 3H3BC 3ZDXF 3EHBC 1HH6A 1EGJL 1ONQA 5EOQH 3VD9A 3F7VA 2BNQA 3TFKD 1UWEH 4K3EH 1BVKA 3PWLA 1C5DA 3MMEA 1QVOA 4KKCD 2HFGL 2HWZH 3SGKC 3SKOA 1CQYA 5BRZD 4ENED 5C0FA 4J12A 3O3BB 4NWTL 1H9VA 4HWBH 4ZAKA 1F11A 5K9QG 2EDHA 5FGCB 2HG5B 5IFJB 2HLFD 3QG6B 4HS8H 4RGND 1T0MB 4OLWL 1OF2A 4MXQC 3L3OB 1WZ1H 2X89A 5ID1B 2YKLL 2PW1A 4FG6D 4HWUA 2XFXA 4HW6A 3IETA 3RUGA 2R2HB 5DVNA 2EEBA 1CFVL 2NW2B 5TDNB 5JOPD 5DEGB 4YK4C 4LLVB 2UYLB 3NIGE 1ZT1B 3QFDB 3WN5A 4EBQL 1EX0A 5EA0H 4IMLB 3R8BB 1YPZB 2JK5B 1BBDH 1T7WA 4Z7UA 3Q6GH 1XMWA 5EIIA 1DBBH 3IF1B 3QG6A 3LPFA 2DTMH 4NN7B 3T0EB 3CX5K 3AXLB 4G7VL 1XF3B 2DN7A 1RD6A 3QIWC 3FB8B 4URTB 6CGTA 4X6DA 3CPLB 1B4RA 1BBJB 3J7HA 3WN5C 1K8IA 1J1PH 2VYRE 5CWSA 3DV4A 4JN2B 3BD3A 3MRLB 3F7YB 3HNSL 3WFBH 4ODSL 5TH2A 1D5MA 4NCC2 3UPRB 5C9KA 2AXJA 4MA1B 4L8BA 1WT5A 2WAHA 1RZ7L 1FFRA 4JFYA 4DUVA 1OGAB 3BVNB 2FIRT 4OF6A 1IM9A 2OCFD 3PWUA 3WEXA 4RAUB 5EU6B 4OJFH 4RZCA 3IJSB 1I7RA 4B50A 4FFWD 2X1PA 5D7SH 4KZDL 1QYGH 1MCRA 4JGUA 4K8RH 4ORGA 4WY7L 1FZMA 3HE6B 5D7LA 5C0AB 3ZDZE 3FKUS 2CK0L 5KSBF 2W0FB 2JJTC 4HWBA 1CFNA 4OB5L 2XTJE 4X7SL 4Z7WF 4X4XA 2DQIH 4K3DH 4MXVF 4L5FH 3M1BB 4HBCL 5A2FA 5HSFA 1TIUA 3T3PE 4AH2B 1GZQB 1FLRH 4I77H 3GGWB 1MY5A 4KPHL 1OAQL 2L0DA 3FN3A 4GSDH 1ZSDA 2X4TA 2VDLH 3LRHA 4O2CA 3EYVB 3MLUH 4RA3A 2Q86A 3EFFB 1CGSH 3PHQA 4CVXA 4XNMA 3BZFB 1Z9MA 3SBWC 5D7LD 3VXNA 5I8OL 2FBJH 1CLYH 2VLKB 4TSAL 4JANA 1RZKC 1M7XA 3HFML 4FQXD 2ZUUA 1R5WA 1MUJB 3CPLA 3QUMB 2N1KA 1JK8A 1SJXA 4YHZH 3VFNA 4RGOL 3ECBB 4UTAH 4Q74A 4DCQA 3WCYA 1AHWA 1CDUA 2OI9B 1J0KA 1JPGB 4P4KD 1U8IB 4Y19E 1ITCA 4JY4B 5CKGA 4KRPD 1MUJA 3O3UN 4AEFA 4GAGL 5KANG 5F3BA 3GSNH 2WIMA 3BUTA 4WEBH 4GRLC 2CKBH 5DJ6A 1TETH 1G6VK 3IKKA 1J18A 1CBVH 3BZFA 1OP3K 4DFIA 2RQ8A 1ZLVK 4NNPL 3AB0B 2ZUTA 3PHQB 4GRWH 4MJ2A 5F44A 3TM6A 4TVPL 4YZFF 2GSGB 5C0AD 5EU7E 2ZUVA 3ARWA 3RY4A 4NO0A 1F4YH 4NUJB 3H9HA 4WFFE 1MEXH 1ND0B 4I3RH 3NN8B 3MRMA 3O41B 3VMOA 4LLMB 2R2BA 2I5YH 3QZWG 3AREB 5TF1L 3ZYIA 4ONGL 3FB7B 3OKEB 1GAFH 3I6LD 2C3HA 4F7PB 2CDGB 3MBEA 3SE8H 5E24E 35C8H 1OP5K 5JORB 2BXZA 1EBPA 3WSQH 2Y36L 4L4VA 3HMXH 4LPWA 1QZ1A 4RAUA 5EU6A 3V9FA 1IM9B 3VXTA 3GMRA 2UVFA 4NQVB 2IQ9H 2PO6A 2X70A 1A64A 4HUXA 3TO4B 3X3FL 4YUEH 5JW5A 4PJHE 4J6RL 5FAAA 4KTDL 3BP4B 4OLUH 5JW3L 4OV6F 1IGMH 4LHUA 2HFTA 1D6VH 3HE7A 4TOYH 1UM5L 9CGTA 2EKSA 3T1FA 5HYJA 2Y07H 4WEUD 4G9DB 3KWWA 5FM5M 3D3VE 5L88L 3MOAL 1OT2A 4WTZA 3PJSA 3P0GB 4WNQB 5EOCL 3QNYA 5KS9F 1ES0A 3GJFH 3P40A 1NEZA 4FXKA 5HYJE 5D2LA 5MHSD 4HGWA 1ZT1A 1QKZH 5BZWB 5TFSH 1U0QA 3RDTB 2XZQL 2F5BL 5GSVB 2PUQT 2AEPL 3VRLE 4HJJL 3MRNB 1JJUA 1QLEH 2W0FA 4K23H 2BFVH 1CXHA 4L4TD 3LZFH 4JRYE 3CU7A 4OV5B 4XNXL 4NO5B 5FXCH 2FWOA 2XA8L 2ED8A 2HG5A 2FGWH 1X5LA 4N1EA 2UWEF 4JDZA 4NQEB 2QQLL 4NWUL 3TEUA 2ZKHL 2FEEI 4OUUB 5F1SA 4L3AA 3X11A 4HIIB 1BFVH 4YDIL 2B8OT 3HB3D 2VC2L 1MCIA 4QRPB 3CSPA 3TPUB 5IG7B 1E4XH 4DGVH 3BXNB 1H15B 4G6FD 4AEHH 2X4RA 1I75A 4XC1L 1QSFE 2CIIA 4XMLH 2M2DA 1NBYA 4HC1A 4JPKH 2O61B 4MDIB 3GMQA 4RDQF 5JR1H 1AO7A 3GKZA 1LE9A 3OGCA 4JQIL 3CFJB 1KOAA 4I0PD 1QQDA 1INDH 1JI2A 2ZUQB 2E3VA 4N0UB 3FRUA 3MRBB 5C0EB 2V5RA 4HH8A 3R06B 3EO0A 2CK2A 4P2QD 3VRJA 1F97A 4EI5C 3K46A 2ITDB 4KVNL 4M8VA 4P5TD 3RWCB 3A6CL 5EBGA 2F54B 4NJ9H 4EOWL 5KBNC 5GGVY 4HDIA 4HS3B 5TQ0L 3MFFA 2R2HA 1IGYA 5DC9B 4WU5A 5EFIA 5F7HA 1NH6A 2XFXB 3WUWA 1VKXA 2NY2B 2ZOLA 4N8CH 4LASL 3P4MA 4AM0A 5JXEC 5ACZB 4QHMA 1OF2B 4L8SC 4Z5RA 1XFPA 3V0VB 2XRAH 4KQ3H 3O3EA 4GXUN 4P3DB 2H26A 4D9QD 5LGKA 3UYPA 5DT1L 3KPQA 2X7LA 4DVRL 3IS0X 3QDME 2JCCF 3FAWA 1OT1A 4W4OA 3UP1A 2EDNA 2X10A 5DJAB 3BQUA 4CKVX 4PJXB 4D8PB 3PWLB 5LCVH 3IGAA 4YHOL 1CF8L 3CCHB 1F13A 5FIEA 1FGNL 1Z0NA 3NTCL 5J1TC 4DVBA 4J1UB 4IOFD 5J0BA 5CINH 4UT6L 2NY1D 5DRZB 1RU9L 3D3VD 1SMOA 1MPAL 3SDDD 5EBWB 1NQBA 4PJGF 5GSVA 2PNDA 3LQZB 4JFZH 1YECL 3OKKA 4PUBL 4OZGF 5B3NA 2D9QB 2VWEC 1D9KC 3FAXA 3OV6A 1F58L 2E7LC 3GHEH 3KYKL 1YEHH 1XR9A 3K4DA 4PJBB 5HHNA 3VGHA 5JLZB 2Y5TB 3ARBC 3L95A 3P4NB 4OZFG 1NGPL 4BZ1L 4M8QB 4OF8A 5AZEH 2AK4A 1KIPA 3OPZL 2CRYA 3HMXA 4XP6H 3UJTL 4MD5B 3UTTA 2AJXH 3BUYB 3G5VA 5E9DA 4KKAD 3EDEA 4IOFC 4HPOH 5LGJA 4PJAB 4H8WL 4LVNC 4UB0H 2MTPA 4PJ8A 4FTVE 5T3ZD 2J4WH 2W65A 4PTTA 3DMMA 2E9JA 2EDKA 3WHE1 1RZIB 3PDOB 1E4XI 1FZJA 2D7PA 2ICEB 4F7CA 5J9PA 2BZDA 5FYLE 4NPYA 1JHKH 1YN7B 2EC9U 3IFPB 4JFEB 2W92A 5IB2A 2G60L 3HC3H 4PRPB 1BP3B 1U36A 1HQRB 1DQJB 5FYKE 1Y6NR 1KT2A 1MJ7L 1AGDB 1YY9D 1TMCB 1S9XA 3REVA 5DD5L 5ADPL 3EOTH 1NFDE 4L29B 1G0DA 3CVHL 4R4ND 4WHTA 4POYA 3MV9B 4M7KH 4MQTB 1BD2B 1EAPB 3QCVL 1MRFL 4I13B 5DRWB 3RWEA 4PGEA 3MRMB 1DBAH 3BSZH 4HCRA 1UT9A 3MBXH 2YPKA 1WFTA 1MWAH 3B9KA 5DURB 5ALBH 2YD7A 1PX3A 5ILTL 4QEGA 4HXAH 2VZVA 3MJ7B 3DRTA 1QR1A 1NMCC 1CGVA 1JVKA 2EEDA 1W72A 5BV7L 3V6OC 4X9GA 4ZS6C 2ZP0T 2WINA 3W0WE 2DI7A 4ZXBD 4PV8B 4BZ2L 4EDXB 2GCYB 4PJ9C 4EN3B 3UTTE 2R4SH 1OAZL 3S36H 4LSTH 2GJJA 4M6MH 5C0BA 2Z4QB 2M26A 1M71B 2QTEA 1AJ7H 2OS7A 4OZIA 1I9EA 3T04D 1PZUB 4WUUD 4IRZL 1NDMB 4Z7NE 4RQQA 3ULVH 5C0GA 4CVZB 1JZ5A 4PLOB 1XGUA 4WJ5B 1ZHNB 1MLBB 2DM3A 1DBJL 2JB6B 1SYVA 3VWKB 3DOSA 8FABA 4H0IA 4OLXL 2YUZA 3VWKD 2VNCA 1I7TB 3S5LB 2FB4L 4HLZG 4NOBA 3EFFA 1QA9A 4YE4H 2XQBL 4MXWL 5BZDA 1OTUD 3EYVA 5CP3H 1GRWA 4LLYB 3QJFB 3QIBA 4OZHF 2AI0L 2CO6B 4QY8B 1ZSDB 2X4TB 3D85D 1BWWA 5F7DB 4MXQD 2DWDB 5EORL 4HIJB 1H3VA 2P8LB 3NFNA 1T0PB 2UY7A 3C08H 3PIQB 4EXPX 3ARQA 1BHGA 3DSFH 2RFXB 2KKQA 1PD6A 1GHFH 4R6UA 2ADGA 3TZVC 3AS2A 5MENB 4XRCB 5DVOA 4XVUC 4RMTA 4JM4H 2E9WA 3C8KB 1S5IH 1IT9L 1CVSC 4KUZH 4YWGL 1V3MA 4P23B 4RFNB 3MRKB 4YBQC 5GISH 1EEZA 1PZ5A 5DJXA 3B2VH 3S3SA 4LLYA 4F37K 2MQ3A 4HKXA 4KTEH 5ALCL 1N6QH 2V2TA 2X2YA 3BP5A 6FABH 1VGKA 2YPVH 4F2MA 4ZFOL 3T8XA 1JF1B 4I18A 1JYWA 3CDFA 3LQAC 3U0PB 4NQUA 4G6AD 3H7BA 2X4NB 4MD0A 4P5MB 1NPUA 5L2JA 4LSQL 3DUUA 5KJRH 3BP6B 5GGRY 1Q0XL 4OIIH 2XYCA 4HK3N 1BPVA 4ZG1A 4NP4H 3IDMA 5BRZB 1OAKH 3VH8G 3T4YB 4KJPC 1A6TB 2VQ1B 1G7LA 3PDGA 2A73B 2W91A 2WM0A 4X7FC 4NN7C 4OCSL 1HYSC 2BOBB 4PRNB 4XP5H 3IFNH 1NCBL 3MRPA 1CL7H 4E0RB 4H1LH 1I9JL 4ZPTB 1HSBB 2DQTH 4EN3A 1F45A 3S35X 4R8WL 5E8DH 5B8CB 3D85A 4Y2DB 3D69B 1JWSA 2A6IB 3EYUL 4MAUH 1LDPL 2FATH 4QCIB 5IFHH 4MNHA 1I1CA 4ISVA 1NCAH 2EE3A 1G6RA 1K6QH 4OAWB 3EO1B 1Q72H 1FSKC 4GRLD 2R1YA 4PGEB 3BH9B 5J6HA 1IAKA 4NRXA 4I48B 5F7WC 4NC2B 4DZBB 3DROA 2O5XH 3BAEL 5L0QC 4HUUB 2FX9H 4MA3B 4JCMA 4PJAF 3P4OA 1CS6A 2YBRB 4TUOB 2H2SC 4UQ3A 3OJDB 5ERWB 4FQXA 3K8MA 4GMSL 4OM1L 5T1KA 1EHXA 4QYOB 4O4YL 1KIRB 1U92A 4E41D 5K59E 1VB9A 2MQ0A 5FO9B 1WVZA 1P84K 3GMLA 4KC3B 4WO4C 4X7CC 5EU3A 3IDGB 2AKRA 3CSBA 1NMBL 4BUHA 5DQJB 3GRWA 4DJMA 1IGFH 4F58H 1XCQB 4KAQL 1WZKA 3VXPA 5FYJD 5L0QB 4NFCA 4ODUA 4XTRC 3B8YA 4OZFA 5C09B 4LRIA 3LIZL 3QCUL 5DMIL 3BUYA 4TPRL 1GIGL 2HKHL 1EXUA 2VXUL 2VR4A 3JV4A 5DK0A 2VXTH 4U6HA 4LLUB 4JDTL 4JO4H 4L9LB 4BFIA 4WW2F 5EU6E 3MLYL 3LRSA 1RIVH 1C16A 1QFUL 2I60L 2XXMB 4NCDA 1CK0L 4PJ7A 4E41A 1DQLH 2A6DA 5C2BL 5T1KD 3L5WA 2APXA 1F4XH 3HI5H 5I8EA 2RJMA 2FECI 2LVCA 3C60D 4TUOA 4UQ3B 1X9QA 4OGYL 5HDQL 2XY2A 1ADQA 1SMAA 2HVJB 3CVIL 3HA0A 5D7IA 3O0RH 1XGQA 4AEIL 4LHJB 1BFVL 3MBED 4YPGB 4P4RB 3KS0H 4WTXA 2Y7QA 4U1KA 2VDNL 3O8XD 4J1UA 3BN3B 5HGDA 4TULL 3QEQE 1U93B 3KPOA 2YPLB 4PJ5D 4MSWB 3KLDA 3KYNB 4JFDE 2J8UE 3QDGE 5KVFH 4H25A 4X9BA 2W0KA 35C8L 5SX4I 1FFQA 1BREA 1DEDA 5DTFB 4WHYG 3UTSA 4YX2H 5GS0H 1KJMA 1QFHA 3QIWB 3C6SA 4OFKA 3I6KB 5FV2A 1NMAH 2DB8A 4XGZA 1GGIH 3B3IB 3V5KA 4F9LA 1CDHA 1G7JA 5A2KH 4LLWA 4LPCA 4HFUL 3GIVA 3MO1B 1T6WA 2XZCH 4LCYB 5ACZA 3I6GB 4JFDB 3S96A 5L9DH 4I5BA 2NX5D 3I3EA 4PJFE 5BMFL 3SJVD 5FM5O 4J4PA 2PCPB 4HS3A 4MJIB 2DQGL 2JCCA 2NX5E 3GBNL 5BVPL 1WIPA 1X5ZA 4MCYA 4L8CB 2P7TA 1A6UH 3VFSB 3TV3L 1S5HA 1T83C 4D94A 2A74B 2YN5A 4D9LL 3RDTD 4H1LG 2R9HC 1RUAL 5DJZB 4TVSa 1S3KL 4IOSD 2I9TB 1XF4B 4O58L 4QTIL 2CIKA 3KPNB 3DRQB 3O9WB 3GMQB 3CMGA 4YQXL 3BRGC 3LKNA 1YMHA 2Z8WC 3ALWA 3QWOB 4S11A 4Z0BL 1NSNL 2QSCL 4UAOB 3S96B 4I2XE 5IJKA 1F5WA 4LCYA 5C3LD 2GT9A 3LN5B 1PYWB 3KJ6H 5LBSH 2AEWA 1ZHKA 3GSUA 1UM4H 2FHBA 4QNPE 1R3IL 2AK1L 1A3RL 3WXVL 3REWB 1FYHB 1I7ZB 1I1AC 1T83A 4GAJL 1JWMA 3UXFA 1RUPH 3JTSB 1OP3H 4ELMF 5D5MB 2EIDA 4XCNB 3EYQD 1VFBA 5DK2B 3RPIA 1Z0MA 2IWGA 5ETUA 4OD3L 4OV5A 3NPSC 2BRRH 2ZKHH 3O9WC 4P57B 3WFHA 2VSCA 3DARA 4N5EC 5I71B 4P2QA 4BZ1H 5IB3B 1DBKL 3KR3H 3LSOA 4UT9H 4P4RA 4XH2B 5D70L 2C26A 3MNWB 5C0NC 2JB6A 1LO3H 1VCAA 1T04B 4M1CC 1AXIB 4P5KA 4MJ4A 2OM5A 4N5UA 1PY9A 4CMHC 2IPKA 2ZNWA 4FQQA 4LOUD 3Q0HA 3GUTB 2BVPB 4ZUSA 4JM2B 1BZ9A 1U8OB 4P46A 4LSUH 4UI2A 5SX4H 3ULUE 3PJSB 2I07B 1IKNA 1LO5B 4ZD3H 4WI4A 3VGAC 5T1MB 3PV7A 1P7KB 1EA9C 3GSWA 3OZ9L 4TNVK 5KW9H 4JFEE 5HHOB 4FQIH 1I7UB 1HSAB 2J12B 2ZSVA 4MAYB 1A7OH 1XF5A 3TCLA 3E1F1 2AV1B 2I25N 2BNRE 1LEGB 4BQBA 3DRTB 4R4FL 2P45B 1QR1B 3VXUE 3PF2A 4QTHA 1HHIA 3BGFB 3T77A 4CAGA 2WQRA 3MRIA 3MLZL 1EV2E 3KPLA 3GB7A 1TTUA 4HS8L 3VMPA 5IROC 1KJ2L 3D39D 5F3HB 4ZFZA 1KXTB 4HG4K 2G75A 5CAYB 1OTTC 1MJ8H 2OBGA 2AV7B 5KVGL 5DRNB 5DHVA 4YHYB 4O2FB 4JRXD 5E2UL 3FN0H 3H9SE 3S3PA 3O6LH 4D0BB 3N1FC 3WNMA 3OAZH 3S8WA 1CGTA 3U9PH 3BO8B 5KTEH 1LEKA 2CUIA 3MBEB 2BNUB 3L3GB 1INQA 2WLYA 5C92A 4JY6A 3BPNC 3TZVB 4X6CE 2FECL 4O51A 4J8RA 3DX6A 1L9MA 3BN9D 3U1SH 2AS5M 5JIHA 4WFHD 5B22A 1KCUL 3B9EA 2IQAB 4G6KL 4G42B 4G9FB 3KYMA 5I1DB 1HQ4B 3E3QE 1IGCL 1ZHLA 4ONHB 3BP7B 4TQEL 4K7PL 1NFDB 1FYTA 3NAAH 4LAQH 3OF6A 3CC5A 5D1XA 3OHXA 4JFPB 4U1IB 3D85B 2AXFB 4ZUUB 3DETC 1HHGA 1L7IL 4Y2OA 4KHXH 5DSCB 2NXZC 1EJ6A 1CGXA 1GZPB 1J8KA 1S7VB 3UTQB 5FYJL 2E6JA 2ZUSA 5E2TH 1DQTA 4KJYB 1EUTA 3KXFE 1MREL 3S7GA 2A73A 1IBGH 5CIPA 1YNLH 1VSCA 4YE4L 3MYJB 5AD0B 3RIFF 1BECA 1YA5A 2OJZL 2AK4D 3MXVH 4PJEA 4LDEB 4HJ0D 1U8KB 3CUPA 2PTTA 4LSRH 3LEVH 3QPXH 5C70A 3KYAA 4QXGH 5TE6L 2YN3A 4GW1B 3QDJA 3KPTA 4JPWH 4YFLF 5D93B 2D7MA 3WHE0 3TBWB 1O7SA 4JRXB 1U8NB 2E7HA 3DSFL 4DKFH 1JGVL 2VZOA 3FCTA 3O4LA 1CGWA 4I4WA 2ZG3A 2Z8SA 1T66C 1QHOA 3WO4C 4HWNA 3MRKA 4XCNA 2VABA 5LQBH 1M05B 2OQJA 2DI8A 1RJLB 3BDXA 4M61B 1U8PA 3BQUB 1TVBB 1RVFH 4NHCL 4L4TA 4LF3B 1JTTA 1QBLL 3P11L 3MR9A 4EIZC 5JHLL 1CTOA 1JE6A 4M7LH 4OLVH 3VXSE 1D9KD 1DSFH 3MV7E 5D7JC 1I1YA 3IDJB 5GSRB 4UINL 5I8OH 1KENH 4LARL 5E2WL 3V0VA 1BEYL 4ELKB 1SJHB 3GRWH 3QXAA 3SDDC 4KHTH 3CK0L 4K8RL 4WY7H 2I26N 2KDGA 4X4ZA 3WEXB 3D0LB 1S7SB 2Z0BA 4OFIA 3ARDA 3GK8H 5H8DA 5C0BE 1CXLA 1I4FA 1AFVH 4ZS6D 4Z7WA 2ESVD 3RWHA 5LXGL 5ITBL 3SDAD 2K7PA 1N4XL 3UBXA 1KB9K 3Q5YA 4JFOA 3WLWD 1JIBA 1QBAA 3K8LA 2VLRA 5FA3B 3HMWL 2FCBA 5EBMA 3WYRA 1SM3L 4OQ1A 3VGBA 2YA1A 1ADQH 4QO1A 1QSFB 1YMME 5KOVC 3T65B 1F6AB 3OMZA 4ETQA 3BD5A 4NN5C 1KCRL 5EZOH 4UUJB 3W11D 1K6QL 3MUZ1 1F4YL 2BMKB 4X6FB 1JGLH 3OJ2C 4LSVH 2NY0C 5EULV 4OF0A 4B7IA 1X5HA 4RMSA 3QNXA 1UKQA 4BSVA 4XGZB 1JNNH 1YQ2A 4EDXA 4Q6YA 1KJMB 4NFBA 2XACC 1UB6A 4YO0B 1DQMH 3NH7H 1DE4B 1ZLSH 4E5XA 4JZJC 3TO2B 2GUOB 4LSDA 4U3CA 1WUNT 4I0PC 4F9PA 4JHAH 3FQXA 3GI8H 1DQDL 3GSQB 1FRGH 4AQ1B 4RWYH 1UJ3C 2HJFA 5DD0H 3GSXA 1A02N 3HE7C 3BI9X 3X3FH 3VFRB 2YD2A 3Q48A 3JBG7 3TA3A 4PGCB 5JDSB 2VSDA 3V7AG 5D2LB 3D2UA 1NBZB 3BZ4B 1HQRA 5D2NA 5I1AB 1CFQB 2DL9A 1ULVA 1XGTA 2QR0B 2VL5B 4XPHH 3SDAA 1TJHL 3NGBB 3O4LD 5JXED 4P23C 5IT2H 4YGVB 5TF1H 5AYQA 3PQYE 4OD1H 1T6VN 3PWPB 2VDPL 4C56B 3M8OL 1AP2A 1E6JH 5HHPB 4GKOA 5HGHB 4AMKL 4U1LB 5MHSE 5K9OA 3ZDYE 4BKLB 5D7KD 4KK8D 4P3CL 3HE7B 3O11A 4PJAA 1RK0A 1PKQA 3TA3D 4CNIA 1G7PB 2Z91B 3OXRB 5C8JA 3H42L 2GSIA 1ZVSB 2XZQH 2D3VA 2DBLH 4LGPB 4YHPB 1WIUA 3MRFB 4QRUA 2HMIC 1DVFB 2C1OB 2DI9A 1RMFH 3THMH 2K1MA 4FHBD 2HFFA 1U92B 4ZAKD 1R5IB 1XGPB 1XGTB 2QR0A 5FOBB 2PO6D 1DLFH 5I1AA 4FQXB 3OKLA 3QEQB 4XCFH 4L8SB 4FFYL 1D6VL 1CXFA 2FJFA 4TOYL 4ZXBA 2A0LD 4R7NA 3G6AA 4PFEA 4QXWA 4RIRA 4V2BA 5I19L 3MLTA 1LDPH 4MA3A 4X5WB 2NXZB 5FDWB 3EJJX 3JTTA 4XBGB 3GZKA 5H2BA 3VMNA 4I48A 2VE6B 4LBEA 3MYZA 5D6CB 3NN8A 3O41A 3H3KA 2CUHA 3HS0B 3L5XH 2FR4B 4Y1AB 3G5YB 3EO1A 2NY6C 5IVZB 5JUEH 4NQSB 2XY1A 3RP1A 1FNSH 4ISVB 4G7YH 3SE8L 2B1HL 4Q58C 3RBSA 5BCAA 5I2IA 4M5ZH 1MCOH 2B7DT 2VXQL 2Y36H 3TJHC 3FMGL 3P30L 5D7IF 3UTZB 4M6NH 5H94B 4X4YB 4U6YB 5A3IC 3CSYA 2R23A 4C83A 1MCCA 1NUGA 3MGTB 3H0TA 2VQ1A 1QRNE 3GMNB 4KVCH 4JPIA 3LB6C 1KCKA 3CDYA 1G9MH 1NMBH 1JFQL 1QSFA 4AZ8A 2CLVA 5ANMA 3MUGB 4YDIH 4F58L 4IRJD 3EYOA 3P9LA 2P5EE 4JFXA 1R3HB 3CXHK 2P48B 2OMBA 2VWEE 5JMOC 3IYLW 5AWNH 4R4BB 2AQ1A 4XI5D 5DC0A 4KI5E 1U95B 5DGRA 3L7EA 3RZCB 2A77L 1TPXB 1AO7D 4I18B 1KEML 2V2XB 3BPLC 4QRRB 3HZYB 1N26A 4JFQA 5CJQL 4GS7C 4Y19A 4JRYA 4P59H 5DR5L 1C5BL 3GGWA 1H3GA 2IPTL 4HIHA 5D1ZD 1P5VA 1BX2A 1JHLH 2WK2A 3STLB 1JV5B 5LGHH 4WUKL 4U6XB 5IMKA 2YR3A 5JW4R 2GJZA 3LH2H 3SDXA 2A0LC 3FO0L 3N85H 2FD6L 5KVDL 1K85A 4I9WE 5GGTH 1F2QA 3SJVB 5I66A 4M7JH 1IGIH 3QEGL 4Z76A 2AQ2A 1SEQL 1TVBA 5GZNC 4ZOCA 2EE6A 3D5OF 4E42B 4MJ5B 1ACZA 2IALA 5DD6B 2VLJB 3V4UL 4UOW1 2Z92B 4GH7B 3MLSH 4QXTA 2BHUA 1FL6B 4N0FB 3MOAH 2JB5H 4XP6L 3UJTH 2V6HA 3O9WD 3Q6FB 4DGVL 1LHZA 8FABB 5F7FA 3AC0A 3VA2C 5JZ7D 4GXVL 1YMMD 3KPRD 4NNYA 1S7TB 2P5EA 1MLBA 4KROB 3I50H 3RKDC 2J4WL 1MCHA 3D48R 1NANH 2D0GA 2JJWA 2QEJA 3ULVD 3LKOA 2ARJQ 5D72H 3LN4A 4U7MA 4DGIL 2BVQB 5EUOB 3S97C 1MPAH 3BYTA 3IDNA 5CMAA 1U8JB 5HJ3A 1O0VA 3RJQB 4HCRH 3QHZH 3NIDF 3TC9A 2B4CL 4D9LH 5I71C 1MJ8L 4IMLA 4HHAB 1WIOA 1G7HA 2FGWL 3T0VA 2Q8AH 1FVEA 4O58H 4QTIH 4BUGA 4KQ4H 1BM3H 5TQ2H 1HQ4A 4X9HA 3KHOA 5IJVA 3QIUC 4KROC 3B9KB 3CMOL 3QH3A 1MFBL 1S9VB 1XZ0B 5LAXB 5GRVL 3U2SB 3BIBX 3ZTNH 2APBA 3VFOB 4XXCC 3G9AB 2EC9T 1ED3B 2FL5A 2YPLD 1FHGA 4H5SB 4HZAA 4JEGB 3F7QA 4C57C 1HH9A 4NC0B 3LKRA 3JWOC 3HC4L 1RUQH 5DRXB 2EIEA 3KLAB 4WU7B 5DZNA 5A16B 4XBEL 1IC4L 3RVWD 3EAKA 3NAAL 2VL4A 4N1HB 4I0KA 2YEZB 3A67L 1A1MA 3L1OH 3OXSA 1HCFX 4HZLA 2WMPA 1GYAA 4XPBH 5I6XB 1IKNC 2FEDC 3U2SA 3G5YA 2G75B 3GBMH 1EK3A 1ZLVH 3ELAT 3ZTJG 1EEYB 1A5FH 1FZJB 2ICEA 3QIUB 4O5LH 1FO0A 1EEQA 5DWUL 4QTHB 3GDBA 4Y19D 3VXQA 4IS6B 5FOJA 3PWVA 3WLWC 3CH1A 2HKFL 1ODAA 1P69B 4X8XA 3IXAB 2F19H 2GTZB 2YD4A 5I75C 3ZKMD 2EDFA 2E7BA 3IFOB 4FRWA 2VLJD 1ZS8B 3O8XC 5C09D 4QXGL 4HULB 4EKXA 3NCYS 1U8QA 4HPYL 1RJYB 4RAVB 4ENEC 1A47A 5IB5A 2FGZA 3UAJD 4F7TA 3HG1D 1K2DA 3P9LB 5IK3B 5ALBL 1G9NL 1YNKH 1X4XA 2PN5A 4G8FB 2VDOH 4DUWA 1DVFA 2Y5TA 3L95B 3W2DH 1W0VB 1ZVSA 1VEMA 1OGAE 4NDMA 5IVXA 3QQNA 5LJYH 3CFEB 4C55A 5MI0B 2NXYC 5IHBA 2BP3A 2AAVA 3FFDB 2E27L 4X4YA 2PYFA 3O2VH 3QDAA 1NGZB 1MFAL 2RIKA 1GOGA 2ICWA 2ZZUT 4FFWC 2AJSH 3SEPA 3ZMRA 5DI8A 3BE1L 3JV6B 1P5UA 5GRVK 1B2WL 5E99L 4O02L 3MRRA 3HC0B 2CRZA 3PWJA 5BVJA 4JM4L 1QFWL 1MJ7H 4NHUB 1Y18A 1HCVA 5GISL 4PG2C 4PREA 2QSVA 1KYOK 2YUXA 4G8GD 1GGCH 4YHNA 5CCKH 3QIWD 3OKDA 4HC1H 3L3HA 2FB4H 4KRPB 4WFED 1PG7H 4GOSA 3E2HB 5ITBH 1VPOH 1P7QA 5IHUL 3ROLA 3LKPB 1FE8L 3GSNB 1GC1C 1H0DB 2IAND 1Z9SA 4JRYB 4X98B 3ZKND 2D31A 4BJLA 4PJFF 1PJ9A 4JG1L 3BDYH 2EICA 3KJ4C 5F97E 1H3PH 1N6UA 1XGPA 1FFPA 5F96H 3HZYA 4Z7UE 4MHHG 3V6FA 2HFFB 3HAEB 4PYGA 1HYRC 3ILPB 5TF0A 3DHJA 32C2B 3MOBL 3SDXE 5SX5K 1BOGA 2PXYB 5GS1A 2V5SA 5DD1H 3O2DH 4CNIB 4PJGB 2XI9A 3EO0B 1KTLA 3R06A 1I9IL 4JRWA 4DN3H 2Q3ZA 2YEZA 3UEZA 1FLRL 4I77L 3HCVA 4LFHG 3W0WA 3O4OB 1MIEH 3NCCB 1EHNA 1VFAA 5CJXA 2ZOKB 2FH8A 4JDVB 1ZLSL 2GK0B 2OL3H 1CGSL 1X3DA 3O6KL 1YUHA 2GJ6A 2ZG2A 5LAXA 3Q5TA 1ZGLB 4EN3D 2XT1B 3AUVA 5HHMB 3NFPB 5KJRL 5CJOH 4JFOB 5DD0L 1E6OL 1GSMA 3BGMB 3UTSB 4DKFL 3V2AR 3QXTA 5TE4H 2X9WA 4H25B 3VRIB 1JRHH 4OFYA 1T5WB 4PV9A 5FEBA 1A7BA 1TZHA 4WI6A 5C0BD 4EI6A 3CZJA 1KUMA 4OZFH 5FF6B 5HJ3B 3GSNA 2O5YH 4GMSH 4I3SL 4WI7A 4ZUWB 5FYLL 1MQ8A 3LPWA 3BQUC 1A21A 4UNUA 1RFDL 1HZHL 2EYRB 3NIDE 3E6HA 3K3QA 2WZPD 3T2NL 1OB1A 4J3WA 1KJ3H 5EO9A 3RY5A 3T0ED 3HNTH 1WSST 4U0RB 4XVUD 5HVWA 5C09E 4MAYC 2OQJB 3B9DA 4BSVB 1GC1H 2A6DB 4NNXA 1NLDL 2OZ4A 4W68A 4BFIB 1WTLA 5GJTL 1U3ZA 3O45A 3LMJH 3TYFB 4JB9H 1YEIL 1NCDL 3MLYH 2R2EB 3QDMA 3T1FB 3DX8A 2ZUQC 4GW1A 1INEH 3KG5A 1PX4A 2HTKD 1G1CA 1NGYB 4Y7MA 2VLRB 3QUZA 4HF5H 4NQED 3AS3A 4WW1A 2VLRD 3K2UL 4M1GH 5F1NA 5FKAA 1BOGB 4U31A 3AY4C 1W0VA 5L2KE 1OWWA 3C5JA 5KN5B 1I4FB 2QADC 3TO4A 3G5XA 3G08A 3RVXD 1IAIL 1JPSL 1FFPB 1GGBH 4G8EB 3L5XL 4GG6E 4F7EA 4TTDC 3C60B 4PB9H 3MLXH 4MZ3A 1CG9B 3OAUH 3ETBF 4JFPA 4NQCB 4U1IA 3UYRL 2B1HH 1L4IA 5J4MA 3PHSA 3QCUH 4FZ8H 2WUCL 3LEXA 4BFBD 2YUWA 2EDOA 1EDQA 1RZ7H 1NMAL 5ITFA 3O6FC 4LNRB 4GG6B 4XPGL 3LS5L 4MS8C 4IHOB 2BVOB 2X4OB 1CE1L 2FIKA 4P46C 5KS9B 1Q9KA 1BFTA 5JDJA 3GMNA 5KSAA 2W9EH 5D1QC 3OKMA 4CU7A 4AEIH 4GT7A 4MJIE 1J88A 4OTXH 3TF7C 4LCWD 1AI1L 3KVQA 3RVUD 3K4ZA 1A9BA 4MNGE 4LQ1A 1LK2A 4AQOA 4WVRA 4DN4L 1R3KA 2AV7A 5HY9B 1QP1A 4CMHB 5SWZA 1IZKA 3FTGA 4OD1L 2J3SA 2PTTB 5KVFL 4KJWD 4YFDB 4QRRD 2FATL 2ERJC 4G9FE 4JFFE 3IKCA 2O5ZH 4P2CG 4G8FA 2A9ML 4MA8H 5HI5D 1KTDB 1P6FA 5TPWL 2QSCH 3D1MC 1AKJA 3QUMA 5SWQA 2BVYA 2GTWA 2FR4A 1HNGA 2FBJL 1MHPH 2DMCA 1A1OA 2BY2A 3WUWG 2EH8H 2ZSWB 4AENB 3SPVA 5DLML 3G6JB 1MIMH 4ONGH 4XWOD 3VWJA 3DJ9A 3VCLB 3OG4B 2YWZA 4JDTH 4RFNC 5EO0B 3U7YH 1FIGH 2MCPL 5C2BH 4Y16B 3CZFB 3T3MF 1WLHA 5JPMA 3TPKA 2Z8VC 3HMXL 4LPVA 1BWMA 4F33A 3M17B 1I8MB 3HPJA 3TV3H 1J86A 1J1XL 1V3LA 5DMYA 1CBVL 2D2OA 1H5BB 3SKUD 5TE7L 1E4WH 3PIQA 2X41A 2W07A 2JELL 3HE6A 1NAKL 1RSFA 5FUOL 3TESA 4X7TB 1MFDL 4KH2A 4PS4H 4NZUH 2DDQH 1UCBL 2WIIB 2Y25A 4NQXA 4Y5VC 3BPLB 3X14B 2DWEA 3EJYD 1LP9F 5FGBC 1B6UA 2ESVB 4WTWA 4DGIH 5L88H 4AG4L 1MCSA 3D3VA 3QUYB 1GGIL 1RURH 4P9HL 2BSSA 2DD8L 1BBJA 5I1CL 4OCMC 4PGCA 3V95A 2F8XC 4OD3H 4B0MM 2EECA 3OF6D 2AEPH 2IQ9L 3DECA 4JFQB 4KRLB 4Q9BA 3V8OA 3RIAK 1KG0B 2E8YA 1WWCA 1FAKT 5CIPB 3L5JA 1F90H 3EGSA 4J6RH 4UT9L 4NUGL 5IB4A 3CFIC 3JXAA 1FSKB 2OZ4H 4WIQA 3VXOB 4YPJA 4FQQB 2ZSWA 4S1RL 1XF2B 4ODTL 5A43C 4DZ8A 4U0RC 1QUNA 1T0NB 3LEYH 1T04A 1GL4B 1MHHA 2NY3D 1X44A 4OFPA 5FUCC 2RB8A 1KB5H 1KIUA 2IH3A 4N9OB 2VUYA 4TTDD 4UU9A 4NT6B 4X6CB 2PTUA 5AZEL 4XHJC 1CLOH 3HRZB 3OPZH 5C6TH 5ID1A 1E4XL 4PJHA 5SWZD 1VERA 3HUJB 4Q97A 1G0YR 3GBML 1EO7A 2G5BA 2J88L 4JM2C 1NDGB 1P9MA 2WIIA 2PW2B 4ESKA 4ODWB 4PRIA 1H3WM 1A7OL 4GRWE 4ODHL 4P99A 2F5BH 4QHKI 3ZHKA 3QEHB 3C6LB 3HI6H 5GZND 2DQHL 1AGDA 2QKIA 2DQEH 2X4OA 4HWZA 4PJGA 3W5NA 4MSWA 4N90D 5GS1B 3BJLA 4MNQE 2BC4A 4G6FB 4GJTB 5E03A 1RUAH 3KPLB 3HAEA 4DQOL 2QADB 3UJJH 1WBXA 2QQLH 1YNLL 1A7QH 1WF5A 5D1XC 4ZOAA 2YA0A 3RTQB 3DI2B 4XX1G 5B38A 4CADA 4QLRA 4BSWB 1IILE 4XBPA 5CBAA 3BWAA 5GGQL 3I50L 2RCSH 1JGUH 5EDXA 5GQBA 1MCWW 3P9MA 3VFSA 2ADJB 2BY0A 3O2VL 4HV8B 3T0AA 4MD5A 4X6CF 2GTWB 3EYOB 2BK8A 5I1KL 2HP4A 4MQSB 3FT2A 2GAZB 4OGXL 5C07B 3JV4B 3NFSH 3B6SA 4LVHC 5E00A 3UZVB 5KN5A 4P46B 3WFCH 5IP4A 1IC1A 1Y18B 1NCCL 1RJLA 4JPIB 5F1NB 5FKAB 5CGMA 5C8JB 3GHBL 2E6PA 4JO2H 4W4OC 4LU5L 3WDIA 4ODUB 1ETZA 4OCXL 3OKKB 1YNTA 3PL6C 3GMMB 4O2EB 1KB5A 4UDTA 1LK2B 4YXHL 2AJZA 5IQ9B 5IV2B 4N8VG 1I1FA 1P4BH 4P2YA 1KPVB 1V8HA 4PJIF 4DUXA 1RU9H 4GLRH 4IDJL 3DX9B 5IVXF 3MGOA 1F6FB 4JREB 5F7NC 3TT3L 4RSVA 1NC2D 2JJSA 1QG3A 2DYPD 3GRWL 2XICA 4IHOA 2IAMD 1FC2D 3FFCD 4Q0XL 2JJUA 3MJGX 3OJDA 4XBEH 3B6SB 3QT2A 3P4OB 1NGPH 1YEKH 1JZ6A 1C7TA 3CJJA 1U58B 4PR5B 3WD5H 1JZ8A 1TPXC 5I1HL 4Q6IA 3K4AA 5DJ0B 2CLRA 3S34L 1ZV5A 2HVJA 1JBJA 2LTQB 4YLQT 4TRPL 4FQPA 5FUZL 4A2MA 1IEHA 1A5FL 1WEJL 2EKJA 4MDJA 5ICYB 3C60A 3UAJC 3IS1X 1NC2A 3DGCR 3K7UA 2NY5C 3PP4H 4JQVC 4OZHB 4NQCD 4QKXB 2NYYD 2H1PH 5ISZA 5CFHA 4Y2DA 3NBNA 1LO2L 1DBML 1XIWA 2BC4B 2NNAA 1YDPB 2YMXL 4PGJA 2KBGA 1U3JA 3NMEA 2WBJB 4UIKL 4KHXL 4S10A 5HHME 1JHKL 1BEYH 4MMZC 1NAMB 3O8XB 4PRIE 5EG6C 3IDYC 3MRQA 3QO0B 4KUZL 4H88H 2FH6A 4BH7A 1D6EB 3DX8B 2W38A 1RULL 3BIAX 2Y06L 4LL9A 3JV0A 2B20A 2QLVB 1L6ZA 1EBAA 3ARBD 5HDBE 1DQQA<