1R2QA

Crystal structure of human rab5a gtpase domain at 1.05 a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
GNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refinement of the structure of human Rab5a GTPase domain at 1.05 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5A
total genus 59
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2003-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r2qA00
1BMFD 1G8HA 2ZYUX 4C0AC 3B13B 1TF7A 1TTTA 4JLAA 3KJEA 3TR0A 1E79A 4PO8A 2VTKA 1AIPA 2CVHA 4QL3A 2R44A 2GETA 3MAAC 2J41A 1S0UA 2BEJA 1NN0A 3H2YA 4YLGA 2GKSA 4ZDWA 3EW9A 2H8KA 4RD4A 4JLPA 3REGA 4HLUC 4NU0A 4Q1BA 1JECA 4X8LA 1OYYA 2GCOA 1US8A 4TYQA 5FBQB 2Q9BA 4LDJA 2O8CB 3ZS8A 2ZI3A 2D2FA 4HDQB 3MWJA 4OI2A 4C2TA 1FZQA 4Q9IA 3ZH9B 2W83A 1KI1A 1KAOA 1KO8A 1U8YA 1X1RA 4MYHA 1KO4A 2LKCA 1M7HA 1LY1A 2HXSA 1DELA 3PEYA 3AQ4A 2RCNA 2ZIAA 4YC7A 4PAMA 5HCIA 1DEKA 2QMEA 3NHBA 1JBKA 1N3BA 2BM1A 3A37A 1GM5A 3U44A 1TADA 1J8YF 1KI3A 2IWRA 1Z6XA 3AUXA 1W4RA 5ANRB 1I4DD 1BO6A 2GWHA 3FKQA 2DFKB 2XITA 4LYAA 2J1LA 4KXFB 2RH5A 1P2TA 1OT3A 1DBSA 2R6DA 3DKPA 3K9HA 4PSKA 2IWHA 1CF4A 5JECA 5FTMA 1UJ2A 4QGHA 4KV9A 2G3YA 2H18A 2HDNB 3E2IA 5DO9A 1RE0A 5FI1B 1SGWA 1E2QA 3CRMA 3OF5A 1Z0JA 1BMFA 4NCKA 2VHTA 2QSYA 4AC9A 1P3JA 3RWOA 1I4LD 2ZR9A 3LD9A 3AUYA 4GP7A 5LD2C 3CX8A 4QM7A 3FMPB 4JVSB 2Q3MA 1DE0A 1GNRA 1SKYB 1Z28A 2EQBA 5LBIA 1G17A 2P6NA 5CDFA 3L2OB 2PMKA 3ZIAD 3CRQA 3LBHA 3TE6A 4HAVA 2VP2A 3V9PA 3JZAA 3MCAA 2V1UA 1E0SA 4GPTA 1N5KA 1XEFA 3AVOA 4M9XA 3CPEA 2ZSEA 1QG2A 5DI9A 2WHXA 1NL3A 1I4TD 4L5BA 2CL7X 2Y8EA 3WNDA 1JR3A 1QHHB 2ZRGA 1Z63A 3QKSA 3RHFA 2QP4A 4Q1CA 1W4BA 2VH5R 4OJQA 4FCTA 4GZMA 1E2LA 1E9CA 3TBKA 2W0SA 4LPKA 3QPUA 3MG9A 5C1BA 2FGJA 5G41A 4BZXA 4BLOA 2OXRA 4DZZA 4C7OB 3KZ1E 4WZAE 3VR4A 2FEMA 2CCKA 1FTNA 1E9RA 1HYQA 3ASYA 4IVPA 4HLCA 5JEEA 5UKDA 3JZMA 1M2OB 1W46A 2PL3A 4M53A 4NCIA 4TLEA 4C0QC 1SVWA 2QZ4A 5AJWA 2F43B 4JBXA 3QVUA 1PLKA 2GF0A 3THXB 3EARA 2PJRA 2ZROA 2GXUA 3KKNA 2FEOA 1TX4B 2N1BA 2AWOA 4MRVA 3PXGA 1FX0B 2YWHA 2C9OA 1FX0A 1KK1A 3THWA 1T8UA 1ONBA 2VBCA 4L16A 2WSSD 1U9IA 4PFSA 1DAGA 2J87A 1L2TA 4TWZA 3Q72A 5TXGA 1W48A 4ZI2A 5AUOB 2EYUA 1COWD 5FOUA 2QL6A 4TL6A 2QY9A 1YZUA 4W7SA 4DSUA 3U5ZB 1KZGB 2BDTA 1GUAA 3GJ0A 3ND9A 5H70A 4DKXA 1CP2A 1D2NA 3S1AB 4B6EA 1NG9A 3UATA 2JIZA 1AGPA 2WVJA 1W36D 1P61B 4NYMQ 4DVGA 1XPRA 1LB1B 1OE0A 1FQKA 1XMSA 4V0OA 1F2TA 4JVNA 1T9HA 4KJZA 2BBWA 2ZUBA 2IYQA 4C4PA 4TT3D 3AP2A 4BFSA 1J70A 3LRPA 5E4FA 3A1SA 3ZVNA 3LX8A 5G40A 4DT1A 1HY3A 1KNQA 3NEJA 1R10A 2YZ2A 5B58C 1OB2A 2WZQA 3BB1A 1N6NA 3K0AB 3TSWA 3NH6A 2O0KA 3SEAA 3DPUA 5CJ2A 4HI0E 3HYRA 4LYFA 2H17A 3D8BA 3PUVA 4FMCB 4UXJA 1ZM2A 1KSGA 4ILEA 1G41A 2B92A 4IDPA 2NGRA 1KIMA 3FE2A 2ZRCA 4V0MA 1GWNA 2JJ1D 2H92A 4DLSA 3FOZA 1NVVR 3L82B 1IJEA 1FP7A 3MMPA 1SZPA 4LHWA 1Z6YA 2QP3A 3H86A 3CX7A 4MGYR 3CLVA 1ZNYA 1G3QA 2KJQA 5CYOA 3U6BA 4WAUA 2HCJB 2ZU0C 1T5LA 1WBBA 2ZRHA 1UEIA 3C4JA 1CJTC 4XTCS 1QHHA 2J0SA 2CEAA 2GILA 1QZXA 1DADA 4UNRA 2PX3A 2WJVA 5FH9A 3DKVA 1TQ6A 3PVSA 4CRWB 3PV0A 2EFCB 1GP2A 4URYR 2IF0A 3TNFA 3LXXA 1YR6A 3SQXA 2P6UA 4HEJA 2H57A 2IYUA 3TKLA 2PZFA 1G3MA 2C03A 1N2CE 2NOAA 4M1WA 1P75A 3IBGA 3WMEA 2A5GA 4W5HA 3ZQJA 4XSHA 3E1SA 3I73A 2GEVA 3VKWA 3C7KA 1IXZA 3GJ5A 2V3CC 2QBYB 3A36A 1G21E 1RIFA 3B5JA 3QG1A 3TJZA 5DYGA 2JATA 2QAJA 3QBVA 1HUQA 3A58B 2REOA 1KI4A 2GBLA 2IX3A 4QXAA 1TQ2A 1YR8A 2QENA 2OESA 4P4UA 1BS1A 2QGNA 1DG3A 4JLOA 1X8LA 4B43A 2FMXA 2ZM5A 721PA 5SZKB 1WXQA 3SC3A 1LVGA 2NPIA 1FNNA 3K8YA 3OIYA 2WIAA 2FPLA 2QEQA 1YQTA 4KHZA 2UZIR 3IDQA 3UMRA 4JKYA 4GNKA 2IYTA 1N5IA 4K46A 2ZRMA 1FP6A 4B2PA 4HZUB 2UKDA 4DCNA 1OIVA 1AJEA 2Q6TA 5JRZA 4B75A 4Q7KA 5C4GB 1U90A 4Q9JA 4ZI3A 4IEIA 3AVVA 1K5DA 1FOEB 5C2JB 3NDPA 1T4GA 1KDPA 5EZ5A 3TUZC 3R9XA 3SU8A 4AG6A 3FMOB 3NEYA 2VSXA 1TNDA 4NYJQ 3K09A 3W6PA 5C4MA 5M04A 2W6JA 4GSYA 5LD2B 1LF0A 4XSGA 1UBFA 4D6PA 2TMKA 4V0LA 3KFVA 1IBRA 3SZRA 1OB5A 1I2DA 1CJMA 3LVRE 2NO6A 4RD0A 1PV4A 2ZRKA 1IN4A 2MMGA 3AEZA 5HR5A 3TSZA 3UIEA 4ACBA 4ZKDA 2HV8A 4FWIB 4ZDKA 2WWFA 1P9RA 1VHTA 3NBYC 2XZPA 1EFRA 2ZJ8A 1XJCA 4EQ6B 3BOSA 3H0KA 1CU1A 3B1ZA 3SFZA 2IXFA 4US2R 5BW8A 4M1SA 4A0FA 3CZQA 2QA5A 1RJ9B 2ZRIA 4A0GA 5E3HA 1H8HA 2GJAA 4UXHA 1Q57A 5FTKA 1RPZA 1E2EA 2XGJA 2O8EA 1P9WA 1ZM7A 3L0IB 4BASA 1HQYE 1JJVA 2NIPA 1OLOA 1IY0A 2ZR7A 3BFXA 5HE8A 2JAQA 2NMVA 3IILA 2IUUA 3OE7D 4EUNA 2ODEA 3SR0A 1OXSC 3SYLA 3WBKA 2GZAA 1ZM9A 1Q22A 2A5FA 4NPHA 5DI3B 4KI0A 2JGNA 1KK3A 1KJWA 1OXTA 2G1JA 4GMDA 4D82A 4F93B 1G4AE 1JXMA 3BORA 2D7DA 3X1DA 2AKYA 3VTKA 1OFHA 2ZS9A 2I3BA 3NC1C 1VG0B 2V4ZA 5E7MA 421PA 5H68A 3U7GA 3QSYA 3N2EA 1CKEA 4XWKA 3P27A 4KLNA 4A36A 2ANCA 2IYSA 2IEZA 2QM7A 3AF4A 1T6NA 1G1MA 2Z6VA 3KXKA 4IVQA 3B78A 2WWGA 4DLUA 5IF9A 1E32A 5DISB 4B3GA 1ZVQA 2IYLD 4G5GA 4OBEA 2XNSA 3A4LA 4G0NA 1ZIOA 3RNLA 2XTNA 4AKEA 1ZNWA 5A4JA 2AK3A 3LFUA 1XMVA 4MITA 2OBLA 4PR0A 2Z4RA 2Q3HA 3FYHA 1KHTA 2AKAB 2ATVA 4D0NA 1N6HA 3Q85A 4TZ6A 4HLDA 3B1WA 1TMKA 2V55B 4HAYA 1L8QA 5D3MB 3LBNA 3LVQE 1P73A 4QNMA 4L15A 2IW3A 3T12A 5KYKA 2BCGY 1W2GA 4GDFA 2ZRBA 3T61A 1GKYA 2I1QA 3DMNA 3KKQA 3CNNA 3U3MA 4BZPA 4D4MA 4BGDA 1W47A 1ZRHA 3KB1A 2QPOA 1Q3HA 4HZUA 4Q03A 4Q4LA 4Q00A 4R7ZA 1XCMA 1W0JA 2IUSA 5BN5A 3UPUA 1RRCA 1O3YA 4B3XA 2GAAA 4NHOA 4NCJA 2AL7A 4Y0VA 2DBYA 1UBGA 5J5CA 3THYA 4JSTA 4LBYA 1R0XA 1CJKC 2ZREA 3IEUA 4IW3B 1G8GA 3DZ8A 3FHOA 2A78A 4RZUA 3WNCA 4B2IA 1YU9A 5AK0A 2FF7A 2CCJA 1XEWY 1JR6A 4Y0AA 3MD0A 3QPVA 3FFBA 1PVOA 4BECA 1BYIA 3EA0A 3ZZUA 2F1RA 3K9NA 4Q7MB 5DLQC 2ZAMA 4U7DA 1TAGA 3WMGA 1TUEA 3AVTA 2ORVA 3DM9B 4QJ3A 3IQXA 2OSBA 2Q9CA 4TMVA 2G9NA 2VL7A 3U7FB 1GTVA 4Q1FA 1E2GA 1F2UA 1RJ9A 4BEBA 4FCWA 1EWQA 3RSOA 3U3OA 4YDHB 1II0A 2IC5A 4XJXA 1IQPA 1E9BA 3Q5EA 4NBSA 4BLQA 1R5BA 4IJMA 3TUJC 1OIXA 4ARZA 4DCTA 3KJIA 4LV8B 1XZPA 4TLAA 5KDDA 4IOLA 2HJGA 5KSZA 3RS7A 3BH7A 3ADKA 4LJ4A 2AX4A 2F1HA 2GHIA 3B82A 221PA 3ZQ6A 2WMNB 2JCSA 2GEUA 3LY5A 1S3GA 3FHTA 2QPTA 2WM9B 1H8ED 1E4YA 3QKSB 2YVUA 3HP1A 4IEEA 4KSCA 4TMZA 3PIRA 4DB2A 1EFRD 4V0NA 3MWKA 2HLDA 5JCPA 1CS4C 1S8FA 4XIGS 3C14C 1D9ZA 1OHHD 2QAGA 4JLJA 5EE1A 4QHYA 3X1XA 1XD8A 3A1UA 1UM8A 1SKQA 4KBGA 3AVWA 4AYWA 3GFOA 2FG5A 5EXPA 4KODA 2ZE8A 3SNHA 3QF7A 2EFGA 4JBYA 2OLKA 3N70A 3AF0A 4A8JB 4HB3A 3CM0A 1TQDA 3W3ZB 1M8PA 4A8JA 3C16C 1E2MA 1A4RA 2FJUA 2FGKA 3AGQA 4E03A 3KFXA 1N25A 1JXOA 3KUDA 4XTRA 5CLQA 4URVR 1N6KA 5F2EA 2WBLC 5KPDA 1N0UA 4OHVA 3SHFA 3QXXA 5EP4A 4I4LA 1XEWX 2CL6X 2W2VA 5G3YA 5HKKD 1M7GA 4D25A 1JR3E 3A6PC 2KB0A 3FTQA 2CNWA 2VP5A 4B3DA 1XMJA 1NN5A 4JKIA 4G01B 4HSEA 3NC0C 2DB3A 2ZVPX 2ATXA 1TUIA 1Z0IA 2GEDA 1YE8A 2RGNA 4TTPA 3T5DA 2ASEA 4DLYA 5EXTA 1VG9B 3FVQA 3EZFA 3O8BA 4X8HA 4LYHA 5CK4A 4OHWA 2FDCA 3K9LA 2V6JA 1QF9A 3LAWA 2PMDA 3BXZA 2FNAA 2X2EA 3KQLA 1DAHA 4QGFA 4BLPA 1FTSA 1YR7A 2B7BA 2KI5A 3OEED 4NYIQ 2J0UB 4D4LA 3NDBB 1OFUX 2OAQ1 5FUVA 2P3SA 4PAQA 1HT2E 4CT5A 3ZLJA 4BLTA 3B1XA 4MUAA 2RGGA 2VP6A 4PTLA 1Q44A 1QHSA 4FD2A 1P62B 3QENA 1GNPA 1QHXA 2O8BB 3QUSA 4CIDA 2AD5A 4EPRA 2EFDB 5AJXA 1OJLA 2PCJA 821PA 4Q7JB 1G3UA 2CHGA 3Q7QA 4LGMA 5EJEA 3PEVA 5FOSA 4W9MC 1KI9A 4KLZA 4LI0A 4R98A 2JLWA 2PLRA 4RD2A 4KO8A 1T5IA 1W0JD 1YZLA 2OE2A 2QI9C 4KCGA 1KY3A 2OCYC 2ZTSA 3VNUA 1RVDA 3REFA 1NMXA 1E1RA 3BK7A 4I99A 1KKLA 2NZJA 4B3CA 1FUUA 1Z22A 2RB4A 1CRQA 5DN6A 2XOKA 1EFUA 2WTUA 3O8DA 3JVUA 2F3RA 3QE0A 1SVLA 4LOAA 3U6KA 4PC3A 1MKYA 1XRJA 4OQLA 4Z8XA 4KFSA 3E70C 4E09A 1IN5A 1UDXA 3CWQA 2Z4SA 3I8SA 1BIFA 2ERXA 2OCBA 2RGXA 2REXB 3DO6A 2VP0A 1CTQA 3QXHA 3UKDA 4FN5A 3QXSA 1F3OA 3X1WA 2Z43A 4PSVA 2Q0HA 1ZBDA 1GKIA 2DWQA 5G3ZA 1U99A 3GLGB 5IT5A 4QHSA 3C5CA 1DO2A 1YZQA 2WKPA 1Z0AA 3L0OA 3I5YA 3WRXC 4M2LA 4CEJA 1W5TA 4TLBA 1G8YA 1KK2A 1EG7A 2Q21A 2B7CA 4JS0A 5J47A 4N0DA 4MYTA 3FWYA 2QUZA 1XJQA 4QRHA 4MUBA 3W5JA 2OAP1 2J5XA 3PR1A 4P4SA 3T5GA 4G1UC 1VCOA 2C78A 2OCPA 1CULC 4UJ5A 3TVDA 2R9VA 2JLSA 1JEEA 2IHBA 2PEYA 2EFEB 2J46A 3CNOA 4TYPA 3AVUA 5JI3E 4NYIR 2ZYWX 1G64A 2WAYA 3IO3A 1W0KD 3DOFA 4S35A 1F6BA 3B9PA 1QHYA 3F3YA 2HUPA 2R65A 2VYFA 4F4CA 2CJWB 1WRBA 1U8AA 1E99A 4Q02A 4MGKR 4PZZA 3IEVA 1HEIA 4Q66C 1DAIA 3CRW1 1PLLA 1E0AA 3RS3A 2WICA 4JT2A 4I1OA 521PA 4JLNA 3KXIA 2X1VA 1E0KA 4M1OA 1P7CA 1TPZA 2EYQA 4LC0A 4C0KA 3FKSA 5C18A 2JLRA 1SXJE 1DARA 1ZIPA 2FSHA 3T35A 2J9RA 4KVGA 4X8OA 5EUQB 4IRUB 5KHOC 1UF9A 1ZMXA 1FW6A 2N42A 5FUWA 1QHNA 2G1KA 2B21A 4RFVA 1IN8A 3U61B 4TSFD 3KL4A 4P33A 3SDZA 2NQ2C 1ELOA 4OL0A 1E9FA 5JJKA 2HLDD 3B9QA 3NHAA 5A0FA 3T1VA 3K0CC 1E9SA 3W5IA 4R2HA 3RC3A 4RZ2A 2ZJ5A 4C0LA 2C96A 2O0JA 3EG5A 4US1R 4D80A 1VKJA 3FHCB 4H1VA 3IIJA 3HWSA 4OI4A 3R7WA 3VHXA 2OFWA 4POAA 2CCGA 2QT1A 2XZOA 1QHIA 3AVQA 3MFYA 1C1YA 2V6IA 2UZ3A 1E2IA 1OFIA 3TLXA 3L0PA 3NTUA 1YR9A 2GZHA 3UG6A 4GMXA 1ZUIA 3RABA 3CX6A 4LV5B 4AYTA 3DMDA 2ZQ5A 1SVSA 4OI1A 4LZZA 1ZU4A 3CPJB 1LF5A 1G7TA 2V1XA 1MABB 2Q3FA 1VYVA 4L4UA 1ESMA 2FSGA 2BMFA 2KBFA 1Q21A 1E1QD 2PX0A 5KTYA 3BBPA 1DG1G 4RKEA 1XJ0A 3GJ3A 1G291 4CEIB 1KO5A 1YKSA 2VQSA 2PJZA 2OT3B 4O2RA 1QDEA 2QTVB 3FKSD 4GOKA 3SYKA 2CMKA 3WHKA 1WCV1 4YDSA 4DLTA 3RRZA 3U44B 1QVAA 4QBHA 2QN6A 1U0LA 2GVZC 2N46A 2XOKD 4B3BA 1CBUA 1JAIA 1MRNA 2W6JD 3DZDA 3IKJA 3M1IA 1E2HA 4GI7A 4DJTA 1MO3A 2FSIA 2ZRFA 4DUGA 4R71A 1L4UA 4MGIR 4LJYA 3ND8A 3BE4A 3W34A 1FMLA 2ONJA 1MO4A 4AY2A 1F48A 1W4CA 5FR2A 4C3ZA 5L8VA 1N6RA 1P5ZB 1XTSA 3EPHA 4CZ2A 3B85A 1E69A 1B23P 3BFKA 1XX6A 3QNUA 4KYUA 1J7KA 4XVRA 1IN7A 1VCIA 4KBFA 1NG1A 1HT1E 3B8HA 3PUXA 2SHKA 2KE5A 2O52A 4HAXA 1W5SA 1JNYA 5DSZA 4LX0A 2RMKA 1MO6A 1DS6A 1RRPA 4JLVA 2O0HA 1Z6AA 5HPYB 2F7SA 2CLCX 1QG4A 2QAGC 5JWOA 3BJIC 4X8MA 4U5XA 2OFXA 2CL0X 5IRCD 4QHTA 4URXR 4PPGA 5DYIA 4DLXA 2PEZA 5KO2A 3DHWC 3Q5DA 4LSGA 3W90A 2ZE7A 4UNSA 5F9HA 1SVMA 4G5RA 1KK0A 5FUXA 3RWMB 1VYUA 2GCPA 4LCBA 3H1TA 3HU1A 1T0HB 2OXCA 2VF7A 4KFUA 4Q19A 4URWR 4WOPA 3WY9A 4DSOA 3IO5A 5D3QA 3G82C 4Z8YA 1CRPA 5DHFA 5BYJA 4NTZA 3RRMA 2ZJOA 2MSEB 4TYYA 1G5PA 3AV0B 5CB8A 1EFTA 1JI0A 2C77A 4C7OA 1Z3IX 3OAAD 2GA8A 1ZD1A 5EE5B 4XH9B 3TQCA 4A0HA 1JAHA 4PQYA 2NPFA 1R5OA 4G5QA 1NMYA 4M4SA 2YOHA 3KKMA 3UWOA 3ZS9A 3EIHA 5TB5A 2AN9A 5EE3A 3LV8A 1XXHB 4FINA 4PO1A 4DCSA 2HF8A 2C04A 5AWFC 3C41J 4J0QA 2VSFA 1GL9B 3CR7A 4TLDA 2YV5A 2QQ0A 3CWZA 1NBME 1DO0A 1Y63A 4JVLA 1Q0UA 4RFSA 4FIDA 2JDID 1NF3A 2ZJZA 3U3RA 4TL8A 3KTAB 3SN6A 4F91B 1AS3A 1NP6A 1Z07A 3IUYA 4N0EA 2ZJBA 4YMSA 5L3SA 1JR3D 4A92A 4AI6A 2C5LA 3RDPA 1R4AA 3EC2A 4AKGA 3GJ6A 1G5TA 2PH1A 5AUQA 3TAHA 2VSOA 3BWDD 4RZXA 3S1AA 4D26A 1CR0A 1U8ZA 1W0KA 4M9QA 1Z5ZA 1ZCBA 2FU5C 2B8WA 1KMHA 3GJ4A 3RVBA 3KJGA 2ZRAA 1LS6A 3WYGA 3LW7A 1F2TB 1E2DA 5J40A 1PUIA 3ZD7A 1XU4A 1E0JA 4PC7A 1E2KA 4Q9HA 2YJTD 3M4YA 3WRYC 4UNQA 5B57C 4P3YA 2RKOA 3PEWA 4US0R 2GXQA 4NYJR 1T3HA 1Z8FA 3BFVA 4HB2A 4LWZA 4IDQA 2G83A 2CLSA 3GD7A 2G0TA 1G8PA 5KPJA 1P6XA 3QI2A 3ICEA 4GL2A 3KDSE 4MRNA 5HZHA 3IIMA 1XFAA 3TH5A 3UANA 5IK2D 1XPOA 5BWMA 2C9YA 3K0FB 1SXJD 2ZYVX 2WWWA 3GMTA 5TMPA 4FW9A 1NVVQ 2ZRPA 1FNMA 1HE8B 4RSGA 4XWOA 1S96A 2BV3A 2ZJ2A 1OXVA 2JEOA 1QRAA 3HU2A 3VU9B 3WHLA 4DLRA 4EPWA 1XNJA 1KSFX 1SVIA 4IKEA 2JJ2D 4A6XA 1D2MA 1H8HD 2FFBA 4IVRA 2C95A 2QPAA 2P0EA 2J7KA 1E96A 3X1YA 4C30A 2DHRA 4JJKA 4QBFA 1WMSA 1TEVA 4JYCA 2F55A 1KI7A 1KSJA 1SVKA 1P72A 1NVWQ 5FR1A 4CEHA 2QRNA 4GOJA 3E5HA 3B6EA 2OFOA 4F4IA 1AKYA 1ETUA 1KKMA 1NLZA 2V7QA 3QEJA 1UEJA 1F5NA 1NY5A 5J4LA 3PUWA 2VHQA 4ZCIA 4NYMR 2VEDA 2OUKA 1QHGA 2GJ9A 1YZNA 5D3MA 1RRGA 4IDNA 3R7WB 3R9WA 1G9XA 4NL4H 3NH9A 5HCNA 4BFWA 2ORWA 2F9LA 1NLYA 4FMBB 3VKHA 1ZP6A 1XXHA 2R6GA 4Q1EA 2GJSA 1Z0KA 3UMFA 3WP0A 4BRWA 3LDAA 2JJ1A 4TTQA 4IDHA 3ZGXA 2FFHA 4Q7LA 5B64A 3K70D 4FWTA 4C2UA 4CVNA 1JALA 3AF2A 4A9AA 3F5FA 3AVXA 5FFMA 1KO7A 3ZZ0A 3EIEA 2QMOA 3PQCA 4ON9A 1GDDA 2OG2A 1E3MA 3WYAA 4LRWA 5JCZA 1NIPA 1W44A 1AA9A 2RGCA 4MGZR 4M1TA 1C9KA 1JQLB 1WQ1R 4HLQB 2JDIA 3U7EB 2WJYA 4Q4HB 4ESVA 1KI8A 4QBGB 2DYKA 4MA4A 2WV9A 4Q4JB 1KMQA 3IQWA 4BEJA 3MLEA 2BC9A 5CLLA 4ZDIA 2GCNA 3IHLA 5KSOA 4A15A 2MSDB 2JJ2A 1EK0A 1UKZA 1XEXB 3IBYA 5FPSA 4EPYA 1EFCA 3QKRB 2ZR0A 4PC6A 2YC4C 5LDDC 4Q4AA 3VQTA 4RY2A 1AK2A 1Q12A 2WSSA 1U2RA 3F8TA 4A4DA 2R6FA 1OIWA 3C5HA 4B32A 1SHKA 3CBQA 4V02A 1COWA 3P20A 2GK7A 4ACAA 3EWAA 2G88A 1ZJ6A 5FTLA 4V03A 2GTPA 2YNMA 3RS2A 4ZV4A 2ORIA 3PUYA 4TMXA 2BMDA 4CGZA 3HU3A 3CW2A 4URUR 3P26A 1ZINA 1VYTA 3GEHA 1VIAA 1XDBA 1JQJC 2IA5A 3I3SR 4D4KA 1Z6TA 2FOLA 3AH8A 1E9EA 3W9YA 2I1VB 3CR8A 5GJCA 1G5RA 2P2LA 3RS4A 4BE7B 4CYMA 2F3TA 2HEIA 2QAGB 2FE4A 4LJ5A 1ZM4A 3CUEF 2XNDD 4IFBA 4LUCA 4PHTA 2E9SA 5KDOA 1EFHA 4MH0R 2P6RA 3NKVA 5JS8A 1RKBA 3LNCA 4URZR 2VHUA 1FMJA 2E1RA 2ZUDA 1Q1ZA 4C0JA 1JEDA 1N0WA 4IDOA 4WBSA 3GJXC 5EXXA 4BPBA 1Z6GA 4IOMA 3GLHB 2PLFA 2IEYA 3EXAA 4EFNA 3IPYA 1U9IC 5BQ5A 3RLFA 1G6OA 4P0TA 3MJRA 1E2FA 5JZVA 3PCRB 1M6NA 4UNPA 4HUQA 2HT1A 2B8TA 4PXAA 3K1JA 4XVUA 2G6BA 1NI3A 2ZS7A 4A2QA 1ANKA 1SXJB 3LW8A 1Q3TA 5BN4A 3SFVA 1AGRA 2W6ID 4Q1DA 3CRRA 4HLUA 1II9A 3MSXA 5DNYB 2DR3A 1JPNA 2B6HA 2PT5A 2WOJA 1IY1A 2ZI6A 3BH6A 2OBNA 3OIUA 4FCVA 4TQUS 2A5DA 1MABA 4N1AA 2VRWA 3GJ7A 5DI3A 5FBRB 3CH5A 3KX2A 3BRWD 5TY0A 3OHMA 3FB4A 4KVAA 3NWJA 3GLIE 3PITA 4BFUA 4PC1A 1E9AA 4AWXA 2K5UA 4DC9A 1R0ZA 2PBRA 4MYCA 3GLHE 4D2IA 5TARA 1KZ7B 3QKTA 5EE9A 1II8A 4PHFA 4HYYA 3RRYA 2ZU6A 2O8FA 3AKYA 3WXMA 4II7A 4IFEA 1GILA 1PZNA 2AXNA 4U00A 1IM2A 4DXAA 1EESA 2OV2A 2GXSA 5CIWA 1X3SA 1RYHA 1TU3A 2ZETA 5IHPA 2BVNA 5FOWA 3SJAA 4EIWA 1N6IA 1IAQA 1IN6A 1N5LA 1SXJC 4L9WA 3ZYCA 4DB4A 2AWNA 1KAGA 1Z0DA 4HAUA 5AJVB 2IYVA 2ZE6A 3EIQA 4DLWA 2JLZA 2C9CA 3LA6A 2QQEA 4A2WA 5E7JA 5CK5A 5TV2A 1V43A 1UADA 2IT1A 1GL7A 2BBTA 1SHZA 5J4HA 3KJHA 5E95A 1EX6A 4FMDF 4JLDA 1BH2A 4NH0A 5K8IA 4TLCA 3CZPA 1DPFA 4TYWA 4Q9LA 2HYIC 2XTMA 4ASUA 4BWYA 2WWHA 1A82A 2HF9A 2ZSFA 2J7PA 1MT0A 4M22A 3RS0A 1ZU5A 1XTKA 5KNBA 1R0YA 3I61A 3LQRA 4M1KA 4Z54A 1SVOA 3U4QB 3TUIC 1KOFA 3TMKA 3CONA 3HYTA 4I1SA 3AVPA 4ITRC 4OI0A 5EUMA 2QROA 3K0SA 1R0WA 2XNDA 3GEEA 2Z5FA 4EJSC 1Q20A 4YMVA 1WP9A 5L3SB 3HJNA 2BKUA 1MRSA 4CEIA 2OEPA 3AKCA 4BFZA 4B76A 3B1VA 2O8BA 1LS1A 1X8JA 2IBMA 5DE3A 3SOPA 1JB1A 1NJGA 1P60A 2CDNA 4B48A 4LBWA 5JI2E 2MSCB 2ZUCA 5AUPB 4LY6A 2IXGA 4BZQA 4B47A 1Q1BA 1HURA 2NZ8A 4YMWA 4HUQB 2CE2X 4A6PA 2FA9A 4B2LA 3LH5A 1ZUNB 4LJ7A 3NBXX 1US8B 2ZS8A 2O8CA 2IS1A 3LLUA 3Q9LA 1NBMA 3QG5A 4HZIA 4ZDJA 4UQOA 1RRFA 4Q1AA 3AKEA 3GP8A 2KBEA 3LQQA 3AF1A 2ZRLA 3A4NA 2VIIA 5JHHB 4BFYA 4GRAA 4EJSB 2D3WA 2FPMA 3ADCA 2IS6A 3EZ6A 2ZYTX 3GCGA 3CKLA 1Z83A 3ASZA 1XTIA 3B1YA 3CH4B 5JHGB 4D81A 3ZJYA 3AB3A 2BJWA 4JYBA 4NZYA 4TMWA 3KQUA 3SQWA 2GK6A 1E6CA 3F0TA 2L0XA 2GBLC 4MKFA 3I72A 4E5UA 3UWKA 4LC1A 1GG2A 4B35A 3GEIA 4B3FX 2ZI7A 2W0MA 2EU8A 3I4LA 2ZRDA 1GRQA 2QTFA 3LXRA 5DIFA 1ZNZA 2AR7A 3IHWA 3MWLA 4OHYA 4A82A 3G0HA 1XBTA 3SS8A 1AS0A 4O2LA 2ZRNA 3KB2A 3CF0A 4HDOB 1NNEA 1DAKA 1XEXA 3AGPA 1QVRA 1KGDA 2PCLA 3ZD6A 1FL9A 1N6LA 3FPAA 5EQTA 4Q47A 4MRSA 1Y3AA 3MUFA 2EWWA 1OH6A 2WSMA 4UXIA 5BXQC 2CVFA 2D74A 2J0QA 3C15C 1KDOA 1NY6A 3BERA 3BC1A 4YMTA 1DOAA 4PQFA 2J3EA 1NKSA 2G77B 2BWJA 3VHLB 4DDUA 1J2JA 1E2NA 2VHCA 1XWIA 4TTRA 3TW8B 2D2EA 1IOZA 2XZLA 1R2QA 5JWRA 2WWIA 3K53A 3WP1B 1GIAA 4CW7A 1X6VA 1NLFA 3DM5A 3QF4A 4YQFA 4ZCLA 4B71A 3QF4B 1KJZA 2HXYA 1W2HA 1A1VA 4DHEA 3KKOA 1I2MA 1RW4A 4QGAA 3QEOA 4M1MA 4CF7A 4Q4HA 1VTKA 1YRBA 2FN4A 1UBEA 3SI7A 4KFRA 4H1UA 4WA7A 3PEUA 3IPXA 3A1VA 3SYNA 1N6OA 1TF2A 1M34E 2W00A 5FI0B 1XCPA 1D9XA 4O0MA 4O25A 4PAOA 3GLFB 2V7QD 1ZC3A 1FPMA 1NMZA 1UDWA 1GOTA 3OEHD 4Q18A 4NCNA 3RANA 4CDGA 4DDWA 1CJUC 3I5XA 3BB3A 3PG5A 3I32A 3TRFA 1XTRA 1AS2A 4L9SA 5AUNB 5KNDA 5FL7A 3SJZA 2EW1A 3RSLA 5A5GA 1J8MF 1OHHA 2ZEJA 5L3RA 1ZD9A 4B74A 5DHAA 1FQJA 2YOFA 4EKDA 3HR7A 5HTKA 4DIEA 4DT1B 3EWSA 1P4SA 5FL3A 1LNZA 4ARZB 4MKHA 2IL1A 2XB4A 2P5TB 1Z08A 2WJIA 2AFIE 2ZXUA 1CEEA 2XAUA 1NVXQ 2J45A 2O5VA 1CIPA 2BKEA 2PT7A 1CXZA 1N6PA 4NP6A 4WZBE 2R8RA 1UKVY 2LCFA 2ZITA 4YONB 2JLYA 2YHSA 2IYZA 2EWVA 2IF2A 2DY1A 2Z83A 4EPVA 1KI2A 1P2SA 1OH5A 2V9PA 4FI3C 4QM6A 1AZTA 1XD2A 4U02A 4QG7A 5GJWC 2DFNA 2QM8A 4AURA 4UKDA 4BRUA 1OFTA 2GESA 3RC8A 4OK5A 3GLGA 2XSZA 4PHHA 5HE9A 2A3RA 4I1UA 1HV8A 3ZIAA 4KAXA 2QE7A 4AD8A 2J0VA 3GLHA 3ZZTA 3VR1A 1YZKA 1ZUHA 2CLDX 2ODBA 3ICQB 4WZ6A 3J81k 3VX3A 1W36B 2FFQA 5FTJA 4BFVA 2C2HA 1N5JA 2W58A 2OBMA 4R9UC 2QSZA 3FGNA 4JIMA 4RCZA 5F3WB 2XSZD 4MDFA 5SZIA 4V0ME 3I8XA 1MV5A 1P2UA 4WIAA 4BUJA 4DEYA 2RGNC 2H7VA 2BM0A 1Z29A 3FFAA 1IXSB 3GFPA 1VG1A 5SZHB 4M21A 3N5CA 3OFNA 3P32A 4E22A 3WNBA 2IS4A 1VG8A 1GZSA 4FMDB 3CO5A 1SKYE 3OZXA 2H1LA 3A4MA 3DVLA 3T34A 4JL5A 2D06A 4OKSA 1PUJA 2NO0A 4WXRA 4PZLA 4WXPA 1XD9A 5FPTA 3AKDA 4OK3A 3BGWA 3UMSA 2DFTA 5FOVA 4DRZA 3GLFE 3KTAA 4JLMA 3VX4A 1DAEA 2QMHA 4TL9A 4P4TA 3B7GA 4Q4JA 1NSFA 2YWEA 2OM2A 3EPLA 4ZPXA 3IGFA 4ZKEA 5CM9C 4EPXA 4IXMA 1JPJA 3D31A 3THOA 5DGXA 3GLFA 1VMAA 2VF8A 3U7HB 4JL8A 5JJIA 5FPHA 5GADl 2GJKA 4RZ3A 2O8DA 4Q4AB 4E07A 1ESNA 3SJBA 1T91A 4FMCF 1G7SA 1RFLA 2F1IA 4BLSA 4CEJB 1CR4A 4HB4A 3TGPA 4GT1A 2YKGA 3T15A 5CYPA 2IYWA 4PC2A 4B33A 4DLVA 1R8SA 3CPHA 1S9DA 2R6CA 2Z0MA 4Q9KA 1IXRC 4B6FA 4EQ6A 1XTQA 4A2PA 5JS7A 2FZLA 2IYRA 4PPQA 2WAXA 2WIBA 1NRJB 5EP1A 1HTWA 4IXNA 4ABYA 2X8AA 3QXJA 2KWIA 5KU1A 1M74A 1GFIA 1L4YA 3LO5A 8OHMA 4RJLA 3OE7A 3QBTA 1II8B 4ZIRB 1E4VA 4XOIA 1OXXK 5KSPA 1O87A 1V5WA 4JLKA 2QRZA 3O8RA 1D2EA 4HAWA 1GITA 2V8OA 1YVDA 3SJCA 2D7CA 1A5TA 4LV6A 4L8GA 4BQSA 2QTHA 2R6AA 4XVQA 4LJ6A 2ZJYA 3OESA 5KUTA 2CK3A 4LYJA 4JLBA 1NVUQ 4PSAA 2IXEA 3V4RA 5FTNA 4TQ9A 5EZ6B 1W36C 3K0EA 4A1FA 1E79D 2BHRA 3P4YA 1KNXA 2IYXA 3I1FA 5TDHA 3ZDQA 3HDTA 3KUCA 1KYIA 5GJVC 1KY2A 5KSYA 1VIYA 1WA5A 3B60A 2C99A 2ZI4A 3VAAA 5GJBA 4MKGA 1P2VA 4MYUA 4GBMA 1T8TA 2WJGA 3KKPA 3ETLA 1S2MA 3CRVA 4HUTA 4EFMA 5KOYA 3VMFA 1FUKA 3GLIB 1UKEA 3HPQA 1XB2A 1ZM3A 1HA3A 3K0AA 3NBZC 4MKIA 2GDJA 5J4YA 2FX3A 2QBYA 4GFDA 3W6NA 5AJYA 2JJ8A 2EFHB 5JFGA 1CR1A 1TL7C 2AD1A 2PZGA 3CB4A 4TL7A 3LX5A 1DAFA 4ESHA 5K8UA 4MDEA 2ZSAA 4EPTA 2BIFA 1W49A 2NG1A 4DBLC 5JLJA 4LHVA 2IS2A 4NONA 4RVCA 1L7VC 2LWIA 1BYUA 2DFLA 1WBDA 3U60B 4LBVA 3DOEA 3HPRA 2ERYA 3V00A 3X1ZA 3ADBA 4EAQA 1MH1A 3BB4A 4P32A 4MRPA 1G7RA 2CHQA 4AYXA 2VO1A 3TVTA 2OILA 3R8CA 2ODWA 2FH5B 4O3MA 3T1OA 1RYFA 2XB2A 1JJ7A 3L8ZA 3AF3A 4PPFA 4M8NE 1G8FA 4MQBA 4DSNA 4GP6A 3T1QA 1D6JA 1GSIA 5KNCA 1OKKA 1T3LA 2OZEA 4Q5IA 5FOXA 4AG5A 1GAJA 2ZVQX 1D8TA 4HATA 4YXWA 5CM8B 3K70C 1J99A 5CJPA 5HZKA 2NO9A 4KFTA 4RCYA 3TAUA 1HH4A 4LJ8A 1G3IA 3VR6A 4QJ5A 2ZI5A 2IUTA 3SE0A 4DUGD 5JSZB 3GLGE 4DSTA 1EXMA 4G5OA 4UJ3A 2IK8A 3M6AA 3GPLA 3OIVA 3PJRA 1S9HA 3U2QA 4KU4A 1NN1A 2V54A 3IIKA 2YINC 5SZJA 1CR2A 2XXAA 4KYIB 3D6TB 2O8EB 2RGAA 5JEDA 2JLQA 3EZ7A 2RGEA 1NN3A 2AK2A 4TMTA 3D3QA 5FBLB 3OEEA 1VECA 2QP9X 1Q1EA 3W3AA 4W5JA 1A2KC 2QT0A 3TIFA 2GXAA 1GKUB 4Z1MA 4NE2A 4DCVA 1J90A 2QU8A 3EZ9A 4B34A 2REBA 1NKTA 4LPSA 3CIOA 2BMJA 1LV7A 4D0GA 3D7MA 4XD7D 5JBQA 1UFQA 1IY2A 3GQBA 3QXCA 1G18A 4D0LB 2GAOA 2CNWD 3BD9A 1IHUA 2CK3D 1CLUA 4Z1MD 2RAPA 2H16A 1SQ5A 1XPUA 1BKDR 4C9BA 4Z51A 4YXWD 3QQ5A 4CT4B 1OYWA 4M1YA 4PHGA 2R62A 2W2TA 4RD6A 1OKKD 4PANA 4AKIA 2ODNA 1IJFA 2BBSA 1E1RD 3AP3A 3DDCA 1G20E 2P5SA 3DL0A 1OV4A 1ODFA 4TSFA 2VHJA 2BBOA 4JBWA 2W2XA 4OQMA 1EWRA 4C0SA 5H1YA 1OXUA 3CF2A 3EPKA 1G3RA 1NJFA 3VKGA 4RKFA 3NG1A 1GNQA 4OHXA 2GJ8A 2WOOA 1KSHA 1AQUA 1OF1A 4JJZA 5GVRA 1UPTA 1T3SA 4NMMA 5HKKA 5J4KA 1P9NA 1Z0FA 4V0KA 1YRAA 4R2IA 2IYYA 3A8TA 2RGDA 2VP9A 4OJKA 1H8EA 1XF9A 1U98A 4IHQA 1GVNB 2X19A 3QY0A 3VR5A 3NXSA 3K0FA 3M0EA 3Q3JB 2ZE5A 2GF9A 2A5JA 4OQXA 1XXHE 4DEXA 1OH7A 1KI6B 1E9DA 3L0SA 4LJAA 3AM1A 3W8NA 2NTYC 4IOJA 3K9GA 2ZPTX 1A2BA 3ECCA 3OFND 5F9FA 1X8KA 1U81A 2XX3A 3BAFA 4OK6A 4TN1A 4YMUA 3QJYA 2O8DB 2GNOA 3OEHA 1S4QA 4QJ4A 2RHDA 3QOFA 5FL7D 4PPNA 1LFDB 3TSOA 2G0NA 5EXSA 3KXLA 4DDTA 2HYDA 2X2FA 2NO7A 2X77A 1YJ5A 3NIBA 4HAZA 2DCUA 3TK1A 5BYKA 1C4OA 4XD7A 5FPKA 2QE7D 2QGZA 4M9ZA 4JT4A 2YOGA 1YZTA 3K09C 5LB4A 4B73A 1GL6A 2DPXA 2YWFA 5K8LA 1WE2A 4MRRA 2YYZA 4CEHB 2OLJA 2WKQA 1KMHB 5P21A 4M9SA 3R9IA 1E2PA 4PO9A 1KJYA 4LHXA 3RS5A 4DDVA 3VNVA 621PA 3CNLA 2C8VA 2D62A 1R5NA 2WWYA 1R6BX 5B30A 5IK2A 3P1JA 4K81B 4NKRA 2A5YB 3L8YA 4XWAA 2MMCA 4JSYA 5JRJA 2AXPA 2BJVA 3PUZA 1W7AA 4FXPA 3CF6R 3W8RA 3MWYW 1DTSA 1VPLA 2WPDA 4RD3A 1G16A 4K8OA 2D4HA 1OW3B 2GCOB 4AK9A 2GZDA 2ZRJA 1K5GA 1XCGB 3HR8A 1MR3F 4TQAA 4S2EA 3X2SA 2QORA 3I62A 5E7IA 2FV8A 3NVAA 2BOVA 4ZO4A 1XP8A 1TU4A 4M0LA 5FBWB 4RFSB 4I81A 5KDLA 4OHZA 2AHOA 3EAQA 4PZYA 1S1MA 2CXXA 2ZANA 3THYB 1AZSC 3PENA 1CJVC 4ZCMA 4DWJA 1UAAA 1HQCA 2OCAA 4OQFA 3GJ8A 4BLRA 5BN3A 3PFIA 2JASA 4H9GA 1E94E 4I1VA 3UG7A 3WYFA 3VR3A 2BCJQ 4C0BA 1E98A 1OPXA 2P67A 4GOXA 2CE7A 2QG6A 3AVYA 1S1CA 2NO1A 4G5SA 4Q21A 1ZD8A 3W6OA 3SBDA 1M7BA 3B2EA 3DEFA 3R20A 4BFXA 1ZCAA 1GRNA 4P4SB 5K8TA 1MOZA 5JJLA 3ONWA 3MGCA 3UXMA 1F2UB 2R2AA 4AKHA 4GZLA 4TT3A 1AM4D 2RHMA 4JVMA 1Z2AA 5EP3A 4Q01A 4LBZA 5FOTA 4TYNA 5H8WA 1OH8A 5J4VA 2J7PD 4LJ9A 2WJJA 4F38A 5JWHA 3EZ2A 3L43A 1UKYA 2HT6A 1R8QA 2UVQA 3GLIA 1TF5A 3TR5A 4QGGA 1NIJA 2A30A 3GFTA 1RZ3A 1E1QA 1U0HC 1BOFA 3Q7PA 2DWOA 5FUYA 3EPJA 3R8FA 2WKRA 2VLIA 2GRJA 1YHNA 2XXAB 4P31A 2CJWA 2VA8A 2ZSBA 2P65A 1LW7A 4EJSA 4QKQA 1DAMA 2XJ9A 1FFHA 4JL6A 3I92A 2I4IA 3VFDA 1TQ4A 1S3SA 4G3XA 4LHZA 3QVVA 4DLZA 1YZGA 3FDIA 1ZYUA 2Q9AA 3QKUA 4A8JC 2H5EA 1KTVA 1ZW6A 1PJRA 1WF3A 2QMUA 4LHYA 2A9KA 4W5WA 3VU9A 3ZVRA 5EP2A 2XEXA 1Z2CA 1Z06A 2PZEA 3OIWA 1DVRA 2JLUA 3BH0A 2BMEA 2IHYA 1A7JA 5G53C 3WMFA 5L3VA 3KQHA 2LKDA 3LBIA 3T1TA 3KQNA 3K70B 2ZSDA 3ZVMA 1WB9A 1X1SA 5JSZA 1RC8A 1B0UA 3SHWA 1G7CA 2F1JA 5AR1A 3TQFA 4A0RA 3MJHA 3WBJA 1XTJA 2ZAOA 2FSFA 4KSBA 2HCBA 3QKRA 4N3NA 3RRNA 4QBIA 2ZJAA 2JLXA 1K6MA 2F43A 3NBFA 2WWXA 4OYHA 5B2ZA 1AN0A 2CBZA 1AQYA 5LB2A 4B44A 1VCNA 1H65A 1Q1QA 4KITB 2A7QA 3BIFA 5LPNA 3KQKA 3V4FA 2XJ4A 4ERNA 3EA5A 3O8CA 3P4XA 2W6IA 4NDZA 2FZ4A 3G5UA 1UBCA 2JIZD 3LWNA 1VHLA 5EE0A 4TZ0A 3C8UA 2FWRA 4OQNA 3Q8XB 4EDHA 3U4QA 4RD1A 4JZKA 2KSQA 2WPDD 4LK2A 121PA 2YC2C 1VDZA 4NCHA 4ASUD 1X86B 1VCMA 2JA1A 2VPPA 1M1YE 4F4JA 4WW0A 5CITA 3JVVA 5DH9A 4C0HA 3QPWA 1WDTA 3LLMA 1KDTA 2RGBA 1QBKC 5FBVB 3THWB 2YWGA 3H4MA 1R7RA 1NSTA 4UNNA 2J0UA 1D5CA 1K8RA 3EC1A 2WMOB 2HJVA 3T06B 3OAAA 1KDRA 3FMIA 2BEKA 1U0JA 3BS4A 1NBMD 2E87A 3MRSA 1EGAA 3UK6A 1OSNA 2A2ZA 4BFTA 1E2JA 1T0JB 1F60A 1ZNXA 1N0VC 3N2IA 4WVFA 3EASA 2ZI9A 5CDFE 2VP4A 5CB6A 2FPKA 4HDCA 4F92B 2J59A 2F6RA 5ELXA 1AKEA 5CIQA 2C98A 2CHVA 2FFAA 1W4AA 4DIDA 2F9MA 4PX9A 3TW4A 3THXA 4HB0A 2QNRA 2WJHA 1G19A 1MO5A 1EX7A 3RYTC 3U3JA 3QIAA 1IONA 1LTQA 1W1WA 5TVKA 1XZQA 1PLJA 4JMPA 4TMKA 1SXJA 1G4UR 4F7WA 2ONKA 4D4JA 4IOKA 3U3KA 4ZIRA 3A1WA 3AP1A 3H84A 2ANBA 4DCUA 1Z47A 4QOSA 4Q48A 5AJZA 1HE1C 1GRRA 3RAPR 3SBEA 5F98A 1XD2B 4PQRA 3O47A 1XMIA 4QC2A 4QFMA 3VR2A 3ADDA 1TEXA 2XTZA 4AIIA 1KO1A 2GVDC 6Q21A 1ZC4A 2EVWX 3A1TA 5IDVA 2O8FB 2OO7A 1G6HA 5DN6D 2DWPA 5L3QB 3FMFA 5C46F 4QNRA 1KI6A 3ZVLA 3EX7C 2OHFA 5FPYA 5L3QA 1ZAKA 2ECKA 1U94A 2JLVA 1SULA 3K0CA 5GVSA 2AFHE 4EFLA 5JMTA
chains in the Genus database with same CATH superfamily
2ZYUX 3B13B 5YASA 1IFXA 3BDVA 1MDFA 3KJEA 3TR0A 2JCBA 4U2EA 4Y2QA 2GETA 3RM3A 3GEMA 4MUGA 3AYZB 2BEJA 3ZW9A 3H2YA 4YLGA 1VJGA 3CUWA 2F64A 4OGWA 2IX9A 2H8KA 4C14A 3VA7A 4RD4A 3PPIA 4EEZA 4HLUC 4ZVLA 1MOSA 4Z7OB 4X8LA 2I4RA 2PWZA 5K3DA 2X4IA 4UUMA 1J2RA 3L6EA 4IKPA 4QA9A 4WMLA 2Y77A 1BW9B 4L3VA 3H9QA 2I78A 5DGTA 4RCVA 3MWJA 1I3MA 5EHXA 1FZQA 1O5IA 1UKCA 1WLYA 1WNFA 4Q9IA 4X44A 2J3MA 3B3JA 3ZH9B 2W83A 1CEQA 1DKQA 4L22A 1ONSA 4UASA 4BN4A 4EEXA 4F72A 2WB2A 4JYAB 3A2NA 5AQ1A 5CH5A 1KO4A 3WKAA 4X1YB 2B5WA 1LY1A 1PTJA 4XUGB 3HB7A 3LXUX 2AFHB 2RCNA 2ZIAA 1DEOA 4G4JA 4NDAA 5HCIA 4K5QA 4AZ3A 4O3FA 4M9CA 3KKKA 1Y8ZA 4JI5B 4M37A 3WMXA 3UJNA 2O7NA 1ECFA 3EBPA 3G5LA 4RK7A 4YAUA 1Y3DE 1OX4A 3EZYA 2OHGA 5ANRB 1GPMA 3NT2A 4GOOD 4ND3A 3HRKA 1TE2A 2GWHA 4KVZA 1CDOA 3UM9A 2DFKB 3DZBA 3EVTA 1RKUA 2WFLA 2ZBPA 4NU6A 3V1LA 1PE0A 1DBSA 3ONFA 5U4QA 3RVSA 1YL7A 3K9HA 4XCVA 4YX9A 3P9YA 5KQSA 2HTFA 1I1OA 4PSKA 4R2XA 4TV9F 5ALIA 2IWHA 2WLSA 3A7EA 5AW1A 5JECA 5U9CA 9MHTA 4C6TA 4QGHA 5B2FA 4JN6B 1U4OA 4KV9A 1Q74A 5IXSA 3FOFC 5DO9A 4HNAA 1WTCA 4RIHA 3H05A 3CRMA 3O4IA 3OF5A 1I80A 3RBXA 1WY7A 2BFEA 2DJIA 2C2XA 2FPUA 3TLBA 2EP7A 4G1BA 1Q7GA 2ZR9A 4GP7A 4JX8A 3TJRA 4KR6A 3CX8A 4QM7A 2XPCA 1N2BA 3FMPB 1T10A 4Q3EA 4QVKA 3TCNA 2I0FA 1M1NB 1Z28A 4D57A 3MJCA 1G17A 1X80A 3MJDA 3WWZA 4NRDA 2J67A 3S2UA 1B1AA 3TE6A 1D3AA 2UZ4A 1GPDG 4NZOA 1LLUA 1WULS 2V1UA 1ENYA 4AO6A 4BO7A 2R48A 4WWHA 1N5KA 1YFJA 1KHHA 3CPEA 4UFPA 2NT4A 4RABA 3SZOA 2IDMA 3WWYA 5IJ9B 1NL3A 4DMUB 1LBIA 3GQBB 2CJYA 4FB4A 4NLLA 5DJ5A 1Z63A 3QKSA 2X0EA 2QG4A 4OJQA 1R0BA 2KPOA 4N82A 3SC2A 9ABPA 1EM6A 5ILQA 1K8YB 3AJRA 2ILVA 3FB1A 4GZMA 3OPYB 4ZAFA 3JWJA 1O7JA 4C78A 2L2QA 3EXG1 4MDHA 2P9FA 3WO1A 3TBKA 2W0SA 3QPUA 5D51S 5EJ8A 3KQYA 4BZXA 2XMGA 2YWBA 2OXRA 1A5SB 4EB0A 4C7OB 4XFKA 2W6OA 1DI0A 1PP4A 1NQOA 3KZ1E 3RFUA 3SKVA 4AJNA 4DSZA 2O2CA 1HYQA 1JEAA 2NXJA 3ASYA 3QFCA 1V5EA 4HLCA 3I2JA 3PBKA 5UKDA 3ESDA 1T9BA 4YP1A 1M2OB 2GK3A 2PL3A 4NCIA 3BCRA 3WZLA 4AW9A 1RSZA 3JATB 5DNEA 2PQ2A 1U2SA 1VI2A 2YZMA 3I6YA 4IRXA 2X5JO 2YUIA 1KFBB 3KD3A 4E32A 4QT4A 2RC5A 3D3JA 5JSFA 5L53A 3O7MA 5KVVA 5JANA 2PO5A 3C48A 1H0HA 1P1IA 2FTKE 3ZU5A 1IBSA 2BLLA 1BROA 2EP5A 1TX4B 1K7FB 2AWOA 2Z8ZA 4LDZA 1FX0B 4MRVA 3OIDA 3I53A 5HJ5A 1BFKA 1F5SA 2QYSA 1KK1A 4I6JA 5BV2P 3THWA 1WOMA 3PDJA 2O3UA 2DB3A 1A1SA 1EE1A 1UFVA 2WSSD 4L16A 4PFJA 1XRSB 1L2TA 2CLFB 3Q72A 1W48A 4CLEA 5K0ZA 1U7DA 4ND1A 4AJIA 3I5UA 3P9CA 5FOUA 5KJFA 1NKVA 1TW2A 2QY9A 1YZUA 4LX8A 4TL6A 2M1ZA 2PMBA 4W7SA 2JBHA 1XRQA 1GUAA 3ND9A 3V34A 1VRWA 3G68A 4LNHA 2HPZA 3IAAA 4YRFA 2WVJA 3VNSA 3OQVA 4DG8A 3HXMA 4RK0A 2JGJA 1RC0A 2XVZA 1SIBE 3EGXA 3P8ZA 3JQ7A 1OE0A 2G72A 1F2TA 3UFBA 3KU1A 1MP0A 2HIAA 1JUDA 1QAMA 2OGUA 4XXHA 4KV7A 3AP2A 4BFSA 1Z4LA 1NXQA 2PUWA 4W8OA 4G5YA 4AXXA 5HKBA 4DT1A 1HY3A 3NEJA 5E3JA 3F8SA 1YRYE 2YZ2A 2D5AA 2RBGA 3TKAA 3BB1A 4L72A 1J2YA 3RE1A 3TXAA 1TQHA 1OB2A 2WD8A 4K9RA 5AXCA 5K3SA 3WQSB 1FTYA 4Z0NA 2FETA 4GU5A 5HRAA 2GERA 3DPUA 4CKXA 4LCJA 4RGBA 1Q19A 1XN1A 1TTPB 1S89A 4EQZA 2QQGA 4YJKA 1ZM2A 2R00C 3A10A 2I3AA 1G41A 2B92A 4Y9TA 1DV1A 3ZW8A 2NGRA 2P9BA 4C3UA 5LJIA 5LNK6 3IP8A 2ZRCA 3WLIA 1QJ4A 4JR0A 1GWNA 4TZTA 5ESRA 5HHTA 2H92A 4CKEB 2BMWA 2IYOA 2WTMA 2XKAA 2DUMA 1EUCB 3UGQA 1SZPA 1Z6YA 1N36B 4J0FA 5COAA 1UT5A 1UPCA 3OC6A 5CFRA 2PH3A 3GXBA 3IJPA 3MB8A 3RPEA 3WIDA 2Q5OA 3U6BA 2IHVA 3PNMA 4WAUA 1ST2A 5ETJA 1KQOA 2G1UA 4WN3A 4Y9UA 2VTDA 3KCNA 1R15A 1CJTC 4J75A 4P9NA 2CXPA 4Y98A 4LTDA 2GILA 1EEHA 4CQMB 3L41A 1JH8A 1VA5A 1B26A 2MSKA 1X74A 2WJVA 1EI9A 4GIBA 4OLFA 5KI6A 3WICA 4EJFA 4CRWB 4EMUA 3PV0A 4HOYA 4FP9A 2VJMB 2IF0A 4HH0A 2JFNA 1I1NA 4COOA 3TNFA 5IANA 1DDOA 2Q5CA 4ZZ3A 3IB3A 1YWGO 3B3QA 3HHPA 2IYUA 2VTBB 4CMIA 1C30A 1SUDA 1BE6A 1G3MA 2C03A 5F51A 2AQ8A 3IBGA 3M9XA 2A5GA 3ZQJA 3CVOA 3WA7A 5KIAA 5EG5A 3KOMA 4WOCA 3ZXSA 2CXRA 1RBYA 3VKWA 1IXZA 3ZNOA 2LRHA 4QU5A 3I2IA 1XZEA 1G21E 1X7ZB 3ZUGA 3KT3A 4UVEA 4MVJA 3QBVA 1YNOA 4EHIA 1X15A 3A58B 2FUCA 1PJZA 1XDZA 2REOA 3KSZO 3O4FA 4JQOA 1TQ2A 4MJ3A 4U7WA 1CEYA 2PL1A 3LGSA 4JV5B 3B6JA 3EDCA 2Q2VA 4JLOA 1A3CA 5AD1A 1X8LA 5GONF 4MIOA 5BW5A 4DLLA 3GGSA 3WLTA 1WXQA 3BZWA 4QO7A 5CEJA 1XL1A 2WIAA 3OZCA 5EMMA 2C92A 2F1KA 2ONYA 4FFMA 4G85A 2CV0A 3DWFA 2RK4A 2YXEA 4G24A 4YLYA 4CTJA 3PS9A 4CM4B 3P2EA 1CDDA 5AW4A 5CVDA 1FP6A 4B2PA 4L3OA 5E3IA 3VU1A 5JRZA 2I99A 1TYEB 4YJ2F 4OA5A 4RXMA 3T3IA 5CEFA 1H2YA 2PTGA 1OBOA 4Q9JA 2BEUB 2V6GA 3G2KA 3TW6A 1JQAA 2BEUA 3SU8A 2CLMB 2AZ4A 3NEYA 4M0KA 1TNDA 2G8LA 4FN4A 4NYJQ 3W6PA 5BWLA 4XSGA 4WBNF 2FWNA 4AG3A 2R85A 1Y1TA 4CETA 1IBRA 1BKSB 2BL4A 4MLDA 4R0VA 2A0XA 2CVOA 1C8BA 2HRBA 5HILA 1CJMA 1ZGBA 4IXTA 2NO6A 1QIEA 2ASVA 2ZRKA 1DLIA 2MMGA 3NNNA 5EZYB 4ACBA 3UIEA 4EHNA 4FWIB 3GH1A 1KJJA 3NBYC 4PGAA 4BCDA 1SQGA 4ZANA 2R8XA 4FHEA 3WK6A 3DO5A 3BOSA 2NUAB 1Q0ZA 1Z5GA 1DJMA 3SFZA 1PRYA 1T6XA 3GFBA 4KQIA 4AF7A 3N53A 3OX1A 3CZQA 1WCYA 1NBHA 5A9RA 5E3HA 4MAFA 3V8PA 2XGJA 4RA9B 1E2EA 1K7XB 4QXRA 4X91A 3AUJB 2H06A 2O07A 5CBKA 4YMGA 3KDAA 1YJQA 4AWBA 2NIPA 4UTPA 1QFSA 1FK8A 1HC7A 2JIBA 2ZR7A 5HE8A 5GV7A 1KEUA 4YWJA 4AMBA 5B2EA 1VL5A 3IILA 1PWHA 5CT6A 2GZ2A 4M54A 2IUUA 1T2EA 4JGBA 3UA3A 1OXSC 1TGVA 2IPAB 4JENA 1EBFA 3RTGA 2GZAA 5HM8A 2A5FA 3ZC3A 4KI0A 4OP1A 5L6MB 4NSNA 2WTAA 4GMDA 2AJCA 1HDYA 2QSUA 4ZZ0A 2CWWA 5CLGA 1JAXA 3G9UA 3X1DA 3CEHA 4ZOLB 5BORA 4LRQA 5ENVA 421PA 3RJMA 3U7GA 1OTXA 1Q0LA 2D2IA 3BEOA 1BE1A 4B5KA 5G0WA 3QSYA 2J33A 2C1ZA 5EKSA 1MB2A 3D8NA 5D00A 3AOEA 1Q83A 3QYFA 2IYSA 3SCZA 4BVJA 2EJUA 1C4WA 1NVDA 2O20A 4BO4A 2Z6VA 3HBLA 4IVQA 3V1YA 4I14A 1P4JA 2MDTA 3IDOA 3FW1A 4DNQA 4OHCA 3G7SA 1E32A 2AIRA 5A3SA 5KMGB 4B3GA 3C8DA 4CMIB 3OOYA 4CKBB 1AD2A 1N9ZA 2PFGA 1E1KA 3GG9A 1KVTA 1Z2EA 1ZIOA 2OC4A 4G0NA 3WA6A 1A9TA 3X43A 4BP9A 5K6TA 4AY3A 4KIUA 2X8JA 1EVYA 1YC2A 3PQ2A 4AKEA 3M49A 1A9YA 3HN7A 1XMVA 4GYJA 3C87A 3DFKA 3IBFA 3JQFA 4BNHA 1MTOA 4BMVA 5HBRA 3I0NA 4U7JA 1ZGAA 3EGOA 4U9IS 3DT8A 2ATVA 4D0NA 6REQA 4RMJA 1ZVJA 4JUCA 2P75A 1ORDA 3B1WA 2V55B 4JQYA 1KQPA 3LVQE 1QK5A 3DAHA 5DHPA 3JQAA 4HAOA 5KYKA 4OU4A 4G4SP 1RJEA 4ZALA 5L4SA 3C6QA 2ZRBA 2IHKA 2I1QA 1AN9A 3DMNA 1ISMA 1QNFA 3PFBA 3WWDA 2BDUA 3ILXA 4OB8A 2V7XA 3TRJA 1QIKA 2PMEA 2XCLA 1Q3HA 3ETHA 1A72A 1RLUA 3NHRA 1NXWA 1ZOOA 4NHOA 1A0OA 1ST3A 4NCJA 2AL7A 4EMTA 1LBEA 3CRZA 4AL4A 1CZUA 1R0CA 1YAHA 5HIKA 2DBYA 4MV1A 4YN3A 1IWOA 1O97C 2O6LA 2QZPA 5AVJA 3UJDA 4YAKA 2CYBA 3ER9A 3THYA 3VC3A 1GPAA 5BR8B 4IW3B 3IEUA 1ADBA 2WIJA 4O33A 3FHOA 3AHCA 4YLEA 4HRVA 4E12A 5AK0A 4FIZA 1WU8A 2PH5A 3WGQA 2CCJA 3OKCA 4UREA 1ZA2A 2GX6A 1Q0HA 5CA0B 2EL9A 4BVHA 1SA0A 3AINA 3LC1O 3E3MA 2P91A 4BECA 1ABBA 1L5RA 3EA0A 5DNAA 2ZR8A 3K9NA 2YY6A 2FN8A 2V45A 1OZ0A 1RKQA 4JP1A 3C7CB 5DLQC 3WMGA 3AVTA 4QJ3A 2H5IA 3BHIA 3PB3A 2JFPA 3KEQA 3IQXA 3H7AA 4EF5A 2AT1A 2G9NA 1U0BB 5LLSA 3T1HB 4LVCA 2J3DA 4QPDA 1RJ9A 7ABPA 1XN4A 1UDBA 3FNRA 4FCWA 4KR2A 4EW6A 2OECA 4YDHB 5A2GA 5HOEA 4P0PB 2IC5A 1IQPA 1V11B 3GZNA 3PK0A 3LIIA 1MX1A 1D1QA 4DWVA 3H4IA 4EL0A 3QA3E 1YXMA 2FRDA 3EQZA 3MM4A 2Q5HA 3JASB 4B2YA 1LBQA 3DUWA 4IFTA 1DKUA 5KDDA 3NTQA 2EP8A 3BH7A 2QXTA 4PY2A 2YRFA 3B82A 4L8LA 3NRJA 221PA 4RKQA 4F2WA 2WMNB 2JCSA 4G9BA 4BEWA 4N5LA 3ROQA 3S7ZA 3GIDA 2QPTA 2WM9B 3NPAA 1Z6ZA 4W5QA 1U1DA 1ZGJA 3QKSB 4LMAA 4KSCA 3PD7A 1U8FO 4TMZA 3LTEA 2JAWA 3SQDA 1YA6A 1EFRD 4X1IA 5ITSA 1JYEA 2HLDA 4F06A 4DB2A 5EYPB 1CS4C 1EE2A 3N0TA 2GM3A 1HE2A 1D9ZA 4J0EA 4YAIA 5LQRA 1IOLA 4CN9A 4TTIA 2QL5A 2NYUA 3X1XA 3ZK9A 1F2DA 1HI9A 4AJ1A 1E3WA 5K0FA 2HBYA 1SKQA 3DEKA 1I7PA 3EXHB 1T1JA 4FONA 1DZIA 3DONA 1VGQA 3GFOA 3ISJA 2ZE8A 4KQ6A 4KODA 4W99A 3RUEA 1QRSA 2PRYA 5HUHA 2EFGA 4JBYA 3N70A 4AROA 3AF0A 1REQA 2OB2A 4A8JB 3EA4A 3QP9A 1LQUA 3ZIUA 2O57A 1ORRA 4MQMA 3WZMA 3G9ZA 3C16C 2YFQA 3PVCA 1L3IA 3Q7RA 4GGPA 4A8JA 1L4GA 2FJUA 1R88A 4I55A 1N3YA 3GBSA 1IB0A 2VJMA 2DWUA 4LQCA 3KUDA 4XTRA 4OSPA 3WLRA 2PX4A 3O31A 5AESA 5F2EA 2LW7A 5T4EA 4UVIA 4ZZ1A 3TZCA 4OFBA 2IOFA 1XEWX 2CL6X 5G3YA 1QAOA 2Y71A 3W5DA 2GKGA 2PLNA 4FMPA 4QOHA 3RSSA 5DMHA 3VHQA 3ETDA 5E4YA 2B5OA 2VP5A 1FLNA 5A3JA 1AXRA 1XFDA 4HUJA 4JKIA 2AMJA 1N3IA 2EJTA 1IMJA 4HSEA 4B09A 2ZVPX 2ATXA 1TZCA 2I2BA 4MI1A 2HADA 1LDMA 1YBVA 3PNSA 2PR2A 2EEZA 2FFRA 4PCLA 4YTEA 2B83A 2JK0A 3W7AA 2HMTA 4RMGA 1MTZA 1N2XA 1RHRA 4PRKA 2IYEA 4RAQA 1VG9B 3FVQA 4Y2PA 5EXTA 2B36A 4R8LA 2J9GA 1EFPB 3B6ZA 5AMXA 2DU8A 5K3OA 4X62B 1LD3A 2PGOA 1QF9A 4BZZA 2OHOA 5DNCA 3HCFA 1Z38A 3NX4A 2R4QA 2FNAA 3I9V6 2KI5A 1YR7A 2JIDA 4Z4EA 4LRYA 2J0UB 1DZ3A 1R74A 1OFUX 4MUXA 4NV3A 3NDBB 1IK4A 1U3FA 1JHDA 1EP2B 3TTSA 1TB4A 5BV8A 1N2GA 2UXDB 1ULHA 2NTEA 4PAQA 4CT5A 1SCJA 2I80A 4KN6A 4FOOA 1NXTA 3V4OA 4BIIA 1BU8A 3OPYA 1K8QA 3ZHRA 5I9LA 1JMKC 4QZVA 2JFQA 2V4UA 1IHPA 1JDTA 2P3QA 4EBFA 3GW8A 1K06A 2CBGA 2AX3A 2NTJA 3BCHA 4FQ8A 5AVSA 5K7SA 1A04A 4IYRA 1FVFA 3NASA 3NHWA 2EFDB 5ELMA 4EPRA 4B3RB 2Y2UA 2FHSA 4KIWA 1U4SA 3VAYA 821PA 4Q7JB 2Q5QA 3KYIB 1W9MA 5H02A 4LGMA 3Q7QA 3VSAA 5EJEA 2YFKA 2DPMA 3LCUA 4HDKB 3A9UA 1U3DA 2FKNA 4PINA 5I7SA 1E3TA 2ZAYA 4R98A 3H99A 4KQKA 2PLRA 4RD2A 4UHBA 1WHSA 4M6WA 4D3FA 4PNEA 1YZLA 5CBPA 5H4GA 2QI9C 3DL7A 5T3UA 1ZMBA 2OCYC 2XCUA 5AW5A 5CYGA 1UM9B 2O1SA 2BGUA 2FMIA 1Z16A 3REFA 5HTOA 1I6MA 1KP3A 1JEJA 3WL6A 2NU8B 1JZTA 4WLOA 2NZJA 2IIBA 3TMAA 2B61A 3B6MA 3FZYA 1TUGA 4H18A 4R2JA 1E6WA 2SECE 1MNAA 2GB4A 5DN6A 4IIFA 2AOTA 1EFUA 4EABA 2P6OA 4KB5A 3JVUA 4M0UA 4PC3A 2XKJE 5T8KA 5TQVA 4ZV7A 2YJGA 1FYDA 1P4AA 4Z8XA 5A7HA 1AHHA 4QOEA 2L17A 4DM7A 4DREA 1K6IA 2EKLA 3OZSA 1J2TA 4JR1A 1SMKA 3MT9A 1UDXA 5ERYA 3R74A 5ICEA 3GG2A 2RGXA 1PJ8A 3RS9A 1M0SA 3EMVA 3C2QA 2OMEA 2OVFA 1ZZEA 1ABFA 2AJTA 2Z43A 4ZA2A 4DUYB 2FAXA 5CYFA 5JROA 1Y9JA 3GLGB 1G38A 4H1TA 3OQNA 4PG5A 3AUAA 1Z36A 1FY2A 1YZQA 2WKPA 4E94A 3NTLA 1FVXA 2JZCA 3I5YA 2HV9A 5CX4A 3WRXC 3MS2A 3ANNA 5LDGA 3W4IA 4CEJA 5ICCA 4NOMA 2TSYB 1VL8A 2ECPA 3L4BC 3OX2A 4MVYA 5C3UA 3RC2A 3SEFA 2B7CA 3WK5A 4BNYA 3KB8A 2WTXA 3T9EA 4ARAA 5FI3A 4PYQA 1UQRA 1FDTA 2PV7A 2QUZA 2CY0A 2NUTA 4QDJA 3TF5A 4U2CA 4HDMA 1PSWA 4MUBA 5CHEA 3ESZA 2J5XA 2YJZA 3DKRA 3MWFA 4ZCRA 2IH2A 4JX9A 2ST1A 4UCFA 1VCOA 3IIIA 3Q2IA 5LQNA 1KZ1A 4QYMA 3ZHZA 1IRXA 3QJGA 1C9DB 1DBPA 3C70A 4X1OA 1TYDE 2IHBA 3H1GA 2K2WA 2R84A 5C7IO 3DG9A 4BQFA 4YRSA 4MQFA 4TYPA 4MI6A 4NYIR 1YDWA 4B8ZA 2JJYA 3E9EA 1VZ2A 2WAYA 4X61A 3BFPA 3IO3A 3NWPA 4FDTA 4CM9A 3TLMA 1FFXB 1UZUA 4Z0TA 5K0TA 2P9QA 3DOFA 1KQGA 3HVHA 2X86A 1BXKA 3O94A 1JPVA 2HUPA 4M8SA 3CEAA 3IV9A 3FWHA 4H31A 1WCIA 1U8AA 3PLRA 4M0MA 5JS1A 4ECEA 3L8GA 3CS3A 3OZBA 3PNPA 4EA7A 2AE2A 2PXXA 1JR2A 1LV8A 1FFEA 2YMLA 3FGZA 2QD2A 5CX1A 3WIUA 1R00A 1NLMA 2R00A 3RBAA 4GLLA 2D13A 3N74A 2XMPA 4ZVRA 1Z82A 1SXJE 2FSHA 2VYCA 3FA2A 1YCDA 4R2WA 3T35A 5EUQB 2NUAA 4ZT6A 1OFGA 1PHPA 2VWPA 5K3AA 3WSVA 5AI9A 3F2IA 4TVBA 5EWJB 2QJWA 2N42A 1TEHA 5DSTA 2H9YA 5DLYA 5JT1A 2GYVA 3C97A 3O8NA 1IN8A 4YUWA 3HV2A 1NXOA 16PKA 1YD7A 5COBA 3U61B 3LDHA 5A7GA 2I6UA 4JOCA 4P33A 4JJEA 5FF9A 4DJ5X 1MB3A 2Q0QA 1W29A 2B8EA 1X7ZA 3FIJA 1YRQA 3SDZA 1KC1A 1ELOA 1NTRA 2R97A 2HLDD 3B9QA 3NHAA 4DA7A 3PX3A 4MR9A 3KWJA 4KX5A 5EIHA 3QX3A 1D7OA 4MB2A 3DVAB 3BMOB 3VU8A 3KELA 6LDHA 1WL8A 2WG1A 4D80A 1KMMA 1K7EB 1V26A 4BTLA 2HA7A 4II2A 2PS9A 1VJDA 2ZTLA 3FRHA 4OUKX 5F2NA 3L0ZA 5CCBA 3R7WA 1VLMA 2NUPA 3UC5A 4BATA 2NZ2A 2E4YA 1N5DA 4ETIA 2OHVA 2V6IA 2VHXA 2HW8A 1Y6JA 2VAXA 3DLTA 1K66A 3R2JA 4TXJA 3TLXA 3M8KA 3NTUA 3J7AC 1YR9A 3FZNA 1TMYA 1SJ9A 1T3GA 4LF7B 3IR7A 4U1RA 3UJ7A 3NW9A 5MHTA 1LSUA 2WC1A 4YJFB 4AYTA 3R3YA 4CFZA 4HDRA 2C07A 1DJQA 4R54A 3K9WA 5KTOA 3O3NB 3B12A 4LZZA 3F4BA 5THKA 3OETA 2V1XA 2Q3FA 4F6RA 1VYVA 3RUCA 1ESMA 2BMFA 2KBFA 1Q21A 2PX0A 1WETA 5KTYA 1I9GA 4ZCSA 1CUBA 5AVVA 1DG1G 3O8OB 1H93A 3A27A 5PGMA 2Y99A 1JILA 3P2OA 4KGXA 1G291 2X6TA 4FDVA 5KNBH 2GSWA 4CEIB 1C1HA 1MNQA 3L8FA 1S3FA 4YPVA 1M5RA 3W1VA 1XU7A 3BMXA 5L95A 1FLAA 3RFFA 1XCBA 3ICPA 3H1BA 5D1HA 1U0LA 3QBDA 2C7PA 4J7UA 4B3BA 1B76A 3UGJA 3PEEA 2FW1A 3TSOA 4GI7A 3FUXA 4X3CA 1O95C 2BGTA 4MUYA 2FQXA 2B4RO 4RDHA 1GCIA 5K6RA 4B7CA 4GICA 4LJYA 3KZOA 5DWQA 5KNDA 5I8WA 1N57A 3CLSC 1JHOA 2ONJA 4N0QA 1F48A 1W4CA 3A04A 4IJ6A 4M0CA 1LDEA 1HFWA 5EN4A 5FR2A 3SIWA 3WYBA 1ZR4A 2WUWE 4JC8A 1P5ZB 1RU3A 2HU8A 2XB9A 1XTSA 4ODIA 5JDCA 3EPHA 4JJFA 2ZJ7A 1O96B 4S1TA 4NK5A 4KYUA 2EKBA 1UAYA 1TXGA 2Y1OA 5ESXA 4RMHA 5DWDA 3B8HA 3PDUA 3PUXA 1L5VA 2PZMA 2O52A 2NLOA 3A26A 5DSZA 4JJ4A 1R50A 2Q3LA 2WB4A 4H4EA 4CR8A 4PLPA 4IH9A 3I01M 2VPIA 1E3QA 1IVNA 1GQYA 4DM4A 2OV1A 3ZWXA 3LHKA 1DTEA 2MU1A 4U5XA 5FV7A 1VKNA 3BXGA 5EQJB 5EIEA 2BTOA 2MJLA 4Q93A 4QHTA 3IAM6 1OBHA 4L4XA 1ZDMA 4ROTA 1OLXB 2B82A 3VC2A 2OZLB 2WPNA 3NHYA 1MJHA 3GAFA 4RE5A 4V24A 2E55A 1ZUWA 3H65A 3BXHA 1N2OA 4MYDA 5LZ2A 3D5EA 4G5RA 1KK0A 4IZIA 5ICSA 5F9HA 2JI8A 5ITZB 2EX1A 4BQOA 4UHDA 3EMDA 1KS9A 3H1TA 5B1SA 1QFZA 2BHLA 3IXMA 4KFUA 4Q19A 5DBEX 2I29A 4WOPA 3WY9A 3AR4A 3G82C 2UUAB 2GM9A 4Z8YA 4GVXA 3S0JA 4NTZA 4AP9A 2MSEB 4QTZA 2HK9A 1X39A 3Q7EA 3ZHXA 4C7OA 1Z3IX 2FRVA 3OAAD 3BE6A 1KH2A 3MCTA 2EF0A 1R0SA 4MPTA 2NPFA 5CFZA 5AKJA 3UAVA 3EZXA 1WB4A 3CZ5A 2YOHA 5AW3A 3K96A 1K0UA 2IIVA 2WJWA 4U9UA 3UWOA 2O7QA 5IT4A 4X92A 4EP1A 1EK1A 2I67A 4AF8A 2BGKA 2HF8A 2C04A 4EY8A 2O2EA 1T3ZA 1LCIA 1LLCA 5IBQA 3DDSA 3ZTTA 3TEMA 4FHDA 1I94B 2JCVA 1GL9B 4TLDA 2QQ0A 3FBWA 3JYOA 4MLZA 2JEZA 1Q0UA 5C8ZA 3FWPA 2Q3DA 2ZB8A 3H5WA 1AMNA 1SBIA 2ONZA 4NWIA 1SXGA 3AL2A 3IAXA 1XZCA 4DPKA 1L4BA 4WESB 3TQOA 2CFSA 2ZYSA 1W93A 2XZOA 2ZJBA 1XCLA 2FK8A 2ZBUA 3CQ9A 2J5BA 5L3SA 2C5LA 3Q7SA 3ZZMA 2C9DA 2D5CA 3B9BA 2OL4A 3T0IA 2PVPA 4EO9A 2CV2A 1Y7LA 1R4AA 3WLEA 2PMCA 5LL6P 3VDMA 4BGEA 2A0YA 1A77A 3QUBA 5KWJA 3H13A 4E14A 4KMSA 4RZXA 2VKTA 5IXJA 1IZYA 1U8ZA 3G9TA 4OBWA 2E5LB 4PSCA 1T5DX 4MWGA 3SSNA 3IR5A 1DL5A 4FNMA 4L57A 4TMFA 2ZRAA 3EGXB 3W7BA 2YV2A 3T7KA 1PWXA 2ODPA 3LW7A 5E9WA 4EKEA 1E2DA 4YP0A 5J40A 3ZD7A 3TMYA 1Z4JA 1T25A 2C3UA 3HACA 1NQVA 1E2KA 1W76A 3O73A 3TL2A 3KG2A 6ADHA 2YJTD 1GTG1 1N92A 2YH2A 4EENA 3K1ZA 5A6SA 2W2KA 1QG0A 4P3YA 3ZY5A 4NBWA 4US0R 3DBIA 3NAZA 1Z8FA 4LWZA 3KZNA 2I2DA 4KOEC 3MMSA 5TVGA 2FXVA 1W59A 4IR7A 2VQDA 1G8PA 3U5TA 3ICEA 4QPJC 1NHWA 1XFAA 3TH5A 3SM3A 5B36A 1UH5A 4UNIA 5IK2D 1XKTA 2WWWA 3MD9A 3CB2A 3CX3A 3FCXA 4TOIA 2PGLA 7MHTA 1CFJA 1RKVA 1HE8B 1TA0A 2FN3A 2ZJ2A 1OXVA 2JEOA 4E3WA 2R1TB 3EEBA 3H2GA 1IE3A 3C3DA 2BI8A 3I83A 4IIXA 2GEJA 3GZ4A 2DKFA 1H8HD 1C2TA 3WGLA 3EVBA 4AUNA 4IVRA 1G20A 4MYSA 3AZQA 4QYXA 5IVIA 1MA0A 4RQTA 3ZHQA 4F6RB 2I1WA 4OU5A 4IJUA 1NU6A 4BCBA 1NI5A 1OZAA 3D64A 3CLHA 1ZZGA 3ODPA 2F55A 2OWDA 1XDGA 3DMTC 2H1RA 1KSJA 1S7CA 2YJ4A 2IPMA 4TV8F 2C9ZA 3GUYA 4Z0HO 3R0IA 3B6EA 4YRJA 1AKYA 1KKMA 2AJLI 2V7QA 1SKAA 3NGLA 4WDRA 1ZH6A 3KTOA 4OLAA 2XUFA 4B7XA 4LFBB 2VHYA 2VJNA 3ITEA 2OUKA 3LM8A 4L6IA 4HXEB 3HE3A 1GG5A 3MTDA 3EULA 4XX0A 5D3MA 1RRGA 2DTDA 2C5EA 1EUDA 1XO1A 1QTNA 1NRWA 2C4NA 5SYAA 3EWNA 2GYWA 1X14A 2VRNA 2F9LA 2ORWA 1R5JA 4FX5A 4L4SA 3VKHA 5CDUA 1XXHA 4B3MB 3NNDA 3LDAA 2JJ1A 3DVAA 4X64B 4JJ8A 3IVGA 2IFTA 1PJLA 4IDHA 3ZGXA 2QB5A 3ZCVA 4FWTA 4QRDA 1OYOA 3ABIA 3OH8A 4UVHA 4A3SA 4A9AA 3F5FA 5EC8A 3AVXA 4IJWA 3GJZA 1J23A 1YRWA 2VQ3A 2QMOA 5EIWA 4PX5A 2PVCA 5KAPA 4WY8A 4LRWA 3WYAA 1RBMA 1NIPA 4N12A 3JU3A 1XVIA 2Y0PA 3NOQA 5LWQA 3OOEA 4EG1A 3F4LA 2P9ZA 5HM6A 1A8PA 4HLQB 3V97A 1FU7A 3KZXA 2JDIA 3JYHA 1SZCA 4Q4HB 3LUJA 3DV0A 4NG5A 2DRIA 1T9CA 4BFLA 4QBGB 2DYKA 4MA4A 1KMQA 3ZGVA 3IMKA 3MLEA 5D2CA 1GZVA 3CUSA 1D6SA 1JE1A 1YDHA 3Q3GE 3LOUA 4CLDA 5KNCH 3BIWA 2EW8A 4RE6A 1WO8A 1K68A 1JL3A 2Q99A 3D3NA 1T2DA 3QKRB 2G9UA 3I0ZA 4G0ZA 1BD4A 2YC4C 3P9ZA 3JQ8A 2FRDC 4K26A 4RPGA 4ZI5A 1K4MA 2R8EA 2FUEA 3WKDA 2WSSA 3BXEA 3F8TA 3T0GA 3PTAA 1YB4A 2ODAA 1GAQA 3K1YA 4FZJA 3Q8LA 5FNVB 1F06A 1K8XB 3DXXA 3BKWA 3LPCA 4MV4A 1AXEA 5JQGA 1O9GA 1U6KA 2MYNA 4ZHQF 1U1CA 3RK4A 2BZGA 3FN4A 3S2GA 2HC9A 5AM3A 1QQ7A 4V03A 1NFQA 1O2DA 3L7JA 3QVKA 5BQOA 2ZAGA 1PR4A 2GAIA 1B6GA 2EXXA 2X2OA 3O3OB 3ORSA 4FFPA 4XDGA 3E05A 3TD2A 4ZV4A 2HLPA 5TPZD 4HPWA 4XGNA 5DRTA 2XAAA 3HCDA 3LP8A 3PTZA 3TLCA 5DYYA 3UT0A 1D2CA 5DNDA 4KN8A 1ZINA 4S1WA 4RBNA 3C4QA 4EY7A 1QU3A 2IA5A 3I3SR 4LZAA 1V9SA 4YBRA 1VBFA 3W9YA 2I1VB 1G5RA 3E2PA 5AH0A 2DXIA 3RS4A 3E35A 1IDN1 3JQPA 3M4JA 3NTXA 4RF3A 1MHPA 2F3TA 2OORC 1DRWA 2OMKA 4LJRA 3KJXA 3ECSA 3AFOA 2LIVA 1F9EA 1KAMA 3TSAA 1C2YA 3WHPA 4MH0R 3FHLA 3CPSA 6GPBA 5C9ZA 1RKBA 4HZGA 1PJQA 3QIVA 2XHEA 1Q1ZA 2W4IA 5AM4A 2LTAA 2B7LA 3GJSA 1DIAA 1I3NA 2QUHA 4KRXA 3UBMA 4PIVA 1HO3A 4BPBA 1JWBB 1JSXA 3GRKA 2FHPA 2DQKA 3RUIA 3AC0A 5EVCA 4G86A 5IHXA 2PLFA 3SEAA 1ILWA 2Q3CA 4PFKA 1H9BA 4ZICA 5FUQA 5MF6A 4TKLA 2GOYA 2OHXA 1F4VA 3IEXA 2CF6A 1G6OA 1UWVA 1Q0TA 1YHZA 4MS1A 4E30A 3CLUC 4MS3B 5T8KC 2C58A 3MJRA 4MS1B 4KYVA 1SUCA 4MO9A 4P4LA 5BP7A 1E2FA 4MP3A 4R9RA 3PCRB 2A67A 4ZT3A 3ZNQA 2YHAA 4MWBA 3BTVA 3K1JA 4F8EA 4XVUA 2G6BA 5EZYF 3WTBA 4WDQA 1SAYA 2GBIA 1ANKA 1XZHA 2WHYA 3HVKA 2R7NA 4FR0A 3LW8A 2BFBA 1RYYA 3BJEA 3NJ8A 4YJ3B 1P6QA 2FWJA 5AVOA 2DM6A 3R23A 3MSXA 4MR7B 4ZODA 3S81A 1I4OA 1JPNA 2WOJA 2PT5A 3OIUA 1IY1A 4Q12A 1VIMA 1G9TA 4R8RA 1MABA 4K9PA 1USKA 1R6UA 4N1AA 1HQDA 1E3EA 1PO7A 1PZXA 5DI3A 3WL7A 4PVDA 2IXAA 5IZCA 3SNKA 1HNWB 3KX2A 4RPJA 5HFAA 1NJ5A 4BNVA 3GLIE 4DOMA 3PITA 3Q7TA 4PC1A 1CUZA 1CUUA 3HYCA 4P3OA 3OJWA 1AF7A 4O4HA 3GLHE 4CFSA 1WDMA 2GBPA 2O8FA 5EE9A 3LOPA 4WOJA 3AKYA 2B1GA 4HQOA 3WXMA 2BKAA 2WHPA 2J6CA 5B1DA 2XZDA 3PHJA 4EGAA 5FLKA 2QDKA 2AXNA 3MINA 3TZEA 3D0QA 1IM2A 1AGNA 3CJQA 4DXAA 3SKYA 2OV2A 4OD0A 1OZFA 2GXSA 4AJ4A 2XH8A 4A73A 3NR2A 1NVBA 3OMXA 3D6AA 3PDHA 5DCYA 1VBNA 2JARA 3ID6C 2BVNA 4QREA 5ALZA 4IH4A 1AH2A 1H5NA 1EQUA 4TKVA 4BNDB 5BNZA 1LBHA 4BRWA 1KAGA 1U80A 3A4YA 2WFZA 1YKGA 4GC9A 4K6KA 1JV2B 4JCOA 3R7BA 4QU8A 2ZE6A 4JXKA 4WFKA 3A11A 4DLWA 3IP5A 3CWCA 3U56A 4U9HS 4BJ6A 1N78A 2TMYA 3GT0A 3PPXA 3IQZA 2C9CA 2QU7A 3FGPA 3QX8A 3O8LA 4A2WA 1VJRA 3I30X 1UADA 4KUEA 1GL7A 4NNPA 5EPOA 3KJHA 3STVA 5E95A 1OXMA 5GP1A 4JI2B 2YYSA 3F1LA 1BH2A 5K8IA 2CJPA 1QRRA 3HYNA 4DRXB 3RAEC 1SC