1R3DA

Crystal structure of protein vc1974 from vibrio cholerae, pfam abhydrolase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
264
structure length
257
Chain Sequence
b'SLLSNQLHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPAEAVEMIEQTVQAHVTSEVPVILVGYSLGGRLIMHGLAQGAFSRLNLRGAIIEGGHFGLQENEEKAARWQHDQQWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQRQTLIAQRSANLGSSVAHMLLATSLAKQPYLLPALQALKLPIHYVCGEQDSKFQQLAESSGLSYSQVAQAGHNVHHEQPQAFAKIVQAMIHSIID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein VC1974
publication title Structural Genomics target NYSGRC-T920 related to A/B hydrolase fold.
rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
total genus 75
structure length 257
sequence length 264
ec nomenclature
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r3dA00
4BTLA 2ES4A 4HVTA 3KDAA 5ALOA 1HDEA 3WZMA 2GBGA 4FLFA 1PFQA 3T52A 4DMHA 4MQMA 1R50A 4UBJA 4BRZA 2JBWA 4K5QA 4QZVA 1R1DA 1JKMA 1VZ3A 2PVSA 3VJLA 3RM3A 2J3QA 4ZWNA 5IH7A 2EDAA 2VT6A 4QLOA 1GKLA 1R9NA 1UT6A 1ZD4A 4CG3A 1PV1A 2PSHA 4EY6A 3N2ZB 1TAHA 3B5EA 2BUBA 3BF8A 4H35A 2JGKA 2C5FA 4K6KA 1LNSA 1ACLA 2R8BA 4F0JA 2QM0A 3F67A 1SFRA 2JGMA 3ANTA 4K6GA 1WB5A 2OAGA 1YASA 3WK8A 4OB7A 2XUQA 1AMNA 4AZ0A 3WYNA 3RARA 5FOQA 1ZI9A 5D7BA 3DS8A 1IZ7A 2OCLA 3E4DA 3VXKA 1LPNA 5LZ4A 3Q0TA 4HS9A 5ALWA 2BKLA 1P0QA 1RWQA 5AHXA 4UPDA 3VKFA 3HI4A 2IITA 3DNMA 3RKSA 1H2WA 5LIPA 1X70A 4Q3LA 5JALA 1LLFA 4BP9A 1YSCA 3LP5A 4UBMA 4ARAA 1JJIA 1BEZA 3F8SA 4BTVA 5ALXA 4P93A 1CUAA 6YASA 1DQYA 1NU6A 3AZQA 3G0IA 3R40A 4C88A 3GUUA 2AJDA 2GYVA 2VF2A 1MNQA 3W04A 1B6GA 5IVKA 1U2EA 2HA6A 2WHPA 3CCBA 3BXPA 5CH5A 3QPDA 3STTA 1ODCA 5FLKA 1AX9A 5ALUA 5FKJA 1Z68A 3FCYA 3QMWA 3DQZA 2GYUA 4CI9A 4DNPA 3WYDA 2OCGA 3IULA 1R3DA 4DNFA 3ESDA 2HA7A 3VDXA 5A6VA 3QVMA 4CG2A 4PV7A 4IHAA 3JWEA 2HM7A 5ALQA 4J0CA 2JGEA 1CUCA 4X00A 4BE4A 1E5TA 4WFKA 2BFNA 2RGUA 4G5XA 5E4JA 1YS2X 1U65A 5FUMA 1BN6A 5AM3A 5IVHA 5AI8A 5LYYA 1EVEA 2CZQA 2DFPA 3O95A 5BWCA 2XMRA 3AIKA 2O7RA 1H22A 3VJKA 5AI5A 3QMMA 4G8BA 2XMSA 2PSFA 2QXUA 4LYEA 5DTIA 3D2BA 4CCYB 3IBTA 1CUBA 1XRLA 4ZGBA 3STWA 1DX6A 1XLUA 3I2IA 1BROA 1EDEA 3EQ7A 2QTBA 1FFCA 2HIHA 2I3DA 5AI9A 3I2FA 3FNBA 1EK1A 2QOEA 1OXMA 4GXNA 5AKIA 1JMYA 1ISPA 3YASA 3AZPA 4KYVA 3IUQA 4U2BA 4X71A 3M82A 4YX9A 1MO2A 1A8UA 3OM8A 2ZVDA 3W2TA 5ALEA 1QZ3A 1CUDA 4B82A 2XQFA 5AKYA 4PQEA 4KRYA 3LIIA 2HA0A 4X97A 1Q0RA 4Q34A 3VVMA 1P0PA 5LZ8A 5AI6A 1K5PA 4QDZA 4U2GA 1XZCA 1CUJA 2C4HA 4NMWA 4BZWA 1J2EA 2Y2VA 2G63A 1O6FA 3I6MA 4CIBA 4AB1A 4OSEA 1ZD2P 5HCUA 2I03A 1EDDA 1IZ8A 1WM1A 2WIJA 3D7RA 3E3AA 3FSGA 3IB3A 5AKEA 5C7YA 1ZI6A 4RNCA 1XRQA 1VXRA 3FYUA 1XZJA 2WLSA 3WK5A 2QT9A 1VZ2A 4H7JA 1LZKA 1U4NA 5AICA 2R11A 2O2GA 5HK9A 1A88A 1DT3A 1G4HA 3M81A 4C87A 4B7ZA 2QUAA 3R3WA 5ESRA 4W1SA 1GQSA 3BWXA 2XMZA 1WHSA 3D2AA 5EHXA 2ZYRA 2WU3A 1SCKA 1EINA 2H1IA 4KEAA 4KACA 5AKZA 1B41A 4G4GA 1XRRA 5JARA 2Y6VA 2WHQA 2XUIA 4U2CA 2Z8XA 5AM0A 4BAUA 1L7QA 2PU7A 4GLBA 3H2HA 1W1IA 2VSQA 2WM2A 4HXEB 4ZV7A 3P2MA 2ACKA 3WL6A 2ECFA 3DLTA 4AMYA 7YASA 2GBIA 2J4CA 2WFLB 5EHNA 1EHYA 5T4EA 3ZI7A 4U2FA 3JYHA 5YASA 5KWIA 3O4IA 4GHWA 2OXEA 3V1NA 1EVQA 4X6YA 2PUJA 3B3QA 1GGVA 3STXA 1LPBB 4BCBA 2HU5A 1GPNA 4DMFA 1MN6A 4QEKA 1AKNA 3I6YA 1G66A 3BJRA 2DHCA 1XZKA 3I2KA 4BC1A 1XRNA 4W1RA 3D3NA 1GT6A 1CUVA 3ANSA 4WY5A 5H3HA 1LPOA 4KE6A 5CURA 5AKKA 4ZREA 1OCEA 3G0CA 3H17A 1CQZA 5AK4A 3V1LA 3H0CA 5E4YA 1YAJA 1JFRA 1RYYA 3FYTA 4G9EA 1XKTA 3G9TA 1YB6A 4G9GA 3MUNA 2BGNA 3G9UA 4HXGA 4H7FA 3W06A 1EB8A 1MX9A 5FP0A 2QJWA 2JIDA 3SC2A 1ZD5A 2GZSA 3C6YA 3R3ZA 4K2AA 2RI6A 3BF7A 5HFNA 5T4FA 4FHZA 2QZPA 1AUOA 4Y7DA 4HRXA 1ZJ5A 4BVKA 1Y37A 1CUZA 3K2IA 1QIIA 1XZGA 1H23A 3A2LA 1UK9A 2VTVA 3HEAA 5D6OA 2V96A 2IIVA 3L1JA 4FLMA 5ISMA 1FSSA 1TCCA 4FTWA 4QDOA 3UUEA 3C6BA 3DJYA 2B61A 4ARBA 3ZLUA 2PUHA 3I28A 4B0OA 1LPSA 2GBFA 1LPAB 1QO7A 1UK8A 2K2QB 3G8YA 3PFCA 2VATA 2VJCA 3WK6A 2XMGA 1HBJA 1SCIA 4UBOA 2WILA 4QDXA 5A7FA 3CXUA 1QIHA 5HQ3A 2OCIA 4QNNA 4HTAA 3DOIA 2C58A 3WJ2A 4WY8A 3CN7A 3BE8A 1E8NA 1MAAA 4OCZA 5ALSA 3OURA 4KAAA 4BP8A 1DX4A 3C43A 3MGAA 5LZ9A 3EF3A 3WL5A 3H2IA 5HZGA 4PSDA 1J07A 3W9UA 3ZLVA 4RE6A 5KREA 4UUQA 5LZ5A 1P0IA 4XVCA 1YA4A 2QXTA 3F96A 5LKAA 2GYWA 1GZ7A 4UHBA 4BDTA 3PF9A 2WIDA 3FAKA 1HLGA 3ESAA 3WZLA 1YS1X 2HA5A 2YASA 4BVJA 4K6HA 3OTQA 1EX9A 3PUIA 2WU4A 4EBBA 4AN0A 1R4ZA 5ALDA 1VOTA 4MXDA 4EA6A 4INZA 3R3YA 5AI0A 2XLBA 3GBSA 3H04A 1A8QA 1CUWA 4FFWA 4BAZA 1W6RA 4FKBA 1H2XA 3WWOA 1USWA 4AO7A 5DWDA 4B80A 1RP1A 3RK4A 4P9NA 1ZIYA 4CG1A 1CVLA 3KSRA 4N5IX 3HABA 4G4JA 2WG2A 1MT3A 1YR2A 5AM1A 1IVYA 3I2JA 3C8HA 3IDAA 2PSJA 1D07A 4B83A 3AZOA 1K8QA 4KE9A 2OGTA 2WG1A 4QDTA 1MTZA 2XUJA 4KAJA 5EIEA 5A7HA 2RONA 3M83A 4RPCA 3F98A 1E3QA 1T2NA 3V1KA 3HLKA 2JEYA 3B12A 1XZHA 4IH1A 4ZI5A 4BAGA 3WK7A 2RAUA 3ESCA 4OUKX 5DNWA 2XUAA 4DYHA 3U1TA 1QE3A 4EZIA 1Q83A 5BWBA 1U8EA 3PI6A 3WWEA 2WSLA 2C5GA 4ITVA 4PSCA 1QTIA 3AINA 5ALMA 3H18A 1AGYA 2WHPB 2FX5A 2WHRA 2XUDA 5AO9A 3AIOA 3DYVA 2ZSIA 2OGZA 1QFSA 2EDCA 4FLEA 2XT0A 1AQLA 4H77A 4CCWA 2WIGA 4N8EA 5HFAA 5FXMA 4UHHA 2Y2UA 3ZLTA 1XLWA 2AJCA 2JGLA 5C8VA 1UK6A 1XZEA 3H2JA 4X95A 3FSGD 4J0HA 1CR6A 2VEOA 5AIAA 1CFJA 4GI1A 2D5LA 4RE5A 4X6XA 4TGLA 1QO9A 4JEIA 4H18A 2D0DA 4F21A 3K6KA 5JD4A 4YK7A 1MAHA 2BGRA 3O4HA 3DEAA 3IA2A 4PO3X 4B6GA 2XQJA 4MJ3A 4AN1A 1SCQA 2PSDA 2H7XA 4OU5A 3PE6A 4HXFB 5KBYA 3ILSA 2CJPA 4DIUA 1ACJA 1DWOA 1R88A 1JT2A 2V9ZA 4TPKA 2BUCA 3C8DA 2BUAA 2DCMA 3HACA 3PUHA 1UKBA 4X3CA 2PL5A 3ZV7A 4H7IA 4W9RA 3D59A 3E1GA 4AO6A 5AK6A 5BOVA 1MNAA 5DNUA 4H7HA 2WIKA 2OQIA 1WPRA 4A16A 2WTNA 3WI7A 5FV4A 3QITA 2AXEA 3AUKA 3A2NA 3NWOA 3T4UA 2H7YA 3BDVA 3FLEA 4Y2XA 1E66A 4I19A 4U2EA 1UOOA 3C5VA 4FDMA 2GBCA 2UZ0A 2CMFA 1CUUA 1BRTA 4Q1VA 1C4XA 2XDWA 4OD0A 5ALTA 4DNOA 4UHFA 4IH4A 2OAEA 4C6HA 3G0DA 1VXOA 2ACEA 3DYIA 4G4IA 4JUIA 3ED1A 3MVEA 3WKBA 4BC0A 5ALFA 4F60A 3FYUB 4C89A 4DSAA 1EXWA 3QMVA 4YASA 2CEKA 2ZYIA 5HF8A 4OB6A 3HJUA 4Y2SA 1MX5A 3F97A 5JAPA 5K3FB 4L72A 3NOXA 5HK8A 4M0FA 5AK3A 1NX9A 1QOZA 1VE7A 4DGQA 3HRHA 1TRHA 1N1MA 3O4GA 1DTEA 5LZ7A 1CUHA 3G9ZA 5AKLA 2ONCA 4WJLA 3A2MA 2YH2A 2Z8ZA 4Z49A 4JH0A 4LXHA 1WB6A 3C70A 5C81A 3C6ZA 5E4TA 1ZGCA 1M33A 4J0DA 5K3EA 5CT6A 5C8ZA 1IUPA 4ZV9A 5JADA 3HSSA 2GZRA 4U2DA 1TIBA 4I3FA 4FNMA 5SYNA 1VJ5A 3I1YA 1GKKA 4FFVA 4X94A 4QDUA 1W4LA 3UUFA 5K3BA 4MWTA 4KJXA 1MX1A 5JZSA 2WFMA 1XZAA 1Q84A 2CKMA 4PNZA 2DSNA 4WDRA 3VISA 3DOHA 2EEPA 5JYCA 1P0MA 2J4FA 5AP9A 2JF0A 4E46A 4EY7A 2XLCA 3H1AA 3DL4A 3GFFA 1BEEA 3ICVA 2PM8A 4B81A 3A70A 4KRXA 4A23A 1CV2A 1XRPA 2VA9A 5I8PA 4X91A 4B9AA 5FPQA 3C87A 4LKOA 4BYMA 4H7EA 5JASA 2DHEA 2IX9A 5K3DA 3SK0A 5ALZA 5AKXA 2CB9A 5JAHA 5FDFA 4Y2VA 4BVLA 1EK2A 4M0EA 2VT7A 1CRLA 1XZLA 2XQKA 1QIFA 2XMQA 2WUDA 3RLIA 3WJ1A 4P92A 1TK3A 2XMBA 1UFOA 2WFLA 2O2IA 1L7AA 5EI5A 4DLNA 5IKXA 3OG9A 4Y2JA 4AMZA 4WFJA 1QIMA 3O9VA 3WK9A 1CUSA 5HF6A 4M0MA 1CUGA 4X90A 1JU3A 4J0GA 2C7BA 1BS9A 5HKAA 3H2KA 1EI9A 4QWWA 3LCRA 4J03A 1SOMA 1ETHA 4FBMA 2PX6A 3NUZA 1DINA 1KU6A 3AJAA 3IURA 1JJBA 4CFSA 1UOPA 3UMJA 3WMRA 1CLEA 5CT4A 1G42A 4EHBA 4QA9A 2G5PA 3JW8A 3QYJA 1F0PA 4FNGA 1LPMA 3KWFA 4UBKA 3R3VA 2ORYA 5CTAA 5ALLA 4G8DA 4J0IA 1H2YA 4E15A 1MU0A 2HADA 2AJLI 3NGMA 4C01A 4OU4A 5HF9A 3G02A 3VJMA 3D0KA 1FFAA 4XWGA 3X3HA 2QRUA 4J3JA 1XQYA 5EHQA 3N0TA 4UFPA 4W1PA 1F0NA 3DCNA 1W76A 4B84A 1WHTA 4HAIA 5ALRA 5FRDA 2HU8A 4C4XA 1CUEA 5ALHA 2O7VA 3GELA 5HKBA 5DYYA 3L1HA 3FOBA 3EIOA 4OB8A 4OYLA 4H0CA 4Y2TA 4NVRA 3W05A 1DQZA 3A6ZA 3FWHA 3L1IA 3IUNA 2WTMA 5ALVA 5JD6A 4UBIA 3H2GA 4JNCA 4MEAA 1ORWA 4F5ZA 5ALNA 3FCXA 3H1BA 5AKGA 5AM4A 2JGIA 1ORVA 4C4YA 2XI4A 3G9XA 1S8OA 2PU5A 3DKKA 3WWDA 4AQDA 1CEXA 2ZSHA 1IUOA 1K6EA 1FFEA 5AM5A 3BL8A 5K3AA 1GXSA 5AIBA 2YYSA 3G0GA 1XRMA 2CUTA 4EUSA 4FWBA 2WQZA 2HRQA 1XZMA 5AKHA 4IQ4A 4PW0A 3TJMA 2OPHA 1UXOA 1UWCA 3I1IA 4XIIA 2WG0A 5JD5A 5F4ZA 3LIPA 1THTA 3DKRA 1ZGBA 2ZJ7A 5CXXA 5IVDA 3WWCA 1Q0ZA 3QPCA 3WA6A 2YXPX 4LXGA 1EB9A 3EBLA 4W1QA 2XUHA 1XQVA 2XQGA 1W75A 3HZOA 4AX4A 4BDSA 4E11A 5JAOA 1T4MA 3WL8A 2JGFA 1FFBA 5DNVA 2HU7A 3FVRA 2WKWA 3I2HA 2G5TA 5LLSA 5EFZA 2HA2A 2XUKA 5CT5A 1XZFA 1CIJA 1HPLA 1AC5A 1KEZA 4V2IA 2X5XA 4BRSA 1VLQA 4LHEA 1ZICA 1GQRA 2AJBA 3BDIA 5EIHA 1CUXA 5CT8A 3M3DA 3DL7A 2I78A 3OC0A 5KWJA 2DQYA 4J0KA 5CH3A 4GWLA 1AZWA 1O6GA 4KE8A 1HKHA 1YAHA 5DTJA 1Y7IA 3KXPA 2OQVA 5CW2A 3PF8A 1UKCA 4Y2PA 5D3KA 1YB7A 3O0DA 3KD2A 3GA7A 3U0VA 2VJDA 4QWMA 2XUFA 1BU8A 4IO0A 4UFNA 4L3WA 4HRYA 1QJ4A 5I7UA 2X8BA 1QONA 3E0XA 4G1FA 3PICA 5FPPA 1KU0A 3QBJA 4ROTA 2ZJFA 5A71A 1DWPA 2DQZA 2WUEA 2WJ3A 3I2GA 2WJ6A 5AOCA 1FJ2A 1EDBA 2XB6A 2Z3WA 3HXKA 3WIOA 2V98A 1LZLA 3WKCA 2O2HA 2OGSA 2QUBA 1UOQA 3STUA 1UKAA 3V1MA 5LKRA 4QE3A 4OYYA 1XROA 3CN9A 3FYUC 3C45A 2BCEA 3OOSA 4KE7A 2OCKA 2WIFA 2PPLA 3V48A 1VE6A 4B9EA 5K3CA 5JANA 4OPMA 1MPXA 2Z3ZA 1XQWA 2XQIA 3GROA 3EQ9A 4X6UA 3WKAA 3R3UA 4J0JA 2VAXA 5ALIA 4FOLA 3H19A 2RHWA 1AURA 2ZJ6A 5CBKA 2G4LA 5ALGA 2BJHA 3TEJA 1G5FA 3WKEA 1GPKA 5BV7A 5CT9A 4Q3KA 2ROQA 5CMLA 3G7NA 2XUOA 4GDMA 2WFZA 4IH9A 1E8DA 3FVTA 5ALPA 1OILA 5DLPA 4BE9A 1ZJ4A 2VJBA 3QH4A 1TQHA 1TCAA 3VVLA 4Q82A 4EB0A 1J06A 2Q0XA 1H2ZA 3DDUA 1EA5A 2V97A 4AO8A 1F8UA 2QS9A 4EY5A 3G0BA 1C7JA 3QZUA 4AXBA 2FUKA 5A62A 3F9CA 4CIAA 2Y6UA 1F6WA 2B20A 2B9VA 1CUYA 3Q8WA 1THGA 3O9MA 1TCBA 4WCVA 5A2GA 3LLCA 3BIXA 4N5HX 1A8SA 4YPVA 3I6ZA 4H7DA 4I4CA 1TKRA 2OG1A 3R0VA 4CCYA 4P08A 1DU4A 1QLWA 3R41A 1X2BA 5AOAA 2HFJA 1ZD3A 3WA7A 4ZXFA 2JEZA 2HFKA 3TGLA 2VQ6A 4LXIA 3W9BA 1LGYA 1L7RA 5A7GA 1SC9A 2VJAA 1HL7A 4DM7A 4JYMA 3FLBA 2W6CX 4X92A 1QIKA 5AJHA 4UHEA 1BE0A 3FLAA 2B4KA 3HYSA 4JYPA 3D2CA 1WB4A 4BCDA 1IMJA 5K5EA 4MYDA 1FFDA 4MWSA 1XQXA 3EQ8A 5JZBA 1BN7A 4AZ3A 1XKLA 4J7AA 1A7UA 1X2EA 5AM2A 4GBGA 2C0QA 4X85A 3SWWA 5AI4A 1DWQA 5JATA 5EGNA 4ETWA 5T4HA 1NU8A 5K3FA 2QMQA 1QFMA 4DSZA 5J3JA 1R9MA 3IUMA 1N8SA 3QPAA 4NS4A 3WWPA 1ZOIA 1VKHA 2QJRA 4QLAA 4Y2RA 1QIJA 4UHCA 4Q3OA 4TVKA 3STYA 3D4LA 4B0PA 1LBTA 3O4JA 5AOBA 5JIBA 4Y2QA 4XX1A 2E3JA 2Y1KA 5IVIA 1QGED 2HRRA 3C5WP 4UBNA 5D3ZA 4FBLA 1ZI8A 2PSEA 2HA3A 1UK7A 5JAUA 1LBSA 2RIPA 2QKYA 4W63A 1JU4A 4G8CA 1JMKC 2WUGA 2FJ0A 3WK4A 5JZ9A 5CXUA 2XMCA 3PFBA 3AFIA 2Z5GA 1W52X 4EY8A 3ZPXA 1XZDA 3WKDA 1ODTC 1I6WA 4DTCA 5LP1A 3HC7A 2QR5A 2PKYX 5ALKA 4DMKA 1ZIXA 1WOMA 4D9JA 2X76A 4KR0A 1K63A 3WLAA 4RGYA 4BZZA 5T4BA 3TRDA 4DNQA 2LIPA 2BAGA 3IVMA 4O08A 4XJVA 4KAFA 3OPMA 4L9AA 4LIPD 5AH0A 3WIBA 2XMDA 2ZYHA 4GW3A 4Y2UA 2DHDA 2XE4A 1QTRA 3QM1A 3D5EA 3GZJA 5HF5A 1XZBA 3DD5A 4FMPA 1WPXA 4B85A 4BCCA 4A5SA 1QIGA 4MYSA 1YA8A 1C7IA 2PBLA 3ZWQA 1LPPA 2HA4A 5DJ5A 3ICWA 2H7CA 3KWJA 2HHAA 3AILA 2XUPA 2QVBA 3FBWA 2H9YA 5HQ3B 1N5RA 3V9AA 1EH5A 3S2ZA 2WJ4A 5DYTA 4PSUA 3S8YA 4Y9SA 4X93A 5LZ2A 1XFDA 2C0PA 1GPLA 1DT5A 1CQWA 5DYWA 4WDQA 4ZRDA 1JI3A 1CPYA 4C4ZA 3AIMA 5EIAA 4LYDA 2HDWA 3WL7A 2VAVA 2P8SA 3BIWA 1UZAA 3STVA 4BATA 1BCRA 5E2IA 2ZYSA 5CRIA 5AK5A 1CUFA 2WUFA 2OLEA 5SYMA 3IIIA 4N8SA 3WQHA 1E8MA 1IUNA 3LS2A 2JGJA 5CH8A 1VA4A 3K9BA 1K4YA 4MQLA 2CBGA 1PJAA 2NW6A 5EHZA 1BCSA 1Y7HA 1VA5A 1QIDA 4N8DA 5ALJA 4EY4A 4WFIA 5ALYA 5AKJA 4NZZA 2W22A 3ESBA 3KOOA 5C8XA 4UHDA 1XLVA 2HL6A 2AJ8A 3R3XA 4DMCA 4H7KA 1ODSA 3SX4A 1QIEA 4Y2YA 1XZIA 4BB0A 1E89A 1J1IA 2RHTA 3MUOA 4X7BA 4PF1A 3IUJA 2XUGA 1WCYA 1YCDA 4S0XA 3PDCA 1JJFA 5I9IA 2J3DA 4L0CA 1MJ5A 2I3ZA 2FJPA 4Q05A 2DR0A 4BBZA 4MEBA 3C6XA 1N5MA 3CCCA 4GECA 1HQDA 4UBLA 1CUIA 4UFOA 4HZGA 4E14A 3BJMA 4GEGA
chains in the Genus database with same CATH superfamily
2CUZA 3OMWA 5DDIP 2HB6A 4GOMD 5JDCA 3BTOA 2RGWA 4V24A 3WVNA 2XKBA 4BTLA 1GPAA 1KAMA 5K8IA 4JXXA 1FLDA 4A0GA 1OIVA 1ESDA 3GJ0A 1HDEA 2AEEA 4D3XA 3UENA 4D0RA 2GBGA 3T3HA 4AS3A 3DDWA 2PY6A 4BFXA 1ZH0A 3HJRA 1AHHA 2DB3A 1FUIA 1DUIA 4HYQA 4UBJA 5M34A 4IIYA 2ZYVX 3IP6A 1ORTA 1KBQA 5C34B 4F85A 3RUCA 1KNXA 4DJEC 2ODNA 2F59A 3L77A 5AVVA 3LKVA 1AU9A 3VJLA 2P0YA 3SHFA 2EBUA 4RZIA 2NO4A 2XRMA 1H9CA 2J3QA 1PZHA 1Y3FE 4ZWNA 3ZK7A 3RYTC 4GICA 5LNK6 1PIWA 3OQIA 2EDAA 3R0IA 4FZ5A 3TLGB 3UO8B 4MRPA 1BAPA 1ECFA 2VVTA 2VT6A 1I3CA 5G1NA 2WP8J 3ZGZA 1KVTA 1T0BA 4ZJPA 4JB3A 1R9NA 2YUIA 3OPVA 3SGLA 1ZD4A 3KD3A 3B6IA 2PSHA 3NCHA 3ZDDA 5B6PA 1V1JA 2XXAA 1N5LA 1GPWB 1AH2A 2FETA 4K9DA 4EP1A 5AJXA 4M8KA 2LZ0A 1ODKA 2CLLB 3K9WA 2P78A 3D54D 2A30A 3FUTA 4PBSA 1JIKA 5AXAA 3O1JC 1U7OA 2GN1A 4KTTE 1KFJB 1EX6A 4OLBA 1ACLA 2QM7A 4LPSA 1WNTA 2O8FA 1M34E 4A2WA 1V26A 1YR9A 1W4ZA 2H3HA 3WGNA 4BVGA 1VKOA 3A9TA 4YMVA 4RGQA 1JEJA 4HJRA 3ND9A 5GONF 3OOHA 4PCUA 4K6GA 1RHKA 1B8OA 2OAGA 3VSDA 3VYUB 3U7GA 3RW9A 2Q49A 1ZR4A 2P9HA 3VR1A 4PX3A 5CBPA 2I7VA 2CVHA 1CF9A 4MUHA 4E09A 5BUZA 2XUQA 3M1LA 4J6EA 1YZQA 2SCUB 4KN6A 4OQNA 4R2JA 3N39C 3ONFA 4YQYA 4AZ0A 2G88A 4BLSA 4KK4A 3OJOA 4CYMA 1DC3A 5KOYA 4BJ3A 5A2QA 4YCLA 3AI3A 1G18A 1SCNE 3QHQA 1DJPA 4R8VA 1UWKA 5K1ZA 2Q6VA 2ZI7A 5DLQC 1N8NA 4EGJA 4U39A 5B7NA 3E4DA 1T9HA 2QG9A 2QM8A 4P7KA 1X7DA 3GJ7A 1SHUX 5ERXA 3VXKA 7GPBA 4HMPA 3HV0A 2I6QA 3V5NA 4ENPA 2R7KA 1P5ZB 4MDHA 5AHXA 2F1OA 1E60A 1F8GA 3KR0A 2XNCA 4G5SA 5CHYA 2IBSA 3HP4A 1T1GA 1N9ZA 1QQ5A 2EJWA 4N0QA 4UNRA 2AC2A 3II6X 4HNHA 2WWRA 2IITA 2FG5A 5EP1A 3CIFA 2WMYA 3VR4D 1H2WA 4AZTA 5LIPA 3ER6A 4MKHA 3T12A 4UTPA 4DCCA 1NBMA 2ZI9A 3GAFA 4Y0NA 2Y1DA 4JELA 4YROA 4CETA 5L45A 2ATIA 3GBPA 2AFVA 4BLPA 2X86A 3W3AA 4WTOA 1VYUA 2O7NA 4KH1A 4YV0A 1OI2A 4BP9A 3QVGA 4ND8A 5CNJA 4UW9A 2CHGA 3WRVA 1EG2A 3TIVA 3LP5A 2F9LA 1T3HA 1PO7A 1W9HA 3QXJA 4LRXA 4J7XA 4QELA 2WYHA 3KFVA 4O59O 4HNAB 2D5BA 3PUZA 4BTVA 1SEPA 2HRBA 3HWWA 2BDTA 1SGWA 4WLOA 2J0UA 3LHKA 4FI3F 5D3MA 1ZCAA 1GTVA 1FMTA 4ZZIA 3FDZB 4AMGA 3FY4A 4I5EA 4YDHB 3M4YA 3E03A 2O3QA 3DMRA 3G0IA 1LBEA 1OVGA 4R0NA 4DCTA 2XZPA 3UXYA 3ZE6A 1A5SB 1RPNA 3IIKA 4WZBA 3RUHA 5E8RA 5JQGF 4FQ7A 1NF9A 5EWJB 4RTKA 3LGXA 4DA9A 4NZNA 5EWMA 2ZSAA 1CJVC 4LI3X 3ZY5A 2R7LA 5CH5A 1XTJA 3QPDA 4J76A 4WOCA 1C1DA 3KTAA 1ODCA 5FLKA 5ALUA 5FLXA 4PXYA 2BSXA 2V54A 4D45A 2DPMA 2WHEA 5CB4B 3MMXA 3LCJA 3R6GA 4LZWA 3HY3A 3I61A 5B7PA 3DQZA 1QH8B 1YIDA 1XV5A 4QG7A 1G3IA 4RBNA 4W99A 4EG1A 2VHVA 4Y9DA 1GAJA 3HN6A 1ONBA 4IOJA 4FFBA 4EJSA 4OFXA 4DS3A 4U6SA 2BYTA 3IJEB 3MWDB 4A0FA 4JI2B 2A5YB 2UUOA 4OP1A 2OCGA 4I4TF 4QJ3A 3SDZA 4ZHQB 5E3IA 4DNFA 1QU2A 1U0TA 3ESDA 2HA7A 4YHHB 1BXZA 1QHFA 4X20B 1GEGA 4NP6A 4CCAA 1N2XA 1GA6A 1N9KA 3PYLA 4F8EA 1UXJA 3NNNA 3U4DA 2PEZA 3I9FA 2VUSA 4C0QC 1TMGE 4KVGA 2DMRA 3L0OA 4PLGA 1DRJA 2RGBA 1UPFA 3L8DA 5ALQA 1Y8RB 3TTXA 1Y6JA 4JYBA 2IPAB 3DTNA 4XAQA 3C4QA 4E1BA 1VSVA 5BYKA 5F9HA 2YW9A 1P4RA 1QKJA 1Y4SA 3CVUA 1PGQA 5H8WA 2Q5CA 4R7ZA 1H5NA 2W8BB 3G1UA 4LYYA 3H1GA 4UJ3A 4DR2B 4WFKA 4UC0A 3ROXA 1KK2A 2W2MA 4TMWA 2RGUA 4G5XA 1NMYA 1P1JA 1YOVA 1E7SA 4F38A 3CG0A 5KTSA 1UINA 1GY8A 4BVAA 1L7EA 1NUAA 3NR2A 2O54A 1YZ3A 4XGRA 4NCJA 1EVEA 4DLVA 1FSGA 1EYZA 1Z4KA 3NHPA 3ORHA 5SICE 2DJ5A 2EIHA 3EXFA 4ND6A 4QNMA 2RH5A 4ALIA 3U19A 4CL3A 1QCYA 3HRKA 4WBSA 3OQBA 4FD2A 2P3LA 4S0ZA 8OHMA 2XMRA 4XD7D 1PZNA 5LC1A 1H22A 4N49A 4O4IF 4DMUB 2XMSA 2PSFA 4XJSA 1CR1A 1A9SA 2EP8A 3NIWA 1PR5A 4YDRA 3CUKA 5K4AA 1Z62A 3VSEA 4BFLA 5FBVB 2DLCX 2VXOA 2NM0A 1G55A 4R9RA 4B7XA 3QX9A 4HDNA 4JSYA 3TZEA 5DLEA 2NVUA 3WYFA 5FNVF 4L8YA 4CTOA 3N6VA 1OYVA 4HYYA 3UB3A 4AJEA 1CUBA 2E49A 4LXQA 4ISCA 1NUSA 5BSGA 5J47A 3JRWA 5NLLA 5CA0F 1DC5A 4RAOA 3TM4A 1WY5A 3RHSA 1DX6A 3AX6A 2CYCA 3MGCA 2ISSD 5A05A 5EMMA 5BSMA 3P97A 1FSZA 1LJLA 1L4MA 4MW4A 3K1JA 3K1YA 3M9WA 4ZPJA 4YLYA 4RTQA 4DHEA 5AI9A 4WKGA 1O0BA 3GLIA 3I2FA 5B55A 2VHCA 4YJFA 2YN0A 2XBMA 3O91A 3OD1A 4CT0A 1DWUA 4GXNA 3LT0A 4CVNA 1VFPA 1RJ9B 3OKAA 4J43A 5EJAA 3WGLA 2C94A 3IUQA 2EV9A 2PN1A 3B9BA 4PAMA 4RHCA 4BV9A 1I01A 4YX9A 1IEXA 1BTOA 1MO2A 3ZWCA 2ZVDA 4CQJA 3IE0A 5ALEA 5TLSA 1ZH4A 2YXDA 4OQYA 4Z8XA 4KQFA 3B70A 5SZIA 2F7SA 2F90A 2XQFA 3B85A 1QHNA 1QB7A 2H4XA 2VDLB 4ZCPA 4WQMA 1C80A 3CPSA 4I8XA 3CF4A 2VT2A 4Y1EA 1EM6A 1DOAA 1ULSA 1HLPA 3LIIA 3KXDA 1UPUA 2AFHA 4KTVE 1FJXA 4X97A 1CCWA 2Q8NA 2W93A 3I05A 1CF4A 3ZZ1A 3GLVA 2JJ2D 1Z75A 3DDSA 4CQMB 2ZSKA 2N0SA 5LBIA 2NU9A 4LOAA 4M3NA 5B1IA 2CJYA 4ARBA 5MGBA 4TWBA 1NVGA 4N3NA 4YV2A 4W5HA 3L93A 3TE6A 4REOA 5DRYA 2DRIA 4GH5A 4C0XA 3K9FC 4TS1A 5I4KA 3IIMA 2BE9A 1RXUA 3ZE0B 3FFAA 1P6UA 2J5QA 4BZWA 1C4KA 4FCWA 4TXHA 5D01A 2A9JA 1BFDA 3JSXA 4ND5A 4QUDA 2Q41A 1HYGA 4ZU3A 5TQVA 3JS5A 3K7EA 3QG5A 5JS2A 2PJUA 4GI7A 4OSEA 3K4QA 3FF4A 2WJJA 3GGJA 2I03A 1QRAA 3E8XA 5FWDA 1BXRB 2VP3A 5HCUA 3TNYA 1IZ8A 1GYPA 1WM1A 3E3AA 3QVWA 5AKEA 4MQFA 3RSLA 5LL6P 2Q3CA 221PA 4KOAA 2J08A 1F8YA 3IQEA 2ZRAA 2W9XA 1UM8A 4F1WA 2F8TA 3KHUA 2ZZNA 2XB8A 3AKYA 5CM8B 3NJ4A 1NBEA 2AG8A 1XZJA 2FWMX 2QT9A 2GOYA 5LYJB 1T9BA 2JFYA 4C3OB 2HCJB 1F7VA 2UVQA 3HWX1 4Q4HA 4ZCMA 1C3VA 1VRVA 1KFKB 1FNCA 2O2GA 2GZDA 3IJRA 4TRJA 5KWEA 1N2CB 2KBEA 3IR5A 5AVYA 3PFNA 5DPMA 1MQ8B 2OHJA 3ZTYA 2O2DA 3K30A 4V1CA 1HYHA 1VJGA 3Q6IA 3DO5A 3KO8A 2M6LA 3DZCA 3MQ2A 1Q7GA 4RPJA 4O2RA 3LDFA 3ROEA 4RL6A 1GCAA 3U6KA 1NJ5A 3NKVA 3R3WA 2FR8C 721PA 2IGTA 2PS3A 2FRVA 3W8FA 2P77A 4M86A 4RDHA 3EA0A 4QOJA 4IHJB 4W1SA 3BWXA 4M0UA 5F64A 2AG6A 2XMZA 1WZEA 2BEVA 4S1OA 1BYUA 4X1IA 4QBKA 3DHYA 4LOLA 5HNKA 1JQLB 1EFKA 3BXFA 2NZUG 2XWJI 2ZYRA 2GEBA 1GLVA 3OZGA 3QEOA 4RLQA 3W1VA 5L3QB 2WU3A 1SCKA 2OCBA 4I6JA 3RG2A 5IZCC 4R7TA 4EQ6B 1GQYA 2RFLA 4J94A 2H57A 4CTMA 2H1IA 1GGEA 4TLBA 5AKZA 3IP9A 3IODA 3PG5A 4Y1FA 4BMDA 4TV9A 4DVGA 2P2ZA 1SD2A 2J9XB 1SN7A 1GL9B 1VBNA 2CCJA 1KR2A 2ZSEA 3VOAA 4DLAA 3LQYA 5JARA 3PQDA 3GJ5A 1BDBA 2CJWB 1T35A 2XUIA 1NXQA 3TLJA 5JLJA 2ZANA 2BR5A 1NXSA 3DCJA 3K5IA 3D1JA 1U6KA 1UMBA 3CZ4A 2ORVA 4R5MA 4WESA 5DGCA 3HCPA 5AM0A 4BAUA 3ZHCA 4KFCA 1VRCA 2FTKE 3H2HA 3VR5D 3OC6A 5KSOA 2P2DA 2DX7A 1NJ8A 4DRXA 1SKQA 3H7IA 4QG3A 4R1SA 2OUIA 3P2MA 1V43A 2HI0A 3H86A 4ZV7A 3U31A 4F91B 4KO8A 3WL6A 2FLWA 3JXEA 1KO4A 1W48A 4AJHA 2Y9PB 3M3HA 1C4WA 2VNIA 1V39A 2J4CA 2WFLB 4Q9KA 1EHYA 3BRWA 3UHAA 5T4EA 4ZVTA 1CETA 2ZUTA 3C6QA 2O06A 4U2FA 3T35A 5LM3A 1HE8B 1HMPA 1ZMXA 2II6A 3Q5EA 4C3ZA 4CM9A 4GHWA 5H02A 1M1UA 1I1NA 4XUGB 4E2XA 4E4TA 1SULA 1YL6A 2OXEA 3MSXA 2QWXA 3BIOA 2Z0MA 5TNXA 3V1NA 4B6OA 3EDMA 3AB3A 4KPFC 2W6ID 1E94E 4IIJF 4ZYXA 4CM3A 1G6KA 4QFBA 5SZKB 1LPBB 2HU5A 1GPNA 4BVBA 1I4TD 1TAUA 1MC4A 1WDWB 3A3KA 3GNTA 1SG0A 1AKNA 4IDDA 4MIKA 3TQIA 3OCZA 3PKIA 1GAWA 2Q6KA 5DHQA 4ESVA 2AOTB 1XZKA 4RIGA 4LVOA 4X41A 4YRTA 5K3OA 2D74A 1QR6A 2UU9B 1FYXA 4W1RA 3HB1A 1F14A 1RYZA 2FI1A 2WABA 3OZSA 1I6KA 1I3NA 2A1UB 1YCGA 2QVZX 1CUVA 3HL4A 3QF4A 3WJAA 5EUCA 1EDOA 1YR3A 5CURA 5KMGB 1ZVQA 3JVEA 1NLUA 5T57A 3VHQA 4DMRA 4FX5A 2ZQYA 1HT0A 4ZREA 3OLVA 4FILA 3VSAA 3G0CA 4P7FA 3H17A 1UQRA 2HWYA 4BGEA 4DV1B 5AK4A 3HXQA 2AMJA 4IXTA 2GK4A 1UJNA 3LLSA 1OWOA 2Y27A 3NDRA 5E4YA 1R7RA 4LRUA 3PRYA 1BU5A 3NDPA 4LGMA 1YUMA 4LOJA 4WV3A 2IEYA 1QMGA 3S2YA 1RYYA 2D2EA 4OJKA 2X7HA 4ZI7A 1H2HA 2CNOA 3O26A 1R5OA 4TKVA 1E2GA 2AF3C 5HBGA 3U5ZB 3A1NA 1SOVA 1EX1A 1P4GA 3MUNA 4G9GA 1ZNWA 2ORED 3FF1A 4URXR 3H2ZA 4X1KB 4HXGA 2HJ9A 2C3YA 2VHJA 1KJ9A 2QF7A 1EB8A 3V34A 2EG9A 1DDOA 2D1RA 3ZQKA 1FTSA 3RC8A 1E6EA 1HQCA 1K92A 1CDEA 1ZN8A 2PD3A 1ZD5A 3CH6A 2DTEA 3OZVA 1Y1TA 5E8JA 1YJQA 4B3JA 5B58C 3CUYA 1R0YA 3CG4A 4MV8A 5A04A 2HHCA 2HJGA 3QWFA 1COWA 4TZKA 1E1DA 2VPZA 1DOZA 2DQ4A 2OVBA 4N6NA 2UUCB 2MJLA 4R8RA 2ZB7A 3LRPA 2KM1A 2YN4A 4QBGB 5T4FA 1T15A 4NZPA 3MMNA 2JKYA 3NHFA 1PSDA 1P4AA 3OE1A 4HRXA 2GPNA 4OMDA 3QUBA 3DPIA 2P35A 4Q4AA 1DRUA 1T34A 2CB0A 2HSWA 1CUZA 4B6RA 2NNLD 2FPUA 3AESB 3H8JA 3L92A 5EJMA 4CUJA 2UXDB 3K2IA 2BSQA 1RAGA 4IGFA 1U80A 1ZK0A 3FUUA 5BWLA 1UODA 3DM9B 2IXBA 4Q3CA 1H23A 2H0AA 3QOFA 4HB2A 5KU1A 3IEVA 4ADSG 2RB5A 4W82A 4A26A 5E6SB 1UK9A 5KYGA 2O3JA 2H2DA 4NE9A 4ZYYA 2JA1A 3VA7A 2ZUCA 4QICA 4EZBA 1TTPB 2V96A 4DQDA 3Q9NA 2FUG1 3WGOA 2RHHA 1Y3IA 1NUUA 2GRAA 3BREA 3CINA 2W00A 3L1JA 3KKOA 3PC4A 4HDMA 2GX6A 5ES4B 3EDCA 4FB5A 5B1EA 3GLFB 1XAIA 4HQFA 5EAIA 3L5OA 3SQNA 4J1NA 2EX0A 3A14A 3Q12A 4FTWA 2WW8A 4GE3A 4QDOA 3H83A 4CR6A 1ZEJA 4DMLA 4X6LA 5JISA 3NJRA 1PLLA 3DJYA 4DKJA 3QG1A 4MQUA 4URZR 1GKUB 1BKYA 3F74A 2YC4C 1ULBA 2QB5A 2RJOA 3KQMA 3E5NA 4KUHA 4ZANA 3ZLUA 4Z1MD 2PUHA 1P2GA 3KB8A 1TKCA 1UZLA 2CXOA 1Z0FA 3CLHA 4G2NA 1LPSA 4FJ0A 2PR2A 1PTJA 3QUSA 1DL5A 2GH1A 4N3AA 1N2IA 2NPIA 3DFZA 3MJRA 1AKYA 3P52A 4AUNA 4EX6A 1F2UB 3F9RA 1O8CA 3CC8A 2ZOSA 4KYIB 4XGQA 2QI9C 2QROA 1WSBA 3R3JA 3ZHQA 4NENA 4JQZA 3WHLA 1CZNA 3AEUB 4G1MB 4XCXA 1TU3A 3EGXA 3WK6A 1WR8A 4UBOA 3GG9A 1EE2A 2V3WA 3L7IA 2DY0A 4LDRA 1W4BA 4QGFA 5DNEA 4G0ZA 2AVNA 2EWVA 2LCIA 1YUNA 2GAIA 1GVHA 1H3FA 5IWAB 1SCAA 4M8NE 3K70C 1KPGA 1XDBA 5IZCA 1YACA 1YJ8A 5FQOA 1DUVG 3AF4A 1RM5A 5H80A 4B2LA 1UC5B 5BY2A 1AO0A 4TZ6A 2OCIA 1IN6A 2QG6A 4IV0A 2QTCA 3BQNB 2CUNA 1Q14A 4HTAA 3ICQB 3ZGOA 1GG8A 2GEUA 2YXNA 4Q1AA 3QP9A 4Y6SA 1U2RA 2JK1A 1XD8A 2D1QA 3BD7A 3ENKA 4GKBA 4FMBB 2BM0A 4IINA 4RF4A 1D6MA 4DIBA 3C6KA 4JI1B 1E1MA 1E8NA 2B7LA 3RUPA 3T9DA 2D5IA 3DMNA 3H97A 5IJ0B 1TNDA 3KL2A 2DPHA 5CLHA 1OB2A 3R9WA 1DX4A 1YVRA 3C43A 4GPAA 3W6OA 2Y66A 4CN9A 4UDXX 3UKDA 2PJZA 4FCTA 4Q4DA 3JAMA 4RH3A 3FNRA 4JGGA 1G6Q1 1B73A 3U9LA 3H2IA 4WZAA 5HZGA 4P80A 4CN8A 3X1YA 2PSSA 4PN7A 1VPTA 5TS3A 4GQAA 3U80A 1JPNA 4OFBA 3AOEC 4KX3A 2JIPA 3STHA 3CZRA 3GUZA 4BIMA 1CU1A 1P1CA 1SY7A 2Q5JA 2C4NA 2D8AA 4GUAA 2A9PA 4M1OA 1CVIA 4IJUA 1P0IA 3RS5A 1O97D 1PR2A 2CDNA 3FI9A 1GL6A 2F2TA 1M0EA 2P3OA 4V3CA 4Z9FA 1QNLA 3U9SA 3ZUGA 3ZWBA 4MYUA 5LKAA 4DIEA 2CBZA 3GCXA 2R48A 3CLRD 1T2AA 1W47A 1EIZA 1A77A 3O03A 3I72A 3Q7TA 1O57A 2A9QA 4J3FA 4RELA 5BN1A 5EKSA 5KWSA 4DDUA 2WYWA 3EEBA 1GZ7A 1U3CA 3M6VA 4JKIA 4UHBA 4YJ3B 4GDFA 4GGPA 5LQCA 4LYFA 3PF9A 5EUQB 3WZ2A 5CFRA 1CWUA 2ATEA 3KQSA 3MCUA 2A9RA 1HLGA 3C3AA 3ESAA 2O2SA 3IAM6 1W19A 4MB2A 2DT8A 4A4DA 5HKKA 1E18A 2QUKA 3BK7A 2OMKA 2HA5A 4NMMA 1YL7A 2CFSA 4HDKB 2C7GA 5FJJA 2JFNA 3OTQA 2FPGA 2VJYA 4BJ6A 1LWNA 3DFMA 2WU4A 2PO5A 4N0EA 4CZ2A 1AKRA 2QBYB 1UAGA 2H06A 5KJ1A 4EYQA 1YQEA 1R4ZA 3DPUA 4DYDA 3HL0A 2P65A 3F1KA 1C9YA 4MXDA 3H5VA 2YY5A 4INZA 4K2HA 4KNVA 1FBNA 1DRVA 1NRJB 3BZWA 3KYCA 1MJGM 1KIFA 4NBWA 5AI0A 1Y80A 3VO1A 4BV3A 2PGOA 1ZIPA 1CUWA 4FFWA 5FHRA 1JJVA 4BAZA 4NY1A 4U4AA 1W6RA 3SS9X 1L7MA 3JWGA 3N2LA 5JAIA 3ZV6A 1H2EA 3FGOA 4COKA 1H2XA 3RU3A 3N8GA 4D2IA 1J2YA 2YV5A 1A7KA 3VR6D 5JMTA 1C0EA 2UXCB 1R6AA 5BMVB 1U8ZA 5FADA 1YFZA 3EPPA 2J3MA 3IQXA 3BXHA 3LUGA 3T4PA 1KDOA 1W25A 4I9GA 1RQXA 2QPTA 2R8RA 1R6XA 5KNCD 4NS1A 3T9CA 2A58A 2NT4A 4YMUA 4E7OA 2GSDA 2CLIB 4JBIA 4EUHA 4G4JA 2I2XB 1B8UA 4PLFA 2IEDA 2PLWA 3BHJA 1MT3A 3KLOA 2PLAA 1YR2A 3IUPA 2W90A 3LDGA 4RY0A 2YFQA 2UYGA 5JVDB 4EGQA 2AIRA 2NQ2C 1D1QA 3VZCA 4A82A 1Z7GA 1M83A 4GPBA 2PSJA 2XADA 4ZT6A 1E3LA 3UJ7A 4IF4A 1G2IA 2QZZA 1R0SA 2HQ1A 3LUAA 5EPUA 2ZPUA 3N3AC 3AZOA 4K6CA 3JARB 3MCWA 4KDRA 3SM9A 4TRMA 3IH5A 2WG1A 1GUZA 1MC8A 1MTZA 3D7MA 3IMGA 3DVRX 4Q5IA 1G17A 5CUQA 1EVJA 4C0HA 1KPHA 1KTIA 4W5QA 4ZEXA 1IXKA 1TJPB 3M83A 1TIKA 2DC1A 3B3GA 4WGGA 4RPCA 1AS0A 4JDUA 2IELA 2XECA 4HYTA 5BRNA 2XZTA 4BO2A 5TGDA 3Q8MA 3AV3A 4BKRA 1E7QA 2GCOA 4B46A 4MIOA 2JEYA 3B12A 2ANBA 2V7TA 3QFRA 3CUUA 4Q1CA 2GM9A 4R68A 5DULA 1UL1X 5I7VA 2Y77A 3IR6A 4ZI5A 3ZGNA 1YVPA 3WWPA 4PNEA 4CU5A 3AR9A 1Q1ZA 2PBFA 1S89A 3ICCA 4KIGA 1D4OA 5DNWA 3UMMA 1QYCA 1UMCA 1NC3A 2AHRA 3QU9A 4KIWA 3RDPA 4D8WA 1L1FA 2VYFA 4YUXA 3EAGA 4B45A 3U1TA 3OM1A 5IABA 1QE3A 2WWYA 4Q7MB 2WUVA 1E1NA 3O8DA 2WICA 2C9ZA 3E27A 3NXKA 3HB4X 3UAVA 5BWBA 5I47A 1U8EA 3PI6A 5LP6A 2P9CA 3OZFA 2WSLA 5L3RA 2I3BA 1GUAA 3WXMA 1DOHA 2GD6A 8ATCA 3KSBC 4BGIA 2GPTA 3AINA 2FSGA 5ALMA 4NV3A 3UFXA 1D04A 1ZUWA 2WHPB 3LG2A 5AO9A 4CLOB 4ENUA 2BV3A 4R51A 4L78A 5JCOA 4JJ7A 2ZYDA 1AS3A 4NCIA 3DYVA 3EFOB 3OX3A 1YZKA 2EDCA 3SJAA 4DLRA 1KJQA 5K0JA 2YWFA 5DK4A 2NWQA 3FN4A 2NO7A 4QL3A 3OZWA 1RACA 3EXEB 4MEJA 1W85B 5BPHA 4EY3A 1FW6A 3NHMA 2GXSA 2WIGA 3ZHVA 5IWCA 4N8EA 1E3SA 2WF7A 5FXMA 1Y1KE 5K03A 1M7BA 4O4HF 4OBEA 2WY2D 4AY6A 3L6RA 3P0EA 3HP1A 4GO1A 5DBOA 1KZHA 2AEJA 1DQRA 2ZIUB 3B13B 2JJYA 4XGNA 2HCFA 1EBBA 3ZLTA 4J91A 2HD4A 2CL0X 4D57A 1U8AA 1AZLA 4NJOA 1Y7PA 2AJCA 7REQB 5JPDA 1QC5A 2GA9A 4ACBA 2RGYA 2QTAA 1ZH8A 4JCOA 3FSGD 2P6MA 3NTXA 5DCUA 5GIOE 3THYA 4JXZA 1Y6FA 3IX7A 4MV1A 2AE2A 4JZYA 3DONA 2QGNA 1DP4A 5AWFC 4P4GA 2XTNA 5JJLA 2ZTMA 3TZLA 4RE5A 1M5UA 4KJZA 5J2TA 4A15A 2GXAA 4JEIA 1K8RA 3FOEC 2DVMA 4ML3A 2FEPA 3ZZMA 5K09A 4F21A 4N48A 1R6TA 6NULA 5JD4A 4K6OA 4YK7A 3OQ6A 4YC7A 5TJ9A 1M1YB 3VZDA 4BLTA 1FVHA 1KKUA 1U0OC 1Z9BA 4HH3C 4OK3A 4BFTA 1U8YA 3HR8A 2FZKA 3V8PA 1SCQA 1JHQA 3R3HA 3IUBA 1UFRA 3OPYI 1V8DA 2ZEJA 1GRVA 1P17A 1Q6ZA 2JAHA 2Q6OA 3EYWA 3P2YA 4HXFB 5HIAA 3TNDA 1X7YA 1CEYA 4GU5A 1WDKA 3ZWPA 3U26A 3ILSA 4FWTA 3FPSA 4AG6A 1Z74A 1ACJA 3QXCA 2C2XA 2E21A 3P4YA 1DRWA 1T24A 2H07A 2JHFA 3AM5A 4LA4A 3RFTA 3CJQA 4A5OA 3EEFA 4X7MA 3HVIA 5C4IA 4DLTA 2QSJA 1WDMA 3WQRA 3BYZA 4NABA 3WBKA 2V9ZA 3OZCA 3EC7A 3AJEA 2BCGY 2C7QA 2OXTA 3FYCA 1VIAA 2BUCA 3LM8A 5CLGA 2BUAA 3FUWA 3R8XA 3RFVA 4DUGA 1LA2A 2EFHB 8ABPA 2Q0QA 1H6CA 5THXA 1TJ4A 4JUFA 3OUZA 4J3NA 3B5IA 2O7QA 2JFOA 3HCAA 3TW8A 4K0RA 1X6VA 4TTVA 3UHJA 4X20A 2ZE5A 5T3UA 3V2IA 1EFRD 1FQOA 2NX2A 2V0NA 4EFNA 1ZK4A 4DIMA 1VJDA 2CNDA 2CF6A 1YQXA 3F3KA 3D59A 2FMIA 2NTNA 3L7JA 2ZPTX 5TPZA 1HZZA 2ZYAA 3OPNA 3S2SA 4P1ZA 4D4LA 2CSUA 2NU7B 2C5LA 4TOIA 2VZ8A 1F51E 4UOEA 3OBBA 3L6CA 4GYWA 3SJBA 2BBSA 3C1TA 4G1VA 5FLEX 2OR3A 1ZOLA 3R4VA 3ISTA 1I24A 1WPRA 2YJ4A 2QT0A 3FKSD 3AVPA 8AT1A 4AYWA 1HV8A 4KRGA 1FLNA 3UMBA 3MF4A 2F1HA 1VHWA 3PQFA 1M1NA 2QP9X 2Q6TA 4M9XA 3RC9A 1ZSNA 2XD9A 1DNPA 3DAPA 3F5FA 4V39A 5AJWA 5JS8A 1E1QA 3SDSA 1N7HA 1DFHA 2AXEA 2BE7A 3AUKA 3INGA 1QDEA 2NU8B 5AW6A 3A2NA 3L6DA 2HSGA 4IILA 3T4UA 4UZSA 2AOWA 4UTRA 4Y2XA 1AO3A 1LI5A 3LA8A 1SBZA 3BGDA 3HLTA 4D9FA 3WAJA 1JEAA 2J41A 1HEIA 3TQQA 1B14A 4X8MA 4MP8A 3RSGA 4ZD6A 2GBCA 1BSVA 1A7AA 2P3QA 1ZBQA 4M9UA 3MCZA 1SBQA 2CFIA 3V80A 1YDMA 3VNBA 2CMFA 2JAXA 3C8ZA 1T5DX 4LC9A 4QD3A 1QYIA 5EZSA 1MHPA 1CUUA 3DZFA 3AONB 3NVMB 3JQGB 4Q1VA 1X42A 4IDCA 1FA9A 4E7PA 1QGUB 2P7IA 4IR7A 1VBMA 3VYRB 1MIHA 3PEFA 2WHYA 4PZ0A 4CF4A 5GZ3A 1EVLA 3G0DA 2BGWA 2RSLA 4PY2A 1NR7A 2NIPA 2P0EA 3NTRA 1AZSC 2LGJA 2QD2A 3PZBA 1N77A 3GP3A 4L5IA 1NPTO 2JAQA 5JXGA 1P31A 5IAEA 3IPAA 4C89A 5EQTA 3PB3A 2FPRA 2QTFA 1GZ6A 1ES9A 1SBCA 3CSSA 1Q0UA 3CUSA 3NONA 3QXGA 4XDGA 5KOJA 2J4DA 3H9BA 4K9KA 3PNOA 4EITA 4YR9A 1AA6A 3DJFA 1DAKA 3MTBA 5FUYA 4B8ZA 2ZYIA 2C2MA 5HF8A 2R6GA 2V8BA 1DBIA 1FTQA 1RQRA 2YMLA 3PCRB 3QEMA 4L72A 3JY6A 2REBA 2RK3A 1VGQA 3NOXA 1N3YA 1M2HA 2BTQB 1JVBA 2JAUA 4RCVA 1H85A 4M0FA 4YP7A 3PE4A 3PI7A 2PA3A 1B8VA 1NX9A 2JHPA 3B9PA 2Q7OE 3RNOA 5CDTA 1SOAA 3KTFA 1JQBA 3OQNA 1JWBB 3G2KA 3T3NA 3DAYA 1QV9A 5JY6A 2Q3MA 5L4NA 2Z6AA 2G07A 4A36A 1SVWA 1Z6GA 1OA1A 4NDAA 1OZAA 4G0YA 3UK2A 2FLKA 3Q7SA 4D8YA 4ESOA 4H1VA 5LZ7A 3PXAA 1VG1A 2DH5A 3G9ZA 3MOSA 3QE3A 4FOPA 5AKLA 1IK6A 1PZXA 1YGYA 3ZQJA 4WJLA 1X7ZB 4QT0A 2YMQA 2UKDA 3BH6A 3U6BA 4YP5A 1HDCA 3Q9LA 3GRYA 4W8HA 4LXHA 3PITA 4AJNA 4P4SB 4C08A 3C8MA 4L2IB 4ZQFA 3SY8A 1I0ZA 2OO3A 4FFSA 1PVOA 3A9WA 4DHWA 3RJMA 1JA1A 1FK8A 4OATA 3BMOB 3WYBA 2IYSA 4DA4A 4KRFA 1QF6A 1FFHA 1ZGCA 1KFBB 2X1LA 4ISBA 4JI5B 1SRRA 4J0DA 5D3QA 3QLEA 3KLPX 4LJLA 4PSVA 5EUBA 4GE0A 2ZWPA 4Z3OA 5K3EA 3ADDA 4GOXA 3IJPA 1E3EA 3K0KA 3L0CA 3LAWA 3P9CA 3PLNA 3R4CA 1WU7A 2GZRA 4FYKA 4OQDA 1K3UB 4U2DA 3AJ9A 4KOEC 4DBVO 3PPWA 4NDNE 4UVEA 3CWQA 4HQOA 2R9VA 4FC6A 1TX4B 2I2FA 4I3FA 4PZYA 5EL0A 4O4JB 5C52B 2HGZA 2QGFA 3I1YA 3FMPB 2OAP1 2WA2A 3U4MA 1E3WB 1X9IA 1JHAA 2VP9A 3CNEA 4FFVA 2AKEA 5BSKA 5DM70 4B32A 3GOQA 5K9ZA 3NJ8A 2OHIA 1MX1A 4WZ6A 5IKMA 2RHRA 2VHEA 1AKQA 3AU8A 2PNJA 3ANYB 2P2YA 2WFMA 4OLHA 1Q84A 3SBEA 1RQ7A 3R9XB 4WDRA 3VISA 3DOHA 4Q3AA 3WLIA 4U7JA 5I7WA 3HTXA 4JJEA 2XA9A 3GT0A 3JQ7B 3K1ZA 3LKDA 4UTOA 5AP9A 4W5TA 3FGPA 1EGMB 3TZCA 3D8SA 2G0AA 4EY7A 2IJGX 3A6PC 1CJMA 3ZKAA 2WKPA 2AOXA 1BEEA 3ICVA 5THKA 2IUYA 1MFPA 4XOIA 5C5DA 1X74A 3G8DA 1O77A 3A70A 3FZQA 2OHFA 3EZ7A 4IJQA 2GF0A 4A23A 4D5GA 4LSWA 2EBFX 1K7EB 1KK0A 3MWKA 4JLJA 4MA0A 1AF4A 1ICIA 3BKXA 3GX1A 2E4WA 4HNRA 4IJWA 4NBVA 4XCVA 5TY0A 4MS3A 1GNSA 2LUOA 4TM8A 2F1IA 4W5NA 4MINA 4Z2AA 1XL1A 2YHUA 5FPQA 1ENYA 1L8OA 3ZXUB 2Y1EA 4LECA 1UP4A 1BX1A 1FSFA 2Y0PA 1EM8A 1T9ZA 2JANA 3N3BC 2AW5A 4GSYA 2QTRA 1Y33E 3GGPA 4H7EA 4HGZA 4MW2A 4ZAGA 4EG0A 2DHEA 3QV2A 2XNKA 4XJXA 3T6KA 2J8ZA 4RMGA 5K3DA 3KTOA 4MITA 3E7DA 3F4KA 1GL3A 5ALZA 3CZPA 5AKXA 5KYYB 3I5YA 2XWSA 2CB9A 4LF8B 1JG1A 3GV0A 4EHAA 1RTTA 2VDRB 4P98A 4MRSA 2FPSA 4WKBA 2FSHA 3RC1A 4EY4A 1NXVA 3ZGVA 5HTOA 4B3CA 3UT0A 2FG7C 4FONA 4BBAA 3FHCB 4C5AA 1MJNA 3EULA 3MJTA 4ALMA 3N7AA 4EJMA 4F3RA 3OUTA 1TM1E 2BEWB 4BUCA 1WXQA 1TK3A 3OCJA 2WFLA 1XAJA 2JGRA 2CLKB 1FP1D 3DXYA 1NT4A 2H2GA 2AC4A 1L7AA 3MGKA 4FW9A 2JASA 5BVHA 1SXJD 5EZQA 5CFQA 1DBRA 5F78A 5IKXA 2NV6A 3AR6A 4CUZA 3G0HA 1MDFA 4Y2JA 4AMZA 4CPDA 1UZMA 5EIBC 1RI1A 2Q4OA 1KOGA 1E2LA 1GTZA 1CQIB 1QIMA 3N58A 1T8PA 1QE5A 4M0LA 4UVHA 5EXSA 2CHFA 4AKTA 1CUSA 1LY1A 1ZM9A 2PUEA 5A0TA 1PJZA 3C1UA 1R0WA 2A4MA 3AW9A 3K20A 4D6XA 1C50A 1JU3A 4BASA 4O0LA 1JMVA 4GOLD 2LDBA 1TO6A 4J0GA 1Y4DE 1YBHA 5FTJA 3COSA 1QP0A 3R5HA 1XCOA 4M2LA 2AOTA 1QVRA 3ZS9A 4QWWA 3LCRA 2HLDD 3EGCA 3NZEA 2D1TA 2D00A 4HWGA 4S1NA 1YJBA 1ETHA 4FBMA 2ID8A 4LMRA 1NX6A 4X7RA 1DINA 2YNMA 4JJ4A 3PX2A 1YU6A 4UE2A 4TV8F 5BVGA 4Q7EA 1G41A 3ZIAD 1R12A 1Y8QB 2AFIE 3AJAA 3L0DA 3UTDA 2E85A 2W71A 3MZ0A 1QHXA 4HAXA 2GBLC 2PGLA 3PRHA 4RQTA 1XDUA 3GRFA 4DR1B 3EPKA 1UOPA 3KB1A 4FJ2A 4PZDA 1ZA2A 2X23A 2BF7A 4EHBA 4ID9A 1FYDA 1PK7A 1G3MA 2G5PA 3QIAA 2X0IA 3WLOA 4E88A 1K3FA 3HKBA 1F0PA 2OYCA 4EL5A 1NY5A 4IVNA 1MB9A 2G4CA 5CVVA 5CDGA 4AJOA 4G0MA 3UMRA 3TVYA 5C9ZA 2CHUA 3HJAA 4F4UA 1IPEA 3QV1A 4J4HA 5HDBB 2Y1OA 5CTAA 5EPOA 4JODA 1EGQA 1P9LA 2XCLA 4G8DA 4C2TA 5BN5A 1AV7A 3QLUA 3D6TB 4IMJB 2BFFB 1FMCA 2H85A 4ZVPA 4PCVA 5HDQA 1MIOA 2CCKA 5REQB 4DV7B 3G3EA 2JLZA 3ANMA 2HADA 3HH8A 3U3OA 4DQKA 3IIEA 3OPXA 2AJLI 8MHTA 2P1DA 1C0LA 5BP7A 2FH5B 4JUAA 3NGMA 3JD1A 2B37A 2JIOA 3DTVB 1KQFA 2BZ1A 4KQIA 4OU4A 3PEUA 1R8JA 3WGJA 3D0KA 4BMYA 4FYXA 4MRNA 4FN4A 4RETA 3I2YX 4L08A 3X3HA 4KZPA 4DY6A 2HXYA 3L4JA 1JP7A 1RABA 2GM4A 5EEGA 3RSHA 4UEOA 3C15C 1ZG3A 1TB4A 1ZWKA 3N0TA 3RC7A 4UFPA 4YAGA 4UOZA 1T10A 2R97A 1UAAA 1WXIA 3GW8A 4E4YA 1T1JA 5BQFA 3ED5A 1CY6A 3LHSA 4KVZA 3UWPA 1VI6A 2MSDB 1W76A 4YP0A 1ATIA 1RKQA 2RAVA 2JAPA 2YV4A 3R6DA 1WHTA 1XB2A 1BFUA 1T36B 3ADCA 1P1FA 3P9XA 4WKOA 2ZI5A 5H81A 1BIFA 2J6IA 2HU8A 2NTEA 5KO2A 4BNFA 1AUPA 1G20E 5HKOA 4PSAA 3UJBA 4EI2A 2O4CA 2Q8QA 3R7NA 4CIXA 3VOBA 4NESA 5JNUA 4V2UA 4QYMA 2B2NA 4HX9A 4RV5A 4BX2A 4D4JA 1G8SA 3GP8A 4MMYB 4L5JA 5HKBA 1E1LA 1QS0B 4R40A 5CG2A 1G5HA 3EIOA 3RS9A 1BCSB 4JD5A 3JASA 5AJUA 2QP3A 4H0CA 4Y2TA 4NVRA 3W05A 1DQZA 3A6ZA 3GLUA 3K71B 1OV4A 5F7OA 1JXMA 3DZ8A 4PPQA 3JZFA 1ZP6A 1TDJA 4UD2A 3RTCA 3E23A 4BKMA 4IWXA 3I8SA 3IUNA 1K08A 1NXXA 1RP7A 2WAYA 2WTMA 6ADHA 2P9FA 4N40A 4JFAA 3MWJA 2DE0X 3H2GA 3L7LA 4R9SA 1QH9A 4JNCA 3E5MA 1L7BA 3M1AA 4FHDA 3KVYA 4IL5A 2KMLA 4MEAA 4MCAA 4Q1EA 4EL0A 2FDXA 1TFUA 4JJGA 2AMYA 2GZ2A 1U4SA 1PEDA 4F5ZA 5ILGA 1V1RA 5ALNA 4NL4H 3FCXA 1SOWA 5IN5A 2WSYB 3D31A 2AK3A 3IAHA 3QOWA 5AKGA 4WBNB 5F3DA 3OU6A 2DPLA 3AEUA 1EAYA 3EPRA 3V7NA 4KW7A 3FR7A 2NXWA 1O0CA 2JCBA 3ODGA 1KMHA 1OWMA 3EZGA 4CL0A 3BWEA 4TROA 1HDRA 2D0IA 1JT9A 2PU5A 3PDUA 4AQDA 5J4KA 1TCUA 4OSOA 1Y5NA 4EHFA 3F71A 3GNQA 1SZDA 1U9JA 4R8SA 1LBHA 3L79A 2PZAA 3N1UA 5JSHA 4W6QA 3DOJA 4ZT5A 1HR0B 3BL8A 1B23P 4GEKA 5K3AA 2WNHA 1FFXA 1GAQA 2J9YB 3JPYA 3V4OA 1GPBA 3LZ6A 2Z2YA 1M10A 4E6PA 4ATNA 1WMBA 4EUSA 4V0QA 1SH7A 5CLLA 2HRQA 3JQ8B 3GQBB 1B00A 1VMKA 2DG2A 4NARA 4YRMA 3U3XA 5DTEA 4EYOA 1OB5A 3TJMA 2N1MA 4W9NC 2OPHA 3T3PB 4BVHA 1UXOA 2EW1A 1OGJA 3LT5A 2JZNA 2WC1A 3EVBA 3OESA 4UHJA 1MUUA 2B0CA 3ECAA 4JJAA 3G2OA 4XLTA 3TUJC 2CNWD 3H5LA 4OHYA 1U0FA 2ODBA 3U17A 3LIPA 3RUDA 1S2NA 2ZJ7A 3I12A 3WWCA 1M2EA 1AB5A 1SC3A 1P4SA 1T0PA 2ZBUA 4QNRA 2VQEB 1I7DA 3NH9A 3T7CA 4MQ4A 3FWKA 4YAWA 4MI1A 4XVRA 3WA6A 3G5MA 1DI0A 1GGNA 3GJTA 2W8ZA 3O47A 4YCDA 3RSCA 4CI0B 2EHDA 1VCHA 2X1HA 1G8GA 2QIOA 1MBZA 4BMNA 3HUEA 3TMYA 1YJXA 5ITZB 2JEOA 3I37X 2CV0A 4AKHA 4MV6A 2IL1A 4S3MA 1L4HA 3A37A 2R1VB 3GT3A 5LFAA 4BNWA 4E08A 4XX0B 3WLHA 4KPUB 3NI2A 5I7FA 1SZCA 4MLZA 2P2CA 3E3NA 4E11A 2VJMB 3HSYA 1WOYA 2NXNA 1AIPA 3PEWA 3FDJA 3Q6NA 3WL8A 3CO0S 1OH7A 3KR9A 5IBQA 2VPXA 4AWAA 3CONA 4BTEA 4P0QB 3HP7A 1ZUNB 4TKUA 1JR3A 2FW9A 4XPZA 4YJ3A 2WKWA 3I2HA 3KKLA 3COWA 3N2NA 4P32A 4RIHA 1CSEE 3G0OA 5LLSA 1M2WA 2RGDA 1EGAA 4V0SA 4FSDA 3V4RA 2A86A 2VDPB 1V3QE 1U8UA 5FR2A 4UATA 5FIUA 1T3GA 1W4CA 1XAHA 2C8JA 1I7PA 2ZUVA 4RKFA 4TTJA 4X0EA 4YCBA 3LUBA 4HDKA 5J1TB 4PEVA 3RPEA 5CA1B 5E9AA 3UT5B 3AC0A 4BZXA 1KEZA 1U2GA 4RXMA 5B57C 3BAZA 4C06A 3WGIA 3IAM1 1M2VB 4F04A 3H11B 1GPYA 1QYWA 3RK0A 3AUAA 3JAKA 3L01A 4ZAVA 1NJ6A 1XU4A 4LZLA 5F5NA 1XKQA 5FFNA 4TXMA 3ZU4A 4B4OA 2Q5EA 2X9NA 2W2VA 1CUXA 3BTSA 3NT5A 4FZ3A 1B2RA 1BA2A 4Z54A 3EDRA 5KWJA 1NOJA 2DQYA 4J0KA 1KVRA 2BR4A 2OCAA 4A6EA 2TMYA 1T6ZA 1CP3A 4HB4A 1NLMA 2ZWMA 3KZVA 2DWOA 2B5WA 4LX0A 1MZPA 2ZIFA 2YCBA 1CZRA 4G5YA 4PSKA 1HNZB 3WIDA 1HKHA 2IUFA 1QE0A 3EIHA 1HE1C 1YI8A 3EW9A 4HUJA 1SKAA 4PFSA 3F5DA 3OJEA 4KDFA 1VSQA 4I9NA 5LUAA 1VPDA 3OY2A 5CW2A 1G4AE 1PD0A 2OSVA 2Y3IA 3GVPA 3C2QA 5EYPA 3OTHA 3JTMA 1XZ8A 5G1PA 4DN6A 3S8EA 1RC8A 3KD2A 3KJIA 2IVFA 2GK6A 2C4MA 3K0EA 4I55B 5GJWC 2ZAMA 1GPH1 1TM4E 3U39A 2VDVE 4MKXA 3NW9A 4AZSA 3IXLA 4QWMA 4TKMA 4BFVA 4US1R 2XUFA 1IOZA 5K4GA 1XD2A 3KDSE 1Q1EA 4ENSA 1G1MA 4IO0A 2VYVA 3INRA 3OM9A 3ZX5A 1AXEA 3D3WA 3QLTA 2WKSA 1KHTA 1CS4C 2FE4A 5BQPA 3THSA 2FMTA 2PD4A 1D09A 4FS3A 2GTPA 1YU9A 3UMCA 4E70A 1A1VA 2ZS9A 2P4EA 3FUCA 3V1YA 4J49A 4PU0A 3RIHA 4EECA 1M7GA 1QONA 1Z7EA 4GBED 4IDHA 3B7WA 1XPJA 1SXJE 2B4AA 3PICA 4L9WA 5FPPA 5FI3A 4B6PA 4K05A 5FBLB 1KI6B 4KUGA 3RTEA 3SYNA 4BVFA 2YRXA 3A1CA 1XVAA 3G89A 3FB4A 5A71A 2Q0SA 4LHXA 3RWBA 4QQ8A 1XNHA 1Q2UA 4IWYA 3B8EA 4N5MA 1C29B 3K15A 2POQX 2DFLA 3W7AA 4RZ3A 4ASUA 5E7QA 1V7QA 3NP9A 4D3YA 4OXRA 5FOWA 2VNAA 2WB4A 5JH7A 2WRZA 4QXRA 2VI5A 3RAGA 2BGUA 5KQGA 2C3OA 4X84A 3HXKA 2CNNA 1A4UA 1P62B 2V98A 3WKCA 4B8YA 3BA1A 5I7EA 1ZK3A 5AJVB 2QUBA 3MXTA 3PVZA 2C4VA 2O5RA 1ZQ9A 2V7QA 3QRWA 2VSOA 3H13A 4TVBA 1DG1G 4BXOB 3O3MB 3WO1A 4IJ5A 4EEZA 2X7JA 4OHXA 4CL2A 2BI7A 3ETHA 3K1AA 3TTVA 4JLDA 4IOLA 1GDHA 1W581 3KHKA 4CM4B 2ZUBA 2GLTA 3G2LA 2NP7A 1QAQA 1U3TA 1CULC 4CEIB 3AWDA 4RPIA 1HM5A 4B9EA 4AMUA 4TSRA 2J48A 5BT9A 1MPXA 1GTRA 2A9FA 3A3PA 1L7XA 4YLGA 4LNUB 5K8LA 2CVQA 2VHYA 4D0NA 3JAWA 5LVAA 5TVGA 5DP1A 1PLJA 3EQ9A 1XTKA 4R0MA 1WBDA 4Q9LA 1VJRA 3WLKX 4BMZA 5JS7A 5IM4A 1RRCA 2HMVA 4F72A 2OTCA 3ZXSA 5E1OA 1MTOA 4L8LA 2GM5A 3R7WB 1J9GA 3IXMA 3B1FA 2IKQA 3SE7A 4P3YA 2MINB 4MO9A 4FU0A 3CMCO 5ALIA 3I3OA 3M6AA 3PUXA 4KXNA 4JC5A 2KS6A 3H19A 1PWEA 2ZJ6A 4UM7A 4JXJA 3C3XA 3AKEA 5A02A 4XA8A 2Q5FA 4AMBA 3ERCA 4UU7A 2PZJA 5EG5A 1T3LA 3L05A 4KREA 1ZCZA 3GUCA 4RFLA 3GXOA 5GIPE 3QVKA 3GO4A 3NAMA 4I3GA 2VH2A 1DX9A 4Q3KA 1N0VC 4NH4A 3L84A 2ROQA 4XIYA 4B75A 1Q74A 3ROZA 3RT1A 4YRLA 1E3JA 1G8AA 4C5CA 1FQWA 2XUOA 3HA7A 1MA0A 1DPFA 1RR6A 1TGYA 3A32A 3AEZA 4EKDA 1G98A 3CRVA 3PJRA 3RQSA 2WFZA 1RYEA 4XRRA 1Y5RA 5AVOA 2IT1A 3FVTA 1H8HA 1N0IA 3NETA 4FMDF 4OHRA 4TQAA 5ALPA 5GY7A 5GPBA 4N5NA 2FWAA 5JEDA 4EG8A 3PD1A 4MS1B 1M1YA 1GZDA 4JB0A 4F71A 3MRSA 4E5VA 4R8KA 4LHZA 5TSDA 1J0DA 1R0CA 1D2RA 3EGVA 1H2ZA 3QXXA 4B74A 3ZNQA 1X1DA 2Z3VA 3SJCA 3DDUA 4LJ7A 4ZYWA 1AM4D 1QTQA 3VDMA 1M73E 4HWPA 1YK0A 2GB4A 3OSUA 4EI9A 4N9QA 1LQUA 3IQFA 1F8UA 3BRWD 1IJBA 3GLGA 2I1LA 5ESDA 2ZBDA 4AIIA 1XMOB 2Z8YM 3HO1A 1PZEA 1XJCA 5I6DA 1IBCA 4LQ4A 3ITKA 4KBFA 3IGFA 5ECWA 3G0BA 4AXBA 3LUCA 4WNAA 2JJ1A 3D2LA 4LJ9A 5A62A 3SE0A 3LBHA 1UDRA 2B82A 2W6ZA 1JEOA 2IUUA 4KXMA 3W0LB 3W8RA 1G0NA 4V1CI 1LS1A 2ZRFA 1NTRA 2B20A 2OL4A 2P4UA 2Z1MA 4YRCA 5A5FA 1VCIA 1R8XA 1CUYA 4OLFA 4PG5A 4F3CA 2JFZA 1G38A 5A2GA 3UMYA 1IN1A 1C5KA 3RHTA 1YV9A 3LBIA 2PO7A 4G5OA 2XT9A 5KOHB 4N5HX 2B1JA 3MMPA 3MMZA 1TIPA 2GLUA 1TUBB 5AVZA 4GGOA 4DYVA 5JC8A 4HH1A 3ZHYA 5B4VA 2BHTA 3GBVA 5BSHA 1JJ7A 2PWZA 3G2JA 3B52X 4CCYA 3GK3A 1PZGA 1E7RA 3DBIA 4S1WA 3IV9A 3VC2A 1KY5A 1XHEA 3GH3A 4EFMA 1JAZA 3CUVA 3IALA 2ON6A 1CJCA 3PP8A 2QN6A 1LRJA 1ABBA 2XWBF 3R41A 3T5AA 4CMAA 4M0CA 4BP3A 3PNPA 4RTOA 3M2TA 3ZIUA 3OIUA 3HJNA 5GGXA 3KEOA 4C4AA 5L9AA 2H29A 4KXFB 1U0LA 1NJFA 4YEDA 3MJFA 2W2TA 3GARA 1F9EA 3I5MA 4IQ8A 5C35A 2ZIZA 2JEZA 1H6AA 2HFKA 1OGIA 3C1OA 3TGLA 2Z2IA 2H2FA 3GPBA 1U98A 3QNUA 5DKFA 4P5DA 3U4QB 3P71T 5IUKC 1SC9A 5LQKA 4URFA 4BLQA 4DC1A 4C7OA 4Y0VA 1XPOA 1H0SA 1P2VA 2AJTA 3DKVA 1A9XB 5T64A 5HMMA 4DM7A 1Z88A 2FV8A 4TL9A 2QW1A 2JFBA 4G25A 4BS9A 4O0MA 2W6CX 3AY3A 1W96A 2ZATA 1OHHA 3DNPA 3R7LA 4RXUA 5KNBH 1ISFA 1COWD 2GETA 2XGSA 4O63O 1H1DA 3ESZA 2I3AA 1MQ9A 4H2DA 4X92A 3VHLB 3NPAA 3ZU5A 1QIKA 2Z6VA 3QOYA 5IM5A 4LSGA 2WM8A 4NK4A 1BE0A 2WSSA 4UHEA 5AJTA 4KQ6A 4DLYA 2G7MC 4LN1A 2HR1A 4K87A 1FFYA 1PNOA 4ZK2A 1EAMA 1REQB 4CT4B 4XZ3A 3GZNA 1ATZA 2I4RA 2QTMA 3D2CA 4NQZA 1WB4A 3V8NA 4ZAWA 3O84A 1ZJ6A 4D3DA 4AF8A 2NMVA 3K2BA 3EQ8A 2P9TA 4TYNA 4JOSA 1FFSA 2VF7A 3T1VA 4IDNA 4PN3A 3OLYA 3ZWVA 1NOIA 4AZ3A 2POCA 2XF2A 3HCOA 4IQ0A 5KYTA 1XKLA 1KE1A 1D03A 2YZ7A 1C8BA 3K4HA 5F23A 2J5KA 2OBNA 4LE2A 3GRCA 3QX8A 1DIHA 4IIFA 3UWKA 4X85A 1L5ZA 1Y9ZA 1FMFA 1IZ0A 4GKKB 1Z6XA 1DWQA 5CDFA 4EPYA 1QVZA 4BN4A 3IHLA 1RBZA 2RGXA 4ETWA 4G37A 2WD7A 2VJPA 1OKKA 5K0GA 2IZ0A 3U60B 5LMNB 1UBJS 5KYUA 3RSZA 4E5NA 3PVCA 1RRGA 3AT1A 4EHIA 1NNLA 2ZKIA 3D3JA 1QFMA 1MVNA 1XZNA 4NX2A 4BJ1A 4JR1A 2NUTB 4IV5A 4YCCA 2NYUA 1D0VA 4LWPA 1J25A 1TVKB 1TEXA 2PRKA 1VIVA 5LXTF 1MV8A 1TKBA 2O0JA 1PKXA 2Q3BA 3HBMA 3IUMA 3G49A 3NFYA 4UEKA 5E1MA 1N8SA 1E9SA 4G0QA 4YUVA 4BNXA 4HPJB 1IVSA 1P7WA 1JLLA 1FUEA 3EZLA 4NS4A 1KVSA 1LJUA 2OV6A 1EXVA 5DSXA 2QJRA 4LWZA 1QIJA 1U0RA 1E2FA 3N2GB 1ITZA 1NIJA 3STYA 3D4LA 3UBMA 1CTQA 2BLLA 1JTFA 1T9CA 1KERA 5DHAA 2F1RA 4AECA 1C4OA 5IS2A 1HYBA 5J5CA 5IXYA 1N6HA 1GCIA 3O4JA 4J0FA 1IN5A 4WK2B 4YV1A 1GZUA 4OHKA 5C5EA 1T9GR 5JIBA 2WI8A 2B83A 1AN0A 4XX1A 1DKPA 5H1YA 4C14A 3J80A 4CF5A 1BFKA 1F3OA 1RJFA 5IVIA 4KWEA 5FA6A 1KGSA 1U94A 2OKGA 1XRSB 4X3PA 4OI1A 5LPNA 2HRRA 3WBFA 1ICEA 1KETA 4Z5XA 3RTGA 3A4YA 2W70A 3FDIA 4JEUA 3S8MA 2GAAA 3FRJA 1SVLA 3H9GA 2HDHA 2W43A 3I9V1 2SBTA 4M49A 4FBLA 3DC2A 3LOUA 2PSEA 2R00A 2LTAA 2OV1A 1MXFA 3QKRB 5JAUA 1LBSA 2QKYA 4LK3A 5CM2Z 2F55A 5SY6A 4G8CA 2JZOA 3IQGX 3T5CA 2R66A 3S1AA 2EIXA 4FFRA 4JMLA 2DU8A 5WRFA 4MTLA 1A9OA 2WUGA 1DCKA 4KLNA 2G0TA 4ACAA 2MSKA 4RVCA 1TVCA 3TRIA 1ZJYA 3H2SA 1X19A 3K70D 3O8LA 4II3A 2QEQA 2HUPA 1S3SA 2EARA 1NWHA 4UOQA 2IRWA 1SJ9A 1DFIA 3AJRA 3RSFA 4N82A 1AQNA 2BGTA 4ZVRA 3TX2A 4JX9A 4EY8A 3A4VA 1TYZA 1NDHA 2JS7A 3AXTA 3NB0A 3AQIA 2HN9A 4R2LA 1XZDA 3WKDA 2F1JA 1SUAA 2YDXA 1GCGA 1UJ2A 1AZTA 2YZ2A 4U9UA 1YFLA 1L5VA 4EHDA 2Q2VA 1V8FA 4RJIA 2QL5A 5GJCA 1L0BA 3PGJA 1RI3A 3NVKI 1IBKB 1E6WA 2EJTA 2GD1O 1SBIA 2C77A 1KAOA 4IOMA 2ZR0A 3GUVA 3P9QA 3HRIA 2P67A 2QR5A 2PKYX 4HFNA 4BFCA 1DS6A 1U2DA 5CAEA 4KR2A 2FW8A 1ENPA 3HJHA 5KJFA 1WOMA 4DSNA 4LF5B 2PH1A 2DM6A 1AGNA 1LLUA 2VOEA 4G0VA 5LQUA 3PR3A 4YLEA 1Q7CA 1YI0A 2BR3A 4RGYA 5HKKD 2CT8A 2VK2A 3ZHBA 5T4BA 1VP3A 1OXVA 3VNQA 5JRJA 3TRDA 3KJFA 1LSUA 3RU7A 1IEQA 1AKUA 1UIRA 5I9BA 6CHYA 3IVMA 1RKUA 4WEOA 2EYQA 3UH1A 4XJVA 1GAXA 2UYOA 2OZLB 3K9NA 2QMOA 2LVBA 3ASVA 2P2GA 4KAFA 2X3UA 4NU0A 5H16A 2FSVA 4OI4A 4CMGA 1SOUA 2BEWA 2AOUB 5FWAA 5HWSA 4HXYA 2M6KA 3S2IA 4LY0A 3HCWA 2BBWA 1X39A 2V6JA 4FHCA 4JJFA 1KO7A 3WIBA 5BSEA 4GW3A 2R6R1 2PUDA 3QLVA 2V1UA 2DHDA 1G0OA 4M1KA 3TJRA 1RYNA 3FHLA 5B12A 1R4MA 1HTBA 4AY3A 4KQKA 1XZBA 1R6UA 1PYDA 3L40A 1AQUA 3OQMA 1JNXX 1QGDA 4R1MA 5HXAA 4YXFA 2WK1A 3OF2A 3RFUA 1IQUA 4K7JA 2C9OA 4N03A 4B85A 1TJ5A 2X0FA 4XDHA 5JWOA 3FAZA 1XMPA 3LHIA 1G8YA 1A9YA 2CL6X 1IMOA 3OA0A 4PFKA 4QOEA 3OSZA 4CDGA 1P4JA 4F4DA 4GP9A 5C4MA 1XOIA 2C92A 2CFOA 1KMIY 5GZ6A 1IRXA 1R6BX 3VNUA 3CVOA 3EZ9A 1XLTC 2IU0A 1YRBA 1NLZA 4TMZA 3U49A 3T9AA 3WGTA 2RD2A 1X1TA 3IKVA 4FVTA 4C6TA 3CU5A 1Z7WA 3B3AA 2QUJA 2RGEA 3PUKA 2P27A 2ZSDA 4M1ZA 4P6VF 1NUHA 3ZK9A 3FZNA 6REQB 3H5TA 2QVBA 2W5UA 2AXQA 4N5DA 3M4JA 4UVDA 5JQWA 4X54A 4J1TC 3AXSA 1ZNZA 1N5RA 4K46A 3LQFA 3S44A 2M98A 1YZLA 4RA9A 3RVNA 4ARIA 5HIIA 2HOQA 1WP9A 2FF7A 4BO1A 5H3LA 4J2HA 2VDJA 3H8VA 5DNYB 4REQB 4LCEA 1U0SY 2H17A 3GFSA 1GG9A 2GEJA 4GVXA 4HQNA 5K05A 4HN2A 2H31A 3HCCA 2X41A 3DKIA 3F6RA 2Y0DA 1G4UR 1S5PA 4NBSA 3FTEA 4K9RA 3EVGA 4IZ6A 4QRIA 4LHVA 1VL0A 2GPSA 5REQA 2IS4A 4ZRDA 3GRUA 1CPYA 2H18A 4LRQA 4MJLA 4L02A 4GR5A 3AIMA 1NF8A 5EIAA 4Q9AA 4I1UA 5AW3A 4YP6A 3DTVA 2QR2A 3TFQA 1UZAA 4Q15A 2VDOB 4JS0A 2H51A 5I4IA 3CXRA 4QRDA 3BGIA 5E9JA 3WRXA 2CZGA 3T99A 5IBCA 1GKYA 2PT9A 4ZCLA 4BATA 1IB0A 2NXJA 1BCRA 3RS3A 3C6MA 3S7TA 5TC4A 3FCCA 4HNTA 4LRTB 3ITDA 2IP4A 2ZYSA 1PT5A 1DLIA 3RVSA 4BYMA 5C8YF 3T95A 3W7VA 5H68A 2FFHA 2GO7A 5TJHA 2NAFA 3UOAB 4CKWB 1AKTA 3QYFA 2X58A 4MR7B 4D4MA 4CKWA 4QBFA 3WP0A 1I2AA 4O25A 5BN3A 2X4IA 1LI4A 1U0EA 2E5FA 4WOPA 4D41A 4NBTA 4J4BA 1YMVA 5SYMA 2RH8A 3QVTA 1CZUA 3H9CA 3M6WA 4U7PB 2EERA 4HFRA 4GBMA 1FQJA 4ZXPA 3SLGA 5C1PA 5HG0A 1YH3A 3IPLA 3PDIA 4HADA 2X5NA 1LF5A 4BNIA 4DLSA 5FL7D 1I6LA 4DILA 1N0HA 1XPRA 1K4YA 2IYLD 4MQLA 5FL3A 3TQCA 4CM5A 1B7GO 2NW6A 1BCSA 2HIMA 1VA5A 3EXHB 2I80A 3F8TA 4M4SA 1NL3A 1XSEA 4ZN6A 4ABTA 1PT7A 1QRRA 5J4YA 3GXBA 5B64A 2HSEA 1EP3B 4U7WA 2WKQA 4F06A 3RH0A 1H3EA 4C1NA 2ZBGA 4IZIA 1FYEA 4UHDA 3REFA 2HYIC 1G21B 3A3OA 4EAAA 4H7KA 4YO8A 3KKEA 4UMVA