1R3DA

Crystal structure of protein vc1974 from vibrio cholerae, pfam abhydrolase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
264
structure length
257
Chain Sequence
SLLSNQLHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPAEAVEMIEQTVQAHVTSEVPVILVGYSLGGRLIMHGLAQGAFSRLNLRGAIIEGGHFGLQENEEKAARWQHDQQWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQRQTLIAQRSANLGSSVAHMLLATSLAKQPYLLPALQALKLPIHYVCGEQDSKFQQLAESSGLSYSQVAQAGHNVHHEQPQAFAKIVQAMIHSIID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein VC1974
publication title Structural Genomics target NYSGRC-T920 related to A/B hydrolase fold.
rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
total genus 75
structure length 257
sequence length 264
ec nomenclature
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r3dA00
5ALGA 5FLKA 2C7BA 4Y2PA 2WFZA 2C0PA 2WUFA 7YASA 3TRDA 4H7JA 3ZLUA 4G9GA 1MN6A 2GBFA 3JW8A 1XZEA 2Z3WA 4WDRA 2JGLA 1ODCA 1H22A 4OYYA 4P92A 1WM1A 4K2AA 5AM1A 4QDXA 2H1IA 5HK9A 2XB6A 3IA2A 3FWHA 4DNQA 2HADA 3TGLA 1Q0ZA 4GW3A 2EDAA 2X5XA 2I3DA 4G5XA 1BN7A 4J3JA 1KU6A 5KREA 1HPLA 2OGTA 3DNMA 1ORVA 1ZGBA 5AKLA 5AI6A 1WB4A 3ICWA 3O9MA 1UXOA 4HVTA 1QTRA 3HRHA 1BROA 4K5QA 3PI6A 1TAHA 2GBGA 3BJMA 3QZUA 1ODSA 2OPHA 4MEAA 3FVRA 3DJYA 2I78A 4DYHA 2DCMA 3HSSA 1WCYA 3D2BA 2Y2VA 4G4IA 1CUWA 4CCWA 3G0IA 2VJCA 3O4HA 3RM3A 3R40A 4B85A 5AI5A 5JAPA 3W2TA 2CJPA 2YXPX 4J0IA 4W1PA 4M0EA 1OCEA 2D5LA 2WJ3A 1H2WA 2PKYX 1BE0A 3M82A 4C4XA 1E89A 1WB5A 1LPMA 4YX9A 2XUJA 5JASA 2BFNA 5JIBA 2I3ZA 2QS9A 4B0OA 1R4ZA 2P8SA 3HC7A 4B81A 2WIDA 2BAGA 5JALA 4V2IA 1QIGA 5ALVA 5IH7A 3CCCA 3CXUA 1QLWA 2JGKA 2QXUA 2C5FA 1CIJA 5AI9A 2HHAA 1HL7A 4HTAA 4BAZA 1LPPA 4H7KA 2OXEA 2JGIA 3H04A 1FFEA 1GPKA 2IX9A 5FOQA 1XRQA 2WFMA 3AJAA 3WYNA 1LZKA 2XUKA 4JYMA 1H2ZA 5A7FA 1EB9A 4QZVA 3WL8A 3FCXA 5DTJA 4BCDA 3W9UA 3EQ9A 5EHZA 1MX9A 3E1GA 5CTAA 1VA5A 4BZWA 2WJ4A 3WKAA 1XZGA 3AILA 3QPAA 2WSLA 1MO2A 5AKKA 1CPYA 1TQHA 1U4NA 3D0KA 4HZGA 3K2IA 5CW2A 4X7BA 1P0IA 3F98A 1U2EA 1QIJA 5C7YA 3QM1A 1VOTA 3DOIA 4OD0A 4BRZA 4CG2A 2J3QA 1XKTA 5JAOA 3BIXA 1JT2A 1VXOA 1XZIA 2QXTA 3VXKA 5JAUA 3BL8A 4CIBA 4AQDA 1LPBB 3IVMA 2BUAA 3MUOA 1UK6A 3V1LA 1UK7A 4X94A 1E8NA 4W1QA 4UHFA 4NVRA 1N1MA 1EVQA 5CXXA 2WUDA 1XZDA 2K2QB 3V1KA 3STUA 3EQ8A 1XZJA 4LXHA 1TCBA 2ROQA 1QOZA 5AHXA 1ZJ5A 4OSEA 1ACJA 5CRIA 4I19A 3L1JA 3FOBA 1GT6A 4Q3LA 3ESDA 1XZBA 3F96A 1W75A 2YASA 3KD2A 1QZ3A 5LLSA 1DTEA 3PFCA 4QDOA 4BB0A 5AI0A 3HABA 5AJHA 5AKIA 3D3NA 4JEIA 1R3DA 1WPRA 4GI1A 5IVDA 5ALRA 1UOQA 1E8DA 5AM4A 1XZHA 1W1IA 2Y2UA 5F4ZA 4BBZA 2O2HA 1MT3A 3MGAA 2WLSA 3KXPA 4AZ3A 3STWA 2Y1KA 1YR2A 3BE8A 1CQZA 3E3AA 3U0VA 4N5HX 2OCIA 3ESAA 1L7AA 1DX6A 1QIIA 1GQRA 3H2JA 2FUKA 4BAUA 4PNZA 3R3XA 4PF1A 3G0CA 4JH0A 1CV2A 3HLKA 4RE6A 1MJ5A 3G0DA 4UUQA 4Q34A 1UOPA 3G9XA 4DGQA 3R0VA 5SYMA 4BVLA 4Y2YA 5AKZA 2DSNA 4F5ZA 4BC1A 1XRLA 4H7DA 4DLNA 5KWIA 1A88A 3X3HA 1ZD3A 1CUIA 4QLOA 5EHQA 2CB9A 3LLCA 1TCAA 1Z68A 1BN6A 1WOMA 1EINA 2QMQA 4X95A 4P08A 4UBIA 1IUOA 3O95A 4IH4A 1N5MA 4XVCA 1GQSA 5ALSA 4WFIA 3T52A 2QUBA 5EHXA 5JAHA 4CG3A 3FYUB 5CT8A 2WIGA 5ALLA 1O6GA 1XZCA 2WILA 1XZMA 2OCLA 1JI3A 4J0GA 2WIKA 1X2BA 4EUSA 2PX6A 1Y7IA 3OG9A 4GXNA 5E2IA 2RAUA 2Z8ZA 1YCDA 2JEYA 1KEZA 4H7HA 1K4YA 4OU4A 4UBMA 2QRUA 5HKAA 4KYVA 5DNVA 2QM0A 4EY6A 1QFSA 4FWBA 2R11A 5BWBA 5K5EA 1ZOIA 3WWDA 5CH5A 1ISPA 3L1IA 2XMGA 5EI5A 1T4MA 1J07A 1CUYA 2XQGA 4OYLA 2VT6A 1NU8A 5HK8A 2WG0A 4H0CA 4DMFA 1YSCA 5JANA 2OQIA 3QPDA 4X85A 5EHNA 4X6YA 4DNOA 1SOMA 4KAJA 2XMQA 2C0QA 1ZD2P 1YA8A 5AM0A 3RK4A 1HKHA 3BDIA 5ALQA 5JARA 4PSCA 3FYTA 1YAJA 1LLFA 2JGJA 2FJ0A 5T4EA 1AX9A 3ILSA 2RI6A 1X2EA 1T2NA 3C87A 3WJ2A 4B7ZA 1CUBA 1SCQA 2AJCA 5CMLA 1R1DA 3F9CA 3IURA 4TPKA 1M33A 2ZSHA 2IITA 4K6HA 1G66A 1ORWA 4Y2QA 5A6VA 4X91A 4CCYB 3C6ZA 2PUJA 4E15A 1Y7HA 3KSRA 2EDCA 2WUGA 4KRYA 3A2MA 4E11A 5AM2A 4FNGA 5D3ZA 3DEAA 3STYA 3FYUC 1ZJ4A 1R9NA 3DYVA 4LYDA 3PUIA 4BDSA 3V9AA 1HLGA 1EK1A 1XQWA 3OTQA 2B4KA 3A2NA 3W06A 1VE6A 3QVMA 1EDBA 2VEOA 5C8VA 1J1IA 5DNWA 1F0NA 2HA0A 1YS2X 1LPAB 2BJHA 4U2DA 5AOCA 3H2GA 3VVLA 2VSQA 2GBIA 4JYPA 3T4UA 3A2LA 3JWEA 3I2FA 2HU8A 5E4JA 3A6ZA 4FLFA 3GUUA 1K6EA 1LBSA 4CIAA 4MQMA 2W6CX 5CURA 4H18A 3M3DA 1G5FA 4G4JA 4A5SA 5HF5A 5LP1A 4H7FA 1CVLA 4O08A 1QGED 1DWOA 4FTWA 3WK8A 4IH1A 4UHBA 5A7HA 4G8CA 1AC5A 3OM8A 1RWQA 1Y37A 2OGSA 2VQ6A 4B9AA 3I2HA 4TGLA 4AN1A 1DT3A 1YASA 4C87A 1PV1A 1UT6A 1DWQA 3C70A 2WHPA 4XIIA 1WPXA 5BWCA 3CCBA 3WK6A 5CH3A 3UUFA 1DQYA 1QFMA 2VTVA 4H77A 4QEKA 1ZD4A 3WMRA 2ECFA 4A16A 3H17A 5HFNA 4LXGA 3VJMA 3LIIA 4FFWA 2HFKA 5AI8A 4AO6A 3DKKA 2ZYIA 3GBSA 3ESBA 3FSGD 2PU5A 2ZYRA 3M83A 5HQ3A 3KOOA 3OURA 3D4LA 4BYMA 4FFVA 3DS8A 3NUZA 3WK5A 1P0MA 5LZ8A 4C01A 3AIOA 1XKLA 3QPCA 1YAHA 1LPOA 5AP9A 2QUAA 5AK5A 2QKYA 5AI4A 1F8UA 1C7JA 3R3ZA 5LZ5A 2O2IA 2CBGA 2HU5A 4W1SA 1ETHA 5A62A 3PE6A 3PDCA 4QA9A 4WCVA 5CT5A 4BC0A 4CG1A 2HDWA 2XUAA 3NGMA 2ZJ6A 3PF8A 5K3FB 1R88A 4Y2TA 5JYCA 4J0JA 2QOEA 1AMNA 4D9JA 5LZ9A 1JMYA 2ZJ7A 5EGNA 5FRDA 1H2YA 3H2HA 3QBJA 1YS1X 3DCNA 3WA7A 2HA6A 1UK9A 3I1YA 3AIKA 4B82A 2RIPA 5HF9A 3ED1A 4F60A 1CRLA 3W05A 2DHDA 2HM7A 4LIPD 2WIJA 2Z5GA 5FV4A 5H3HA 2ZYHA 3H2KA 4UHHA 3IBTA 4GWLA 2V98A 4DTCA 2C58A 1ZIYA 3G0BA 2YH2A 2OAGA 4ZV9A 5HF6A 1DINA 3VJLA 5I7UA 2JF0A 3AFIA 1BU8A 4OB6A 4ETWA 2O2GA 2XMSA 2PSEA 3N2ZB 1CEXA 1SFRA 1UKCA 2JGEA 5AK6A 1QIFA 5FUMA 4DMHA 1VA4A 2CUTA 3D5EA 3CN7A 3DDUA 1KU0A 3DL4A 4RPCA 2XUQA 4C88A 4J0KA 5ALTA 5DYWA 1JMKC 5BV7A 5EIHA 2PPLA 5FXMA 2Z3ZA 4HRYA 2G4LA 5ALWA 4OPMA 1HDEA 2XQIA 1HBJA 1U65A 1GXSA 1XZLA 3BF8A 4U2GA 4UBJA 2XMCA 1AZWA 4QNNA 4AXBA 5DTIA 4DNPA 3PFBA 1JU3A 2H7XA 1FFAA 5AKEA 2WIFA 1C4XA 2XI4A 1W6RA 4X93A 1ZI8A 5AK4A 4HXEB 4Y2SA 3I1IA 3S2ZA 4BCCA 4ARAA 2WU4A 1DQZA 1XROA 4X6XA 3M81A 1MNAA 1BS9A 3UMJA 3FLBA 4X71A 2XQKA 3IUQA 4C4YA 1WB6A 3QH4A 2WHPB 3ESCA 2GBCA 1A8SA 1C7IA 4MXDA 1XRPA 5LKRA 5HCUA 4XWGA 4ZXFA 4C89A 5FP0A 1ZICA 2PL5A 4OUKX 3AZPA 3BJRA 3S8YA 3VDXA 4MWSA 2BUBA 4EY8A 1XZAA 4AO8A 4UBOA 1JKMA 2BUCA 4G4GA 2R8BA 3HI4A 4RNCA 1K63A 4BATA 3L1HA 4OCZA 4G9EA 3C45A 3O9VA 3H2IA 5ALXA 3IB3A 3EF3A 4DIUA 1CUXA 5SYNA 2HA3A 3PF9A 4KJXA 1CLEA 1CUJA 4WY5A 5ALHA 3H18A 3UUEA 1UFOA 5CXUA 1TIBA 3PICA 4QWWA 1FJ2A 2YYSA 4NZZA 4UFOA 2V9ZA 1XQVA 4FLEA 3DLTA 4LHEA 2JBWA 3P2MA 4GEGA 1GPNA 3BXPA 3WWOA 2I03A 4OB8A 4B83A 1CR6A 1MU0A 4I3FA 3DYIA 1UKAA 5ALUA 3ANSA 1UZAA 3EIOA 1BEEA 1MAHA 2XUIA 4KAFA 1TKRA 1EA5A 3BWXA 2BGRA 1RYYA 2AXEA 4J0HA 4AMYA 2CKMA 3HJUA 3C8DA 2X8BA 3N0TA 1WHTA 2Y6UA 2IIVA 1ODTC 2ZVDA 4QE3A 1AUOA 3IULA 4FLMA 5DYTA 1EB8A 5HF8A 5LZ2A 1XFDA 3I2GA 3AZOA 3G9TA 2XQJA 4EA6A 5ALDA 3WWPA 2BCEA 1JFRA 4BVJA 2XLCA 4IO0A 4B0PA 3F67A 4WFKA 3FBWA 3RKSA 2V97A 2J3DA 1U8EA 1QTIA 1YB7A 2X76A 3WIBA 1P0QA 4IQ4A 2XUGA 4UHDA 1MPXA 3W9BA 3ZWQA 4FNMA 2EEPA 4Y7DA 2QJRA 3IIIA 4PV7A 2OCGA 2GYVA 3GFFA 4INZA 1JU4A 1FSSA 4Z49A 1A8QA 5ALIA 5ALNA 2XQFA 1MTZA 2GZSA 1NU6A 3ANTA 2ES4A 2BGNA 1QIMA 1EDDA 3FSGA 2HA2A 2G5TA 3HXKA 2B9VA 3NOXA 1AQLA 4X97A 4EZIA 1AKNA 3OPMA 3G8YA 3WZLA 4AX4A 1DT5A 4BTLA 4E14A 5JD6A 1CUVA 2Z8XA 1ZI6A 5E4YA 2UZ0A 1QIDA 5EIAA 3IUNA 4KE7A 2W22A 5D7BA 3O4GA 2WUEA 4BAGA 1ZIXA 3WK4A 4AO7A 5HZGA 3BF7A 3Q0TA 3WKBA 3BIWA 3KWJA 4Q3KA 4Y2XA 1ZD5A 4QDTA 4FDMA 2XUDA 2V96A 3I28A 2HL6A 5AO9A 4B9EA 5AOBA 2HA4A 2XUPA 1XLWA 1YB6A 5C81A 1XLVA 5DYYA 1K8QA 2RONA 3WWEA 3IDAA 2RHWA 2OQVA 3AZQA 1QIKA 4ROTA 4EY7A 3CN9A 1TCCA 3WIOA 2DQZA 3FAKA 3IUMA 3I6ZA 4QDZA 3QYJA 1XQXA 3MVEA 2XUFA 1Q0RA 4LYEA 3GZJA 2XMBA 5YASA 3ZPXA 2CEKA 1H23A 3V1MA 3DL7A 4FOLA 2H9YA 1OXMA 2ACEA 3O0DA 4EY5A 4NS4A 5K3EA 4L3WA 1JJIA 3GROA 4BTVA 1MNQA 2Y6VA 5ALEA 4EHBA 1L7RA 4E46A 3IUJA 5ALOA 4X6UA 1DX4A 2ACKA 3G7NA 3JYHA 4W9RA 2JGFA 3VVMA 4KE6A 1QONA 3LP5A 2QZPA 3G9UA 2C4HA 1QE3A 1XZFA 3EBLA 3HYSA 2VAXA 3LCRA 5AIAA 4L72A 3TEJA 5IKXA 4DMKA 1F6WA 4HXGA 1CUAA 1ZGCA 3HZOA 5AK3A 5AIBA 4Q1VA 4X00A 3R3UA 5A2GA 3VKFA 4ZI5A 4G1FA 3E4DA 2O7VA 5EIEA 4DSAA 2HA5A 3D59A 1QO7A 4UHCA 5E4TA 3WA6A 1PJAA 3SK0A 1CUEA 4LKOA 4U2BA 2VT7A 5IVIA 4KACA 1GKLA 5JD4A 2VF2A 2PSDA 4OB7A 4X92A 2XMRA 3SWWA 1VZ2A 4W1RA 3A70A 3ZV7A 1J2EA 5LIPA 4AB1A 1THTA 3H1BA 3DKRA 2RHTA 4Y2JA 4RE5A 4CFSA 5LZ4A 1S8OA 1VZ3A 2VATA 1CUZA 4C6HA 3U1TA 5FPQA 5DLPA 1EDEA 3D7RA 4IH9A 1IVYA 2NW6A 1OILA 4PSUA 1I6WA 2HRRA 3FLAA 4FBLA 4KAAA 4KE8A 3C5WP 1F0PA 3YASA 4JNCA 2WFLA 4U2FA 3LIPA 1NX9A 3FCYA 4I4CA 5AKXA 5T4FA 3WWCA 1XRMA 2QT9A 1R9MA 3G0GA 4LXIA 3F97A 5FPPA 2WTMA 2Q0XA 1LZLA 3C6YA 1EI9A 1CUFA 1VE7A 1D07A 1XZKA 5CT4A 1LGYA 4BZZA 1LPNA 5T4HA 4HAIA 4C4ZA 4K6GA 4L0CA 4M0FA 5I9IA 3FVTA 3ZLTA 2RGUA 2PUHA 4H35A 1H2XA 1PFQA 4BP9A 1E3QA 1IUNA 1SCKA 3R3WA 1FFBA 5JATA 4FBMA 3KWFA 5FKJA 5HFAA 4N8DA 3GA7A 4ZRDA 1EX9A 3EQ7A 3FYUA 4Y9SA 1IZ7A 2PVSA 5D6OA 2XMZA 1W52X 2XDWA 1GZ7A 1QIEA 4UFPA 2G5PA 2J4FA 4AZ0A 2PSFA 1HQDA 5A7GA 3RARA 1ACLA 2ORYA 1UWCA 4CI9A 2HIHA 3SX4A 3G9ZA 1P0PA 3ICVA 3OOSA 2GYUA 5IVHA 3DOHA 4AMZA 4Y2VA 4N8EA 3ZLVA 1O6FA 4XJVA 4OU5A 1G42A 4Q82A 5AKGA 2ZYSA 4MYSA 2DHCA 4ARBA 2XUOA 4QLAA 4J7AA 4GECA 4KEAA 4ZREA 1XRRA 1J06A 5I8PA 4BE9A 1USWA 3WYDA 4S0XA 3QMMA 2ZJFA 3HEAA 2G63A 2PBLA 1XQYA 4FHZA 1UK8A 3I2IA 3BDVA 1X70A 4UBKA 4Q3OA 2OGZA 4N5IX 1W4LA 2H7CA 2GZRA 5DWDA 4MWTA 2AJBA 3R3YA 2JIDA 5A71A 1N5RA 4J0CA 3E0XA 5JADA 3H0CA 3VISA 4UBNA 5LKAA 5EFZA 4Q05A 1LBTA 1GKKA 4MYDA 3PUHA 1VKHA 2CZQA 1E5TA 4AN0A 5HQ3B 5K3DA 4CCYA 4X3CA 1YA4A 1GPLA 1B41A 2ONCA 3D2AA 5AM5A 4NMWA 2C5GA 5ALKA 4H7IA 2XUHA 1GGVA 5HKBA 3WJ1A 2WHRA 3C6BA 1MX1A 5ALZA 4B84A 5D3KA 2OCKA 3WI7A 1EH5A 3I6MA 4DMCA 3F8SA 4UFNA 3QMVA 2WHQA 3R3VA 2WFLB 1CUHA 2DR0A 4GLBA 3ZI7A 3C6XA 4XX1A 2WG2A 3WK7A 5C8ZA 5ALMA 1FFCA 3STXA 2XLBA 2AJ8A 5T4BA 1BEZA 5CBKA 3B5EA 5LZ7A 3DQZA 2O7RA 1EXWA 5AM3A 2WQZA 1CUSA 1AGYA 1EHYA 3GELA 1N8SA 3QITA 1WHSA 2B61A 1UKBA 3I2KA 5JD5A 1JJBA 5CH8A 4G8DA 5AOAA 4ZGBA 1ZI9A 4HXFB 4K6KA 4Y2RA 2AJDA 5AICA 1E8MA 6YASA 3OC0A 5JZSA 1R50A 1LNSA 5ALPA 2JEZA 1BRTA 4BP8A 5ESRA 5CT9A 1QO9A 3I6YA 5KWJA 3WK9A 4RGYA 4BRSA 1TK3A 2PSHA 3STVA 1A7UA 2WKWA 3KDAA 1MAAA 4ZWNA 1AURA 4YPVA 4Y2UA 2WU3A 2HU7A 5BOVA 2LIPA 4B6GA 3B3QA 3O4JA 4MQLA 4DM7A 1XLUA 2OAEA 4QDUA 3AIMA 2WTNA 3WZMA 1CUCA 5ALJA 4UBLA 1CFJA 2HA7A 5IVKA 3MUNA 2PM8A 2OG1A 1K5PA 2VA9A 2WG1A 1CUDA 1CUUA 2FJPA 4PQEA 1VJ5A 2B20A 4BCBA 1DWPA 4X90A 5ALFA 2D0DA 4F21A 4EBBA 2E3JA 4F0JA 1Q83A 5FDFA 4WDQA 2CMFA 1CUGA 3K9BA 2J4CA 4ITVA 3V1NA 3D2CA 4N8SA 5C8XA 5ALYA 4PW0A 1EK2A 3Q8WA 3WKCA 1IUPA 4WY8A 2PU7A 3V48A 1BCSA 3H19A 4HRXA 4J03A 1FFDA 4WJLA 5J3JA 2AJLI 4P9NA 1SCIA 3QMWA 3NWOA 2HFJA 5KBYA 4GHWA 4MJ3A 2GYWA 1SC9A 3FLEA 3VJKA 3LS2A 5AH0A 2VJBA 4UPDA 5K3FA 3DD5A 1TRHA 5LYYA 4G8BA 1IMJA 4DNFA 1JJFA 4DSZA 4YK7A 2WM2A 3B12A 4P93A 3HACA 3I2JA 1W76A 4KR0A 3W04A 5JZBA 2JGMA 3WKDA 4ZV7A 2XMDA 4MEBA 4EB0A 4JUIA 4UHEA 5K3CA 3C8HA 3C43A 4FKBA 3O4IA 3FNBA 2XE4A 3WL6A 1G4HA 4TVKA 1MX5A 4BVKA 1THGA 1QIHA 3STTA 3SC2A 4A23A 1E66A 1XRNA 4FMPA 5DNUA 3R41A 2VAVA 2QJWA 2HRQA 5JZ9A 4QWMA 2DHEA 2H7YA 4PO3X 3AINA 1VLQA 2FX5A 1LPSA 4W63A 4IHAA 5K3BA 1BCRA 1B6GA 3H1AA 1A8UA 5ISMA 5AKYA 3K6KA 5AKHA 4M0MA 3TJMA 4BDTA 1IZ8A 1L7QA 4J0DA 1VXRA 5AKJA 2VJAA 3AUKA 1EVEA 2WJ6A 4GBGA 1CQWA 3RLIA 4U2EA 2VJDA 3G02A 4L9AA 1QJ4A 3WLAA 4HS9A 2OLEA 5DJ5A 3WQHA 2QTBA 1Q84A 2DQYA 4BE4A 4EY4A 3WKEA 1RP1A 1UOOA 4WFJA 4YASA 2DFPA 2ZSIA 2QR5A 2XT0A 4U2CA 4KE9A 4H7EA 1DU4A 4GDMA 3WL5A 2BKLA 2QVBA 4KRXA 5K3AA 5CT6A 3WL7A 4B80A 2PSJA 4PSDA 3C5VA
chains in the Genus database with same CATH superfamily
1ANKA 4OHOA 5ALGA 5G1PA 2C7BA 2EFHB 2Q3HA 1K6XA 3B1KA 2DR2A 3PQ8A 2IEDA 4I08A 4TL7A 2PUDA 1VIDA 4M9SA 5H02A 3CYFA 1PT9A 4YJHB 2XA2A 2P7IA 4IXWA 1WUIS 4M1EA 1HOXA 4IUBS 4RLHA 4PAGA 1XZEA 4MGYR 3OCZA 3RVOA 4WDRA 1WY5A 2JGLA 4NJEA 1AB5A 3R23A 3TZQA 2RJNA 1Y7PA 3AV0B 3B1YA 3Q7TA 4OJMX 1H2FA 4LRTB 1TAGA 5AM1A 4PQGA 3DUFB 1L7PA 3QW2A 2H1IA 2PAAA 3VKHA 5TGZA 2FK8A 2PRZA 1H93A 4X7PA 4H6PA 3AF1A 2JLUA 1SVWA 5CX1B 2Q28A 3BZUA 2ONJA 3U40A 1K2VN 2I6UA 1Q0ZA 3SOZA 3DUWA 1ILWA 1OAKA 3OA2A 2EDAA 3RKUA 4F06A 3VYSB 5I7WA 1ZQ1A 3OU7A 1N8NA 4RK4A 1Y3HA 4DQUA 3EFHA 3IQXA 2IYEA 4R81A 3BICA 4J3JA 2UYHA 1DEHA 2WT4A 5TEWA 5KREA 4NBVA 1UBFA 3AEXA 4IDNA 1HPLA 1E3WA 1NFRA 2Z2KA 3BXZA 3HR7A 3ENKA 5AUQA 4BLOA 1I6LA 2JDIA 1ZGBA 4GM1A 3PX2A 5AKLA 3D8SA 1I10A 5KNBA 2HPZA 3AF3A 3ICWA 3ETNA 4PYMA 5FL7D 3O9MA 4MVJA 3WISA 1NN0A 3ABRB 4LHWA 4X1OA 13PKA 1Y4DE 4XYBA 1E58A 1H05A 4XWTA 1SB9A 3IERA 3A6FA 3SKXA 4PEVA 4DUPA 1DJLA 1BROA 3LCUA 2AIRA 4BQEA 2RGEA 4ES6A 3A1TA 4EG6A 3CLHA 4NATA 4NYMQ 1TE2A 4UNQA 4JBIA 4OSPA 1Q0UA 3KTAB 1P60A 2G76A 1JHVA 1XAIA 4LXTA 1JALA 5REQB 5D3MB 2V6MA 4YRGA 3FVRA 4GYKA 1EUQA 2CNWA 3JYNA 4JC0A 4ETIA 2I78A 2DCMA 1NY6A 3HSSA 3P9SA 5AQ1A 2KM1A 1CR2A 1NVTA 3DZIA 1CUWA 3VI4B 4RZHA 4CCWA 5AW2A 1C1DB 1X92A 2VJCA 3O4HA 2VIIA 5ULLA 3OAAD 2ZE8A 4FX5A 4B85A 2R47A 3K0AB 3DTTA 4B6OA 3T35A 3CF2A 2CJPA 2YXPX 2VT2A 2GEVA 2Q5OA 2VF7A 4MDYA 4Q66C 4FZ5A 1UBGA 1EFVA 3EFOB 2XB4A 4BMVA 3Q9NA 3BSYA 3RS7A 1DRWA 3HHPA 3PUJA 2P2YA 4AP9A 3JQGB 1PX0A 2WJ3A 4OL9A 1EGQA 1H2WA 2H4WA 2IC5A 5JJLA 2NYVA 4XUEA 1BE0A 2VH1A 3H3FA 1RWPA 2EERA 4E5SA 3QKRA 1OPXA 5C7IO 3PSAA 5EZYF 1XAJA 3M82A 2AMJA 1PU2A 2GSDA 1WB5A 2HNAA 2JD0A 3V4PB 1MVOA 2IOFA 4EL0A 5JASA 3ZNOA 2OGUA 1UIRA 5AVVA 4FBGA 4JUCA 2P8SA 2WIDA 2VYQA 1YD7A 3LVBA 4NS1A 4V2IA 2A0WA 3HCOA 4JJ4A 4LFAB 3ZWVA 2I4TA 3LUPA 5ALVA 5IH7A 4BWFB 1YIDA 4CQLB 1T1RA 1K7YA 3B1VA 4R0NA 1JGTA 4US2R 3HKEA 1PFWA 3L0IB 3V3TA 2JGKA 1K7EB 2ZUWA 3BFVA 3L18A 4L78A 5G0TA 4FOTA 2GKGA 4HP8A 4G5HA 2E4ZA 3D8UA 3ZHBA 5FOXA 4RTSA 2QT0A 4XQ0A 4EARA 2NTEA 4HTAA 4HUQA 4LY9A 2Q2VA 3FFWA 3VVCA 2LW7A 3O0TA 3V8NA 1U8ZA 3W77A 3OIFA 4IVPA 1U2TA 4HO1X 4KYTA 5J2UF 2UVQA 2PRKA 5HQJA 4XLTA 1GNSA 4P2BA 3H04A 3Q8MA 4MHSA 3ZG6A 3RSGA 2VWHA 3EZXA 3OTGA 4JB0A 4FHGA 4BKPA 4Y0NA 1GPKA 1UBKS 2ZE7A 4Q6WA 1VC2A 5FOQA 2ZP1A 1Z33A 1A9PA 4D3YA 1W94A 4MWCA 2R8YA 2ZIZA 5IZCA 1DEKA 5A7FA 2AW3A 3LHSA 4M9CA 2RBKA 3Q9LA 1SOAA 5CDTA 4K88A 4ME6A 1ZD9A 1B76A 2BFBA 2QZJA 4QZVA 1L6RA 3RDPA 1X1TA 3ZGVA 2IY7A 3IO3A 3BD9A 3AVOA 4CT4B 3H5WA 3G5AA 2MMGA 3E7FA 4GX0A 1T6ZA 3C97A 1GUBA 4WXYB 1VDMA 5EHZA 3NNSA 2CV2A 1KOGA 3ZS9A 2PNJA 1IIRA 1V2GA 1XAHA 3EQ6A 4TUYA 1VCOA 4HZUB 4LMAA 5EJAA 3P4YA 1XZGA 5JS8A 2E49A 4L8YA 1K75A 4NNJA 4V0SA 4BKRA 3CZQA 4ODIA 1C1XB 1MO2A 5AKKA 1TQHA 821PA 4KQXA 4DM4A 4ZCLA 3TXXA 2FE1A 3CUSA 1DAMA 3OJXA 4KC0A 2GD2A 1DIOB 2YJGA 4MTCA 5C3MA 2BMEA 4MLDA 4B5KA 4MLZA 4HL6A 1QVAA 3ZZ1A 3WOVA 1TADA 2H00A 2I6FA 3ETGA 3EH2A 1EFAA 1QIJA 1C8BA 1SCJA 1RD4A 2IPOA 3TI7A 4BO5A 1XGKA 3QM1A 4BQIA 4U39A 4YP1A 4L51A 1XKTA 5JAOA 3LOPA 3EDYA 3K8YA 1DKRA 1L5MA 1XD9A 2PUTA 3BIXA 5LQKA 4MVJE 1KK1A 4CEJB 3QSGA 4DCMA 1VXOA 3OT5A 3UO8B 4H27A 4QHYA 3AGPA 2QXTA 4Y6RA 3JVUA 5FHQA 1N33B 3IOBA 5AJXA 4EW2A 5KTKA 3IVRA 3GVPA 1IU9A 3BL8A 4CIBA 4AQDA 2ECOA 2V7EA 3KXLA 3UJ9A 5C1BA 4QQNA 4C0QC 3RTGA 3A4IA 3O1HB 2BL4A 3GJZA 1U8YA 2H0QA 3V1LA 3BG5A 3VGPA 2W8BB 1PNQA 3OZGA 3ZCRA 1WXQA 1HO3A 4RVFA 1ZNXA 2NO0A 1Z0ZA 5IFKA 1XX6A 3ZBTA 1N1MA 1EVQA 1UMCB 2WUDA 3UPDA 2JA1A 1IJKA 1FTSA 1SC4A 1YQDA 2N3ZA 2SKCA 4RTOA 2VTBB 1UPBA 4J1NA 2C2WA 2MJLA 4DCGA 2X1LA 3AJ9A 4EI7A 3VOSA 2G72A 4C0LA 1VRCA 2JLSA 2Q8PA 2QDKA 4CR8A 5CRIA 1ZC3A 3PLRA 4D8TA 1OI3A 3U4MA 3TW8A 5A4JA 1A2KC 2KJQA 4WOBA 4KXVA 4WBSA 3EVAA 4L5AA 2BP7A 4MWZA 4ZTZB 1G2PA 4S35A 1XQ6A 5CCEA 2R751 2JJ2D 2QY6A 4Q3LA 5CAEA 4LBWA 1VMDA 2BW0A 4TQUS 2PUEA 2EP5A 1NFQA 4R3WA 1XZBA 2VHCA 4IGFA 4H6WA 4JASB 1W75A 4NABA 5K0LA 5HX7A 1FMTA 5AXDA 5D01A 4AVYA 5C5EA 4B75A 1AMUA 3M5PA 2CVFA 3DXYA 2ZRCA 1L5HB 3PJEA 4JLOA 2QRMA 3ZX5A 2XWPA 3IMFA 1KQOA 4UOQA 4NMHA 4RCVA 3U0BA 3FPEA 4QYTA 3SXUA 1VPVA 2VQ3A 4U63A 4V39A 4CWAA 1C4OA 3E2MA 1CU1A 1OFGA 4I8DA 2PIDA 1U7OA 4GI1A 2RGBA 3ZHUA 1DP4A 5F7OA 3SEQA 4OM7A 2DFTA 1D5WA 3BOSA 1I36A 4HPWA 1KY2A 1ZH0A 4YHHB 2YQ5A 1JECA 1T9KA 5DTRA 4N5NA 2P9EA 3DLHA 3TYXA 2DT5A 4FIZA 4JP3A 2HCBA 2JFUA 3EOZA 1KDVA 4KFTA 1I7QB 1N2CE 2QSYA 3AHJA 3CSSA 1NBAA 4AXXA 1OOEA 1T15A 2NYAA 3S4YA 4AICA 5KYTA 2XQVA 4YCNA 5LL6P 1FNNA 3VC2A 1CQZA 1W2GA 3R2JA 4WNCA 3CR3C 4BEVA 1DRKA 4LSZA 5HNKA 5EWLA 4IXDA 4RHUA 1QIIA 2B21A 5CB4F 1PEKE 3H2JA 3D81A 3IP1A 1IM2A 4TWAA 5KO2A 3FNHA 2J08A 2OUIA 3EZ7A 3T9AA 4IIUA 4Q4JA 5LN1A 4BAUA 4G5SA 4KB5A 1JEQA 2BJWA 4PNZA 4DIOA 4YAUA 2CV1A 2Q9CA 1BGVA 1N6NA 4GRDA 4GZ6A 2NNLD 2FPMA 4PF1A 4RIIA 4BQPA 3DMNA 4Q02A 1E2IA 4LY0A 5SZKB 3RV4A 1YF3A 1DQPA 3HLKA 4RE6A 2QT1A 5EJ8A 1W6UA 3CINA 2RK3A 2VR1A 4M8KA 4Q34A 2GPAA 3GO4A 3D6VA 4EYKA 5C37A 2IZ1A 4M1QA 3B36A 2REXB 1UOPA 4RESA 2EJCA 4MI9A 2FETA 4DA7A 2C2OA 3HEBA 3R0VA 5SYMA 4JDPA 3UA3A 4BVLA 5JXWA 2WTUA 2VHXA 4F9GA 2DSNA 4D46A 1RJWA 2ZXEA 4O2LA 2OHGA 3FTDA 2OHIA 1BH6A 5BWMA 1P62B 3UN1A 4BC1A 2X9QA 3HKDA 2BGJA 3ENQA 1FFHA 2VRWA 4FR2A 4H7DA 4P22A 4DLNA 2QTHA 3EXG2 4KMOA 5KWIA 1C80A 2A9RA 3PB3A 4YBRA 4CLRB 3I5XA 2ODBA 2EEZA 1L7XA 1A88A 2NADA 4IDDA 4MWOA 3SQMA 4FGJA 1ZXBA 3DMDA 2H7VA 2YS6A 1Y8AA 3DBLA 1DUIA 3ITNA 1U3GA 2CB9A 4X3OA 3RTAA 3QE9Y 1P2FA 1XU4A 1IXRC 3NATA 1TCAA 2F43A 1S1CA 4O2AF 3R8CA 2ZI4A 1HM5A 2QQ5A 4M8LA 1UKZA 1BN6A 4YLGA 3HFJA 1RRFA 1IWBB 1GUYA 2WJVA 5K8UA 7MHTA 1H8HA 1B00A 1X19A 1HE5A 2ISQA 2IHBA 3DKIA 3WL4A 1JILA 4KFRA 4UBIA 2YZKA 1IUOA 3AJRA 3MJRA 1E6LA 2DKFA 4GQIA 4IH4A 5D87A 3WSWA 1PGJA 2VLIA 3FYCA 5G0VA 3S8EA 2ONYA 3P32A 3R3JA 4JXKA 1CCWA 3EN0A 3ONWA 1GQSA 3U49A 1OTYA 4HAXA 4ZC1A 4AKHA 1GU7A 2P1ZA 4XARA 3QRWA 1TEZA 4CFYA 1YB4A 3S99A 4KIFA 4EW6A 3FYUB 2B4TO 1SRRA 3IHWA 1SBHA 4FJ2A 4QKQA 3UXYA 2R6GA 2DHQA 2UUPA 3TR5A 4EVIA 3PWKA 1JI3A 3P26A 1A3CA 3KTDA 3VOTA 1O6ZA 2AW5A 1Z2EA 1AE1A 5FO0A 2PX6A 1V5GA 4MYCA 1XDZA 5JH7F 2HH9A 1JDNA 3OG9A 5E2IA 1OLUB 4NCXA 3HBNA 3KZMA 5C35A 3FWYA 1M6VA 3RS9A 5G02A 4ER5A 4ZKDA 4FONA 3KT8A 2DHRA 4NHEA 3ET4A 4I1PA 1G6Q1 1KEZA 3OE5A 1P18A 4H7HA 4TYQA 4A6EA 2ZM6B 4KRGA 3DF7A 2QM0A 4HPXB 5B7PA 1XDSA 5CDHA 1QFSA 3ZCQA 4FUQA 2FN9A 3PIRA 2R11A 3KUXA 4OJKA 2HRCA 2WZDA 2VHVA 3LLMA 3WGOA 1N75A 2BN4A 2CV0A 3KJIA 1UCFA 3W4IA 1YU6A 3CMCO 3P2EA 1ISPA 1WXIA 4E1VA 1XAGA 3FKQA 3KQWA 1N2SA 5JCPA 3UENA 4C0HA 3ZE9A 4GL2A 1KZ6A 1SUFA 1Y42X 1W5SA 5F23A 4NNOA 2Y93A 4OMUA 4TQAA 9ABPA 3NHFA 3OT1B 3T1QA 3EG5A 2YZ2A 2QLLA 1YMQA 4FCWA 1J2YA 1Z6PA 1FJGB 2GPNA 3MWLA 2B0CA 1J07A 2PXXA 3F71A 3M0EA 1P1HA 4BWVA 2J3EA 3PHIA 2PYDA 4Q4LA 3RUPA 2VT6A 1KBZA 3IDFA 4MW7A 1YRQA 3INYA 4IX9A 2JJYA 4HDRB 5HK8A 3M9LA 5AW9A 5AD1A 2FKNA 2XYHA 3V6LA 5CFLA 4GFDA 2FF5A 1YSCA 2HBRA 5JANA 5JS2A 2B9EA 3ZJUA 4TZKA 3DAFA 1YNOA 3QOFA 2QBYA 3JQQA 3QPDA 1KI9A 2QPAA 4X85A 3CKMA 5IT4A 1TTPB 4IJUA 4KAJA 3L7NA 4OYRA 2C0QA 5TXGA 1I2MA 2PFKA 1HDOA 1FJHA 1M8KA 2AG1A 1QCZA 1P29A 2H2AA 1INLA 2O1SA 2QRKA 3F3SA 4OJTA 4EO7A 1O8CA 5MGBA 5TF0A 1A76A 3D6HA 3BDIA 5LXTA 4FGKA 4PSCA 5GONF 2QX4A 3H9BA 3UANA 3VHQA 3QOYA 2DVMA 4C6SA 5BWNA 4XR4A 2HN9A 1HLPA 2YX1A 4YJGB 2OM6A 3LT0A 3PVCA 5DLYA 4C4RA 1OB2A 3NHSA 5KSPA 4M1KA 1NOJA 2A1TR 3T3EA 3DPUA 4ND6A 1G3UA 4UARA 4R9NA 2BPOA 4GM0A 2PVPA 5GAJA 3GQBB 4US0R 2RC6A 4YCLA 2H1VA 4G5RA 1AX9A 3KZKA 4DIDA 3AWIA 3P71T 3RQSA 2VWPA 1PJ3A 2OY0A 2ZUUA 4A8TA 1T2NA 3KFVA 5B53A 1SXJA 5FOTA 1ONOA 5BN1A 2AJCA 3NGLA 1D6JA 2D3TA 3NHZA 1R1DA 2H4XA 4NYJR 5CMLA 4RPLA 1R16A 1U04A 2JGAA 2MSDB 4IRMA 3KEOA 2OSBA 1W8DA 1UZNA 2Q50A 2QSJA 2ZANA 2AK3A 1TW3A 3KUCA 1IL0A 2C3UA 4K6HA 1AA6A 1G66A 1RCFA 4JP8A 1VHQA 2B4AA 5A6VA 4X91A 2JLZA 3GFQA 4CMEA 4ZVUA 1RQ2A 3GUVA 1YFKA 1QZUA 2E7ZA 3ADOA 4X60A 5DWVA 2OKCA 1BQ4A 1JXOA 1YK1A 2X19A 2K87A 1PYGA 2EDCA 4EKNB 5AVOA 3KPYA 2DWQA 5D86A 1DJPA 3QFTA 3PCXA 2RHRA 2C59A 3OKCA 5KU1A 5BV1A 2P68A 5CPFA 1M2OA 2HBYA 3BD6A 3ONDA 2QQEA 4BASA 2CLHB 3E9DA 3UAGA 2WK1A 3RLFA 4CEHB 2NPFA 1GV1A 1R9NA 2QL6A 2RI1A 3DYVA 4LYDA 1X1RA 3KYJB 3PUIA 4FHDA 2H2IA 2HQSA 3KKPA 3NASA 4EPWA 3QYFA 1KMCA 3W5DA 2ZSAA 2XYQA 1EK1A 1XQWA 4F4FA 4JI7B 3R5TA 1UBRS 1NOKA 2DPXA 3ETHA 3VHXA 3JQBA 1RHRA 2JGRA 2GTHA 3P1JA 2ZK7A 2VEOA 3H83A 4MI1A 3A25A 4TKZA 1XCBA 3L7KA 4Y6GB 3KK0A 2HF7A 4DCJA 5AVUA 4Z54A 1WXEA 1I4EB 3K16A 1XCLA 3KAKA 1VSUA 3OC6A 4CNBA 2UV8A 4YMWA 1N8TA 1IN7A 5IANA 4KQ2A 2WE7A 1B3BA 3A32A 1PZNA 3HB0A 3V7UA 2OK7A 2E6KA 1XWFA 3D8TA 1NDUA 1MAWA 5K6AC 4BVHA 4FW9A 2ADFA 5AOCA 3H2GA 5AHKA 5CLIA 2QRHA 2JLRA 3ORHA 3TOVA 3VVLA 2J87A 3HFGA 4DUGD 2W83A 4EG8A 1H1LA 1D1QA 1KY4A 5B1SA 5A0FA 2VSQA 1VGRA 5DOZA 2HEIA 4XFDA 4EELA 5GTDA 4UZEA 1J00A 2KHZA 3E4CA 4HGYA 1JLRA 4JYPA 4B3XA 1R5JA 2N9UA 3BL5A 1RJDA 1WXXA 2BJVA 3JWEA 3OLXA 1L4GA 2HU8A 4EO4A 2Q1WA 2PD3A 1RTTA 3GUUA 3PD7A 3CZRA 1EQUA 4XB1A 1GAQA 2HEGA 5JAZA 3O8CA 4Y1RA 1S9HA 4I1UA 2GXQA 1HRDA 1QBGA 4JI3B 1YHYA 3SZMA 1E9EA 1Q0TA 4MQUA 4MQMA 4Q9LA 5H3CA 4I1IA 4P32A 2YXLA 2IUFA 3UAOA 2A92A 4H18A 1VSBA 2Y99A 2V9PA 4IBOA 4PFQA 4GICA 4OGKA 3F6BX 5IBPA 2OEPA 4GIBA 1PG0A 1WHSB 3Q10A 3KKLA 4IHJF 4UM5A 3DO6A 5TJHA 1CY8A 3QEAZ 2K7ZA 4HX9A 4D9EA 5LP1A 1SQ5A 3UJ3X 3GMTA 1RKVA 5HG0A 1PD0A 2FB9A 3CHYA 2OHXA 4MP3A 3GEIA 1Z16A 3EZ2A 3N87A 3T4EA 4CGZA 1QCYA 4EAQA 3EE6A 3F2IA 1EP3B 4G8CA 3H1GA 2VTKA 4EDFA 2AOXA 1UANA 1RWQA 2FR1A 4KMMA 5GJWC 1V6SA 2BFOA 2FPIA 3RKRA 1K97A 4AF8A 3K35A 4JXJA 2CFRA 1QQ7A 4D9KA 2JKVA 4EJ0A 1HFKA 5M7EA 1W48A 4B9AA 2V7BA 2X4LA 3K1ZA 1YVPA 3KJGA 5F1PA 1J2RA 2ERYA 4C2UA 1FFWA 1H3FA 1KL7A 1NVWQ 2MYPA 2RE8A 1FRFS 1OFVA 2WB4A 1NVVQ 2G3YA 2Z83A 3OZCA 2XV1A 4U00A 4C87A 1TC2A 4PXAA 2QY9A 4BU1A 1U9IA 1P61B 3FPSA 1UT6A 1DBQA 2IPXA 3BWVA 4BZQA 3NDBB 2PL9A 4WNIA 1RKBA 2RKBA 3IPAA 5HQTA 2MINA 5BWOA 1WDKA 2IKQA 1WPXA 5EP3A 3TSAA 4B3SB 1YRBA 2YXEA 3RVJA 5DP1A 3B3AA 3WK6A 2UUBB 4J76A 3UUFA 3QLUC 4AROA 2R0QC 4IQ0A 2VTVA 4QBKA 2C9YA 3NIFB 2H57A 4W5WA 2GHQA 1ZD4A 3REQB 2ECFA 1SXJE 4JENA 3H17A 1SELA 2EFJA 1ZJYA 2GWHA 5K8LA 4LXGA 4JGIA 4ZANA 3A1WA 3M5CA 1Z7BA 4DA4A 1SD2A 1ECJA 4E30A 5FOSA 5CFOA 2A67A 1G98A 5JCZA 1YZTA 3OM9A 1CNMA 3NV9A 4ZVQA 5EIFA 3DW3X 4ZOCA 3COJA 4RNDB 3VNQA 4Q3BA 1GZ4A 1KK3A 2Z57A 1AS3A 1U0TA 2HFKA 4FFWA 4MVCA 4UD6A 3VDRA 3ZEIA 4D0SA 4CKYA 4ZO8A 5TX7A 1WCIA 4M0CA 4PX5A 4RZ3A 4AJNA 1EJ2A 1OT5A 1J1UA 1TQ4A 1ZDMA 4RVUA 1BKSB 3EYWA 4LHVA 3O1JC 3QVOA 2A9PA 4A8JA 2R9VA 3K30A 4BECA 5JRDS 3ZJVA 1PKXA 4D25A 3PC6A 4DSUA 1QQAA 2GVZC 5DM70 2W2TA 4BYMA 2G0TA 2IOQA 4YC7A 4C01A 2B7CA 4GGMX 2D5IA 1P0MA 3ONEA 3OCYA 1WBDA 3AIOA 3V32A 4E6EA 3QPCA 4O8CA 1EWTA 2FP4A 3LM8A 1BW9B 1DCFA 2ZT6A 3FTPA 1EZ4A 4B3DA 1VJGA 5IT9A 4P7JA 3LXUX 1KAQA 2QKYA 1X80B 4PPFA 5CA0B 1C7JA 5JS1A 3O8LA 2V3VA 2CBGA 3AF5A 5L51A 1M6YA 4XEHA 1IY9A 3WZ2A 4YRZA 1BCSB 1UQRA 1CD5A 3W7AA 1OU4A 2YOFA 5CK5A 4YV7A 2D5AA 3EZ9A 4H1VA 1DE0A 1KP2A 5AUOB 3P9IA 1SBIA 1K0UA 2HQBA 3NTOA 4NQRA 4NZPA 1UDXA 4I4IA 1KETA 3WLSA 4CG1A 3H97A 3NHMA 2P9TA 3LO5A 5DI3A 3HB7A 3R6TA 1VIVA 3BM5A 2ZPUA 1MQAA 1E5DA 4D1YA 5FORA 1U99A 2QAGC 1JDTA 3N07A 1JIIA 1V1RA 1DAFA 3HP1A 3COZA 3HCNA 2G9RA 1R88A 1TUBA 1UXJA 3CTMA 4X45A 3FDZB 1Z7WA 4MVJI 2QOEA 1IN1A 1SHTX 1NW4A 2EGUA 3CKKA 4OGGA 1Y3IA 4EI8A 3SIXA 1F6DA 1A4UA 1AMNA 1FS4A 3HDYA 5LZ9A 3I5MA 1XPOA 3MHTA 1MJNA 3FM9A 4OHBA 2NZJA 1VMIA 2COEA 1WY7A 3UQZA 1G2QA 2PGLA 2ZJ7A 1NNLA 2PX4A 3CVOA 3PSHA 4Q7MB 5EGNA 1OV6A 3VR1A 5LP6B 4BYGA 5ECYA 2G40A 4IIVA 3LTNC 2HDOA 1BHO1 4IJQA 3WA7A 5L7WA 4NI5A 5E6SA 2JVJA 5DX0A 2C8VA 2GAOA 2QMEA 1TF5A 2A5YB 3M1IA 4J16A 5FNVF 5L6LB 1XTZA 3IAAA 5IN4A 5JT1A 5DTQA 4B3TB 1LDNA 3K09C 5HF9A 2I2FA 4YDSA 2XVXA 2COKA 2YMPA 4UTNA 4PIPA 5ER9A 2DHDA 3LDAA 1KI1A 2XCUA 4WZAB 2I2CA 2VCEA 2B98A 4H6XA 4KH1A 3IAUA 2C3MA 1JIJA 1YQGA 1US8B 4LIPD 1F2UB 4I99A 2ZSBA 4BV2A 4YQZA 4I6EA 4MINA 2ZYHA 3IV7A 4U0JA 2G77B 3RBAA 3NM5A 1C0PA 3IBTA 4ND2A 4GWLA 4IJWA 3PYLA 4Q39A 5EXEA 2LWIA 2XWSA 4DTCA 4L0MA 1B8PA 2PJZA 5JCJD 3PXBA 2GUGA 1OWPA 3TIFA 2PQ6A 2RHHA 2PPVA 1HH4A 2CJWB 3ZQ6A 1WLYA 2OAGA 4ZV9A 3AFHA 5HF6A 4RPIA 3RSFA 3PJRA 4R4JA 2PD6A 2HT6A 3IHLA 2WF9A 4PRKA 1T0BA 2CYCA 4OGWA 3QWIA 3VJLA 4C6TB 5I7UA 1EP9A 2FLVA 3EEBA 1T3LA 3FY4A 3BRSA 2Z8YM 1BCRB 4Q6BA 1TVKA 5HMLA 4EMSA 4U7HA 1MV8A 3P97A 1YR8A 2A9QA 2O2GA 3JAKB 1KEEB 1MA3A 3FB1A 2F9FA 4MMZB 1NQUA 4U3JB 4E4YA 3MJ4A 1YJ8A 2JA2A 4S1VA 1SZCA 3GH3A 1Z6TA 4WLVA 4BJ5A 1B23P 3E8MA 2C98A 3BVPA 5AWFC 1SFRA 4ZZ2A 3H7IA 1GNQA 4IWXA 3RVSA 5HUJA 1R5BA 3S70A 3OQPA 3VBEA 4E1BA 3C74A 5FUMA 1J22A 1HFWA 4I8XA 4Q12A 5E6RB 4I1YA 5GMOA 4ERNA 1JDBC 2WAOA 1SUAA 1K6JA 2GN9A 4RHXA 5CBPA 4J0KA 1BYUA 2RGNA 1JMKC 2VHTA 5SYAA 4KLCA 4UQOA 5H59A 5CB4B 4DBVO 1QYDA 2NXWA 1Y1PA 1NJ5A 3EA5A 3T5BA 1G21E 4HJXA 4YCDA 4MR8B 1T0UA 2CL6X 1PJ2A 2FEAA 3AI2A 3JVIA 3FFXA 1T5LA 4RIHA 5ALWA 4KPGA 1OJLA 4L2IA 3Q85A 3PITA 4TMTA 3SSOA 2FW6A 2R60A 2A8YA 1U65A 4S0ZA 1GXSA 1P72A 1SU8A 2OV3A 2WD8A 3PEUA 4YI3A 2DUMA 5CEJA 3BQMB 2ZB2A 2EQBA 1QH1B 3K3PA 4JR0A 2JGDA 1GZ6A 3AKDA 3NHAA 2ANCA 1ICIA 4H1UA 3SS9X 3FCOA 3TVDA 4GC5A 4NFHA 4PSKA 2VLBA 3DB2A 3ONFA 3HEMA 4AXBA 3BK7A 4CL8A 2XVYA 4DNPA 3FHLA 3ZCTA 4ZV4A 1GPUA 4OQQA 2PCLA 4BFXA 3GARA 1JU3A 2VI5A 3U5TA 1Z5UA 2D2XA 4D42A 2J9XB 5DBIA 4H3HB 1QG2A 4E3ZA 3K8ZA 4ISCA 1C4XA 2FP3A 1CRWG 1AF7A 5CFQA 4QTTB 4BFTA 3VSCA 4TQ9A 1BMTA 2Q6IA 3SR3A 3PV0A 5AK4A 1KI8A 3QWAA 4HXEB 3I1IA 3S2ZA 4MVXA 1UZLA 4IUYA 1PQ4A 2HHCA 3QELB 3ZGNA 4BCCA 2O19A 1JSLA 3P9KA 3EMVA 2PJRA 4ZVKA 5JLAA 1XROA 1LF0A 5FTKA 3HCPA 3V42A 3EXEB 3W6PA 3CU5A 3M81A 4IILA 1W1WA 3VZPA 4LOKA 2PWBA 3UMJA 4D02A 4OQ4A 3FLBA 4YJ3F 4X71A 4U7FA 3CONA 2WQ6A 2PQ0A 4I6JA 5FWXA 5BUSA 3IAXA 3OQBA 2WHPB 3QH4A 3ORFA 2WICA 1CQIB 4HRAA 4XYGA 1XNQB 1A8SA 3LVFO 4P4SA 4MI3A 4RYDA 1PJQA 5THXA 7MDHA 3IUEA 4PHCA 3A4NA 1CXZA 1PHPA 3QFRA 1QKIA 2NSHA 5FFFA 2IBTA 2R96A 4IMRA 4AL4A 3N2IA 2H2GA 4UJ3A 4QM7A 2J9FB 3ETDA 4ZXFA 4RTKA 4KPUB 3GLIA 1H4TA 4XWOA 5FPYA 3EGEA 5A5GA 3FLMA 5A9TA 3GFPA 3BHNA 4OUKX 3AZPA 1JRLA 2DFKB 1Z12A 3VDXA 2YVKA 3I5UA 1BWQA 3LY5A 4GE0A 2ZUFA 1FPMA 4OIMA 3DONA 5JH7B 4LVUA 1GSOA 2E89A 3KU1A 4WN9B 3ZWOA 3Q11A 4M76B 3L7MA 2RDMA 1S3SA 4XQCA 1CG6A 1NQOA 1SRQA 2WYWA 3RVKA 1E4OA 4TV9F 4B31A 4LYJA 5H16A 2YZGA 4BATA 3O7MA 3NWPA 1M9NA 3BHMA 4RWZA 1RAGA 4JIMA 1QM5A 4GLLA 4FS3A 4R8SA 1X7YA 1DC8A 2AYZA 3L0OA 3O9VA 1V39A 4G25A 1JZSA 3CNOA 4X6LA 2I55A 3QHPA 4KBGA 1L7BA 5ALXA 1NLYA 2CNBA 1UC5B 2QTRA 1R37A 3ZE1B 1VJTA 3WBFA 1OC4A 2EP8A 4A91A 3PF9A 1NUSA 1VLLA 2C2YA 2CVPA 5TGTA 2I1LA 2LKDA 1FXSA 1P3JA 3PUVA 4F7WA 1H3EA 4L1KA 1CUJA 5F78A 3F0TA 3LOQA 4D9GA 1KJZA 2LD4A 2BBSA 3WLHA 1I33A 4GRIA 4BO0A 2QTFA 4A1OA 4I5GA 1XXLA 1PUIA 4J4TA 1PWHA 1Z0FA 1DQSA 1GITA 3HJNA 3JVEA 3JQ7B 4BIIA 5A9SB 4X65B 4P3KA 4C14A 5LD2C 4FNOA 3U37A 4HQLA 4QWWA 3LK7A 4IZOA 5HIIA 1EUCA 2Y68A 1FJ2A 4G9BA 4PBSA 4LF6B 4C05A 3QFCA 1J5PA 2CVQA 1D2GA 4MHOA 3VDNB 3O1LA 1D6MA 1N0IA 4FFLA 3U17A 3X1XA 3L49A 1F2TA 3TR6A 4QPZA 1REQA 2OP1A 3T7RA 3ZWYA 1YUBA 1BMFD 5J40A 4NXMB 5HDBB 1M0SA 3OFKA 2F4VB 4ZK2A 4GP9A 1LKZA 1HL3A 1XVAA 1IM8A 4QGHA 4B83A 4PLWA 2QPLA 1K3FA 1S8AA 4ZXPA 4BB9A 1PGOA 5KX5F 5GADl 3QPVA 2VYCA 4ZYWA 4J3FA 1M1YE 2JGNA 1SHZA 1UKAA 5ALUA 1J56A 3UHAA 1XP5A 3O8QB 2X2EA 1L1FA 4B47A 4NYIQ 4R2IA 3CWCA 1TKRA 1CB7A 3B2EA 3G2HA 3BWXA 1K7FB 3K2EA 4IUCS 4KMRA 3HBFA 2AXEA 1BXGA 3MZ0A 3VTFA 3AVQA 2ZRKA 1HDIA 2OKGA 4L08A 1KXJA 1ZBDA 1TZKA 1CRZA 3N0TA 4CU5A 1WHTA 1OQAA 4BLRA 1T2DA 4PZEA 1ODTC 3K6SA 1A9QA 1LQTA 2ZVDA 3IALA 3THXA 3NFYA 1SO8A 4P5PA 3PKZA 3TEMA 2A59A 2SNIE 2Z2XA 3PPWA 4JJ6A 5EP4A 3JSAA 1CZKA 3P4XA 5LZ2A 1BVRA 5DNDA 4JV5B 2H1HA 5IXYA 5KQPA 2UYQA 2V6GA 3SZ3A 4EP1A 1YQ9A 4YV2A 1RYFA 1JV2B 1W85B 4N7MA 3WADA 3G9TA 4M8NE 3THYB 1WX1A 3NAQA 2XQJA 1DIHA 4ZYTA 4W7HA 2ZSJA 3GRVA 3LVRE 5GM1A 2VDUE 3P52A 1BKDR 3ZU5A 4CM5A 3LBYA 1TOAA 2ZTUA 1E7SA 1PW5A 2Z1MA 4EY3A 4FMBB 1JFRA 1L7EA 2AQKA 1QF6A 4M0DA 3RYIA 5F76A 4BVJA 5AVJA 4DHEA 2OB2A 1BX0A 3RVQA 2BSXA 1F06A 2WJWA 3AGQA 4N65A 3GPLA 3IMGA 4ZEWA 1UJ2A 2VCHA 3CPHA 2HD4A 3FBWA 3QGMA 5CPBA 5AW4A 4GX5A 3ZX4A 2MSNA 2YIVX 3FROA 3PGLA 1U8EA 5L4NA 3P0FA 1QTIA 3EGXA 1GPH1 4RY0A 5M3BA 3ANYB 1Q0HA 2P2GA 4OFWA 5ITZA 3O21A 3U7FB 1F9EA 2IUUA 2VPWA 4QGGA 2AH5A 2CLOB 1IVNA 4UHDA 3W9BA 3FSJX 1NBMD 4PSAA 3VZSA 4GKVA 1T1JA 4EYOA 5FUQA 3ZDZB 2F3TA 3LECA 1SCAA 1PZMA 1L5QA 2EEPA 2O57A 4IIHA 4O4HA 4Y7DA 2QJRA 4FFBA 5DHTA 1JG7A 1U7UA 4IV8A 4PV7A 2OCGA 4JHXA 3IO5A 3SQDA 1VP3A 3DFUA 2CVOA 3L0ZA 5AVQA 2C7OA 3G7UA 3UPTA 1XDUA 4QO8A 3HZZA 2R4TA 4TQGA 2AN4A 4UEQA 2EZ9A 1D2CA 2MYTA 2Q6LA 1NLUA 4N9WA 3T1TA 4W5JA 2HO5A 5ALIA 5GP1A 3LUHA 2JLCA 4XWYA 3ZD7A 1E2MA 2NX2A 2YRWA 2YYAA 4A0GA 3V1UA 3GRRA 3LL7A 5ED4A 2V7WA 3S1AB 3DTVD 1E1MA 1F14A 1EBBA 2JB9A 3FJOA 4JB2A 4W5HA 2FFBA 4TXNA 1MCZA 1DPGA 1GJRA 3C24A 3ZGLA 4H3VA 1YUMA 2B9VA 3CR7A 1MQ8B 4FMCB 1KRHA 5K09A 2Q5IA 1TF2A 2ZKLA 3QVJA 4N3CA 1AKNA 4I1RA 5B2FA 3R6LA 1QGYA 4OIFA 1KQ3A 4R5HA 3DTNA 5CNJA 3BH0A 4GC9A 3PQFA 3DAPA 2W2LA 3FE2A 1SA0A 1HEUA 2GZDA 2PXCA 3CC8A 1NG1A 2CMDA 5HOEA 3PQEA 3F8WA 4MUKA 4HV4A 5C34B 2W22A 5D7BA 4O02B 4Q9AA 1RPZA 3ANXA 2OC9A 4BAGA 1JIUA 1OBVA 2BONA 1KKLA 3CG4A 4GOND 5FOWA 3TR0A 1FUYB 5HZGA 3BF7A 3U16A 2AWNA 1LI7A 1FRVA 1B8VA 2SCUB 2VQDA 1O5OA 1Q3TA 3QTTA 2YWDA 4J75A 4R84A 1EXNA 5ER6A 3TVTA 4BWGA 4KG7A 3WKBA 3CLKA 1JE1A 1L8XA 3KWJA 4OY3A 4UCWA 4ZU6X 5C7LO 1HT1E 3GLSA 3E2PA 4MUFA 4DOMA 4MRRA 2Z8YA 4QDTA 3JWHA 2XWBF 1SVUA 2OBMA 4IUDS 5KOHA 2OFPA 2QROA 2HA4A 4G65A 4N03A 4DT1A 3AR8A 1XLWA 5BYJA 3NJ4A 5KTMA 3IEVA 1SZPA 1YRLA 2YVQA 4OI0A 3PR3A 3U44A 1K5HA 3F74A 3T7TA 4MR9A 5AVSA 2GM9A 2QEQA 4MS1A 2OQVA 2ARKA 4XCXA 4JS0A 4AW9A 5G3YA 2VYVD 3FTCA 2CFIA 1K1EA 1JFFA 1QFJA 4GBJA 4K0RA 4P86A 4DIKA 3RC1A 2B7LA 2V4UA 1EK6A 3MBIA 3PQ2A 4KBYA 4MVWA 3EWSA 3TLGB 1WJGA 3QKTA 2ZYAA 5FUYA 3C3DA 5AW1A 2DQZA 5F21A 3MNFA 3FAKA 3QU7A 5IK2A 1SG9A 1ECPA 3I6ZA 4L4YA 4LSGA 4DVGA 3PHGA 2QMHA 4M8SA 3T5AA 3GRCA 3ZXXA 1I4LD 3ZNQA 3GZJA 2IUYA 3ZPXA 3OY7A 1X8XA 4CQJA 1H23A 1R8SA 2W6MA 4EPYA 4H4DA 5DN6D 2B0JA 3Q0EA 4DUYB 4F9FA 1WW2A 4FOLA 2H9YA 3QSYA 3CH6A 2YIDA 1DFHA 4C30A 2X2PA 4EY5A 5A03A 3MWJA 4MCIA 1Z3IX 2X7JA 4NS4A 5F7ZA 4DXDA 5K3EA 3U4QA 2R5WA 3GN2A 3T7EA 1U6JA 2GJSA 4YPOA 2H29A 1JPUA 1P31A 5I9NA 1KWGA 4PWYA 1COWD 1UBNA 2FX3A 1T3GA 1MRSA 3RS0A 1JHMA 1XJQA 4N39A 1EM6A 3R7FA 2NUTA 1A77A 2X0JA 4R51A 1GNRA 3UW3A 5KOYA 2D1RA 5FAXA 3VPGA 3TG2A 1Y8CA 3FPJA 2ACKA 2W2PA 4HKTA 2Z5LA 1S8NA 3G7SA 4PG8A 1JQBA 3WXMA 3FNEA 2DKOA 2VZLA 3L8YA 1D09A 4G0UA 4EMTA 3WLOA 4IZ6A 1M34E 2XNKA 1NRIA 3ZHQA 4KYUA 2B5WA 4H2DA 3FWPA 5DB4A 3FRJA 3L5OA 3DQPA 2QZPA 3RG2A 2C4HA 4DDVA 1QE3A 4YJKA 2CXQA 4EX7A 3Q4GA 3U81A 1TZ2A 1BX1A 2F1IA 3MT7A 1OMOA 5AIAA 3SG0A 2VK1A 1CR4A 2TYSB 3L8DA 1II8A 4NIMA 3KQTA 1BYIA 5BW8A 1NNI1 1E2LA 1D6NA 1UMBA 1X87A 3KYDB 3K0BA 2JJ1A 4ALMA 4XASA 2EC5A 4YWJA 4EKEA 2AFHB 1QCCA 1VPEA 5LUBA 3ZU6A 5IKXA 4Y1FA 1DKQA 2OESA 3DC2A 1R0XA 1UM8A 5H1YA 3SDBA 1C30A 1F6WA 3EVEA 4HXGA 4NOKA 4CU2A 3R77A 4UDXX 1MR3F 1CUAA 4ZOEA 5FLXA 2QUKA 3MPOA 1O2DA 1IHXA 1MW9X 3O2QB 2NVBA 3L40A 4IVRA 3ZR4B 1B6RA 4EK9A 1GUFA 4DLSA 1NV9A 4NV1A 5JWHA 3BERA 5TE9A 1G20A 2ZVQX 2WJGA 2H59A 3BRWD 4RA9B 4Z3KA 1PLKA 5EIEA 1QHEA 3C3MA 3KVRA 2AD1A 1KFBB 4EGFA 1N92A 4DSAA 4MB2A 2PMWB 4ENTA 1E96A 2IQ5A 2ZRHA 4ER0A 1I2BA 4TMKA 1RYBA 3QVGB 2OBXA 3O6VA 2GCOB 2YHUA 4FHFA 3FOZA 1Q0LA 2QX9A 3I3SR 1X8KA 5ERXA 2R5NA 2O7SA 4BE7B 4PGHA 3F6EX 3U3KA 1SUCA 2F1HA 4MRPA 3G2OA 4HGZA 4U2BA 3H1EA 4F4IA 4IMIB 2PLFA 1ZRSA 4UKDA 1GKLA 3TK1A 1A4RA 3RNOA 4MRAA 2VUHB 3ULKA 5BNWA 2NTJA 5HM6A 5IUNC 4RHEA 3R20A 4YHBA 4YMUA 1E2QA 5BYBA 2AV6A 4JI0B 1OYWA 1Y80A 2DT8A 4GKKB 5E9QA 1WRBA 1EE1A 1E9AA 2IWRA 4RORA 1ADYA 1VZ2A 1FYEA 3PVSA 4GPTA 4WEQA 1L7VC 2WYUA 4KZKA 2XIQA 2B6NA 3CPJB 2BRUC 4W1RA 5GGXA 3U7IA 2I4OA 2OV8A 3WRVA 4AZTA 3ZV7A 3PFIA 3U2QA 4KQ6A 1LB1B 3EVBA 5LIPA 2VEDA 2H5JA 2Q4BA 2J6BA 1PI3A 1P6QA 3GLFA 2C2KA 1GFWA 4GX2A 2WVHA 2FXIA 2YL2A 4RD3A 1MVLA 1UC9A 3JV7A 1FU7A 1JI0A 2Z6VA 4QBIA 3G23A 3BQ9A 3NR2A 1G9XA 1E3SA 3A11A 1PR2A 1OTHA 4W4TA 4QOFA 3A6EA 4N01A 3V33A 1CUZA 2AZTA 2WMNB 1IBRA 2IYSA 2Z2IA 1KRWA 1WZUA 3A37A 3OUUA 1SG0A 2G25A 4Q3DA 5HMMA 1K89A 4YREA 4F2GA 2VSXA 3ASUA 5IP5A 3NFRA 2NSLA 5K0GA 3PX3A 4F86A 5EQDA 4B8WA 1IWPB 1VPTA 5F5LA 1KBQA 1W93A 4TT8A 3TIIA 4ZDWA 3VU3A 4JBHA 3GBPA 4PYRA 5IWCA 1LS6A 1D0VA 3TH5A 3RTCA 1QHYA 4D9IA 4B4OA 2QTTA 3DCIA 1NY5A 4M60A 4DLYA 4LNUA 2VDPB 2DUNA 3JQ8A 4L27A 2BHTA 2AKEA 1NXXA 1QO0A 1ZZGA 1MIHA 5HIAA 2AR9A 4K3VA 3I9V1 4RKQA 4OHFA 2YY5A 3LKBA 2D0PB 3H8SA 3NDIA 1WSWA 2PK3A 3GPCA 3H86A 1YONA 2JH3A 2P62A 3C5WP 3K0HA 4GPD1 4UDYX 3AY0A 5DGTA 4D82A 2EJWA 4DMLA 1S3GA 3EIXA 3RWBA 3IJRA 1L5RA 2BELA 1WP4A 3K5IA 4MV8A 3AJ8A 1BGWA 3O8OA 1T35A 4RV5A 3VH4A 1W4RA 4QUEA 1MB0A 3FB4A 3R7WA 2PLWA 2V1XA 2GHRA 3DL2A 2H4YA 4U2FA 1KOLA 3O94A 5C8YA 3O73A 3CUWA 1PL8A 1WZEA 5AKXA 3PIDA 4MDEA 4A7PA 1BVHA 4JB3A 5EJ5A 3T3NA 2OYSA 2A5DA 5JQGF 1XRMA 4CETA 2QT9A 1QVZA 1CY6A 4PO1A 3IEXA 3BTUA 4LXIA 3E9CA 3PA6A 2IEBA 4G0PA 4C29A 2WTMA 3ZU2A 2X86A 3MPUA 1N6RA 1U5CA 2Q0XA 4KJZA 4BLWA 1U4SA 2IGBA 3C6YA 2A94A 2G07A 2CJXA 4QELA 1EI9A 3SKYA 3BMCB 1CUFA 3AM3A 2L17A 1GQOA 3EHEA 1QYRA 4JC5A 5BR8B 1IEWA 2XODA 3B1JA 2X5NA 3K2QA 1NYLA 2HJ9A 1D07A 5J59A 3PTAA 2P4EA 4MCAA 3FFTA 1KAOA 3TXAA 2C8JA 5BYKA 4XI9A 3AESA 3E7DA 2UU9B 3A06A 3NRCA 1LGYA 4F72A 4CIXA 5T4HA 1I13A 3TDNA 5GONA 1NJGA 3GEDA 2BSAA 5DXFA 2W5UA 1Z2DA 4BO7A 4O63O 2ANBA 1B4DA 2QUJA 4K9QA 2KSQA 4RETA 4B7CA 1HNXB 1RPJA 4L0CA 3ZTWA 4HH0A 4ZZ1A 5ITSA 2PNFA 4MRMA 2WWYA 5TMEA 2PG3A 1MXFA 2X8AA 3PT9A 3HA5A 3DOFA 2JRLA 1Q0PA 4H4EA 2JFOA 3AUTA 3VC7A 5BW5A 3DM9B 3CVWA 4HTFB 3KWMA 5FTJA 3O7WA 5L6MB 3LZDA 3R5JA 4I2NA 3EGDB 3KS9A 2F8MA 4I50A 1E3QA 1IUNA 1CKEA 2GQ0A 3R3WA 3GJ3A 4IEEA 5GQSA 5B1IA 5FTMA 1ZQ9A 3P9YA 3WHKA 5F64A 3W6ZA 5AW6A 3CS3A 1EKXA 2NU8B 2WWVD 3OQVA 5H4GA 3OPYI 4PNEA 2Q0HA 5FKJA 2PT6A 3IAFA 1E79A 4PLYA 2FZCA 5HFAA 2VG8A 2P9HA 3GA7A 4GPEA 3L4BC 4YMSA 2QR2A 1JEJA 1X7HA 1QRRA 1M83A 1HDXA 1YJXA 1WPGA 4MDHA 4BKOA 2FI1A 1IY8A 1E6UA 1DS6A 1UDRA 1X7XB 2LCIA 1QHSA 3C85A 3EXHC 1W30A 2CLEB 1N78A 1YOVB 3CUTA 2F62A 2G70A 4BKMA 3ACDA 1X9HA 2H0AA 4MQ4A 1DQRA 2NUPB 2XMZA 5K8JB 1Q74A 3SLGA 1G8SA 1A04A 2J67A 4GKJB 1GZ7A 2AEMA 4D9NA 5JYEA 1QIEA 3I04M 4PIMA 1VRVA 5BQPA 2VF8A 1OYYA 1NMQA 2G5PA 1A5SB 2I33A 2IEZA 2J4FA 2WM3A 1HQDA 1U0RA 1WCV1 2DPGA 3D3WB 3RARA 2PZKA 1ACLA 1NC3A 4KQIA 1RHUA 2ORYA 1GLVA 4YAOA 3VDMA 4AI6A 1SCBA 1RZRA 2Q6KA 5LB4A 4MPTA 3IKVA 1HE4A 1QE5A 3JWIA 3ICVA 3M3HA 3MJEA 3O90A 1Q15A 4MP6A 4R7TA 2PWPA 5TMPA 3CF6R 1WBBA 4B46A 2PKQO 3I30X 2DY1A 4MR7B 2JAWA 5SV2A 4D3SA 2O8EA 1MC8A 3HHEA 1PNRA 4MIOA 3D6AA 3N0RA 4AMZA 2YY6A 1VGQA 4J90A 5KYUB 1U63A 1S0UA 3ZLVA 3PQ4A 1YNSA 1JJ7A 1IHOA 2JIRA 1L3BA 3OE7A 4MQFA 4AJEA 3G2LA 5F3DA 1B1AA 3U39A 1MIOB 3Q6IA 4OU5A 5BQOA 2UVPA 3ZHSA 1R6BX 2ZTLA 5TLSA 3TTSA 3A9TA 1NBIA 1X1BA 3UMFA 1T6NA 2RI0A 5FWDA 1AGNA 4BLUA 3LY9A 2DHCA 4ZPXA 1GEEA 1E1CB 5KNDA 3BWBA 4GMKA 3U4DA 4TROA 2XUOA 3A6KA 2GT1A 4EDHA 3R6GA 2DUJA 4GZMA 2MSWA 1QU2A 2CFTA 4K8OA 2VHYA 4BBAA 5FTLA 5KINB 2O0MA 1BVYF 1JEDA 2I6QA 3W1EA 3TO5A 4JLKA 2O2YA 1NP6A 2RHGB 3JD4A 2XCIA 4PHTA 4EGSA 1K98A 5LOVF 1J06A 1P0FA 3UJ6A 5DLEA 1KYXA 2LE0A 3T34A 2O3QA 4MOWA 4GBED 3HEAA 3CLSC 4DB2A 2Q5CA 4Q19A 4QTXA 4F04A 2PBLA 4MKIA 4ZAWA 1GYQA 3RREA 2A9OA 4B33A 1X70A 2ID8A 4K9RA 1Z18A 2A35A 3W90A 1HDCA 1DAHA 1KVUA 4XIYA 2X22A 4PHFA 1Z37A 3UFXB 4F3NA 3P9CA 1KO7A 2AZDA 1C2YA 3ZWMA 1TMYA 4P5EA 3MOSA 3T3OA 2V4ZA 4C22A 1T6BY 1GYRA 1YDFA 3DBRA 3MWKA 2P9YA 4ID3A 1FTNA 1C14A 2FF7A 4HD8A 1DL5A 2OAQ1 4OXIA 1KARA 2JDID 1RI1A 3DZGA 4JDUA 4YK7A 3IMEA 1R5OA 3SIWA 2X1MA 1DJNA 4AFNA 4E12A 5KNBD 1IBKB 1I3NA 1RRCA 4UBNA 1XLTC 3NYWA 4MVJD 1KYVA 1Z07A 2D1FA 2J5RA 4RPJA 3EZYA 1TVCA 1EE2A 3OWXA 1GKKA 2VXYA 3R8FA 2R62A 1G291 3PXEA 4QYXA 4FC6A 5DOVA 4A3SA 4AN0A 2V03A 3OHMA 1U28A 3DMPA 4CDNA 2ZI9A 4TL9A 4RD0A 2BR3A 3ZYZA 4CCYA 1RYEA 2IUEA 4DG5A 2ORVA 4RA6A 1B41A 2CNWD 1I0IA 4GKBA 5LLTA 4RGBA 4ZCSA 1FW6A 4Q47A 1WIWA 3LQQA 5LUAA 5LYJF 5KYWB 3L1VA 1N3IA 1FS5A 3NKLA 2Q7OE 2DBRA 3KSBC 3GLUA 3ETEA 2GOYA 3VZQA 3KUUA 1B0ZA 2DP4E 1H0SA 3TAHA 5HKBA 4TTVA 1NPTO 2WAMA 1NR1A 2Y1DA 1TXGA 4EITA 3RH0A 3WYEA 4UNSA 2AS0A 3K9CA 2PH3A 2Q8NA 2FWBA 4FGSA 3AF6A 2BISA 1ZOPA 2EW1A 1J49A 1H9AA 2G9ZA 3C4QA 4TS3A 4X61A 3NC1C 1DEXA 2P4QA 2QRJA 5ALZA 4B84A 4F4JA 5A6SA 3T5PA 5D3KA 3AEKA 4K28A 4F46A 3Q8XB 1H0HA 4L6AA 3W79A 5J1SB 5EVCA 3NWBA 3MRSA 3RYCB 1N77A 3I72A 4LC9A 3I6MA 1U8AA 2A5FA 2RH9B 4GOOD 1PIWA 3HO8A 4KGZA 4ZQGA 3RS2A 1H42A 4UFNA 5CVUA 3THSA 3QMVA 1VCIA 4I4TA 2TS1A 1ULSA 1N5OX 1R5NA 4GLBA 2AOWA 2VP2A 3PCTA 4ZVVA 4B35A 4DR4B 3AMVA 4RW0A 3QIAA 5FUVA 4C7MA 4CIWA 3PKJA 3EWAA 5DM4A 4EYSA 3OO0A 2ODNA 3SGLA 5C8ZA 3RF7A 3KETA 2JNWA 5BOSB 2QAGA 3J81A 3M89A 4JVMA 1PYDA 1G8HA 2GBLC 2PH7A 3B52X 4MW0A 3GC6A 2CLCX 3I4FA 4QUDA 3VBCA 1QYXA 4V24A 2XZDA 3UYKA 1BC5A 1HQCA 5T4BA 1Q7BA 3F5MA 4EHJA 2AX3A 5AVRA 4EYGA 1YR7A 3ICPA 4PWZA 1DAKA 3UAWA 4FWIB 3T7JA 4KLNA 4B74A 1M2VA 1HFEL 4LECA 4EG1A 2PLRA 1KZ4A 2GRAA 2OCBA 3DMYA 3DEHA 4C04A 1M67A 2CDNA 1E6CA 1MRNA 3DZ8A 3GELA 3OEYA 1B0UA 1HNNA 1JVSA 2CUZA 1N8SA 2G36A 3JSXA 4F4DA 3OLQA 3QITA 3TRFA 1GKUB 1UQUA 1ZK1A 3KQQA 4DEXA 3A1NA 3DMTC 4HWGA 1H5QA 4BV8A 2DERA 1ZNQO 1UKBA 2PO7A 2V4MA 4PBRA 3ZWWA 1XJWA 4BMOB 2AFIA 3K09A 5CH8A 2GEBA 4PONA 5F2OA 2O2ZA 1DBPA 1P1RA 5IPFA 1E2UA 2R48A 1SGWA 3RT7A 1NW6A 2Z0MA 2D2VA 4RZ2A 2VDWA 1N5IA 2DOKA 5BN4B 1LS1A 2I9PA 3OTHA 4K6KA 3T38A 4OFBA 3QVWA 2QLMA 2ABWA 3TNFA 3ZD6A 2VQSA 4QG7A 4MW2A 3NQ41 5IKMA 3MTAA 2ZCUA 4M83A 2EKDA 5AJWA 2YYYA 3OZ7A 2JEZA 1E0JA 2QW1A 4DLPA 3BCRA 3KBOA 5DMHA 3WV4A 1FE8A 2NWQA 4TXJA 1Q3HA 4MKXA 3RTDA 1QO9A 2P91A 3A14A 3QE4A 4YJHA 1NJ8A 3MBKA 4MNTA 4YB8A 5FR2A 5G0WA 5JMPA 3P0RA 4ITRC 3WK9A 4DXHA 4RZXA 1E3LA 2IIBA 4DPKA 1MAUA 1ZM7A 3PEEA 4D79A 1NNSA 1GTVA 4KO3S 3IKMB 1MAAA 2B5OA 2BR4A 4D9BA 2WB2A 4DFDA 3IELA 2V5VA 1QLHA 2VSNA 4PZUA 4ZT7A 2QUHA 1USKA 2LIPA 3UCXA 4Y1EA 4YUVA 5H9WA 4MUYA 3N8DA 5IUKC 3V1TC 3DUFA 4U02A 3L43A 5CJPA 3T7DA 2AXPA 3BSWA 3MA0A 3PIIA 1WDTA 4Z2YA 2O5CA 1U6IA 4CN9A 2XT9A 2GF9A 2IU3A 3AIMA 2ENUA 2ODTX 2OOKA 4UULA 3U4CA 3ZVNA 3AVXA 1F51E 4CW7A 1DJMA 2M9MA 1CFJA 1AS0A 2YR0A 3EIQA 2J0EA 5KB3A 2QU7A 2LGJA 3DE5X 3ZZNA 3R75A 3HJFA 2ZS7A 4FCTA 4FDAA 2Z9BA 3AYXB 3OUTA 4Q21A 5ERGB 5LNK6 1IHUA 1K5PA 1HWYA 1R4NA 2X9NA 2WG1A 1NYRA 5MN6A 1J90A 5DYGA 2GI4A 1F2VA 1QAOA 5A06A 3QUSA 4PQEA 4U8GA 5DGDA 2OXTA 3M4YA 4D26A 1QPZA 1P5JA 4R1MA 4ZO6A 5IJAA 3T1OA 2E18A 1I1OA 3OCXA 4UMFA 4OLFA 3ROZA 2XJ4A 2D0DA 1D2MA 3GRZA 4DPMA 2V0GA 3U19A 3ND9A 3R8XA 4F21A 1YJQA 4LX0A 5AJZA 4F0JA 1X14A 1ECCA 1NASA 3K4QA 4L16A 3W5BA 4HH3C 3VKUA 1F4VA 1PQWA 1YXMA 2SHKA 4I81A 3KTAA 3C39A 3E61A 5A4DA 4YUAA 2HX1A 2HWYA 1TEVA 5D3MA 2B78A 1QU3A 2WM9B 4PW0A 1P9LA 3QXCA 5TDHA 2BLLA 3BRQA 4KKXB 2LDXA 5B3JC 2PU7A 4ZAFA 4HRXA 4J03A 2JL1A 4IVQA 4JU9A 3DG9A 3RAFC 1NA5A 2RGRA 1ZIOA 5JAQA 1T4CB 4HN9A 3ZD9A 4HYTA 4RL4A 1C81A 2QIPA 1V71A 1KVQA 5ES4B 5I4BA 5L3QB 3N6RA 3D4NA 3G2JA 5FL7A 3A4YA 2HPHA 4DR3B 3V2GA 4Q15A 5BMVA 1MH1A 2VJBA 3HKBB 3HKCB 5IJ0B 3NBXX 3WGZA 2HK6A 3TZKA 1C9JA 1G3RA 3VPHA 4G8BA 1IMJA 4DNFA 1D4FA 2TMGA 4CUKA 1NJ6A 2IXAA 3RJTA 1RE0A 4PLHA 1Z13A 2PE5A 2F8TA 1VRWA 2EJUA 1DIRA 2QSZA 3JATB 1IOWA 2WM2A 1UF9A 3KCNA 3LQ4A 3O9ZA 3OO1A 3Q2IA 3DBVO 3UK7A 3V3KA 4CM9A 2R7LA 5G53C 4MTLA 3B12A 2R8PA 3QF4A 4OMDA 5ITVA 1XD2A 3HACA 3HCWA 3KOYA 3FH0A 1ZL2A 1WQ3A 2RK6A 3OX3A 4FU0A 1ZPDA 4CKBB 5JZBA 2UYOA 1TB4A 3KR0A 4XSVA 2B25A 4KUEA 4RTJA 1NN3A 3FSEA 2RAVA 3VO1A 3WYBA 4O0LA 4B5LA 4EVRA 3VHRA 2YHSA 3RPEA 1OSNA 4K26A 3W5HA 1PG5A 2WD7B 3G85A 4UHEA 4JT4A 5K3CA 4BL5A 4JI8B 3N6VA 1VKZA 1Y98A 2JC3A 3C43A 4FKBA 1RJ9B 1SC6A 1WEHA 2XBMA 4CLDA 2HW8A 5DN9A 3K32A 4TVKA 4XD2A 3UK1A 3JAWB 4XB2A 2CL7X 1W4CA 3ZVMA 1DAEA 1THGA 3MMZA 1IZYA 4G56A 3G1WA 1ZEMA 3IBFA 5C31A 3TCXB 3HCCA 4KIGA 3H4IA 3RFVA 3ZGXA 1L4EA 3W8RA 3ZGOA 3DLPX 1CE8B 2WTBA 3MTJA 3NEAA 2HRQA 4LDRA 3WIUA 4QWMA 2H7YA 1ZM3A 3CX6A 3PL5A 3R5FA 4ZVMA 3BYZA 1FL9A 3FUTA 2KPOA 2FX5A 4M89A 3WLEA 2D5BA 4HQFA 2EKZA 4OA5A 4WVLA 4E2WA 3T3PB 2XDQB 3VPDA 3GA5A 2QW0X 5CXSA 3TZLA 4Z4EA 5K3BA 2RHLA 4DQKA 2WVJA 2P2LA 3R9XB 4UMDA 3K2BA 4RJTA 3H1AA 2JFHA 3EPPA 3U61B 4LZLA 2QVZX 2ZIXB 1U90A 5AKYA 721PA 3TPZA 2BIFA 3BDAA 5LBUA 4Z51A 1NQWA 3D3EA 2ZR0A 3DOOA 5FFNA 3PRHA 5JSHA 1MB4A 1MC1A 4WERA 3IHTA 2I2WA 1K5DA 3WRYA 1P7VA 1ZCFA 3A3KA 2HYDA 3T7IA 5AXBA 1WEKA 1KPIA 1C1XA 1JFTA 4OHVA 2W58A 4HR7A 1H0KA 2FMTA 4K9SA 1VXRA 4II2A 4GZ5A 2VJAA 2ZT7A 3WLLA 5A4FS 4LKRA 3ZHVA 3G0OA 2EZ8A 1VJRA 2H48A 3DLIA 3TNLA 2J33A 1H8HD 3WLTA 2UZ4A 1WCXA 1EVEA 1XCMA 3A9RA 3K9NA 3C3EA 4GF5A 4QVKA 2REQB 4WGFA 1UFRA 5IWAB 1QWOA 3WGIA 4KGVA 3RLIA 4U2EA 4GMHA 4I5IA 2EHJA 9ATCA 3GGCA 4I9FA 4BGDA 3EXIB 4HB0A 5DIZA 1KSFX 2VJDA 2ODEA 3G2KA 1UR5A 2OTCA 4AWBA 1T91A 5KJFA 4P4GA 2B2CA 1MVNA 2XCRB 1GL6A 1AJEA 4CEJA 3ND8A 4P3YA 1I51A 2SKDA 3UM9A 4OHYA 3HVHA 4N0DA 3FAZA 4J0QA 5DJ5A 3TQIA 5BQXA 1HSZA 3B9PA 2JFQA 1EPUA 1GDHA 1QDLB 2AMLA 1KYYA 2Q1UA 1U81A 4EY4A 3PNMA 4HT3B 5ELMA 4LJAA 5D85A 4ARIA 4YASA 2DFPA 4JSRA 5DT2A 3SY8A 1Z15A 1YQEA 3AFOA 5JTTA 4H7EA 1WNTA 5JO9A 5HKKA 1YFLA 2QVBA 4CMKA 3IR7A 4ZI7F 1XRJA 2B8WA 4TS9A 4XA8A 1T0JB 2BEWB 3DULA 4PSDA 5EZ6B 3RFFA 4B3HA 4EABA 2A30A 2XAAA 2ON6A 3RYFA 5FLKA 4QFCA 1WVGA 1TJ3A 4LJ8A 4AWAA 3ZHCA 1HTWA 1DJQA 2C0PA 2H52A 3NOQA 1KA9H 4CXMA 3L7JA 1VCNA 1LA2A 1T5BA 2RSLA 3OPXA 4PPNA 5FTWA 1ENPA 1FFXA 1GY8A 3UT6A 2JRCA 4M9RA 2WJHA 2Y1GA 1T8PA 2GBFA 1A2OA 1O0SA 2WJIA 3DHYA 3GJ7A 3LDGA 4AKGA 4MB6A 1ODCA 4E08A 4M88A 4CTMA 4F11A 3PQ7A 5HBGA 3PHBE 5K0SA 2RIRA 2ZROA 4OYYA 4P92A 4WXPA 2C3PA 5MN5A 1IXZA 3CISA 1WM1A 2BKAA 4E0BA 3N2LA 2HPAA 1KI7A