1R3DA

Crystal structure of protein vc1974 from vibrio cholerae, pfam abhydrolase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
264
structure length
257
Chain Sequence
b'SLLSNQLHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPAEAVEMIEQTVQAHVTSEVPVILVGYSLGGRLIMHGLAQGAFSRLNLRGAIIEGGHFGLQENEEKAARWQHDQQWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQRQTLIAQRSANLGSSVAHMLLATSLAKQPYLLPALQALKLPIHYVCGEQDSKFQQLAESSGLSYSQVAQAGHNVHHEQPQAFAKIVQAMIHSIID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein VC1974
publication title Structural Genomics target NYSGRC-T920 related to A/B hydrolase fold.
rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
total genus 75
structure length 257
sequence length 264
ec nomenclature
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r3dA00
2JIDA 2QJRA 2PSDA 5AKKA 1SCKA 3GFFA 3M3DA 4NS4A 3D0KA 4CI9A 4FLMA 3R3YA 2WUFA 5FV4A 3CCBA 1THGA 1T2NA 4Y9SA 1TRHA 2O2IA 4UBMA 4PW0A 3AZOA 1SFRA 1BEEA 3G0IA 4C4YA 5LZ5A 3WKEA 2JGEA 3PICA 2HA4A 3ILSA 4FOLA 4BAUA 2PUJA 4GI1A 3BIWA 5HKBA 1HKHA 3VJLA 1UXOA 4BCCA 5CW2A 1FFBA 1SC9A 2PUHA 2JEZA 2HA2A 4W1QA 5FUMA 1QZ3A 1BROA 3WWCA 2PSEA 4J3JA 3HLKA 1W6RA 5A2GA 1RWQA 4BYMA 5AOBA 4UFOA 2GYWA 3KOOA 4OYLA 3OTQA 4HVTA 2CJPA 4F0JA 3SX4A 4F21A 4B82A 3GROA 1QJ4A 1JJBA 4RGYA 4PSUA 5K3EA 2I3ZA 5HKAA 3GA7A 1XRPA 4BB0A 5AI9A 2WHPB 1H22A 5DYWA 4KEAA 5I8PA 3H2KA 4PV7A 2OGZA 1MX9A 3TRDA 1DT5A 3FAKA 2HRQA 1LPSA 1XZJA 3WL8A 3A2LA 2XI4A 1ZGCA 5HFNA 1J1IA 4X3CA 1TCBA 2H7YA 3FCYA 2WTNA 5HF8A 1FJ2A 2WU3A 1P0PA 1YSCA 5AK5A 1JU4A 3I1YA 4ZI5A 4ETWA 2JGMA 1AUOA 2C5GA 1UK7A 4X6YA 1YA4A 1FFDA 2UZ0A 2NW6A 5ALNA 4BZZA 1P0IA 1VA5A 1WB6A 2WIDA 4BDTA 1YS1X 5CRIA 3G0BA 3Q8WA 1MX1A 3C6ZA 3WKAA 5A6VA 4FBLA 2Y2VA 4ZWNA 1ZD5A 4IHAA 3RLIA 4WY5A 5K3BA 4LXIA 3B12A 2VQ6A 3DD5A 2YYSA 2W22A 1RP1A 4KAJA 4UHDA 5AO9A 5HFAA 5CURA 2WILA 3V48A 3WKDA 2WSLA 3STWA 3FVTA 2AJLI 2WM2A 2ZJ6A 2AJ8A 1RYYA 3NGMA 2XUDA 3ANTA 3R3XA 4N5HX 4KRXA 2X5XA 3IUMA 1C7IA 2B9VA 4RE5A 5AKEA 5AKIA 4EY4A 4NZZA 5E4YA 4CG2A 4RPCA 5AK4A 3WYDA 5C7YA 5ALLA 3W05A 3BF8A 3VJKA 4AZ3A 3PUHA 4ZXFA 4H7FA 1EHYA 5EIEA 3C6XA 3F98A 4Y2PA 4AX4A 4ZRDA 5CH8A 1Q83A 3W9UA 3AZQA 4OU4A 4X85A 4U2FA 3I1IA 4MEAA 3VJMA 1PV1A 1CUCA 1MAHA 1XRQA 3I2FA 4KRYA 2OG1A 5LZ2A 3E0XA 4UHEA 4G8DA 4MWSA 3LS2A 2DQYA 1ZICA 4Y2TA 1JJFA 3CCCA 4BC0A 1F0NA 2HDWA 4QLOA 1VE6A 4N8DA 3WK5A 1UOOA 4H77A 1LNSA 2K2QB 3BWXA 3LCRA 1MU0A 2QT9A 3NOXA 3G0DA 3N2ZB 4C89A 1OXMA 4BCDA 4GDMA 4AB1A 1CQZA 1BCSA 2H1IA 5T4HA 1IUOA 1GPKA 4AO7A 3EBLA 4U2DA 5C8XA 2DHCA 4ROTA 4BAGA 5LKAA 2AXEA 5AM1A 4BVKA 3L1IA 3WK4A 4DLNA 5EHXA 4C6HA 1YB7A 2HL6A 4P92A 4AO8A 5ALYA 4LIPD 1J07A 1VLQA 4K6GA 5IVHA 4C87A 1QOZA 2G63A 2HU5A 4H7EA 3I2GA 3KDAA 2FX5A 1EB8A 5ALPA 3P2MA 2EDCA 3AILA 3H0CA 3H1AA 4BRSA 4BAZA 1GQSA 2DFPA 1YA8A 4CFSA 1EK2A 4A16A 1TQHA 1R3DA 4MJ3A 3F9CA 1TK3A 5FPQA 3STVA 3DEAA 4CIAA 2WG0A 3UMJA 4XJVA 5K5EA 3C8DA 4UFNA 3FOBA 2WUEA 2QVBA 2ZSIA 2OQVA 5JZBA 5JD4A 4HZGA 3V1KA 5CXUA 3EF3A 1EA5A 3GBSA 2JGFA 3JWEA 3O9MA 1SOMA 2XLCA 2W6CX 4WFJA 5J3JA 4LKOA 2BCEA 3VKFA 3HI4A 3NWOA 4EY7A 1Q84A 3ESAA 2HHAA 1XQVA 3DDUA 4FDMA 5DWDA 2Z3ZA 4K6KA 2DCMA 4KE7A 1A8QA 1CPYA 1CUHA 3AZPA 4HXGA 1ZJ5A 4L0CA 2PL5A 4BTLA 5SYMA 4BVJA 1A8SA 2VA9A 4Y2RA 4KR0A 5E4JA 1C4XA 5AP9A 1XQWA 5CH3A 3TGLA 2WIGA 3LIIA 4J0CA 2B61A 3BF7A 2FJ0A 3H2JA 3V1NA 4PF1A 1GKKA 2XMGA 3ESCA 4OB8A 4PQEA 2QOEA 2HADA 5HCUA 2AJDA 4BVLA 3IUNA 3DS8A 5ALHA 4CCYA 1Y37A 3WJ2A 3DNMA 3QPCA 3WA7A 1WB5A 3ANSA 4I19A 3SC2A 2HFJA 2Z3WA 3KSRA 4J0HA 4G9EA 3H2HA 1CIJA 3G7NA 1MNQA 4C4XA 3WZMA 5HF9A 3WYNA 2XQKA 4H7IA 3GZJA 4M0FA 4LYDA 4PSCA 2V9ZA 2OLEA 5K3AA 2I03A 3WK7A 3HZOA 5JZSA 4Y7DA 1XZMA 1VKHA 3C5WP 3FYUA 1ACLA 4X94A 1OILA 4FWBA 4J0JA 3OPMA 1UK6A 1PFQA 2HU8A 2GBFA 1TAHA 1ZGBA 5HK8A 3CN7A 5DNUA 1BRTA 1ACJA 2ACEA 1O6GA 5LLSA 1CVLA 3OG9A 1LBSA 3DL4A 5AJHA 1DWQA 2BUCA 3ZLUA 1BCRA 5JATA 5AI0A 3STUA 1NU6A 4CCYB 5HQ3A 3YASA 2WIFA 1U4NA 4P9NA 5CXXA 1BEZA 2H7XA 3HRHA 3I2JA 5ALTA 3K6KA 2ACKA 3EQ8A 2CBGA 4MYDA 1FSSA 5DTIA 3CXUA 1R9MA 2RIPA 3W2TA 1EDEA 2BKLA 2OGSA 2G5TA 2PKYX 2ONCA 3O4JA 1ODTC 5AM0A 1ZI8A 2PVSA 4EY6A 4MXDA 1GPNA 4BZWA 1WCYA 4OUKX 1VJ5A 1ETHA 2QRUA 5FOQA 3FYUB 3VISA 1YS2X 4EY8A 5HK9A 1GQRA 5JALA 1JJIA 3KWJA 1XZKA 3DYVA 4IO0A 3QMMA 2OXEA 4A5SA 1UFOA 2PU5A 3AJAA 1R50A 4MEBA 2LIPA 3LP5A 4UBJA 3D2BA 3D4LA 1GZ7A 2I3DA 4U2GA 4Y2XA 1AMNA 5HQ3B 4AO6A 1JU3A 1YR2A 2QMQA 3UUFA 4CCWA 5SYNA 3G9UA 1IUPA 2WHPA 3A2MA 5AM4A 3RARA 4BATA 3FVRA 3T4UA 4G4JA 3R41A 4PSDA 3PF9A 2XUHA 2JGKA 1LBTA 2GZRA 2HFKA 5IVIA 2OPHA 1HLGA 4DM7A 4EHBA 5AM3A 2D0DA 5A7HA 1XZDA 3PE6A 2ZJFA 1WB4A 4OD0A 3UUEA 1QIMA 1XZFA 3X3HA 1H23A 3SK0A 1K63A 4X6UA 4ZGBA 2VJCA 1CUFA 2WIKA 2XQJA 5AKHA 2VAVA 4ARBA 3D2CA 4DGQA 5JAUA 5AM5A 1CRLA 3A6ZA 2WTMA 3H19A 1KU0A 1QFSA 3VDXA 5YASA 2XUKA 4G5XA 4KJXA 2E3JA 2XUPA 3HSSA 3IBTA 5ALUA 1K4YA 4K5QA 1WPXA 4ARAA 1CUIA 1QIFA 5KWIA 2XUOA 3HYSA 2XQGA 4UHFA 5AOAA 4I3FA 2FUKA 1ISPA 3M83A 2R8BA 4U2BA 1YCDA 1A8UA 5IVKA 1EI9A 2WUDA 2ES4A 5ALEA 1QTRA 1K6EA 5CMLA 3F96A 1WOMA 5BOVA 1DINA 1HBJA 1QTIA 2WG1A 4W1PA 3PI6A 5C81A 4EY5A 3G8YA 2XMBA 4FFVA 2HU7A 4KAAA 2GYVA 2PSHA 3O4HA 2XMDA 3WIOA 3RM3A 4XIIA 4GECA 2ZVDA 3ESDA 3BE8A 4F60A 3IDAA 4EA6A 5BV7A 1QIHA 1LGYA 1W52X 3STTA 3ZWQA 2OQIA 3FLEA 1VXOA 2Y2UA 1ZD2P 3IVMA 1W75A 4FTWA 5BWCA 1E66A 1N8SA 1ODCA 1Q0ZA 5CT8A 3OOSA 3GUUA 4AMZA 4B84A 4HXEB 1MPXA 3IIIA 3WIBA 1UWCA 2VEOA 2OAGA 3HEAA 4V2IA 3A70A 5DNWA 4OU5A 3IUQA 3TJMA 1A88A 4WJLA 4U2EA 3FSGD 3HC7A 1MO2A 2I78A 2JGLA 1A7UA 3FSGA 2WLSA 1CUWA 1J2EA 1JI3A 1MAAA 3I2HA 5ALGA 1SCQA 5LYYA 3EQ9A 2GYUA 4OB7A 1JFRA 4G1FA 2AJCA 4BCBA 1LPNA 1R1DA 4BE4A 1MTZA 4DMHA 2QUAA 1Y7HA 2QUBA 4J03A 2G5PA 1W76A 2RGUA 4M0MA 3WQHA 4B85A 1FFCA 1K8QA 2AJBA 2JEYA 3L1JA 4P93A 3OURA 4Q82A 1QIDA 4X90A 4LXGA 3VVMA 5ALWA 4BBZA 3QPDA 4KAFA 5AH0A 1CEXA 4EB0A 2D5LA 2PM8A 2C0QA 4GXNA 4X7BA 2WJ4A 4FNGA 3AFIA 3GELA 5C8ZA 2HA3A 3G0GA 3FLAA 3QMWA 4QDOA 1G5FA 2VJAA 3H2IA 4Y2VA 2IX9A 3K2IA 3FBWA 3C70A 4LHEA 1HQDA 3D2AA 4H7KA 1YB6A 3DKRA 5ALRA 2FJPA 3FYTA 1CUUA 2Z8XA 2HM7A 3C5VA 1FFAA 5T4EA 2Y1KA 4DNOA 3D5EA 4BDSA 4FNMA 5DLPA 3G0CA 1E3QA 5AIAA 3R3ZA 1U65A 4QDUA 1N5RA 1EINA 4FLFA 2C7BA 4WCVA 3H1BA 1YAHA 2JGIA 1GKLA 1GXSA 4WY8A 4B7ZA 2XQIA 1M33A 3WK9A 5AKGA 4HAIA 2CZQA 1THTA 1DTEA 3M82A 3DOIA 1QE3A 2WG2A 1XROA 3C43A 3H2GA 3R3WA 1Q0RA 1VZ3A 1QFMA 1UOPA 4DMFA 2QR5A 4QE3A 4AQDA 3IUJA 2O7VA 4Q3OA 5DJ5A 3I6MA 3B5EA 1EB9A 3W9BA 1JKMA 1CUSA 2VAXA 5FKJA 2WHQA 1BU8A 2GBCA 4QDXA 1XLUA 3H04A 3R3VA 1HPLA 5ALSA 3OC0A 1LZKA 1AQLA 3HACA 3AINA 4P08A 5CH5A 4HS9A 4JEIA 2ZYRA 3ESBA 5D6OA 4A23A 1XRMA 4MWTA 4UBKA 1E89A 1XZGA 4H18A 2JBWA 4H0CA 2C0PA 3QPAA 4AMYA 5C8VA 2HA7A 4IH9A 1BS9A 5DYYA 5AOCA 4WFKA 1GGVA 5CT4A 2PPLA 4DNQA 1DWPA 1IUNA 2IIVA 3PFBA 3H17A 5LZ9A 4Y2QA 5DTJA 3WKCA 2DQZA 1ZIYA 4DSZA 2GBGA 3WK6A 4W1SA 2X8BA 2CUTA 2YASA 4X95A 2BGNA 4G8BA 3V1LA 5EIAA 5JARA 3MVEA 1PJAA 2VT7A 3OM8A 5AKYA 3WJ1A 2ZJ7A 4J0IA 2Q0XA 4QDTA 3L1HA 3BL8A 2J4FA 4XWGA 2VT6A 2PX6A 1VOTA 2BGRA 4N8SA 3W04A 7YASA 5JAPA 2VATA 2CMFA 4WDRA 2XMZA 2EDAA 4BP8A 5CTAA 4BTVA 2H9YA 1ZJ4A 3ICWA 1EXWA 5CT6A 1X2BA 4OCZA 1EX9A 4LXHA 2XUIA 4UPDA 1VE7A 1KEZA 3C8HA 4Q05A 3I6YA 4D9JA 5JAOA 1EDBA 2Y6UA 3I6ZA 4DNPA 5AKJA 1R4ZA 4FHZA 4E15A 1E8MA 3JW8A 4ZREA 1F6WA 2WUGA 1MN6A 3BDIA 1B41A 5A7GA 1NX9A 1CUBA 5LZ8A 2BJHA 4QZVA 5H3HA 1JMYA 3IURA 5KWJA 1W1IA 5ALMA 3F67A 2Z8ZA 4G4GA 1AC5A 4CG1A 1LPOA 3BJMA 4JUIA 4G8CA 1UT6A 4H7DA 4Q34A 3AIOA 1QLWA 4Q3LA 5ALDA 4MQMA 1XRRA 3KXPA 1T4MA 1UOQA 3PUIA 2DHEA 2CEKA 4UHHA 3LIPA 3I2IA 1AZWA 4QWWA 4E46A 4DYHA 5BWBA 2BAGA 3Q0TA 4FFWA 3BIXA 2ROQA 1YASA 1UK8A 1XLVA 3IA2A 1ZD3A 1DX6A 5DNVA 5AM2A 5JAHA 1AKNA 2Z5GA 3C6BA 2RAUA 3AIKA 3DCNA 2XDWA 1G42A 3ZLVA 1GT6A 1ZIXA 4S0XA 2WIJA 1UK9A 1DU4A 1W4LA 5AI6A 4BP9A 1LLFA 3G9ZA 2WJ6A 3AUKA 1MT3A 4HTAA 4X00A 4N5IX 4KE8A 3O0DA 3VXKA 2O2HA 4BRZA 3U1TA 5ALXA 1EVQA 4X92A 3I28A 1G4HA 2XMCA 3DKKA 2PU7A 2R11A 3WI7A 1L7RA 2HA6A 2QZPA 4C4ZA 4NVRA 4Y2UA 3VVLA 3QMVA 3QVMA 3WK8A 2ZYSA 5LP1A 1R88A 2XE4A 4Y2JA 4B80A 3I2KA 4UHCA 4TVKA 1USWA 2WFZA 4Q3KA 3KD2A 5EI5A 1KU6A 3PFCA 2B20A 1CFJA 4RE6A 2RHWA 2GBIA 5T4BA 4HXFB 2XUQA 4EZIA 4JH0A 5FP0A 4YK7A 5EHZA 1QIEA 4GBGA 5FLKA 1XZCA 3WMRA 3G9TA 5HZGA 4M0EA 2RHTA 1H2ZA 2BUBA 4DNFA 5EGNA 3WL5A 3BDVA 1TCAA 5K3FA 4Y2SA 1O6FA 1MX5A 3WL6A 1CUEA 4UBNA 3DOHA 1XZBA 2Y6VA 3DJYA 5EIHA 5K3CA 3WWDA 4DSAA 4K2AA 1U2EA 3A2NA 2WQZA 2QKYA 5ALKA 1G66A 4NMWA 4YX9A 2ECFA 5A62A 1TIBA 5KBYA 3T52A 5E2IA 1XRLA 4JYMA 4DMCA 2XUAA 1LPPA 2V96A 4B6GA 3V1MA 5ALZA 3WWEA 1Z68A 1DWOA 3FWHA 4KE6A 5AI5A 1B6GA 1P0MA 3E1GA 3WWOA 1QIJA 1ZI6A 5IKXA 1BN7A 5EFZA 1L7QA 1ZI9A 4W9RA 1CUAA 4GEGA 5K3FB 3EIOA 4J0GA 1EK1A 1QIKA 1JMKC 2VJDA 4GW3A 5CT9A 1CUZA 5ALOA 4EUSA 5HF5A 1K5PA 5AKXA 5JD5A 3WKBA 1XFDA 1S8OA 3G9XA 3QH4A 4Z49A 4TGLA 5AK6A 1U8EA 2QXUA 3ZLTA 1NU8A 5EHNA 4XVCA 2ZYHA 1XZLA 5A71A 5ALJA 4UBOA 3QITA 4H7HA 4UBLA 2BFNA 2C4HA 1DQZA 5ALIA 3C45A 4QEKA 1VA4A 4B81A 2IITA 1IZ7A 4GLBA 1WM1A 4B0PA 1LPMA 2QJWA 4HRYA 1ZOIA 3KWFA 3D59A 5AI8A 1EH5A 3DLTA 3SWWA 1ZD4A 1H2WA 3FLBA 2RONA 1L7AA 4MYSA 5D7BA 2DSNA 4X71A 4L3WA 4E14A 1E8NA 4RNCA 1F0PA 5FPPA 4WDQA 1CQWA 3FCXA 3QBJA 2OCKA 4BC1A 5D3ZA 5LKRA 2XT0A 2OCIA 4KE9A 4W1RA 3WZLA 3EQ7A 2ZYIA 2QS9A 2WHRA 3PDCA 2VJBA 2OGTA 3BXPA 4CG3A 5K3DA 2PSJA 4L9AA 4OPMA 5ALQA 1LZLA 1IMJA 3R40A 4QWMA 1XLWA 2J3QA 2VSQA 3PF8A 1WHSA 4HRXA 1HL7A 1EVEA 2PSFA 1LPAB 2JGJA 1IZ8A 1Y7IA 4QDZA 2PBLA 3ZI7A 3M81A 1JT2A 1J06A 5FRDA 2WU4A 2XQFA 1AX9A 2H7CA 4WFIA 1CUVA 1UKCA 4PO3X 3HXKA 3F97A 2ZSHA 1CR6A 4EBBA 1CUDA 4KYVA 2XUJA 1XZAA 5LIPA 5F4ZA 2B4KA 3O95A 1QIIA 3LLCA 2XUFA 3R3UA 6YASA 1SCIA 5FDFA 2XB6A 3RKSA 3WLAA 5AIBA 4JNCA 5JD6A 5IVDA 1XQYA 4JYPA 1X70A 1CLEA 4GWLA 5E4TA 3E4DA 1IVYA 1AGYA 5AICA 2YXPX 5KREA 4QNNA 1AURA 2GZSA 2C58A 1CUJA 3C87A 1XQXA 4UHBA 5ALFA 3D3NA 1CUXA 3O4GA 4B9EA 1UKBA 3HABA 4C88A 4TPKA 4FMPA 4INZA 2CB9A 3BJRA 3DQZA 2C5FA 2V98A 1DX4A 1XKTA 4N8EA 3W06A 4O08A 5AHXA 4G4IA 5AKZA 4BE9A 2XUGA 2DHDA 3ZPXA 4AN1A 2WFMA 3N0TA 2J3DA 3NUZA 4YASA 3R0VA 2VTVA 1XZHA 2OAEA 4X97A 1E8DA 2HIHA 2WJ3A 1QO9A 4J7AA 3AIMA 2X76A 4FKBA 4MQLA 5T4FA 3V9AA 4B9AA 2EEPA 1HDEA 2WFLA 3ZV7A 4DIUA 1MJ5A 4UBIA 1QONA 2DR0A 4FBMA 5AKLA 5A7FA 2HA0A 3QM1A 4OYYA 1ORVA 5ALVA 1QGED 4G9GA 4IH4A 3D7RA 5IH7A 1I6WA 4J0KA 3MUNA 3JYHA 4E11A 4W63A 1CUGA 1CUYA 3K9BA 3O4IA 5JYCA 1WHTA 4OSEA 3E3AA 4YPVA 1BN6A 2RI6A 1GPLA 4XX1A 3G02A 4UFPA 1WPRA 1H2YA 4OB6A 5LZ4A 4J0DA 3STYA 4LYEA 4QA9A 1XZEA 3C6YA 3DL7A 3QZUA 4I4CA 2WKWA 4Q1VA 1CV2A 2O2GA 4ZV9A 1D07A 1UZAA 3WL7A 1ORWA 1BE0A 1DQYA 3IB3A 1DT3A 3QYJA 2WFLB 4QLAA 2QM0A 3TEJA 1FFEA 4AN0A 5JASA 1R9NA 5EHQA 4U2CA 3WWPA 2O7RA 2QXTA 5FXMA 1TKRA 1ODSA 1XRNA 4FLEA 2YH2A 3CN9A 4X6XA 4Y2YA 5I9IA 1QIGA 3IULA 5JADA 1XZIA 1VZ2A 4X91A 3FYUC 4ITVA 2XMQA 5CBKA 4AXBA 3S2ZA 2XMRA 3B3QA 2HA5A 4C01A 5CT5A 4UUQA 1N1MA 2HRRA 4CIBA 3O9VA 3ICVA 2XLBA 5AI4A 3RK4A 4DTCA 5ISMA 4B83A 3FNBA 4IH1A 3U0VA 4H35A 5DYTA 4PNZA 3H18A 2VF2A 2JF0A 5JZ9A 2P8SA 5AK3A 1MNAA 2OCGA 4DMKA 4IQ4A 2ORYA 1OCEA 4K6HA 2G4LA 3DYIA 5D3KA 1VXRA 4L72A 5HF6A 5LZ7A 2OCLA 4B0OA 5JANA 5JIBA 1X2EA 2CKMA 1H2XA 4ZV7A 3MUOA 1C7JA 5I7UA 1F8UA 1YAJA 5ESRA 1QO7A 2V97A 4X93A 4AZ0A 1EDDA 1N5MA 2QTBA 1TCCA 4H7JA 3S8YA 3STXA 4GHWA 2J4CA 3ED1A 2BUAA 4KACA 4F5ZA 1XKLA 1LPBB 2XMSA 1E5TA 3F8SA 3WA6A 3MGAA 1UKAA 1P0QA 3HJUA
chains in the Genus database with same CATH superfamily
1Z6PA 2ZPTX 4M21A 2JIDA 1IEWA 4ZAGA 5CD1A 1SC1A 2QYSA 3M3DA 2GVZC 4LCJA 1NN3A 4NS4A 4ZCSA 4BQEA 1HLDA 1NQOA 2ZSAA 4BS9A 3A9SA 4FLMA 1KBQA 2Q5OA 2RG7A 3VOBA 1WEKA 2CSUA 2EX1A 5FOWA 1GHTA 4OREX 4AWAA 5FTJA 3PLAE 1YQGA 1CT9A 2AA3A 3BWBA 3INNA 3MC1A 4P3NA 4ZT4A 4C0QC 1O5OA 1N3BA 1FJXA 3DBRB 4R31A 1JA1A 1TRHA 2R5WA 2LBPA 4POAA 2X15A 3L93A 3L05A 1G3RA 2CMDA 2QQ0A 4Q4AA 1A72A 2FPIB 1TEVA 5K0EA 4PW0A 3LCCA 3R7BA 4HX2A 3HO8A 1NG1A 2REBA 1BEEA 1UKVY 3G0IA 3O74A 5TPZD 1F9AA 3I5XA 4ZAFA 4DR2B 3AOEC 4FJ2A 3KLBA 1DDOA 1U9YA 4KO4S 1N1DA 2CZGA 4RAOA 4FOLA 4BAUA 3U7RA 2VP4A 4XJXA 1FLVA 1IOVA 2D1TA 2PT9A 4HDRA 1RXCA 1JXAA 3T3PB 5CBPA 4RZQA 3UO8B 3NATA 4C04A 4FYHA 5HKBA 2Q5HA 4GBJA 1MDBA 2ZIUB 1DI0A 3CB4A 4Q1AA 4X7PA 2FGKA 2Z1DA 1XNRB 4DR1B 3A1NA 4JYBA 1SC9A 1I4EB 4IJVA 3NLLA 3EXG1 3O2QB 1C81A 2PUHA 3DCYA 3QHQA 4C22A 2BBTA 4YGYA 1RRVA 1X9IA 3GLQA 3ADDA 4V0MA 3M9LA 3RNOA 4TLDA 1SC4A 3D0QA 3ME5A 4Q48A 3AH8A 1BROA 4W7SA 3A31A 2H1LA 4UM7A 3CW2A 4MIEA 2PK3A 4JX8A 1DUSA 1FXSA 1N5LA 1Z74A 3B82A 1M8KA 2HSGA 3FMIA 4ND6A 2XKBA 3IXQA 2B1IA 1UXHA 3KJNA 2V7UA 1SU8A 4XEHA 4W9NC 2KW5A 3UJ6A 1OAAA 1VYUA 3ZHSA 4D3DA 4M88A 3DWFA 5DBGA 5IMBA 1OV4A 4HVTA 1LI7A 4LC9A 5K3EA 4L08A 1G6KA 1U3TA 4U1RA 3E35A 4W7IA 4XM0A 3VTFA 3UB4A 4AYXA 3P4YA 3KZNA 1PCXA 1QJ4A 2DR2A 3QHPA 1I9CA 3LY9A 2IS6A 1K97A 3BK2A 1G3IA 4PSUA 3TQRA 4EVRA 5K45A 1A9XA 3C7KA 1TJ3A 1YBFA 1XRPA 1QANA 2BD0A 5HKAA 3BEDA 4CETA 1UBRS 1H22A 3NAZA 5DOVA 3MGGA 1D2EA 2Q0SA 1OLXB 1TJ5A 1XLTC 2R85A 3KK0A 3KR9A 4P4NA 1UBHS 4QOEA 2JIOA 2QW1A 4TQUS 5HMMA 1N25A 5EUCA 1FMLA 3JQ8B 3DGFC 1XMIA 1MTOA 5TSDA 5I4KA 2GEFA 2Q45A 1DT5A 1ES9A 2VRBA 5GV8A 3TRDA 2FPSA 4R40A 1ZN7A 4GRDA 2H0QA 3JVUA 2BGTA 4IJUA 1TGYA 3A2LA 3HNOA 3RYCA 5LQDA 3SF0A 1J1IA 3UKJA 2CHFA 1YKFA 2OHGA 5J2UF 5AW9A 1TCBA 1YZLA 1XFAA 3A6LA 4LGVA 3M6AA 2VJLA 1KYXA 2XWJI 4BNHA 3TI9A 1N6RA 4K9MA 3N86A 1NW4A 2JFNA 3QSYA 2DC1A 1OGIA 2EX4A 1BQ4A 5BP7A 4G5FA 3PYXA 3P45A 1GUBA 3I1YA 2XNJA 4YRLA 2EFHB 3O8RA 4IFTA 1J8DA 4ETWA 1VIDA 3M1AA 1F4PA 3NNNA 4HDSB 1SURA 2BFDB 2PH3A 2RGXA 4EABA 5JQGA 4KUEA 4KN8A 3I6QA 1RKVA 1FC0A 5F52A 5T7BA 3R7NA 1RZRA 2GEUA 2X6QA 2ZW9A 1PDWA 2X7JA 1NY5A 1O4VA 1Y33E 1XDDA 3FN4A 1AA9A 3HE3A 1CQIA 3DBLA 4RYDA 1UJ2A 4D79A 1TJ4A 2AJTA 4O3FA 1YQWA 1ZC3A 3FZQA 1PYGA 3I62A 2QB5A 4AURA 2Q2NA 1PL0A 4NNOA 1N4AA 4BJ6A 3BA1A 4BKRA 3OBIA 1WZCA 3OQ6A 5D8DA 4CT0A 2QT0A 1RKBA 1OFGA 2QP9X 1I7NA 5JCPA 4WXEA 3WKAA 4KDFA 5DZSA 2F9MA 2V58A 4BFLA 1V4NA 1ZX1A 2GF9A 4XE5A 2VNHA 1D2AA 1ZU5A 2IYXA 1E0JA 1X8XA 2YVAA 5CNIA 4W6QA 4WY5A 4YP5A 4ZWNA 3RLIA 4LXIA 1PUXA 5CVVA 4YUAA 4P98A 5B1EA 5EJMA 1ESMA 1DJNA 4UUAA 3AVWA 5A02A 4ZZ1A 3RTAA 3FWZA 3SBXA 4UHDA 2RGEA 1UPXA 5HFAA 1DC7A 2QG9A 2H5IA 1NFFA 1YCGA 5JUWA 4F04A 1C8LA 2XX3A 4P7KA 4H3VA 3WKDA 5KCZA 5JOQA 2YS7A 3RU3A 1GR0A 1W8DA 2AJ8A 3F74A 3NGMA 3JVEA 1T2AA 4HDKB 5FPSA 3E5HA 1EX7A 3VYSB 4RKQA 2GZAA 4GZLA 4N5HX 4R1TA 4KRXA 5H3CA 4YCMA 1A4RA 3GAFA 3VR6D 1PFYA 2DLCX 1KC1A 3IKVA 4KPUB 4G84A 4ZALA 1KJNA 3SJ7A 4YCSA 4PYNA 5AKIA 2WKQA 3HKBA 3N8IA 4EY4A 5IUNC 4B3TB 1EM8A 3UFBA 1O58A 2HLNA 2INGX 3GJQA 3QLVA 5AK4A 5DU2A 4BQIA 5JHGB 1WMFA 2AXNA 2NO4A 3TLCA 3RS8A 4I5EA 4RKWA 1CD5A 3ZVLA 5IKMA 3VU9A 3PNKA 5LLTA 1BC5A 4AZ3A 4OK3A 1E60A 1O9GA 4G07A 3BB1A 4GF5A 3IQIX 4MKXA 5T57A 1ZM7A 4MVJG 2IEGA 3ZK7A 4D8VA 3KZXA 2I80A 3AUAA 1K86A 4XB1A 4H7FA 4CDNA 1GG9A 3QUQA 3JQ6A 2E4VA 4EB6B 5BR8B 2XYHA 3UG7A 4PC6A 4BLRA 2H1WA 5EIEA 2I29A 1BQ3A 1GG2A 3EA4A 4RZUA 4DIMA 1Z2CA 1ZQ9A 4UU7A 1O9HA 2JGDA 3AP1A 3EAGA 3G82C 3JR3A 3IJ5A 4BQPA 3Q8MA 5BN4B 2AFHA 2P77A 2QUJA 1ZRSA 1SXJA 4DDVA 2O8EA 1RNLA 4AK9A 1J25A 5GOZA 1G98A 1ZS9A 1IY2A 1P73A 2FP4B 4A2CA 3AZQA 2AW5A 1IQPA 1F0KA 5A2QA 4NBWA 5AVZA 2CXUA 1JEYB 3H9BA 2PUAA 2CY0A 1K3UB 3VJMA 4CQLB 1PV1A 1WCWA 3ONDA 4G3XA 2PX8A 3E82A 2AIRA 4L57A 2C2ZA 4WZBB 3TTWA 2D7DA 3IMEA 4GQIA 4IKEA 5AXDA 1VL0A 3BMOB 4KRYA 3MWJA 4Z9BA 3VPDA 2IW1A 2OG1A 4JKOA 1NXXA 2NADA 4PCVA 2FWMX 3GFQA 4XWYA 1C3OA 4Z9FA 2O3TA 4A2PA 2DMRA 1HETA 4ZIRB 2QM8A 2D5IA 4KVAA 1X15A 4GPZA 5B12A 1R4NA 1EIZA 1BMFA 1ZICA 1LQTA 1OFHA 1TL7C 2I3BA 4G8JA 3TJZA 1JJFA 1LLCA 1WQ1R 1HYGA 2GN4A 3M2PA 4ARZA 2IOYA 1P61B 2V7WA 2GVDC 2O3UA 2GYYA 2EBUA 2FOXA 2HDWA 4MVXA 4QLOA 3S28A 2Y1DA 3K6JA 1QOQB 3ABSB 5LBUA 4DDUA 1CQJA 2VSFA 4NFHA 4F97A 4MKFA 4I9HA 1OFTA 2K2QB 1NWCA 5BQXA 1ONPA 1QV9A 4Z5XA 1MABA 3A1WA 4QUIA 4MPJA 1ID1A 3U3KA 2W6PA 4ITUA 4LF6B 3DJFA 1EQUA 3E23A 2EHJA 1FRFS 3ZH2A 3G0DA 3AUUA 3H4VA 2L18A 1KZHA 2ZUWA 5C4MA 2BEJA 1L3IA 4RS3A 3QXHA 4OI1A 3WISA 5KVVA 3W7BA 4ZAZA 4FOSA 2JLYA 1AQUA 1FTYA 1W85B 1TQ4A 1CQZA 2GJAA 4YFYA 1I13A 3AFHA 5F64A 5T4HA 4KOEC 2G36A 1GCUA 3KXKA 5T64A 2RHRA 1GPKA 3ZXIA 1EJBA 4AO7A 5CYOA 1RWPA 3OM0A 4M89A 5TGDA 2Z5FA 4HWKA 2QLLA 1KMMA 2JGNA 1MUUA 4FN5A 4ROTA 1U8AA 4XDHA 5LKAA 1EZZA 3BH0A 1AH2A 3A6HA 2QTGA 3MUFA 1L4FA 3L1IA 3DXZA 5EHXA 1ND5A 4P83A 4R1OA 2MINA 1VE3A 1BRMA 5CXSA 5K2MA 4EWLA 4Q1EA 1R6UA 1R00A 1YVUA 3OZVA 3CLRD 1TEXA 4KLRA 2EF0A 4ZOLA 5HKOA 2XMPA 4AO8A 3H1PA 3CLHA 4KQXA 1FVXA 2MHCA 2QRZA 4LIPD 1ULSA 1E3SA 4LJLA 3DHEA 4RO0A 3NO4A 1KKUA 1O4WA 1E5VA 3JQ9C 5CDSA 3B1JA 1QOZA 2G63A 4X44A 2YMQA 3PUVA 2O5CA 3R20A 2I9KA 1E99A 2OZLB 2FX5A 4HJRA 4MB0A 2PX3A 3OFKA 4JXKA 1NR7A 2PANA 2Y9MB 1QBKC 1AJEA 2JFFA 2JASA 4K28A 5G53C 2Q99A 3HU3A 3O83A 1TOAA 2OV2A 1MKYA 3AILA 1UZLA 3BKWA 2ZWPA 4FYYA 1N0IA 3H0CA 4YP9A 3ZKWB 3P71T 3T5GA 4CL8A 1UMCA 4NXNB 3QEOA 2CXXA 2OD2A 1YR1A 1CZLA 1ZH6A 2HIMA 2QD1A 3Q3JB 4IDOA 4BAZA 1YRHA 5CB6A 5LP6B 1NVMB 1RWBA 2ILTA 1G3MA 1RJ9A 2AOUB 3TINA 4P0PB 3RVMA 4PINA 3RS7A 1N3YA 2CMGA 4CFSA 1G60A 3B3FA 1T4DA 5CAEB 3QE4A 5E2AA 2Q3JA 4H1WA 4A16A 1DOZA 1KVRA 2WHYA 1NG9A 1PJSA 4XSVA 3FFXA 1N2HA 3F5SA 3IUPA 1PWZA 3UGKA 5K3OA 1TQHA 3HFSA 1R3DA 3LSTA 3OZEA 1EWTA 4MJ3A 4J07A 2BMVA 2IDMA 2OB2A 1WX1A 1UBUS 1IWBB 4ZU6X 2WWYA 1TK3A 3EXEA 3TKAA 1Q2XA 3CLUD 3DEAA 1XZQA 3STVA 2CNBA 4AIRA 3U44A 3TRKA 1Y8RB 2YIDA 4U6NA 4CIAA 1N5IA 3UMJA 3MBOA 2B35A 4JS0A 4QTUB 1U1CA 5I9LA 2EJTA 2OGUA 4UFNA 4WZ6A 1BDBA 2QVLA 1G2PA 5KJCA 1QRUA 4D26A 4V0OA 3IPCA 2WUEA 5TVGA 4OHYA 2AK2A 3X1WA 5IG2A 1XCGB 1MA0A 1GAQA 3AHHA 5D7NA 1ODKA 1WVMA 2WICA 4HZGA 2Z9DA 5IT9A 3B1WA 4HBZA 1NQTA 2O1XA 3NHPA 4Y6LA 4XD7D 3IBCA 5FQOA 2OBNA 1ICIA 3DAOA 3JYPA 1KL7A 2L69A 3O9MA 2XLCA 5G4KA 2C2HA 2W6CX 5J3JA 3WMGA 3E9ZA 3DAYA 3T41A 1W1UA 3ZKAA 4BB5A 3J81A 2BCEA 2P67A 1RMTA 5DN6D 3H2ZA 1QHYA 3UM9A 5LYJA 5DBOA 4CKYA 2QM7A 3AL2A 2VIIA 5EAIA 4Q7LA 3LWZA 1ADYA 1GRNA 1T1EA 1XRSB 4FCWA 3MPUA 3BE4A 3ZTYA 4DLYA 4Z1OA 2X9QA 3VRHA 1V26A 3KYDB 4FDMA 5DWDA 1HDXA 4QKQA 5BNZA 3FYSA 1DEOA 3PNOA 3JYQA 4ZU1X 4KBYA 3D3JA 4FJ1A 4QD3A 3BGDA 3DE6X 5FBHA 4IDPA 1ZISA 3EMVA 2BKVA 1I3LA 3SFTA 1CUHA 4WN9B 4WT7A 4ENTA 3AZPA 4O63O 4HXGA 3ZX5A 1QOPB 4JC4A 3A6GA 5FI3A 2PL5A 3UJHA 5K09A 3AR6A 4CM4A 4PC1A 1MO6A 1PI3A 1ML4A 1FDIA 3FHLA 2IDJA 2YV3A 1I1QB 3LQ2A 1PSWA 4KR0A 4PLHA 4WJKB 4EFNA 2E7ZA 4ZCIA 4IVRA 4RS4A 3NWBA 5LQMA 3ZWOA 4J49A 5AP9A 2PMBA 1DQPA 3ER9A 2HIGA 1HMPA 5CH3A 3TGLA 2R0QC 2ZS8A 4ZVRA 2IBSA 3QTLA 3G2PA 3VNQA 2ZTUA 3IAS6 4CMIB 3BF7A 1P7WA 4KO8A 3AXSA 2QL6A 5KTTA 5LXTB 1JZSA 3A4MA 2I7XA 3QLUC 4PF1A 3W5UA 4URXR 2PZJA 2P0AA 2QOEA 1VPLA 3GJTA 2Z1MA 1XEAA 1CTQA 1HEUA 1QHEA 2E55A 3KZMA 5AHOA 1RYDA 4PSAA 5ERXA 1CXZA 4LJ9A 2CGEA 3AR7A 1FU4A 1W4AA 4RK4A 3WRVA 2YYZA 4BVLA 1U7WA 4R9VA 1FX0A 3AM1A 3VNVA 5F3DA 4UNSA 4P82A 3WL3A 1N3IA 3TYXA 1SQFA 2G9UA 4BNIA 5E0OA 4OHFA 2QBYB 3DNMA 2I2FA 2NG1A 4HCJA 5KVAA 1C3VA 4JGGA 3GLHE 3QWBA 4YV2A 2QZ4A 2LWIA 4GVLA 4PYKA 1ETUA 4QJ3A 2VQ3A 4I19A 5F12A 4CRWB 2Z3WA 4MS1B 3TH5A 1RPTA 4UVHA 1AN9A 5DHRA 3UW3A 1ZGZA 3G7NA 3KQVA 3KL4A 1MVNA 1RBMA 5THKA 4LYGA 2VDWA 1M66A 4FHGA 2GH1A 2VH5R 2YR0A 1SHZA 3GGCA 4GWGA 4IIGA 2P78A 5HF9A 1ESDA 1YZVA 2R8PA 3U7IA 1CQXA 3WYNA 4EKNB 1H8ED 1KAGA 2RH4A 3AIIA 5FUYA 4XCXA 3UATA 4G0YA 3CR8A 1BWRA 3A2KA 3GLVA 1L9XA 4TLCA 1ZCFA 2OP1A 2PH1A 3EVZA 4JC8A 5KQGA 4XIJA 4DLLA 1QLHA 2V9ZA 1VIVA 2OLEA 1I51A 1FY2A 4J43A 4RD3A 5SY9A 2F3PA 2NSJA 1TCUA 2W2TA 1GU7A 4RANA 3PE3A 3U7QB 4BV3A 2O0LA 1C29B 1ZHFA 5LQSA 5SICE 4BVAA 1FP4A 1SA0B 3FYUA 1VKHA 1T6YA 3JD3A 3GYBA 3TQCA 4TYNA 2R5FA 3BRWA 3GNLA 3PQ2A 4CQMA 2CXTA 3WOHA 3X1MA 1U0TA 1GZ3A 4FWBA 5GVSA 2KBEA 5IXJA 3OPMA 2W58A 5ITZA 4IF4A 5TDHA 4UULA 3F49S 3W3AH 4WZAE 1IEVA 1F20A 2IV7A 2QJOA 2RGYA 2G9RA 5GZ6A 4I4IA 3K16A 3NIFB 3FMOB 5FA5A 1U5BB 1H4SA 1FYXA 2J48A 1DOHA 1LBIA 3T4PA 1TVKB 1W25A 4GZ5A 4KPYA 2C9BA 3A37A 4JJEA 3E5RA 4I8DA 4E31A 3ONVA 1L4LA 2GPYA 2QF7A 4DREA 3DL4A 1XPRA 5A4IS 4G2NA 1DWQA 1JE0A 2XSZD 4ESVA 1GZ4A 3O31A 2AN5A 1YOVA 3TIGA 5ADUS 5EZYA 5JATA 3QVLA 1SXIA 1FNDA 1ZH8A 3WP1B 4FYXA 3E9CA 4URFA 3LO5A 4CCYB 5HQ3A 3BWVA 4RYLA 2DECA 1P9RA 2XTAA 4F7WA 2QX7A 1BEZA 4NBKA 3DFZA 4DDHA 3NC0C 4KNWA 4PGMA 1B0PA 2FZ4A 1UUFA 4P3XA 1GAWA 5CGQB 1D4AA 1CDEA 3ABQB 3RHSA 3EQ8A 1GPMA 4YBZA 5D5QA 2DTEA 1RZUA 4UAVA 4Q18A 5DTIA 3NKLA 3CXUA 1VMKA 3RPEA 1MB9A 2FE1A 1BA3A 1KYTA 1UQTA 4QU0A 4JUAA 3NOQA 4W8OA 2IZ6A 4ZI7B 4MTCA 1Q0LA 2OGSA 3HR8A 3NBKA 2H8KA 4PZAA 4EW3A 4FOOA 3VSCA 4AY2A 2HRZA 4RK0A 1SBZA 2ONCA 3T5DA 4Q3CA 4R6WA 4D9EA 2ZROA 4LJ7A 2C99A 1ZI8A 2P27A 2ERXA 1GRCA 1P1FA 1A9OA 3B20A 5F51A 3LQYA 2P2LA 3V1UA 4OQYA 1G20B 7GPBA 2NUBA 3K9FC 3D54D 2G6TA 4B3FX 4ZKDA 3VISA 1CZNA 3FDFA 1EXDA 1E98A 1AS3A 3SCZA 3FSRA 4M9ZA 1NMEA 3H5WA 3W5DA 4R7TA 2PYDA 2O8VA 4BFXA 2J0QA 2FMHA 2VDKB 4LJYA 2W2PA 1Z7YA 4HLNA 4JOSA 4QUDA 4IO0A 3DZFA 2GPAA 2A8YA 1H05A 2ZRPA 3L1VA 3QMMA 4U7FA 1ZMXA 3SNHA 2J08A 4ZJUA 4A5SA 4EG6A 4OXNA 1TZ2A 1UFOA 3OTIA 3INRA 5ITSA 3OP4A 4TKMA 4EMUA 3GP8A 3QG5A 3FPBA 1ZCAA 2IEDA 3BMCA 3K32A 1BHQ1 3BGOS 3TDMA 3DOCA 5EJ9A 5TGZA 2UXBB 3DMTA 3W5VA 4EPWA 1GTZA 3H5AA 2P4EA 2ZYGA 4YR9A 2DCUA 5K8IA 3CVYA 2R8YA 3DO5A 4BNYA 2JD2A 1VTKA 1Z2NX 1LQ2A 2VWQA 3LJKA 4L4YA 3M49A 5EPUA 1IN8A 3KEOA 1SD1A 5JAQA 4CN9A 4AJNA 5M34A 3ZI4A 1R5NA 5PGMA 3T9CA 4HDOB 1JU3A 1KIFA 2F67A 3V46A 4AO6A 2BP7A 4DMLA 1F60A 3RFUA 2WJIA 1CNEA 1M75A 1L5KA 2R3SA 4PO1A 5HGJA 4CCWA 3G0OA 2UVDA 1Z0DA 4EDFA 2CJWA 1DPGA 1IUPA 2BGIA 2FPPB 2FSVC 2PIDA 3HFGA 4YWJA 2R4QA 3N2IA 1QZUA 1IY0A 3R41A 4IIYA 2B1GA 1HORA 1IHYA 3SVTA 3PF9A 1NQXA 2EFEB 2QVZX 1IATA 2XUHA 3D6VA 2C9ZA 2QTWB 4P7BA 1LSSA 1OI3A 1P31A 4FZ3A 2GZRA 4PZLA 1EVYA 5JTTA 2FU5C 2RJ3A 2HFKA 4QGBA 2OPHA 2ANCA 4DM7A 1RFGE 2WPDD 4DR3B 1QE5A 4FKMA 2I6QA 5FTNA 5BRNA 4F1KA 5A7HA 4Q01A 2VAWA 4QJ4A 1FTNA 3FM9A 1VL2A 1QF9A 3AHIA 4JL6A 3U1BA 1IZZA 4X65B 1WUJS 5M2QA 2MCFA 1P81A 1P2SA 1XZFA 2HV8A 2Q6IA 3WRYA 3BD6A 2YXEA 1K63A 3HUDA 1XU9A 3LQFA 4UUNA 3TRJA 3EXHC 3KBOA 3PC7A 3TTXA 4LQLA 4FVTA 1ENOA 1D9ZA 1Y82A 3PLRA 4GLLA 3OIWA 5FBWB 2PX5A 4BMDA 1NSYA 5KPDA 3MTGA 4DAOA 6REQA 5JJLA 5JXHA 2H5JA 4UPEA 2VAVA 1ZSYA 2A57A 3WNBA 1KOFA 2X5OA 3HL4A 3NJ8A 4JCOA 4KP7A 1PJZA 2I4OA 2J87A 2LKCA 3GUVA 3Q2OA 4NCHA 3V6LA 4EHHA 5JAUA 1VP3A 3NWEA 4DKXA 4HZIA 4X1IA 3Q9NA 2MTBA 2IE0A 3HY3A 4IHJB 5LDDC 3OCUA 3ZDAA 1E1RA 2A0XA 3BJZA 4B73A 2IUSA 5CJPA 1TU3A 1BW9A 4MYCA 4B3MB 3K0BA 3O8QA 3V55A 4CR7A 5BMVB 1S02A 2NVBA 3LO8A 3O38A 3KQSA 3VKGA 4JJFA 1BVYF 2DBQA 2XUKA 4KJXA 3TD2A 4WACA 5FWAA 1EUDB 3IOMA 4EHJA 3VUEA 1FXWF 2ZM6B 4DVJA 2I22A 4DUPA 1UP6A 3IBTA 4IQFA 5ALUA 1M2HA 1XD2A 4K5QA 2W5UA 3U6BA 3OQPA 1ECLA 1XJ0A 1CUIA 2W6ZA 1QIFA 2FOLA 5KWIA 1E2JA 4IKPA 5FFFA 1WTCA 4NZMA 1NNUA 2B83A 3MJFA 4UHFA 3G1WA 3R9XB 1SN7A 2FUKA 2F43A 3HN6A 3HYLA 2ZB4A 3ABZA 5F35A 1VMIA 1U8TA 2WZCA 3E61A 4GVXA 1OT3A 4HAZA 3T6KA 2ZJ3A 2R8BA 2YJ4A 1GAXA 5A1JA 4QIHA 1NW9B 4ZYXA 1ZOLA 3Q72A 1Y98A 5J4HA 5IVKA 3KLOA 5CLHA 1E2LA 4FUQA 5JVDF 5ALEA 2A14A 1QQ7A 4G36A 3A27A 3FW1A 4C7KA 4M8KA 1EA7A 1T2UA 3JAKA 4P22A 1QMPA 1W35A 1BVHA 2I2CA 5SZIA 5K9ZA 4NARA 4L6IA 2VNAA 1FDRA 3E3NA 2CYBA 5T5QA 1UCFA 2R84A 3OICA 5FQNA 4YMTA 3GAZA 3PI6A 2YY7A 3KOXA 4IVNA 4D74A 4M87A 4AUNA 1I4WA 2HU7A 5DGHA 2GYVA 3DZIA 3KKNA 1H1TA 1PJBA 2WA2A 3D8TA 1VDZA 4JQYA 3OEED 4LK3A 4O1IA 3RM3A 3S1AB 4LKRA 4P5EA 2L42A 2Q41A 3AF4A 3CLTC 4BNDA 5LDHA 4GECA 3UWPA 2E49A 1IAQA 4TZTA 4XGRA 3ESDA 2I66A 1LSUA 1YJ5A 1K8YB 3AI1A 3KFLA 4GYKA 3SKVA 3VHXB 4CM6A 1J6UA 2AC4A 1DWUA 3FBTA 4J1TC 5TQ0B 3GUZA 3V4LA 3IMFA 4KL8S 1U8FO 4CKEA 3W1VA 2Y1EA 4F56A 2QR3A 1W52X 4YUYA 4JJAA 3ZV4A 3ANMA 4PZDA 4TS1A 1F12A 2B7LA 4ND3A 4RH1A 5KWEA 1X38A 5CJ2A 1E5DA 3FHTA 2QMOA 2GM9A 4ROSA 4EHIA 1TMGE 3IVMA 3NTUA 4TS4A 2OCYC 3ZHXA 4WW0A 4UTVA 3EX7C 1SKQA 5JPCA 3OOYA 1N8SA 1ODCA 2BF4A 1SUEA 2HMTA 1WF6A 2KQUA 3T9EA 5JAIA 2V7XA 5EWMB 5HWSA 1JIKA 5CT8A 3CONA 1V71A 2EAUA 1UT5A 2R6CA 3D4IA 3GUUA 5EG5A 2REXB 1IQ0A 4PBTA 4OHOA 4Q3EA 3JYLA 1D04A 2OO5A 2RBGA 4MI6A 4AMZA 5C2JB 2J9GA 4NICA 2UVQA 1MPXA 4OEHA 1T9GS 2JDID 2VEOA 4CWAA 2Z6AA 1GYRA 5JS7A 3EPPA 3TSCA 4CIYA 1HDZA 1YZQA 2OAGA 3GLTA 2I6XA 3KZKA 4RETA 4CU2A 2R66A 3ASYA 4V2IA 2ZWIA 1KTIA 2VJMB 1DQRA 1X1AA 1USGA 4YLYA 2IXGA 3HZRA 1KMHA 3RE1A 4Z54A 3CPJB 1NAIA 1Z7BA 3JQAB 3Q11A 3I09A 1TKAA 3UHAA 1KMQA 4HGYA 5AXBA 4G5RA 1C9MA 1CK4A 4L1KA 4OMUA 2GT1A 1Z3IX 2WJYA 4L8VA 4ARCA 3GJ3A 3WTCA 2I78A 3P0RA 1W5TA 4AKTA 2B7CA 5AUPB 4MULA 3G2MA 1ZGJA 4XD2A 4YWHA 4ZCRA 3K0EA 4LDJA 4X5OA 2NOAA 3DEHA 1GA4A 1CUWA 2XNKA 1MAAA 2QP3A 3O8BA 4FCCA 3UUGA 3I2HA 1EG2A 1L5OA 3ND8A 5D01A 1K8ZB 1UXIA 2GYUA 4F84A 1J2RA 1KHTA 3PUKA 1EWRA 4OAPA 5HYVA 1NBIA 3C1OA 3LC2O 4BQFA 4QICA 4OJQA 2HLHA 4HH4A 5CUQA 1LPNA 1R1DA 2E4XA 2HCFA 2J9YB 2KYRA 4OBBA 3DZGA 4Q66C 1UIRA 6PFKA 3VSBA 4DMHA 1UMKA 1ONSA 4DUGA 1W44A 2C3PA 3ZHBA 4JI2B 2QUAA 1EK6A 1QH8A 3L7NA 5D1NA 1BZYA 2ZSFA 1UDBA 2G5PA 2IEAA 3HDQA 3OPYB 4IFBA 4JXJA 1V6SA 2BHSA 2RGUA 3NHKA 1FFCA 1E6KA 1JHPA 2G08A 5ENVA 2AJBA 3ZZ1A 3WSWA 1Z2DA 3B9QA 1X1SA 3W8DA 4AY6A 1CDDA 3Q7QA 1HYHA 2P2NA 3ESRA 4NSNA 1QIDA 1C9YA 1LSJA 2Q3MA 4UDXX 4X90A 4F4HA 4LXGA 5ALWA 3JASA 1U04A 1KI2A 1B76A 1HUQA 2KJQA 1FSGA 1FP1D 1I8TA 3P9SA 3BSYA 4DCNA 1DKUA 2HD4A 2HWXA 3ZJVA 1ODIA 1Z18A 3A9TA 2MU1A 4MUXA 2D5LA 1IJEA 1L7MA 2C0QA 2PM8A 2ZAGA 3BZBA 3MMNA 2FTKE 2WJ4A 3L7KA 3ZZNA 3AFIA 1YCHA 4Z7JA 2HA3A 1PR4A 3IT3A 2WDPA 4LY9A 3BHJA 4CTNA 1G5FA 1KO1A 3MCAA 4AF6A 4ZYZA 5KB3A 3OFSA 1KDYA 4AS3A 5BQ5A 1W9MA 3PLNA 3ICQB 4UDNA 2BMAA 2A0FA 2RHOA 4XLZA 2QRKA 3ZY6A 2ST1A 1HQDA 1YRWA 4LHEA 4M60A 4MKIA 2ZQYA 3KJEA 5EXTA 4C5BA 1PGPA 2O3QA 4WBNB 5AUNB 2OHIA 5KOYA 3GPLA 2SKEA 2CV2A 5AJYA 1G8HA 3P4XA 3A10A 4ICIA 1I6KA 3GFSA 3MF4A 4IIEA 5DM2A 3DOUA 4PXSA 1NRWA 5C5IA 3FYTA 1JXOA 4WJZA 2NT3A 3FMGA 3NHUA 4K1LA 4HK4A 3LF2A 4U9IS 4EO4A 4N0QA 1A82A 1RSZA 3VYRB 1PGOA 1HE5A 3BAFA 1HZJA 4IFIA 2ODAA 2Y1KA 3GRAA 1U6JA 1KIAA 2RAPA 1KMNA 5ESWA 1E77A 5AK0A 5H9VA 1LK7A 1GP2A 1L8OA 3ZIAA 2LD4A 2OCPA 4BDSA 3KU1A 3OPYI 2VJKA 1Y6QA 2GTHA 2ONKA 3V2HA 1UDWA 2J5QA 2VQFB 1FNCA 4V0SA 3PFFA 3DVQX 1K0UA 4R16A 4C7OB 2ZT8A 5JDCA 1R2QA 3R3ZA 4O1MA 4PHFA 4PTLA 13PKA 3WDLA 5IXYA 3CF0A 2D06A 1UKYA 1YWGO 3PENA 3CUVA 4REQA 5EINA 3M9XA 4UEQA 3MILA 3GXOA 4IJMA 1RJWA 4LVCA 4CCSA 2IU6A 2WNHA 1L1QA 2FMKA 2UZIR 2WKRA 3HB9A 5EIBD 1RQ2A 3A6DA 4MUJA 4MX8A 3OEYA 5K8LA 3L7AA 3BL5A 1AGXA 2W71A 4NL4H 2PHZA 4CKBA 5IF9A 3EBOA 5IARA 2XQIA 4B33A 4MRMA 4F72A 5JE8A 2AD1A 5CX1A 3AEUB 3VPCA 4HAIA 1ZN8A 2Q6TA 3C16C 3KKLA 2NU9A 2J67A 1Y8ZA 4V38A 4L5AA 3ZEIA 1S2IA 4JWKA 5HZHA 1CR2A 4A27A 1OH6A 2DPHA 1XQ9A 1XTVA 4J6FA 4K05A 1TFRA 1KAOA 1E9FA 2HXYA 1EESA 2GFQA 5C8YB 1V16B 1AIPA 3PFGA 3PXEA 1NRXA 2CE2X 3FPAA 5D3MB 5JFTA 1HR0B 4Z3OA 4W6ZA 5GONF 4GYWA 3THWA 2DJIA 2X0FA 1YR8A 3IQXA 2VTDA 1VYVA 3UWOA 2J8ZA 3PGVA 1RAFA 2P9BA 4F3TA 3A6FA 3NEAA 5DXFA 1SO8A 3WGQA 5J43A 1DG3A 3MN1A 2NU8B 1N2BA 1RWMA 4RQUA 1PS8A 2X2FA 4IGEA 4PFKA 3HK2A 4FFBA 4HH1A 4AQDA 5I3CA 3U40A 3GCWA 4LY3A 2R79A 3K0FA 2QIPA 1GZ6A 1M6YA 3C5HA 2BH9A 4Q1FA 4TUYB 2WKSA 5DJ5A 4BZPA 4CLEA 4YXWD 5ELXA 1KFJB 2ODWA 3T1NA 1T8TA 1WIWA 2BEUB 2WPNA 3N7UA 1EB9A 3PXDA 1ZIDA 3I72A 4FGZA 4G0OA 3W9BA 2WQ7A 1H3EA 4M0CA 3RG8A 4WOCA 2FN3A 1OHHD 2GHRA 3OZXA 2FMTA 3PE4A 4ALNA 1XLUA 4EGSA 4YJFA 3GT0A 3H04A 4OQDA 2RHGB 3N9IA 1MB0A 2QN1A 1UPUA 3WGVA 4B40A 1XJ5A 1TK2A 3LQRA 1VRCA 4H59A 1AQLA 2ADMA 4HNTA 5JCJA 4K9NA 1M6HA 2RK3A 4MV6A 5FA8A 4KODA 4JEIA 1DC4A 2EP7A 1O54A 2F4NA 2IYVA 2XVYA 4IAOA 3BHMA 4WZBE 3E9EA 1F9EA 3F4KA 2CNKA 3ADPA 4ISCA 2XECA 1XRMA 2YJTD 3K0AA 4HNHA 1CJBA 1W29A 2I6SA 3UPUA 2L82A 3VHQA 1BGVA 1NHWA 4H0CA 1B6RA 2OBLA 3AI2A 3FPCA 4DA9A 4E5VA 4BFVA 5B58C 1GXSB 3CKMA 4YI3A 1QZTA 5C8VA 2YMPA 2HA7A 2GCPA 3PWKA 4DANA 4IH9A 1BS9A 1EX6A 5AOCA 2D1RA 3M89A 4DQVA 2DKOA 3NOOA 1E2FA 2EP8A 3W5HA 4ERXA 5C32A 3H17A 4GE0A 1KQOA 3GRYA 2WR8A 4YP1A 2PFGA 3BG5A 2E4AA 2Q0QA 3DBHB 3FNHA 1TVCA 1NRIA 3WKCA 2DQZA 4ML3A 5B3JC 1R0WA 1QXSA 3HJRA 5AW6A 1SCJA 3B3GA 2O8CB 1UQRA 1E1CA 1PR6A 2AHOA 3EZLA 4HWTA 4AJ1A 4UQPA 3Q87B 4E5NA 1PZFA 2OAP1 2ON6A 3FCAA 1BKYA 2D00A 4KQCA 4JVSB 2YASA 4N0MA 1IRXA 4DV7B 3IDQA 3OE4A 5CVUA 1YCFA 3IERA 1XMSA 3ETDA 3R23A 4G0NA 5FIUA 3L4KA 1OFIA 2V3CC 5EIAA 4Q4HB 2O1WA 3MVEA 4E3WA 3S81A 1PJAA 1S01A 3GQVA 2QTRA 4QATA 5GIOE 3WJ1A 3OM8A 4JLUA 4WL0A 1Z0UA 3TR6A 5B3AA 3EODA 2AQKA 1JHQA 2ZJ7A 1YE8A 3W9YA 3SBEA 4IDEA 3QFSA 2Q0XA 3D8SA 5FUBA 5LUBA 4XYBA 1Q1AA 3VNUA 4I0WB 2JKVA 4J1SA 1MMFB 1BFDA 1CS0B 2HQOA 1US8A 3VPFA 3A9WA 3RAGA 1BDMA 1VE1A 2ZSKA 3GDFA 1KIMA 1V35A 4OXKA 1WXWA 1KH2A 2FPGB 4JZKA 2VHCA 4FDLA 4RF2A 3KPJA 4ZT6A 5HR5A 2YIMA 1VOTA 4LDRA 4N8SA 4CLHA 5IJ0A 1N7JA 1A2OA 4CMEA 3W04A 3KPYA 3EAQA 5K6AA 3R5JA 4BB9A 621PA 4JN6B 2JAOA 2CXPA 1G55A 2G1JA 4P34A 2CMFA 2VT3A 3E2MA 1XO1A 3ORQA 2F59A 2O2SA 4WDRA 3ZWKA 3JRWA 5LU9A 4EPYA 5F23A 1JVBA 3DV9A 2F00A 4XWOA 1NXQA 2AOXA 5BNFA 4EGCB 4AP6A 4PR0A 4R8SA 4BP8A 4BTVA 1D1PA 2JIMA 3EVNA 3I9JA 5KOJB 4C0XA 1YTUA 4D4HA 1EXWA 5DCLA 1Z4QA 4P54A 2QLBA 3OJLA 1KI6B 3WBBA 4M8IA 3CE6A 1FSFA 2V59A 5K4HA 5DWVA 3G2KA 1S1MA 3T1VA 2OOKA 2VKTA 4PGGA 1X1DA 4KQ2A 4GXTA 3KQMA 5KU7A 3V7FA 5ARBA 7ABPA 2DHQA 2QZSA 4PTZA 3WLNA 2AXQA 2GPWA 3IQHX 5HG0A 1ML3A 3RRJA 1NBOA 3L1UA 4DM4A 3OZGA 4L4UA 4GO1A 2QZJA 4BQNA 3FWKA 4PX2A 4K3VA 3RV4A 2X4LA 3MHTA 1N1GA 3MOIA 4DNPA 1RTKA 4IIHA 1R4ZA 2DBZA 3TKLA 1S9HA 2QI9F 1PNTA 2HO4A 3VFDA 4YDSA 4MDFA 3Q6NA 1MN6A 1O0SA 3D8BA 1B41A 3WNDA 4EHNA 3ICEA 2R6JA 2XTZA 2P4UA 5A7GA 2IYUA 4HOYA 4KLAA 4NG4A 1XJWA 3I04M 4D4JA 2VL7A 5LZ8A 5CDFE 3JVVA 5B1HA 1LRLA 4DIBA 2JAQA 1XAJA 5H3HA 1YZHA 2I4LA 1Q92A 1EGMB 3WP0A 2VYFA 1MDFA 2YRFA 3R24A 1XP5A 3F67A 3F5DA 2WYIA 3ET5A 3UYKA 2O2DA 4D02A 2AWNA 2Q8QA 1Y3DE 2H0AA 2VYVD 4MAMA 4ZQEA 4CG1A 4CFYA 1NNEA 4ND1A 4OHKA 4BMPB 2HXGA 2Q4RA 4G8CA 1OZGA 1NJ8A 4HH3C 3C3YA 1I7LA 3AVPA 1FXWA 3AIOA 1C1DB 3EHEA 1R37A 2QAJA 2NZWA 4IDFA 4NMXB 1RD4A 2I2WA 3LX5A 4N3NA 4CIXA 4KR2A 4KREA 1MIOB 3KXPA 3TE7A 2IJGX 1T4MA 1P33A 4DSTA 4HPJB 3TR5A 4E32A 4ZN6A 2CEKA 4YV1A 4OKIA 4ALLA 4S3MA 1JR3D 3IOYA 1KI7A 4NC9A 3OPXA 4H17A 2OWDA 2W9XA 4HI0E 4QWWA 4XB6B 1O97D 1V8OA 2FW0A 3D3KA 4YRRA 3CT4A 3ZDZB 3TM4A 5BWBA 2BAGA 1OXVA 2XNSA 1PQWA 2RGAA 1VGVA 3EPLA 2ROQA 1W5BA 3CIFA 3ZK8A 5IFKA 1RMQA 2ZATA 3WWZA 4BRUA 4EB8A 4ETMA 2V9CA 2DFLA 2J0SA 1HMYA 3FZGA 4HDMB 4LVNA 4WA7A 1ADFA 5EJGA 5JVDA 3W1WA 4MHTA 4AJ9A 4D3YA 4WCFB 3EGDB 3IA2A 4G1UC 4ZPJA 5DNVA 3S55A 1AKNA 5K99A 3H8VA 2WIAA 2IYQA 4AF7A 2O2CA 3PR3A 5BN1A 2OENG 2A94A 3Q5GA 4JX9A 4U2KA 5DIZA 1N6PA 3AHDA 5IN5A 3AIKA 3DZBA 3DCNA 3PHLA 1IOZA 3MOGA 3RYHA 4EPXA 5C37A 3ZCRA 4RA6A 3VHRA 3VR5D 3SBDA 1JAIA 4FMDB 3BEOA 4RKFA 3ZLVA 4E51A 1NPTO 4A15A 4S0XA 1UK9A 4ONEA 3DMPA 1MW8X 1W4LA 2FPLA 3L0CA 5JWHA 1VKJA 3AP2A 5AI6A 3V97A 2IELA 1H1DA 2QA5A 1LLFA 3KQUA 2P6OA 2C9OA 1ECFA 3DR3A 1Z37A 1Y9AA 2KX7A 3AM3A 2WJ6A 5IUKC 3D64A 1MT3A 3RUAA 1E94E 4ZHQB 3O8OB 4N5IX 1KDPA 4KE8A 1KFCB 2DBVO 3O0DA 1PAUA 3N53A 5B2ZA 3V7WA 1BQEA 1YRAA 3E05A 5BT8A 1P6UA 3GNSA 3ETLA 4GWKA 4AS2A 5ED0A 5FUQA 4RF5A 3G2OA 2Q4TA 1Z5ZA 4R1MA 2G07A 4X92A 1V25A 2FR0A 2HWYA 4MV4A 1FS6A 1JLSA 1FYEA 3PHBE 3SMQA 4D4KA 3VGPA 5DTMA 2BTQB 2EZ4A 2FG6C 2X1MA 2VXBA 1G4HA 3KKMA 3QLTA 2P0YA 4IF6A 3IQDB 4RDHA 2AG8A 1ZK0A 2HLDD 5FL3A 4BBJA 4HYQA 1GNRA 4Y0VA 2C1ZA 1DBQA 5FPHA 3PFHA 4Y1EA 3WI7A 4CPDA 2RHHA 2FSPA 3PXUA 4CM1A 4CZ2A 3EK2A 2R60A 3DVAB 3RJ9A 2OXCA 4CLOA 1X92A 1UDRA 1Z7EA 3AB8A 5D86A 3LBNA 4HWSA 2N0SA 2ZI6A 3DB2A 3QMVA 3MWGA 2XEXA 2GD6A 2BEKA 3OUTA 3WK8A 4U5XA 1IN7A 4YY3B 3A25A 4M22A 4JMLA 5JH7F 1RC1A 2C5HA 3QY9A 3U4QB 3H97A 3VR2A 2HPZA 3TSYA 3LG2A 1ZYUA 4Y2JA 4MR7A 3U37A 4B2YA 2EKLA 4B80A 2Q1XA 2OE2A 2G80A 2W2LA 4ZVLA 1A95A 4MDEA 1JHXA 2OHFA 1DTSA 2IODA 2VZ8A 2ZRKA 2ZRIA 4ZVOA 1ZK3A 3VDQA 4DWJA 4ZARA 4RGBA 4B3JA 4L8FA 2H57A 4WINA 4HNAA 1RM4A 3N59A 4DUZB 1QVAA 1KFEB 2R8EA 3O1LA 2BGLA 3WXBA 3VC1A 3O21A 2JRCA 4YRSA 1VSQA 1TTQB 1R7RA 4PRZA 1DKRA 4ND5A 4BO4A 1IPHA 1KR5A 1OU4A 4DAEA 1RABA 3LFHA 3QE3A 5LFAA 5EHZA 4GMHA 4QUHA 3ONEA 4GBGA 1ZVJA 1MC8A 3DT9A 1RAHA 2NN3C 1HI9A 4FYPA 5KQPA 3M5PA 1HC7A 1Q57A 4QT4A 2PRSA 1WDLA 5F7JA 4EJMA 1VCMA 2C4NA 2H2FA 4KFTA 3MT0A 2NO9A 4V24A 3ZYCA 1L7XA 1KI3A 3CEJA 3DEZA 5HDBB 2B1RA 2P1ZA 3L5OA 3LHDA 3A1FA 3NTRA 1QP7A 2Q6KA 3UJ7A 3WL5A 3WNZA 4HEA1 3BDVA 1TCAA 1P0FA 2QN6A 3ENNA 3GPCA 3PNVA 4PO9A 4Y2SA 5K3FA 2PZLA 2ZXFA 4DRYA 4GSLA 4PZ9A 4HDCA 221PA 1MW9X 1Y7PA 3Q9SA 1SPXA 5L4NA 2R86A 2NIPA 4GPTA 2Z57A 2HK7A 4HFRA 2OM6A 3JATA 4OLFA 1QH1B 1LNQA 2XA1A 1V3TA 4DSAA 4PY2A 3E9RA 3UF0A 2JA2A 4EY3A 3O26A 2OUKA 2WM3A 5TF4A 1G66A 1DBWA 1Z6QA 2M2IA 2Y1OA 1T5HX 2QL9A 4NMWA 1MJFA 2J07A 1TO1E 2PGNA 1GILA 2H4YA 4D5EA 1LCIA 4UU0A 1OLSA 1KZGB 1KSJA 3T52A 1M1ZA 1U81A 1XVAA 4UCQA 3QYAA 1G6Q1 4D41A 3UPTA 4Z4QA 3RHTA 3WADA 4DMCA 2EKPA 2ZVJA 2FQWA 3FUTA 3HBJA 4ZQFA 4X45A 2XYPA 4F4JA 4ZP1A 5LQCA 1ZA2A 1HE3A 1RYNA 4JBHA 2JBAA 2V96A 4NOJA 4TTVA 1NPDA 1AS2A 3LA6A 1THZA 1JDPA 4IINA 4MVJH 2WI8A 3AEXA 4KE6A 1MB4A 3BXZA 3L8FA 3GLIB 1B6GA 4RF3A 4JYZA 1JZTA 5IXSA 2WF9A 1XMOB 5FADA 1ZIOA 3CMMA 1QIJA 1ZI6A 2QSZA 4B75A 2J6HA 3RHFA 1VYTA 1KRXA 4CGZA 3B60A 3HKDB 1Y9EA 1AXEA 2VHUA 4HNVA 3MWEB 1V9SA 1ZAYA 1PEDA 3REGA 1AF4A 4XQCA 5T41A 5FEUA 2ZBEA 2OL4A 4K9OA 1BN7A 2BEVB 4HB2A 4P32A 4EMTA 5JAZA 4BNXA 1YL7A 4NMMA 2OBXA 5JAMA 4EQ6A 4TL8A 1E1YA 2C92A 3RV3A 3C2QA 1YI1A 4YS6A 1GZ5A 4WE3A 1Z83A 2FPXA 1T1GA 2MR6A 3DDNA 3U7FB 2GN8A 1QHSA 4EO9A 2IP4A 3VR4H 4I46A 1Z07A 2ECKA 1CUAA 1OXKB 2FK7A 4WRRA 4ZCQA 2FXIA 5IAEA 3QU2A 4FOPA 1KZ1A 3HKEA 3FF4A 1J0DA 4Z8YA 2QG6A 1SEPA 1EFKA 4B2IA 5ICMA 4TTPA 2OUIA 1J5XA 4Q3BA 2VJDA 3TFOA 1CUZA 2C78A 2X9NA 4TL7A 3WLFA 4U3JA 5HF5A 3I39X 4F12A 5AVRA 3IOCA 1UEIA 3IV9A 5F7ZA 3QIVA 4A8JB 3T5MA 1N6KA 2RGGA 3DE2X 4LRQA 2Q4BA 2XIQA 1YU9A 2FSHA 3EDYA 3EPRA 4WECA 3UAGA 2GCNA 2G77B 2ZAYA 3I0MA 1KMIY 2WYVA 4X1YB 1S8OA 3G9XA 3TOZA 4V2UA 2PNJA 1D5CA 2Q7XA 4AF8A 5A0FA 1JQJC 1SCBA 1H0RA 3OAAA 3W34A 2P41A 4FGWA 5L3ZA 1IXSB 2Z4SA 5EHNA 1IG0A 2C2WA 4LXUA 4UMEA 4J7XA 1JA9A 3NONA 2X9LA 2ALJA 2XZTA 3EMDA 3H1TA 4PLVA 2X4IA 1XZLA 5JSQA 2ZSBA 2GESA 4ZAYA 4Z6KA 1VHWA 2PLNA 2ZAMA 3H99A 2X7HA 3TIFA 4BO9A 3AF3A 3RASA 2ZWVA 5ALJA 5EJ7A 2CL6X 3HHPA 3QPBA 4M76B 2F1HA 2HREA 3L6OO 3SXUB 2UUAB 3IAUA 3MD0A 3L92A 2FWIA 2DFVA 1EFVB 5IULC 2C4HA 2RMKA 3QJGA 4DV4B 4W8HA 2XE6A 3L7IA 4RIEA 1V37A 1ZOSA 3E9YA 3JQFA 4LBVA 3HUFA 1VA4A 1B93A 2QRGA 2J5KA 3DLAA 4P5DA 2IV2X 4B81A 3QI7A 2EGUA 4GLBA 5TE9A 4KXYA 5JSFA 4JWTA 4OK6A 3TW4A 1CSEE 5I4CA 1LPMA 3L6EA 1W6UA 3CX7A 3GQBA 4ZVUA 5A4JA 1MG0A 3ACDA 4WNAB 1PR9A 3ZHVA 4OHCA 5I8WA 3D59A 4LQDA 1VKOA 3II6X 4QFDA 1FMJA 2QTTA 2GJ4A 2ZQ5A 3DFUA 3OQHA 3I01M 1ZD4A 2JIPA 3PD1A 5DOZA 4XQ9A 1W2WB 1FUYB 3QWFA 1XMJA 5BO5A 1LU9A 3VU1A 3T5PA 2FLKA 5F9HA 2JI8A 5L3QB 3K96A 1FQKA 2WYUA 1MRSA 1ILEA 1WDKA 4IWNA 4O4IA 5E0KB 1RLOA 3E2IA 1N0UA 1K27A 2EFGA 3HP1A 2TMKA 2BCGY 2OTCA 4EL0A 1F0PA 4J1NA 3FUWA 2PKRA 1V1MA 1XDGA 1CQWA 2ZIAA 2QTNA 3ELUA 2RBEA 1PKXA 2X40A 2YWJA 3QBJA 4Q9LA 1HZZA 5LDGA 1OOEA 1N77A 2FR1A 1WP4A 3SQDA 2MMGA 2PTHA 3DFMA 2GZ2A 4NABA 4KWTA 5I45A 2A30A 3RRXA 2XA9A 1XVIA 1FNSA 1YGPA 1AUPA 3PQDA 1W5FA 3ILHA 5AJXA 1F8XA 2RGNA 1M74A 3P9CA 3R3JA 3SJBA 2MDTA 3LUKA 4K9DA 4KE9A 1HNWB 3BL6A 3KM0A 4FGLA 5HUJA 1XR3A 2QS9A 3ODPA 4LUCA 5JEDA 3LTNC 3NMUF 5DHQA 3PEFA 3AUXA 4TSRA 3K94A 1T36A 4A82A 3DE3X 1P2TA 3HXOA 1ODJA 1V0JA 1WXDA 1U2QA 4IFEA 2DB3A 1HE1C 3DLHA 1DUVG 1Z0ZA 3VZCA 4F8JA 2WF7A 1YJBA 1Y4UA 4NX2A 1C3LA 2C4UA 4L5YA 5BOSB 4FWIB 4RTOA 3QUAA 5K3DA 2BKEA 2F3UA 4YMGA 2NQ2C 4D4IA 5EP2A 5LMZA 5KNDD 3DMRA 1LZLA 4PWYA 1IMJA 1D2MA 4LHSA 2A7XA 1O2DA 4YREA 3HWRA 4LJSA 4N0EA 4L8LA 4OX9Y 1O5TA 1CDOA 4INJA 4XVHA 1X0XA 2VSQA 4DEYA 2VDMB 3E6AA 3F78A 4ER0A 1SG9A 1WUYA 4I55B 4XEUA 1FW6A 4OFBA 1HL7A 1XSEA 3H5RA 1EVEA 3MMXA 4MV0A 1TUBB 4B7XA 3M6UA 2SECE 2PT7A 5CLIA 3N70A 2ZXUA 3N74A 2VCEA 1T5OA 1DBSA 1W49A 1DHRA 3AUYA 3MJHA 5I9SA 5KPJA 4DWOA 3CSSA 2CB0A 4N39A 4QDZA 5DBHX 3C1AA 5E9JA 4MEJA 2PBLA 5LP6C 4C29A 4PS1A 1SBCA 2E5LB 1UC4B 1J06A 1F4LA 3AR8A 4B3BA 2O7SA 4LF7B 3N2NA 1ZD8A 3MS7A 2JCVA 4P31A 4NLLA 3PEWA 4WFIA 5KQLA 1R8YA 1UKCA 3ILVA 2GF2A 4AU1A 1SOWA 1P1KA 2GMWA 3IPRA 2VPZA 1PWHA 3SQLA 1ISHA 4DJFC 3FKSA 1T29A 3H9CA 3SPXA 2WABA 3F97A 1TXGA 4QNRA 5CGZA 1CR6A 2ERCA 4EBBA 4EJFA 1EBBA 1CUDA 1E0SA 1WVIA 3EIQA 2XUJA 3RODA 2J0EA 1J7JA 1QQTA 3BQMB 3I9OA 3LPCA 2B4KA 5EP3A 1XPUA 2XV1A 3ZDFA 4CM8B 2BHNA 4KR9A 3UB2A 1BDJA 3LHFA 1ZWLA 4MTLA 5LMCA 3FTCA 3KFVA 3Q2KA 1R4MB 3O1JC 3PDIA 3D8UA 2C2YA 4KUHA 4F86A 4ZXPA 3BIOA 2GHIA 1GGEA 5FHRA 4B46A 1W48A 2EKZA 1O95D 4WXHA 5FUXA 1DL5A 1K9SA 3IEUA 4QL3A 5FPYA 2BY4A 5AIBA 1QVRA 4C6TB 5E4FA 1P5FA 1DCTA 3DXXA 3ZDYB 1SKYB 2P6MA 2OECA 1XQYA 1XB2A 5GM1A 5JY1A 2AOWA 4M9SA 3RHZA 1X70A 4IEIA 2R2GA 1CLEA 3OBBA 4GOXA 3WDMA 3QKSB 3KEFA 1RHRA 1DEKA 3M4NA 3UFXB 4EELA 2WU0A 2J32A 3PA6A 3H2BA 1IQUA 4QXQA 1T26A 1IVYA 1KVSA 2HCJB 3L8MA 3ONFA 4JUBA 4M1SA 3CLRC 3PFKA 4QNNA 5F3RA 1RMYA 1AURA 3KL2A 3LVBA 2J9RA 3WFIA 4X66B 1E2BA 3C87A 2OPBA 5FWYB 3ZD6A 4JUCA 1WHSB 3M3PA 3QIAA 3D3NA 1CUXA 4F11A 2FAXA 2YHIA 3O4GA 3GZNB 2DF8A 2DPMA 2AOTB 4KI0A 4TMVA 1UKBA 3L4SO 2CW5A 3BDAA 1KWGA 4OKNA 1GCIA 1IMOA 1EJ6A 1T5TA 1GARA 1FRZA 2R25B 5ER9A 4TPKA 2X8JB 2GKGA 4INZA 2CB9A 1NE7A 3BJRA 4H6XA 4L2IA 2NYUA 2V98A 1DX4A 2XNDA 3DE0X 2YJ5A 3LUPA 3ZS8A 1HTWA 1PNVA 3I9KA 4O08A 5AHXA 1L5YA 3AR4A 1PNRA 3R6WA 1VG8A 3UXHA 1NVEA 2EZTA 1EFTA 2PRKA 1U2SA 2WZDA 3H3XA 4JB2A 1P7PA 3HPQA 4EKGA 2C7RA 1E5XA 2PAFA 3I9V6 4CQNA 2J5BA 3FNIA 4X54A 3A1VA 4DDKA 2ZSDA 2NUTA 2V7QD 1IHOA 4EFMA 1GIAA 4AN1A 1EUCB 3EPHA 3O94A 2WFMA 4NCNA 2J3DA 4IZIA 2P5SA 4LY6A 1Z2AA 1P2DA 2BFWA 2VTVA 1P2UA 3IT0A 4WH0A 3UV6A 1HK7A 1OZ0A 4OXXA 4Q7JB 2CD7A 3OMWA 1XZHA 4IIVA 2OAEA 2IIBA 1I4OA 2PWYA 4U7TB 1BGWA 1E8DA 3CLUC 4Y6GB 2HIHA 4H4EA 3TPFA 3AUFA 4Y9RA 3Q9UA 5F7OA 4B44A 1QO9A 1R0CA 1NLFA 5IF3A 1TU4A 2QM3A 1TDJA 4HQ0A 4U4AA 2NYVA 5ELLA 1KPGA 1UJCA 4ZYVA 1AQYA 4L73A 2OFOA 4X61A 2EXXA 2YW9A 1LDNA 2Z0MA 1G1MA 3SGLA 3PI7A 3H9EO 4J2TA 2CDAA 4MQLA 5P21A 2V5VA 3A4TA 3VAZA 3R0QA 4ISBA 5EWJA 4ZT3A 3CLKA 1RJGA 1HDEA 1WMEA 3DO8A 4FQ5A 4KIGA 4N7JA 4Z4FA 2A88A 2ZRAA 3V9PA 1PTKA 3CO0S 1XA4A 2ZP1A 3UH0A 1DAEA 4O2LA 2O8BA 4FBMA 4FS8A 3R7AA 4EF4A 1X7YB 5A7FA 3TR0A 2FPRA 4A5OA 1CB0A 3ZI0A 3W5SA 1GQQA 3PFIA 3PL1A 3DZCA 1L4KA 1RIIA 3PSAA 1SULA 1J8FA 4IJWA 4TWZA 5HS6A 3X1DA 5KMGA 5LM3A 5IH7A 2J0UA 2PLFA 3TLYA 1I30A 4E7OA 4KWIA 3USZA 3UT0A 1T5DX 3HYRA 5B2FA 4MYRA 1WUKS 4O02B 4Y6OA 4KKXB 2Z95A 1V7PC 3FVQA 4PYRA 1DHTA 1CUGA 2E9SA 1W88B 3DONA 3LWDA 4W63A 1S8AA 4O4JB 2J9ZB 1DO0A 1T9DA 1ZVMA 2PR7A 4OK5A 1YZUA 3ENQA 5JYCA 4YROA 2CFRA 4ZODA 1SHLA 3I0NA 1KO4A 3A3PA 1OH8A 2PAAA 2JHCA 4IGFA 1P5JA 4WIAA 1ZMTA 4YPVA 1BN6A 5A06A 5CHYA 5IDXA 2O52A 4XWAA 4ZRNA 1MRZA 2MSEB 4R0VA 3NDIA 2ACVA 4KLZA 3G6KA 4DDMA 4YECA 3DTTA 1J97A 1ZNYA 4YRDA 2FFHA 2IUYA 3CT6A 5KAPA 5K8CA 3BILA 4DA8A 3Q7PA 1ZG3A 5LZ4A 2ESRA 3PZBA 1HT1E 3DZ8A 4XZ3A 2R1UA 3ZJTA 1SELA 4N18A 1LS6A 3GLGA 5E95A 4PEVA 4HAWA 2GJ8A 4LSGA 2WWXA 4LYEA 2ZR0A 3EA0A 2X8WA 1P4AA 4UHJA 2ETVA 3DL7A 2PD3A 3QZUA 4BVEA 1SBIA 3C98A 1F2UB 4N41A 4I4CA 2WAAA 3HEMA 5CYPA 3WSVA 3G49A 4HLCA 4MUEA 4A1FA 1DVRA 2ZB2A 1K1EA 4X1OA 1QFZA 4JLWA 4N5LA 2ZU0C 3RSQA 4E3ZA 3BQ9A 5HTOA 3SE7A 1V8DA 3GMSA 4TKVA 1DT3A 1NUTA 1XD9A 1XQ1A 3QYJA 1ODLA 3N6VA 1H66A 4YH1A 5EXDA 1E2QA 4C05A 5I01A 1LDGA 1ZL0A 2YWEA 3R5SA 1RQRA 4EHKA 3C14C 1FFEA 4AN0A 2LIVA 2ZKLA 5EHQA 3BWCA 3L02A 5I7OA 2CNDA 4MQFB 2EKDA 1YR3A 1ULTA 1Z3CA 4G09A 4EVSA 2AT1A 3NDBB 2PJRA 2F3QA 4GMDA 1KYQA 4YMIA 3S6JA 1TYDE 2O7RA 2Q3HA 4IIJB 2Z1NA 1TKRA 1EGHA 5CNMA 2HSEA 3LCVB 4RU1A 2ZWMA 2EJWA 2BFEA 4RLQA 3HCDA 3WGIA 1TC2A 1W34A 2XBUA 2YHSA 3ZHYA 3VZBA 4DW8A 5AW4A 1VSBA 2W4QA 4NH0A 1NVAA 2YWBA 1QIGA 3KXIA 1Q5PA 2ZK7A 4R5HA 1XNHA 2BRUC 1Z0IA 1SXGA 4G5OA 4CNQA 3U7EB 4LHZA 3JQ7A 4BOYA 3WBKA 1V5EA 3IKTA 2M98A 2MSCB 1FL9A 5FTMA 5CBKA 3QI2A 1WHTB 4X3PA 3JQPA 3V1TC 1DTWB 2XMRA 2YW2A 2IKSA 3B3QA 1NTRA 4XQGA 2P3SA 1Q7GA 1UWVA 4NYIQ 5H1YA 1SU6A 4O4LB 3WXMA 4BX8A 1BWPA 1GGFA 3FSEA 3KO8A 4H1HA 2W83A 4ZT5A 4UUQA 1N1MA 4R9SA 4GLJA 3UWDA 5HKLA 2JLSA 3VR3D 3DDZX 2NXNA 2XLBA 1SB8A 3C3DA 2P35A 3OCJA 4MWDA 4QDJA 1M10A 1DAPA 3PC4A 2G9NA 2R87A 3HJTA 3RK4A 2TMGA 3SIRA 2VPIA 3DM9B 5CLQA 3ST7A 1PVVA 5ISMA 1YJCA 4B83A 1HEIA 1ZK2A 2XKKA 3FNBA 1Z38A 3HM2A 2Q4DA 1GRRA 4H35A 4JJKA 4BEWA 3L6CA 3MLBA 4P7GA 1RHKA 4ZCLA 3LVRE 3C3WA 4NEHB 2Z30A 1GL6A 3V2IA 4AKIA 1VFNA 2JNWA 5DI3A 821PA 2IIPA 3CUWA 1D7AA 2Y92A 3AQIA 2EGGA 3JYNA 2VF2A 3H4IA 1IEXA 2JF0A 2R9VA 2P8SA 2Y1XA 1L4BA 2I1LA 4BLTA 4MRVA 1YBAA 1GSAA 4Q9NA 1E7MA 4F45A 3FGZA 4B6SA 4DMKA 3ZQKA 5DHSA 1A27A 4OP1A 3E18A 2ONZA 1M8FA 1BD3A 3T95A 2ORYA 1RHQA 2NSHA 2C2OA 4I4TA 3RVKA 4RJTA 3A6KA 2PKWA 3EW9A 1YFLA 1ECJA 5EUQB 2UYHA 5WRFA 2UUBB 2C04A 2IT1A 1U0RA 4LXXA 4QPZA 5M3BA 3KVNA 4DM3A 2JFGA 3GRUA 1XCLA 2OCDA 3GBPA 4LWZA 1RWKA 2F1RA 3KYCB 3VR0A 1VRWA 1VIAA 1G7CA 2A86A 3AHFA 4ZA2A 3ZU3A 1QQAA 1XPJA 5IASA 2XT6A 1A7AA 1MEJA 2CKMA 2JI6A 3KAQA 2GUGA 3ROXA 4KYIB 4UQOA 2CEAA 3G2IA 5TLSA 4RKEA 3ZQJA 4RCVA 5TV2A 1EEXB 3DLCA 5CDYA 3C1UA 3RSCA 5BR1A 5I9NA 5I7UA 1GPJA 2SCUB 4Y6PA 3AEYA 1Q21A 4RH3A 4W7HA 3UZUA 1QO7A 3GYGA 3AEQA 1XVLA 2CK3A 4AZ0A 1EDDA 3O91A 5KSZA