The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
75
|
sequence length |
264
|
structure length |
257
|
Chain Sequence |
SLLSNQLHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPAEAVEMIEQTVQAHVTSEVPVILVGYSLGGRLIMHGLAQGAFSRLNLRGAIIEGGHFGLQENEEKAARWQHDQQWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQRQTLIAQRSANLGSSVAHMLLATSLAKQPYLLPALQALKLPIHYVCGEQDSKFQQLAESSGLSYSQVAQAGHNVHHEQPQAFAKIVQAMIHSIID
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural Genomics target NYSGRC-T920 related to A/B hydrolase fold.
rcsb |
molecule keywords |
conserved hypothetical protein VC1974
|
molecule tags |
Structural genomics, unknown function
|
source organism |
Vibrio cholerae
|
total genus |
75
|
structure length |
257
|
sequence length |
264
|
ec nomenclature | |
pdb deposition date | 2003-10-01 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF12697 | Abhydrolase_6 | Alpha/beta hydrolase family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |