1R3HA

Crystal structure of t10
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
260
structure length
248
Chain Sequence
GSHSLRYFYTAVSRPGLGEPWFIIVGYVDDMQVLRFSSKEETPRMAPWLEQEEADDWEQQTHIVTIQGQLSERNLMTLVHFYNKSMDDSHTLQWLQDCDVEPDRHLCLWYNQLAYDSEDLPTLSENPSSCTQHLEGHCSDVLQKYLEKGKERLLRSDPPKAHVTRHPRPEGDVTLRCWALGFYPADITLTWQKDGEELTVEFVETRPAGDGTFQKWAAVVVPLGKVQSYTCHVDHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MHC H2-TL-T10-129
publication title Combined pseudo-merohedral twinning, non-crystallographic symmetry and pseudo-translation in a monoclinic crystal form of the gammadelta T-cell ligand T10.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 36
structure length 248
sequence length 260
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3hA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1r3hA01
3G5XA 1M6OB 3VI3F 4NOBA 3ARFC 1HQRB 4UU9B 2FBJL 3OKYA 3IU4H 1T1XA 4PJFB 4F7TA 4OGAC 4PYGA 1QZ1A 3AU1B 1ZGLM 2RHEA 4OUUB 5FYJD 1WJ3A 4EI6B 1I9EA 5JPMB 1N7ML 3MV9A 4NCC2 2XRAH 4U1SB 1I1AB 3FHAA 4I5BB 1U8JA 3ULVE 5F3BA 5E8PB 4KDTC 5BZWB 1BBJB 4MJ6A 2FL5B 3TYFA 1GHFL 5C0RH 3SGEH 4YUEH 3LKNA 1A4JB 2HFEA 3AS3A 4YHOL 3ROLA 4JFEB 4MS8A 1AQDA 4QF1B 5DVOA 4LDOB 5E8EA 4BSVB 2IADB 1C5BL 1EV2E 4M5YH 2Q76A 1YYMH 5H2BB 3VI3E 1CDHA 2HJLB 3BH9B 4X0KA 2FSEA 1BD2B 1EIBA 1OTTC 4AIOA 4YHLL 4CN1A 3QPXL 5FK9B 4LGRB 5DQJA 1MCBA 2H2PD 3GBLA 2WBKA 2Y6SD 4XPBL 2B0SL 3C5ZC 5TDPA 2B2XL 3K8LA 4PGDA 2AJUH 2GSGB 4XNZB 5KVEH 3CDCA 3HI6H 4G9DA 2G5BA 5DUPH 3BIKA 2PNDA 4XC1H 5AYUH 4L5FL 3LPFA 4NN5B 3QDJA 4DWHA 4F58H 4HAGA 3F7VA 3MLTA 4ETYA 1JYWA 4JFOA 4R8WL 1DN2A 1WISA 4Q9CA 1VEPA 5I1IH 4JM2A 2R69L 3MZGB 3O8XD 4NQUA 4L4TE 2E7CA 1JNHA 4L1DA 1BFOB 1YC7A 5FUOL 1OAQL 2DWEA 3DYMA 2EC8A 5I76B 5D8JL 4PREA 5DJZA 4EZMA 2NCMA 3UEZA 4WFGD 1NFDE 3BHBB 5ID1A 4Y8DC 4L8SC 2E6QA 5DYOB 1J1XH 1RZKH 2VXQL 3RVUC 3SCMD 5L0QC 4JKMA 2B7DT 3V2AR 2D9CA 3NAAL 4MJIA 4DVRH 1T03H 4FXLA 1HCFX 4RMTA 5H35A 3AXLA 1FG2B 4G9FD 3LKSA 3B2UD 1U3HC 5FGRA 4E41D 5L2JB 4YK4B 3ZTNL 4XAWL 3WE6A 2V2TA 5E2UL 4ZO9A 3TCXA 3V4PH 1JNLH 1KN2H 3MCG1 5DRXB 1UACH 1FIGL 1RMFL 4PTTB 3GKWL 3FFCB 4W4OC 3RZCC 2NNAA 4OLVH 4MQ7B 2AXFB 3U2SB 1LO5B 2AJYL 1B2WL 4ODBD 3TFKA 4OFIA 2AERT 4B53A 4J8RB 2XKNB 2IFFH 3PXJA 1DEEA 4HIIB 5ACZB 3ARED 1MCQA 1P1ZB 3SY0A 2W65B 2WNGA 1S7RB 4HS8H 4Q2ZB 4Y2DA 2FATL 3SGJA 4LBEB 2Y1VA 4Y89A 1CLYL 4GBXC 1A1MB 2CGRH 1BFSA 1W0VA 1R3HB 5HGBB 3P11H 4ZS6C 3IKCB 1WCQA 5EBMA 2R1XB 4GKZA 2BSRA 4PFEA 1NGQH 3UYPA 5DJCA 1BVZA 4H1LH 4APQD 1PEWA 1S7QB 4U4BA 3Q3GA 1CK0L 1WWCA 3MRNB 3RA7L 4P4RA 4OZ4A 5D5MB 1BZ7B 2FYYB 5TE7L 3HMWL 4NP4H 4ODSL 1NEUA 3MGTB 2GUOA 1G9ML 2YMXL 1RUPH 3S36H 4MSWB 2QSQA 3D1MC 4J2XA 2ZZUT 4HIHB 1FYTB 3BN3B 2OX5A 5T33L 1AFVL 2AKRA 3WIFB 3QWRD 1UZ8B 1QVOA 5ILTH 5DXWA 1NL0H 1CF8L 2VNCA 4XPGH 4MNQE 4KMTH 1LO3H 4LEXL 4QKXB 1OL0A 1I8MA 1TVHB 3IAGC 4JCMA 3WMSA 2CLVB 1GIGL 4ELMF 5BV7B 2F53A 4HK3J 5I74B 5DMGC 4MA1B 1BX2B 2IJ0C 4PGEA 5I1AA 1JZ2A 3ZE0F 1WZLA 5F1OB 1A6UH 5CGTA 5C0EA 2J5LB 1AXTH 2IAND 4LCCB 3LSOA 1XGUA 3NIDF 4NRXB 4P0DA 1BM3H 3WUZA 4J4PC 4FA8A 4JVPA 3HZMB 4WY7L 5IF0A 1QBML 5T1DL 5C7XH 4DKEH 4M00A 1KF9B 1OB1B 4DN3H 3DGGA 3OJVC 2AQ1A 3DVNA 1NMBH 3IFPB 3W82A 2ZCHL 2Z31C 3BXNA 2UVEA 3FQRB 3VGEA 5JLZB 2A6IB 1KEML 2XWBB 1ZVSB 4MCYB 3N85H 3RNQB 5I1HH 1S9WA 4BQ9A 2XTJB 2H6PB 3QDMA 5E5UB 4I2XB 5FECB 5DQ9A 4ISVB 1MELA 3HCVB 3RPKA 5HGDA 4AMKL 1EHLL 2A83B 4LSTH 2FDBP 3QXAA 1VKXB 5EBLB 4L9LC 3RJDA 3NVQA 5E9DA 1A6PA 4F33A 2VDQL 3GHEL 4EDWL 2Y06L 2HFFB 4P23D 3DX6A 5KN5B 4GAGL 1TNNA 4L9DA 4YFLI 4ZFZA 3R06A 1YECH 3G5YA 3OXRA 1NLDL 5DMYA 1ND0A 3VFUA 1JPSL 3D85D 4RFEB 4KI5E 4G7VH 3SDCA 5CHNB 3U7WL 1KIPA 3IT8D 4JFYA 2WV3A 1JI1A 5F9DC 1F00I 2ARJB 4ONHA 4EBQH 2HVJA 5GGSA 3CLFH 4FTVB 3VFWA 4Y2OA 1ZEAH 4QOKE 5I8KL 4G5ZL 4G6AC 1IMHC 3HKFA 5EU6D 3NGBB 1QEWA 2WQRA 1H0DB 4M03A 4PRHE 3IDJA 3UP1A 1PSKL 1CFVH 3WO3B 3MXVL 5IMLB 1KB9J 4XH2A 1FJ1B 1MQKH 1I1RA 2P5EA 5JIHA 4HUKB 2YPLA 3QEHB 5IB3B 2Q7YB 4KTEH 4XPHL 4GAYB 5A2IH 1I1YB 4RWYH 1O7SA 2NZ9D 3EJYD 4DUVA 1UM6L 1SYSB 1CD1B 3GNMH 3H9SB 5F1IA 5INCB 4LAJH 3KPSB 1MJJB 2BSTB 1I7RB 3CVHB 1LE9A 1E4XL 4MXVF 3DOSA 3OGCB 1GGIL 3MLPA 1M7DB 1H15A 2C26A 1G9NH 1QFUL 5KOVC 4LCWD 3MJ6A 3S98A 4ZO8A 5HGHA 4QRTA 2FR4B 3ZDYF 3KPMA 4MB4A 2QSVA 3OG4B 1G7PA 4PYHA 3CDFA 2RR3A 4GAJH 2Y23A 1OSZB 4LPXA 3F58L 1ERNA 1DBKH 1QO3A 5I71C 4XXCA 5HJ3B 1JWSB 3HUJA 1CXIA 4OM0H 4PJ7E 1Q9OA 3LS4H 1V7NH 4LVOB 4RFNB 4XCFL 5SWSB 1ZLUK 1CTNA 3JBG7 3U0TB 5T1LA 5JW4N 1BWMA 2BCKB 5D2NC 3PWPB 1L9NA 4MXVE 3PWUA 3MMEB 3PWVB 3HC0B 3SGKA 5HHMA 4NJAH 4X98A 4KKAC 2GTZB 2QEJA 1J88A 5JDSA 1XEDA 3MNVB 4YO0A 1E27A 4YWGL 4WDIA 2Y9RT 3LB6C 5JHDD 5T3XE 4S1QH 2ZSWA 4MZ2A 3DXAB 5I1LB 3B83A 3F7RA 4FG6D 4Y4FC 3REVA 1GJIA 2ZUQC 5DHVA 3LQZA 1QFWI 1GGCH 4P2QE 2YD5A 4YQXH 4GRMB 4YC2C 1S9KC 1N6QL 1IC5L 3MPCA 3CLEL 1BVKB 3ROOB 1MWAA 4HX1A 4QGTA 1JZ8A 1U58B 4MMZC 2H32A 3P9MB 3LRSB 5I8OH 1WSST 1BOGA 1UM5L 1W0WA 2FGWL 1LILA 4N1CA 4NKIL 4YHPB 4HKJA 2OXGA 1KJ2B 2Q8BL 4O2EB 3D0LA 3TN0B 5I6XC 1YDPA 4YJZL 1QYGH 2HKHH 1LO0H 1K8IB 2AVGA 2OTUB 1OAUH 3OR7B 5K59F 5CP3H 1T89C 3E3QE 3PABB 2D2OA 4I0PD 4M7LL 3UCRA 1G7IA 1BP3B 4PG9A 4YHKL 3M17A 4RGNE 3VG9C 3GUTB 2VL4A 1CE6A 4PGBB 3KPLA 2CDEB 5LQBL 4QRRB 1IM9A 5EU4B 5IW1B 3QUML 3IETA 1C5CL 3BRGC 1NLBL 3SDXE 1ZLSL 3LKRA 4LCIL 5IESL 5ICYA 1GVIA 4NRZA 1DBJH 1RZJH 2Y5TA 3EOAA 3DURB 3QG7H 5JZ7C 5J12B 1MHPL 4PP8C 4L29A 2D0FA 4IIQB 1WBYA 3L1OH 2VAAB 3ARFD 1LDPH 3BUTA 3FB5A 3HZYA 5F8RC 2GY5A 2R39A 4JAMB 1E6OH 4PJGB 2DRUA 5LJYH 1RZGB 1U3JA 5K59E 1UGNA 4KZDH 4JJHA 4LU5L 2DICA 3QFDA 25C8H 3L5XH 3N1GC 5C07A 4Q6IA 2XPGA 4Z7UF 1AR1C 5BQ7B 3QIUC 5F7UA 1FO0B 5IHUH 3UZVB 1U6AH 5EO0B 1HH6B 5E94A 5FDYA 3QULB 1EEYB 5JR1H 2PR4H 2XZAL 3H3BC 4JGMA 3VFVB 5GGRB 3QEQE 3C60B 4TVPL 2UWEB 4NZUH 1F8TL 5DDHB 1IGYB 2Q3AA 2ED9A 5DTFA 3MBEA 3P77B 1MCRA 3QWQB 4OGYL 3MRJA 4DEPB 3MV7D 1B4JH 2NXZB 2QADB 5DJ6A 2VC2H 3PUCA 4NM4L 2X4OB 1KPVB 2FX7H 3WS3A 5EU3A 4P4KB 4HCRL 1A1NB 1XF4A 4LSRL 5AZEL 3UBXI 3KPQA 4PJFF 2WIMA 4LSSH 3A0OA 2ADIB 2YHGA 3BW9B 5CJ5A 3PG2A 1P5UA 1S78D 1L0YA 3RNKB 1LO4H 1PG7W 4HUMB 4Z7UE 3BISA 1RFDL 1MREL 1DQQA 1EO7A 5E6IB 4UV4H 2D0GA 4C83A 4AL8L 1JIBA 2F19L 2F9BT 4PP2A 2EDBA 1P4LA 2VIRB 4NQVA 3O3BA 1EHAA 4NC0B 1JZ6A 3LKPB 4PP1D 1G6RA 4WU7B 4OTXL 5IQ7H 1YQVH 1YA5A 4G80A 2F74A 2QQNL 2AAVA 3GSUA 1G7QB 2E8ZA 5FUCE 5JPNA 1A47A 3W5MA 1RPQA 1H3PH 3LMJL 1J8HE 1A6AA 3BD3A 2IPKB 3UTTB 4H88L 4IMLA 3ZKMD 4PRIB 5HPMB 3MRCA 1JCKA 5I1CH 1HKLH 5IM7B 1BF8A 4CVZA 2YC1B 4L8DA 4E0RB 3JV6A 3NABH 2DF3A 4HC1L 2WIIA 5C0CD 1WT5A 4TRPH 3WIHL 4ELKB 4Z7VA 1IGTA 3SPVA 2Y72A 1UWEL 5GRVK 4B7LA 5BS0D 5MEOB 2LU3A 4MNGE 1D9KD 1AGBB 3GO1H 2X4QB 3ARVA 3VD3A 2OJZH 3SCMA 3L6FA 5CSGA 1EBPA 1K4DA 4B0MM 4U0RB 2WBJA 2HP4A 4AM0B 1L4IA 5L2KD 4KJQC 5HHNB 3BP4B 2IC2A 4FQHA 3X17A 1IC1A 1U3HD 3WDJA 3HE6D 2EC9U 2DDQL 3V0WL 4E41A 5JNYA 5CSZA 4PIRF 4DW2H 3CX2A 2PTTA 1NBQA 1MFBL 5E7BA 1JYXA 5DVNA 3V5HA 1RK1A 4WUUD 4MQSB 1OGAD 3NPSC 4YAQA 4I3SH 4HH8A 3P4MB 4F37F 1IGIH 2AV7A 3BQUC 2LE9A 3SDDC 3VFRA 1NSNH 3X11B 4PGJA 5I16B 3DRQB 2YD9A 1HILB 3D25B 4PJCA 3BWUC 5C0JB 3AREA 4IRJA 4ZFFB 1Q0XH 3V4UL 3ALWA 4U1NA 1W72L 1T04A 4GMTH 4I3RL 3ZE2E 5HI3D 2CKBA 3UBXA 1KB5L 3FQTB 1CIDA 1P53A 3VWKC 4ENED 4JEGB 1JBJA 5ADPH 4PD4J 4TSCH 2EDDA 4NKDB 4APQA 1HXMB 5JQ6L 4B50A 2GT9A 5I8EB 1WK0A 5D1XC 4XVUC 3D3VB 3IDIA 3FT3A 3G04B 3CXHJ 3DSNA 2VLKB 5J3HC 1LO2L 5CLTA 3RIFF 1DE4A 3BKYL 4NYLB 5GHWH 4ODHL 1AKJB 5FKPA 4FQ1L 2DQCH 3KGRA 3OKMA 3MUGA 1NCAH 2DIBA 1EAJA 3RL2A 1KJMA 4H1LG 1JTPA 2LU7A 2PW2B 4KJYA 4LSVH 3NIFF 4JO4H 2V7NA 4NKOA 1H3TA 4WU5B 1IAKA 1U2HA 4WNQB 2CLZB 3ZKNC 3QUXB 1QUNA 3G9AB 1OF2A 1JRHL 3K4AA 1JVKA 3ILQD 4UT9H 5D5MF 5DMGD 4Q0XL 1CQYA 1NCWL 1Z9MA 5IKCB 3K80A 4WHTB 5C0AB 4P9HC 5TGBB 4QXGH 2IANA 4K3GA 5IGXH 4J4PD 5EOQL 3BT2L 4RAHA 3SEPA 2DN7A 1I3GH 3RIAF 4KWUA 4DUXA 1UG9A 5JHLL 5FOBA 5EWIL 3CPLA 4FZ8H 2BVOB 3KYNA 2Z31D 1QLRA 1NMAL 2ITCB 1INEL 1N3NB 3SGEI 5FF6A 4PLJC 2X4NA 5A2FA 4ACPA 2CIIA 3HG1B 2A1WH 1MF2H 2CUHA 4V3EB 4PJIB 1SMAA 4JM4H 3WDHA 1JHKH 2XA3A 4UILL 3CFKB 3DMMB 4OF7A 1P2CA 2ORBH 1FVDA 2HT2C 2LVEA 1N5YL 3VGGA 5L88H 5BV7H 3HNTH 2GJ6A 4UDTB 4GMSH 1SYVA 4M3JA 4OCLC 1YMMB 1KFAL 2ZNXA 3H9HB 1JPFB 2AABL 4OZFB 1LP9A 3L3GA 3QDGD 1W2KT 3MLUH 3C5SA 4NWUH 1WGOA 4P23A 3QJHB 4NQED 4YDLC 3EFDH 4QXWA 5D7LA 4X7FC 3TO2A 5T5FL 5AG9A 2CIKB 4N0UA 1UQSB 4ZDHB 3AY4C 2CJUL 4OZGA 5MENB 3VW3L 3JWOC 4WFFD 3U83A 5IW3A 4NPYB 3D85A 1FNLA 2C3GA 2NY4D 4PRNB 5CZVH 2VLLB 1Q72L 2ZOKA 2BNUB 4D0BB 1ZA6A 4M5ZH 4I18C 4OFYD 1P84K 3UJIH 5HVHC 2DQEH 1J0ZA 2HJKA 2VDLL 4WTZG 2X4TA 5I66B 1REIA 1TVBA 5FYKL 4ZYKA 3MLSH 1QSED 3TYGL 3BZEB 1IL1B 1IAMA 1SY6A 5JXEA 2ZG3A 4WEBH 1QRKA 2FO4B 4PJHA 1G1YA 2B20A 5CBAB 1BHGA 4G8GD 1WVZA 4KQ3H 3ES6B 6FABH 1ZT7B 4OCXH 1FVEB 1GZQA 1KGCD 4XBGA 4YBLB 1DUZB 3VD7A 1JNNL 4CU7A 3EYFB 4RGOH 2VL5A 5FYLL 4ZS7L 5F7FA 5A16A 5GRJL 3WS6A 5D71L 3IDGA 1SJVA 4Q58C 1AJ7L 1Z3GH 2K1MA 2Q8AH 5F9JA 4XCNB 4PJXE 1BQSA 3KS0H 2X1OA 4XP4L 1RK0B 3JWDL 1B4RA 4F15B 3AAZB 1UKTA 5MEPB 3BPCA 3IJSB 4WWKC 4PV9B 4MQTB 2FJFA 2GYSA 1PEZA 3BIBX 4G6KH 1YMHA 4JO3H 1NANI 3ZHDA 3QFJD 4XMKH 3V6ZA 5DSCB 4XP9H 3P30L 3JV5A 2VWEE 5BCAA 1WWBX 3RGVB 4CBPA 2DTSA 3EYVA 4HUNB 5IFAL 5DJAB 3I9GL 4WCYL 2XN9E 3ULVC 3TWCL 5IK3B 1SEQH 1YNKH 2DIJA 3FT2A 3KYOA 4R97B 4ODVL 1TTGA 3ZZ1A 2GSIA 3LN4B 3VXTB 3O45A 1VGEH 5EZJA 3MGOB 3QRGH 4JRYA 5D93B 4M1DL 2X4RA 4J23A 3CVHH 1U8KB 2IPUG 1A1OA 3OAUH 3DX9A 5KOMC 4KTDH 1X5IA 4MNHB 4WGVB 4WI5A 4X80H 4QXUH 5I75B 3LB6D 4AIZA 2YKLH 4KU1A 1JGLL 1EJOL 1EAPA 4XC3H 4Y4FD 4NSKA 2M2DA 3OKKA 4PJAB 5I2IB 1GC1L 3T09A 2LABA 2X42A 2DJ4A 3MQIA 2R0LH 2ZSVA 5DLML 4RGMB 3PGDB 3U36B 3M1BB 4LRIA 1EX0A 3Q5YA 3QUZB 3K2MC 2OYPA 3U79A 3TNNA 3C5JB 4FRWA 4H0IA 5KVFL 3FO2B 1DCLA 3DECA 3U7YH 5TPWL 1FE8L 3TJHD 3QO0B 1BMGA 4HKBA 1L6ZA 3I6GB 4QHLB 5F7DB 3WDIA 1BZQK 4JR9H 4N0FA 3TT3H 2NY7L 4K9EH 5KJRL 4JFDE 3D39B 4JDZB 4R96A 3FTGB 2IBBA 4K94L 3WBDA 2R0ZL 4JFZL 1U8PA 4I0PA 5FM5O 4LSDA 3ELAT 1F4WH 3NFPB 3FQWB 1QA9A 3OZ9L 3W9DB 3IFOB 4JFFB 2XI9A 1RZ7L 2FB4H 5E0QA 4NDMA 4ZUVA 1IQWL 1EXUB 1MQ8A 1FRGH 4YGVA 5FUZL 2EDFA 3BP7B 2HH0L 3VGAB 1MAJA 2X70B 5IB4B 4YBQC 5T3ZD 1KCRH 1NPUA 3MV8E 4JFQB 2P8MB 4JQVC 5L9DL 4GQPH 2VLJB 4HPOH 2J88H 1LVEA 2PYFB 2C4XA 1C5DA 3C6LC 3GSNH 3T04D 1SMOA 2HVKA 4XHJD 3I6LE 1YNLL 2W91A 1BQLL 5EUKB 4HWBH 4A6YL 3WHE0 3U46B 4RSVA 4PJ5D 5E70A 5C09E 1RZKC 2YEZA 4M9PA 1VFBB 1ORSA 5IVNA 4UIMA 5DJ8A 2YRPA 3TIDB 4RA0C 5JORA 5CIPA 4HSQA 1UVQA 3QIWC 4U7MA 3R8QA 1OOAA 1MRDH 1XGQA 1TQBC 5HI4C 1NBYB 3KWWB 4H1LA 4GJTB 3FZUC 2VISA 5JTWA 3G6AB 3OKOB 1AY1L 1KELH 3K4DA 4H20H 4GRLB 3DV4A 3VRLF 1PKOA 1GZPA 1N6VA 4PJDB 3ULUH 3QZWB 1NAKH 1S9YA 1AGDA 2C1PB 2GTWB 3FFCD 2GKIA 3ISWA 2JCCB 2O26U 5IFJB 5IW6B 4PJGF 1KULA 5C0ND 4KMLB 3VXSB 4M6MH 1Y0LA 2BNQE 3KPNA 4TOYH 1IARB 2BHUA 1KTLB 3V0VA 3EKCA 4K3JH 2VDRH 1AGEB 1LK2A 1KJ3L 4DJMA 4RBPH 4F57H 3RWGA 3SN6N 5DJXB 5TQ0H 1EBAA 1F6FB 3DX8B 3GZKA 4PJ9A 4N0YH 4X6DA 1VFAB 4QHKJ 2UWEF 1FO0H 1XGRA 1XCTA 1A6WL 4N8CH 3KYKH 2DYPB 3BUYA 4ZUTA 3U1SH 1C7TA 4J12A 3C8KB 3VRLE 3B5GA 5I19H 1AO7B 1ZMYA 3OX8A 1OPGH 1PG7L 4X8JA 1FBIH 4NC1E 2YD7A 4NM8H 2VLRE 1DLFH 1Y6KR 3B2VH 4TULH 5IJKA 3ILPB 4XNUH 5DC4B 4P5TA 1V3KA 1FORH 4J3UA 3GMQB 3OKNA 2IALA 5EO1B 1S7VB 1VESA 4MHHG 3SDAB 5JW4M 2JE8A 2EECA 2Y7QB 3CCHA 3GDBA 4JKKA 5D7JD 4P2OC 5ELIA 1KCGC 1NGXA 1JPGB 3O3EB 4NWTH 5C0CA 5C0DB 4CVUA 1I7UB 3MLWL 4P2YA 4F8QA 1OP5H 1WZ1H 4LNVA 3ZHKA 2FIKB 3QO1A 5BS0A 4GKSB 4P5KB 1D9KA 1J5OH 3OAYH 2I07B 4NHCH 5BMFL 5IMKA 3STZA 4MAYB 4OB5H 2FEDD 4OV5B 3TVMB 1U8QB 1KC5H 1WIOA 4P9ML 1MVUB 3VWJD 5HY9A 2ZCKL 43C9B 4MA7L 2BXYA 2JJWA 4LLVA 4V1DA 1F4XL 1NAML 1FLRH 4XTRD 5J6HA 2NY0B 3KAAA 4U1IB 4IDJL 5L2KA 1TTUA 4XPAH 1FZMB 1S5IH 1GYAA 4YX2L 2ZUTA 4GG6E 1HHJA 2ZKHL 3HE6A 4OFDA 3UTOA 4OGXH 5CEZL 2F8VA 2H1PH 4DK3A 3O4LB 1GH7A 3CFEB 3QEUA 1PX4A 3RVXD 3GIZH 5CZXC 5AD0B 3WL9A 1OGAA 4HGMA 5GS1C 5CJQH 1JK8A 5GRUL 2V2WA 5C2BL 2R0KL 5I1KH 1ODAA 4Y4KC 4OCSH 2XKSA 5ESQB 1DVFB 5K9JH 1N5AA 3PL6B 4M62L 5BW7A 2YD3A 1R5IB 4HT1L 1RIUH 4URTB 1RJYB 1XF2B 1UH2A 2R2EB 3GRWL 4U2ZA 1G1CA 2RQ8A 2DQJL 3VWKD 1INDH 4N8PA 4LSQH 3FMGL 2EO1A 3DUSA 5DO2C 3MRFB 2AEWA 3BPNB 2X44D 1X5KA 2UYLB 4LIQH 1YEKL 1D5ZA 2PYEA 1RUQL 3Q6FB 3DUUA 4C56B 5D1XD 2BNRB 1HQ4B 5DRNA 2R9HC 5E56A 5E2VL 3ZKQD 3PNWB 2J6EH 5EIIB 4MXWH 5E6ZA 1F4HA 1YEHH 3MRGA 3ZYZA 5J3HD 5CJOL 4GW5A 1NGZB 2CDFA 5C1MB 3OG6B 1SJEB 5KSAA 4RZCA 5F44A 3HS0B 5DVLA 4OAWB 1JYVA 3OJMB 5JOFA 2P42B 1DQDH 5GISL 5CMAB 2HAZA 3KPTA 2PXYD 1FFPA 1CFTA 4JO1L 4QRSA 4XNMA 3BE1L 1GSMA 3IYLW 5ISZE 1A7RL 2DQUL 2A0LD 4OQTL 5SX5H 3WJLC 3JTSA 3ARGC 3QHZL 1BFVL 5TDNA 3BDBA 4JRXA 1ZK9A 2JF1A 3ZKND 2KZ1B 4I8DA 2G9HB 1HINL 3IF1B 1MFEL 4F7CA 4JN1H 2ATPB 4N90E 1Z5LA 1UH4A 2HTKC 3W39A 1UXWA 1U8LB 3NA9L 3UJJH 3GB7B 4ZD3L 4HBCL 4K07A 2X89D 4LGSB 3I50L 1NCBL 3GGWB 4XCCH 2FJHB 4HJGB 1MWAL 2WWKT 3THMH 4X7EC 4Z5RA 3HPLA 1RJZB 2A6JB 4HUXB 3H9SD 2VQ1A 2W9DH 4GS7B 2ATKB 3DIFA 5LG1A 3LN5A 4U6YA 4NQXA 4QT5B 4HKXA 5F72S 2V5TA 5MI0B 1M71A 4MD5A 4N68A 3PDOA 3T4YA 4MGXA 3G5VA 1R24A 3OBAA 2NR6D 4WW2B 3S4SB 2HMIC 1ZHNA 5EZIH 1KEGL 2YD4A 2VAJA 2HTLD 1Q0YL 3DARA 2E27L 4HXBL 4K55A 5JO5A 2E7LE 1G9NC 5DT1H 2VXTL 3T0VA 3W11C 3BH8B 3E0GA 4HJJH 5KS9B 1HHHB 1YN6B 5BVPL 2QL1A 5GRZA 4FXGB 2IQAB 1YEFH 2HWZH 2X7LA 5IEKB 4HWEL 2MPAH 4KQ4L 2EYRA 4NQEA 4UTAL 1AIFA 5SWSD 3LH2L 4RMUA 1TMCB 4X7SH 3RI5F 4KHXL 1R3LB 3PWPD 3VXRE 3HI1A 4PJIF 3V6OA 4XP5H 4AH2A 4LAQL 2BVTA 3BO8A 5D1ZA 4BQCA 4D8PA 4A2MA 4ESKA 4MDJB 3BEVB 3OKLB 2V5SA 2BFVH 4HF5L 4NQCE 3TH2T 4DAGH 4EQ2A 1DQTA 4UT6L 1VEOA 4QTIH 5IEHB 4KY1H 5F3BB 5BJTB 5C0AE 4QRPB 4OFYA 1RIVH 4Q97A 1YN7A 5FYKU 4OZHB 2HFEB 5FYJL 1NKRA 4U6VL 4HD9A 3IDXL 5DHYB 3QIBA 3MRIB 1QSEA 4P5MB 2H2SC 3BWAA 5C08B 4ZAKC 4JPKH 4OZFH 3KYMA 4MD0A 5BZDB 3UMTA 2Q76B 1X5GA 4G42B 5AYQA 5J57B 1CBVL 4RGNC 1BREA 2DMCA 2C4FT 2P24A 3TO4A 1EZVY 1CD9B 4DKFL 4Y1AA 5FCUL 2I9TB 3FO1A 5TDPB 3TN0D 4PGDB 3BSZL 1A9BB 1RU9H 5CILL 1CGUA 1U36A 2DLEA 1JUFA 2XNAA 4OKVB 4U1JA 4KROB 4PTUA 3KXFE 1UWXK 4G9DB 1FAIL 4ETQA 1CT8A 2EEDA 3DX7A 4PY8J 3NCBB 5C0BE 2VOTA 1BF2A 4QRRD 4WWKD 5ETUA 5GGQL 3S36X 4L8BA 1ZT1B 1P7HL 4WTWA 4YDJA 4JM2B 1HSAA 4KK9C 1G6RL 2CK0H 3DETD 5C3TA 3ULUD 3CIQA 3O6FC 3JV4B 4ZMAT 4WI7A 2A77L 1E6JH 3LKQA 3GSQB 1BAFL 5C6TH 2BY1A 3FN0H 3ZMRA 4NUGH 1A22B 4PPTA 2O5YH 5E03A 1F58H 3P3YA 2HRPL 1A9EA 1WEJH 1M6OA 5A2KH 4X6CA 1OWWA 3C09B 1IGML 2DKSA 5E2WH 5IBTL 4UU9A 3QCUH 3KPRB 3KHQA 4AZ8A 3WFCL 2X05A 4L3EE 2B4CH 5DFTA 3AU1A 5EUOE 3JZ7A 4OUUA 3S37H 4EI6A 3HHRB 1TXKA 5JPMA 3ARDB 2NXYC 1GCFA 4U1SA 4Y5VB 3VXQB 4RMQA 1LE5B 4M43L 3AXLB 5BZWA 1BBJA 5D7SL 2ZCLH 1CGSH 2FL5A 1K3IA 5DQDL 1A4JA 3VGFA 3WIIL 3E8UL 4NNYB 4JFEA 2DD8L 5IMMB 4OF8A 4QF1A 3H3PH 4KKNA 4R7NB 1OLLA 3B9KC 3DNKA 4KGLA 2NXZD 4BSVA 2IADA 3CFCH 3VCLB 3OPZH 2OR9H 4OF6A 5H2BA 1NKOA 2HJLA 1NCUA 3BH9A 4PJEA 4RBPK 1BBDL 2WM0A 4HIXL 1DEEB 4O02H 5KW9H 5FK9A 4WO4C 3I85A 1ACYL 3TJHA 2APFA 4Y2DB 4U49A 1VEMA 1KPUB 3MUZ1 2A2QT 2WINB 4Y16B 1BIIB 2GSGA 1W0VB 3ARSA 5GS2H 4ONGH 2WWMD 5EBMB 5DD5H 4PJAF 2WAHA 2IGFL 1FSKB 1I9RH 1U92B 4LP4A 4OV6F 4NO2B 3T0EE 1G84A 3QUYB 1I1AC 4OCWL 3U0WH 5DGQA 2OCFD 1MJ7H 1A6VH 1T0MA 3SE3A 4Q9QL 5HTSA 4OI7A 3CX5J 4LLQB 3MLVH 3RVWC 4P3CH 3S96B 12E8L 3QR2A 5FKAB 3UTTD 5CUSH 2GAZB 4M7KL 3QDHA 3UO1L 2ERJC 1OD9A 3QAZB 2H9GA 1S8DA 1BFOA 4OZIB 4BYHA 1MCKA 5I76A 2D03L 4EVNB 2Z4QB 3C6LD 2WZPD 5B8CC 1A5FL 1Z0MA 3LZFH 1I9JL 3BHBA 4X9GA 5DMIH 1E28B 4M48H 5DYOA 2F53B 2B5IC 2QJDA 1UA6H 4G3YH 4ZUSB 4XNZC 5TF1L 5D7IE 3FAWA 1YEGH 3DHMA 3BYTA 1CGWA 4UI2A 5HI4D 3KPOA 1XGUB 2VDOL 3GK8H 1ZTXL 2C3HA 3PP4H 4NNPL 1FG2A 1YEJL 3V5KA 4R4BA 4NN5C 4KRLB 5L2JA 4PLOB 4P2CG 3X3FH 5KANG 1I8KB 4OD3H 1D5IL 5E4EC 4XBEL 3DVNB 1Y6MR 5DD6B 5DRXA 4PTTA 3HNSL 4JN2B 3FFCA 2OM5A 5K9OA 1YPZA 3CC5B 3CK0L 2AXFA 3IGAB 4MQ7A 3U2SA 1LO5A 4ZXBB 3QDAA 3BDYL 4J8RA 2XKNA 5ACZA 3Q6GH 1P1ZA 2W65A 1IGFL 1S7RA 4Q2ZA 2JJSA 5KSBA 3JXAA 4LBEA 4XWOC 1PYWB 1GL4B 3X3GH 3TJEH 4BSJA 1R3HA 5HGDB 3RTQC 5HGBA 4YIQB 2O5ZL 3IKCA 3EOTH 1JJUA 4GQ9H 2ZJSH 2R1XA 2FD6L 2YK1L 2Z92B 3DGCR 3QI9B 3ET9F 3TZVB 1S7QA 3LOWA 4BSWA 4PJDF 2QQKL 1MJ8L 3MRNA 2LFGA 1R5VB 3D3VD 1BZ7A 5D5MA 2JCCF 2FYYA 4W6XB 1XGYL 4F80A 3MGTA 4OLWH 5ENWB 4I9WE 1J1OH 4MSWA 4YHIB 1ND0B 1TIUA 5JW3H 2J8UE 2B1AL 3K2UH 4JZJB 4EOWL 2QSTA 3WIFA 4YDIL 5F7KC 2XXMB 1NC4B 4X4XB 1UZ8A 1JWMB 1B6UA 4P2OD 4TVPE 1OM3H 5D7JA 4LQFL 2EE9A 1QBBA 4BELD 2A9NH 5I73B 1UEYA 3T3MF 3MRLB 4CMHC 4X4ME 1TVHA 5GGTH 3QUXD 3D9AH 5GS3A 3MXWL 2OSLB 4OD2B 5I15L 4POUB 4XWGL 5LCVL 1J1PL 3MUY1 4LVHB 3AROA 1BX2A 3HN3A 1QEWB 1J0KA 1E4WL 3QXWA 1QTYT 4P59L 4FNLH 4ONFL 3VWJA 3S35H 2F54B 5F97E 1TCRB 4LCCA 1YYLH 3ZYOA 4PGZA 2VLME 2I60L 3HZMA 4E42A 4LDLB 3SBWC 1VENA 1FNSH 1ZHLB 3ULVL 3LV3B 3S88H 3LHPH 1YY9C 1OB1A 2JIXB 1IRAY 3QHFL 3QXVA 3IFPA 1Z6JT 4BFEA 5JIKA 1EFQA 1BECA 3FQRA 2AEQH 5JLZA 1XZ0B 4Y5XC 2VABA 3HPJB 3VH8B 1H15B 4KMQA 1EHXA 3VXUE 2XWBA 4Y4KD 4HLZH 4MCYA 3CMOL 3RNQA 4PRPE 4HAFA 3RVVD 2ESVE 3IU4L 4S1DC 1OAYH 4I2XA 5FECA 5GS0H 1MEXH 2IG2H 1CICB 4ISVA 4WV1C 3HCVA 1E4JA 3DTXB 4QRTB 2VDMH 2QHLA 4KJPD 5D2LB 1A7BA 4KI5D 5D6CB 1A7NH 2A83A 5DO2D 3QQ9C 3TBWB 1VKXA 5EBLA 5J11C 5C0RL 4J3XA 1QBLH 4F7MB 4D9RE 1N64H 2HFFA 5KN5A 4ZNEA 3TV3H 1B9ZA 4FFWD 4RFOH 4ZUWA 1JF1B 2FBOJ 1XGPB 5GXBB 1EO8H 5E4IA 4QOKD 1P7QD 3MA7B 3KPPA 4GG8B 4M5YL 4OLYH 1YYML 5FO8A 1F6AB 4ZTPH 4RFEA 2RB8A 4QHNB 2BVUA 5CHNA 4RQQA 1MIEH 2PXYA 5JDSB 3HAEB 1P9MC 2H26A 3MREB 4WDIB 5SX4I 2AJUL 5JMOC 1FZJB 3MO1A 2XOTA 5KVEL 2XTJC 1ZA3B 2DBLH 3IVKB 3HI6L 1RI8A 4FTVA 3LQMA 4R4NC 5DUPL 4EN3C 4XC1L 5AYUL 2HTKD 3D6GA 1WF5A 2OJEB 1T1WB 3SO3B 5KANI 3PGCB 5FCSH 3S6CA 1S7UB 4FZEH 4HX1B 4F58L 4TSAH 2EXYC 3WFEL 4ZSOB 4JFPB 5IMLA 1QFHA 4WI2A 1JNJA 1CU4H 1KCLA 3U4AA 2X89A 5I1IL 1FJ1A 1W0WB 3HZVB 3B4NA 3QEHA 5IB3A 1JWUB 2Q7YA 4G8EB 4GAYA 1I1YA 3IDUA 5F9OH 2JJTC 1SYSA 1CD1A 1IFHH 4LFHD 3H9SA 3SE8H 5INCA 5GGVL 3KPSA 1MJJA 2BSTA 4YHYB 2OK0H 1I7RA 3CVHA 2JB6B 5CBEB 3OGCA 4Y88A 1M7DA 3HLAB 2AW2A 4MB5A 4XHQA 1J1XL 1RZKL 4R4FH 1KCVH 4U1KB 1EEZB 4PUBH 3MRMB 4CW1A 1T5XA 3IAQA 3IETB 3T4AA 1A02N 4DVRL 5CEYA 1T03L 1RZFH 3RGVD 3REWB 1CLZH 1IZJA 2Y5TB 3NOIA 3EOAB 1UH3A 2DJUA 5DK0A 1C12B 2CMRH 3WYRA 3PQYB 4MZ3A 4KRNA 2BJMH 5T3XD 4HUUB 3DYPA 3BRFA 1RY7B 5HJ3A 1JWSA 2W60B 3V4PL 1JNLL 4IRSB 1EA9C 1KN2L 1UACL 4P2QD 4M8VA 5SWSA 3U0TA 4OLVL 2BCKA 3PWPA 4WW2F 5AAWA 4P2RE 3MMEA 3HC0A 4LPVA 1CD0A 4OFKA 2IFFL 2DMKA 1W8OA 2GTZA 1IKNA 4JKPH 3ARWA 4HS8L 4CGTA 2DQGH 3MNVA 5KS9F 3RAJH 2CGRL 3DXAA 5I1LA 1DN0B 1GOFA 3P11L 5FYJU 2W0PA 1TETH 2DM3A 2Q1EA 1NGQL 3G6DH 3SKJH 4G8IB 4KK6D 2H2SD 2P46B 4GRMA 3NFSH 3QUZD 1BVKA 3O2VH 3ROOA 2BRQA 1U58A 3CZFB 5FGCE 3P9MA 4NP4L 3LRSA 4KK8C 3MOQA 4OCYH 1RUPL 3S36L 1VDGA 5CKGA 5SWZE 4YE4H 4YHPA 2XG5A 2NQCA 1KJ2A 4O2EA 3KJ6H 3TN0A 3LEXB 3UTQB 2BSED 3NCCB 1EO5A 1HEZB 3CU7A 1K8IA 3DJ9A 1RIHH 2OTUA 5ILTL 1A7PH 2VDPH 1NL0L 3OR7A 2OI9C 4OZHF 3PABA 3C2AH 4PP2B 4XPGL 4KMTL 1MH5B 3F7YB 3UTZB 2BVPB 4JFFD 3WJJC 3GUTA 1ZHBB 2AXJA 4UBDD 4PGBA 5D72H 4G80B 4JVWA 2CDEA 3EFFB 4QRRA 4C54A 3IKKA 5EU4A 5JPNB 4M4RA 3S5LB 2P8PB 1ZT4B 4KK9D 5E2TH 3O8XB 4JZOB 1A6UL 1QFWM 5DMKB 3QPQD 3O6FD 1E0OB 1ZLWH 2AJVH 3PP3K 4IMLB 1BM3L 4GUPB 1NMCB 3DURA 4NFCA 2VLJD 1CWVA 5C7XL 4DKEL 2FX8H 1H3UA 4PLNC 5EC2B 4I0CC 3HE7D 3JV6B 3WFBH 3MV9E 4IIQA 3WUWB 4DN3L 3BN9C 4M1CD 1NMBL 3QEQD 1MRCH 4JAMA 4PJGA 3PV7A 1SM3H 1RZGA 2R29H 4O51B 4OBSA 3N85L 5F7HA 2CXGA 5FEBA 5BQ7A 2DB8A 2NXYD 4OF5A 4JM2F 4PJ8C 1FO0A 2VR4A 2N7AA 4LLMB 5EO0A 1HH6A 3QULA 5CJXA 1EEYA 3TM6A 1IVLA 4G9FB 1T66C 5HHQA 3VFVA 5JNYB 4E41B 5GGRA 2OTPA 4PY7B 3C60A 3GMOB 3ZDXF 5DDHA 1IGYA 4LSTL 3V5HB 3P77A 3DSFH 5HSFA 1OP3K 1VB9A 1NFKA 4M4PA 4P46C 4D3CH 3F8UB 2ZUXA 2J7LA 4L8CB 1C8PA 4PLKC 4JDTH 3FOMB 2X4OA 1KPVA 2AV7B 4QHMB 3W2DH 2X1QA 4P4KA 2H45A 4QEGA 1FGNH 2D9QB 3G08B 3Q1SH 1D6VH 2AJXH 3AREB 3BW9A 3EBAA 7CGTA 2CPCA 1HN1A 4KKBC 3QDJE 2V6HA 4UNVA 4G7VL 1CDYA 4ZFOB 3RNKA 5LGHL 1AR2A 1QFOA 3FQNB 5D1QB 5EPMB 1WAAA 2AXHA 5E6IA 2X41A 5HYJB 4GSDH 2VIRA 3CLFL 1BJ1H 4U31A 5TF0A 1ZEAL 3ZDXE 2KUTA 3IDIB 3FT3B 4NKMB 1U9KA 4Y8AA 2IBZX 1A3LH 1MCWW 3PGFH 5LBSH 5A40E 4LHUD 1ZWIB 5ADOH 2NY5H 1P4BH 1DE4B 1CFVL 2IPKA 3UTTA 4X8XA 3KVQA 2DL2A 4PRIA 5HPMA 1IM3B 3IJYB 2QADC 5IM7A 3IS0X 3BPOC 3SDAD 2E7HA 3RL2B 1KJMB 3H7BB 2W92A 4KTEL 3PHOA 4E0RA 4H0GA 4BJLA 4MJIE 4RWYL 3VFPB 4MA8H 2MKWA 3VXPB 4ELKA 3GNML 4N0RA 1BPVA 1OCWH 4JHWH 3CDGB 5JA8B 2CSPA 2X4QA 2GITB 2P7TB 4LEOA 4IMKC 4MAYD 1RURL 4RWHA 4UOJA 4N5EA 3S3JA 4GRWB 1G9NL 5MP6H 1XFPA 4LLWB 2J1KA 4L3CB 4X9HA 3BP4A 5E7FA 1I3UA 1CGVA 2IPTH 1QNZH 4X5WA 2YA2A 2J6EA 2YUWA 3O4LD 4GAJL 4OZIF 2DQIH 3MNWB 4MXQA 5DUMH 2IAMB 1QLRB 2Z8VC 3L95B 1DBKL 1NBZB 1CVRA 1EFXB 2HFTA 4O4YH 3X11A 5I16A 3RWHA 3RKDC 3DRQA 4OM0L 3LS4L 1V7NL 2P45B 3D25A 3VGDA 3ZDZF 3PL6D 2V17H 3CVIL 5C0JA 1PZ5B 2VXUH 4NJAL 1UB6B 2C1OB 2AQ3A 3OKEB 4ODWB 4WHYH 4V2BA 2R2HB 3FQTA 5BRZE 4HFUH 1AP2A 5FV2A 4S1QL 4WI3A 1H8OA 5J1SC 4RMWA 1V5JA 2HKFH 4FP8H 4NKDA 1HXMA 3K3QA 4OF0A 5CD3B 5I8EA 3MLZH 1GGCL 4WI9A 4P23B 3QNZB 4X6BB 4YQXL 1PKQB 3D3VA 2VUYA 3RY6C 3TBYB 2VLKA 2C3XA 3MNZB 3MLYH 1MCCA 4KTYA 5C2UB 2FGZA 4RAUB 3SJVB 4QTHA 1IAII 3P0VL 1TQCB 1MFDH 5TE4H 4NRYB 3D85B 1MHCB 2MJWA 4G43A 4DVBA 1XIWC 1JGVH 3ZDZE 1ZA6B 2PW2A 2YWYA 2FLRT 3OAZK 1FPTH 1SVZA 1QYGL 2HKHL 2XA8H 1LO0L 4KRMB 4WU5A 3VRIB 3BPLC 1OAUL 4AQOA 2L7JA 4WNQA 3SO5A 1TVBB 2CLZA 3QUXA 1T6VN 4TPRH 1QLEH 3TA3B 4D2NA 1NBVH 1OTUC 1WFOA 1JZ3A 5IKCA 1AHWC 5EU6B 4W4NA 5GGVY 5DD3L 4FFYH 5TGBA 1FL6A 3RQ3A 4IEFB 4DOHB 3HMXA 4XBGB 2P5WB 4UINH 1WFTA 4ZPVB 1J0HA 4LNRA 5DD1L 3DRTA 2E7LC 3QDME 1DBJL 1KCSH 1RZJL 2GQHA 3QG7L 1TENA 5DI8B 2BVOA 3BMVA 1Y18A 2ITCA 1N3NA 5A16B 4HJ0C 1TZGH 4NO3A 4P57A 3L1OL 1FV1B 4XPBH 1LDPL 5F88B 5F9JB 3HG1A 2YPVH 5IVXB 1U8OB 3NH7L 5I1EH 1E6OL 2YA0A 4PD4K 1T1ZB 1BQHB 4PJIA 5E9DE 3H2WA 3GI8H 5I30H 3BPCB 3DMMA 4NZDA 4JZNB 3RDTB 4LCWB 3O0RH 5EFIB 3CXHK 4Z95H 4HW6A 4UDTA 2Q20A 3B6SB 1X6NA 5IHUL 5FM8A 1U6AL 3H9HA 4G6FD 4U7KA 3EYVB 3VD5A 4OZFA 5JR1L 2PR4L 2MFNA 4HLZG 5DGRA 3MROB 4NZUL 4KUCF 3QJHA 4XAKE 2ICWB 1KIQB 3WEXB 1B4JL 2VC2L 2CIKA 2DI8A 1F3RB 4QOKA 1P7QA 1UQSA 2FX7L 4ZDHA 5MENA 4Z7WB 3O45B 5E24E 4MQXC 5JMRA 1XCQB 1G0DA 5AUMA 4NPYA 3H7LA 1A1OB 2XWJA 1RVFH 1NCTA 4PRNA 2VLLA 1J05B 2BNUA 4C55A 1ZLVK 4D0BA 2DLFH 5D2LF 4YNYB 1W72B 4RIRB 5CEZE 4QRPD 5JHDB 3DO3A 1LO4L 1JN6B 3LD8B 5D96B 1T2XA 1F4YH 1J18A 3HFMH 5I66A 4UV4L 1URLA 5EIVA 2P5EE 2YPLE 3KLSA 3INUH 4WGWB 4F9PA 3BZEA 4C4KT 2ZSVB 3UTSE 5C08D 2FO4A 5HYEA 4K71B 5F96H 5IQ7L 1YQVL 4K7FB 5CBAA 3TNNB 3L3IB 4OLUH 4NJ9H 3ES6A 5E2UH 3K7UA 1ZT7A 2GIYA 1FVEA 5FGBA 3ZYIA 1KYOJ 5EBWB 1DUZA 1H3PL 4LF3A 3BKMH 4UNTA 3O3DB 1FQ9C 4JY6B 5A1AA 3GJFB 1PJ9A 4YFLF 5I1CL 1HKLL 2VN4A 3EYFA 4K8RH 2VERN 3L9RB 4KROD 1MLCA 2CLRB 3NABL 5FO7B 1ADQA 3HAEH 1OGTB 4TRPL 4LSPH 5GJSH 4I0PB 4HGWB 4XCNA 3UZEA 1RK0A 2DIAA 4JPVH 3AAZA 2YUXA 3GO1L 2OJZL 3O2DA 5MEPA 2BX5A 3IJSA 4PV9A 1UC6A 2MQ3A 2NY3C 1Y6NR 3HUJE 5DSCA 4BK4A 2EICA 4X7CC 3RU8H 2X4UB 1CLCA 5HYIA 1I75A 3RGVA 2OL3B 1MI5B 5DJAA 5HHME 4NCC1 4D0CA 4DW2L 3WNPA 2IFGA 1CDIA 3ARFB 5T33H 2HVKB 2XZCH 3KPRD 4EDXA 4I3SL 1IGIL 3LN4A 3VXTA 1KT2B 1FFRA 1NSNL 3MGOA 4U1HA 1BGXH 1U8KA 4Z0XB 5B3NA 3ARDD 5JORB 2B4CC 1Q0XL 4MNHA 1V3LA 2X9WA 4LLDA 1EH9A 2ICEB 2QBWA 4BH7B 4GMTL 1MRFH 4K3DL 2EDJA 2XQYG 5I2IA 5IOPB 3DV4B 2UZXB 5ADPL 5HDBE 4TSCL 4WIQA 1U8MB 3PGDA 3M1BA 1FDLH 3MV7B 1TVDA 3QUZA 3E3QA 3FRPG 1TJIH 3UYOD 3ARYA 3ZTJH 1JGUH 3C5JA 2JJUA 3UAJD 3P9LA 3T0EC 3GFUA 3SGDH 3FO2A 4AEIL 1H3WM 4KV5F 3V0VB 4QHLA 4QHUB 3I6GA 5F7DA 2FRGP 3HTLX 3J7HA 3Q5TA 1L0QA 5GHWL 5CFHA 3C5ZB 4KH2A 1V8HA 4HEME 1L7IH 2DQCL 3RWGB 1NCAL 1NUNB 3C08H 2NY1C 5E00B 3D39A 3FTGA 2FEEI 2HN7B 4LSVL 4JO4L 1ZGLP 5DVMA 1WIUA 3NFPA 3FQWA 1CYGA 3MJ7B 2XG4A 43CAB 3EAKA 3W9DA 3IFOA 4JFFA 1SEBA 4UT9L 1EXUA 3QXDB 2EDKA 3BP7A 4C57C 5F89B 1F13A 4EDWH 2X70A 5IB4A 1F45A 2IQ9H 5C09D 3QXTA 4QXGL 5HVFB 2NTFB 4JFQA 2P8MA 2CR3A 2QQQA 5B4MC 1JE6A 5CKAA 5C07E 2VLJA 1I3GL 3GMNB 1X5ZA 1QFWH 2OMBA 35C8H 5FYJE 2PYFA 3HE7A 4FMKA 2R56H 1P7KB 4FZ8L 1I8LC 1PD6A 1U3YA 2X5PA 4U05A 3MRDB 1F11A 3QEQA 4UUJB 4L8SB 5EUKA 4WI6A 5BS0B 2IH3B 1V3MA 3PWNB 3KG5A 4X9IA 2A1WL 4Z18A 1PFCA 1MF2L 2YWZA 3STZB 5L0QB 2KBGA 1VFBA 4JM4L 1JHKL 4M9OA 4U6TA 5HD8D 3GIVB 3TIDA 4S1SH 4PRBA 1DLHB 5IQ9A 4JY4B 2ORBL 2VR5A 2BNQD 1NBYA 3KWWA 4XPTH 1N8ZA 4FHBD 5L2KB 3HNTL 4JLRB 4DTGH 4GMSL 1T66D 1NCDH 1U3HB 3G6AA 4K2UH 5I1DB 3OKOA 3U4BH 4EIZC 2D7PA 4L4VB 1CXFA 4POZD 1V3JA 5ESAB 4P46D 5HGAB 4N8VA 4WUUB 1T2QH 1Z9OA 3QZWA 3B8YA 2AI0H 4PLKD 3QEUB 3ARPA 3MLUL 2C1PA 4PRAB 4Z7VF 2GTWA 1OGAB 4NWUL 2JCCA 3RZCB 1OHQA 1WBZA 5IW6A 3X12B 3EFDL 5IFJA 3H9YA 1U8HB 4JO2H 4R0LC 4ZXBD 2AEPL 1FFQA 2XY2A 3VXSA 2ADJB 3I2CH 3GMLB 5C8JB 1N5AB 1KTLA 1UCBL 1PZUB 5DRWA 1AGEA 1MHEB 3KS0J 5J56B 2VLRD 5CZVL 3GJEA 3T1FB 3WHXB 1QRNB 3DX8A 1QFUH 4LCYB 3DUSB 4DZ8A 1VFAA 4RMSA 3UJIL 1NGPH 3TZVD 1H3GA 1RJLB 2DQEL 3FO0H 3IDNB 3LRGA 5EH1A 4D9LH 4RA3A 1HZHH 3MLSL 5EIQA 1CGTA 4WEBL 5HDQH 3RL1A 1NCCH 1AO7A 2EKSB 4JHZA 5IFHH 4Z7VE 3DROB 4J3VA 4GAFB 3RKPA 4GRLC 4WFGE 3GSXA 3I6KB 4X4ZA 4KQ3L 6FABL 3ILPA 3W0WB 4OCXL 1CTOA 1X5LA 2WP3T 3GMQA 4WRLA 5EO1A 1NC4D 1S7VA 3SDAA 3T3PF 3GSRB 4M7ZC 3TT1L 5I8CB 2Y7QA 3EIFA 5T5NF 2XXCB 3H3KA 1JPGA 2G5RA 4RGOL 4HKZA 3QSKB 4YDKH 1I7UA 2BXZA 2FIKA 4BM7A 4AENA 4GKSA 4P5KA 5F6IB 4N9GB 2CKBH 4F7CB 1Z3GL 2I07A 2NY6D 2Q8AL 3ORJA 2C3VB 3A67H 4UDUB 4MAYA 3CFIC 2VSDA 3TVMA 1U8QA 3LY6A 4UOW0 1MVUA 5GRWA 1NJ9B 4TNVF 43C9A 4GOSA 4G6KL 3GM8A 4NBYB 4JO3L 3CXDH 2OQJA 4U1IA 2PO6C 4XMKL 3IFNH 1HDMB 4XP9L 3TBVA 1FZMA 4HDIB 1YEDB 1N4XH 1HSBB 4PJCE 3EZJB 4Y5YC 4Z5RB 4IDLA 3HPLB 4IM8A 3O4LA 2JIXD 4FQXC 1SJHB 1UM5H 5AD0A 2Z31B 1R3KB 1SEQL 5AWNH 5FB8B 3T3PE 1YNKL 1HIMH 3V79C 2APTA 2YD1A 2MTPA 3RKDD 4C58B 3UYRH 1R24B 4DFHA 4RX4D 2H8PB 2Q7NA 4N9OB 2JK5B 5ESQA 4YBHA 1DVFA 1VGEL 1WBXA 3PL6A 1DZBA 2F58H 4LHQB 5HYSB 1RD6A 3CVHL 1R5IA 4CADB 1RJYA 4TTDC 1XF2A 2R2EA 4YHKH 4U2YA 1QD0A 4KTDL 1I85A 5GS0C 4X80L 3ZL4H 4QXUL 2MSPA 1IQDB 2YKLL 2EDNA 3MRFA 3PXHA 5DEGB 2UYLA 4XC3L 3O9WC 1QACA 2YRZA 5DEFA 4L9LB 3Q6FA 3QDGB 4C56A 4Y4HD 5FXCH 2BMKB 1ZLSH 1X44A 3MOBH 4EI5C 4NQSB 2BY0A 2B39A 2R0LL 3ARBC 3QCTH 4NQEB 3PNWA 1CCZA 1CIUA 1A21A 5EIIA 3N1MC 1JFQH 1NC2B 3WD5H 1MHPH 1NGZA 2EEAA 2C5DC 1SJEA 4N90D 4AH2B 3S37X 3AM8A 4RMVA 1JHTB 4OAWA 5HGGS 4LPYA 5CMAA 3U7YL 1MCOH 2NY4B 4JANB 4J3SA 4D9QE 1A3RL 4MLSA 4JR9L 4YZFF 4EXPX 1TJGH 3H42H 3TT3L 2IANE 1DBMH 4K9EL 3F62A 4UAOC 4NN7C 2HRLA 3MACH 1LP9F 2G9HA 3IF1A 3JVGA 1F4WL 3QA3A 4DK6A 2ATPA 2GHWB 3EHBD 2FB4L 3NN8B 3GB7A 4W81A 1FRGL 4G8GB 4U6HB 2G60H 1KN4H 1LNUB 2FJHA 4HJGA 1MCPH 1ITBB 1JZ7A 1KCRL 2GCYB 4I4WA 3M8OH 1X4XA 1L9MA 4JPWH 1RJZA 4JREC 2EYTB 2ATKA 5D70H 3QG6B 1KTKE 2DTMH 4QT5A 5C0IB 2J88L 2GJ6E 3ARTA 4HJ0D 3RWDB 3GSNL 4ETQB 3FRPA 5DEZA 3TPUB 3DX7B 5DK3A 4Y19D 3S4SA 1LP9E 4MVBC 4HWBL 4Z77B 1L0XA 5ANMB 4NIKB 1OAKH 3H9ZA 1SY6H 5D7LE 3VXRD 1FAKT 4YDJB 1CL7H 3WFDH 3QFJB 3BH8A 3LRHA 1MRDL 4N0UE 1NAMB 4E5XB 5KS9A 1HHHA 1UYWH 4OZGE 3S97C 3O11B 3I84A 5C71A 5D6DA 3E1F1 5A3IC 4FXGA 2IQAA 3LEYH 4AEHH 5IEKA 1CG9B 5DFVC 2BDNH 4H20L 4RNRB 5I71B 3IFLH 1A9EB 1Z2KA 4IRSD 4X6CB 3ULUL 1NAKL 1ETZB 4KK5C 1TMCA 1R3LA 5IB2B 5D2NB 3OJDA 4M6ML 4MDJA 3BEVA 3OKLA 1M05B 4PJHE 4TOYL 5LGKA 3RJQB 5IEHA 4K3JL 2VDRL 5FOJA 4F57L 5BJTA 4QRPA 3NZHH 5TQ0L 1YQ2A 4WW2C 1KCUL 4Y4FB 1PQZB 4OZHA 4PG2C 2A73B 5DUBA 2ZUQB 4N0YL 4DFIA 3VXMB 1EUUA 5DHYA 1FO0L 3SE4A 3MRIA 3WN5C 1Q94A 4P5MA 4YC2B 4N8CL 3KYKL 5C08A 3U1SL 3KXFD 4O2CB 5BZDA 3VH8G 4YHMH 3VJ6B 3V0WH 1FNEA 4IJ3B 2ED8A 1OAXH 4G42A 5I19L 4PJEB 2ADFH 5IROA 1OPGL 5C0BD 4NHUB 5F3HB 1OY3B 1FBIL 1N6UA 2X1PA 4NM8L 1DLFL 1U93A 5HHOB 3B2VL 3T65B 4TULL 2I9TA 3WO4B 4XNUL 5JOEA 1FORL 3EO1B 1A9BA 5I6XB 3TEUA 4OKVA 4NWTL 3C6SB 1YEEH 1KXVC 3P2TA 1WZ1L 3I75A 4LARH 3VG9B 3L3JB 4I3RH 1J5OL 3R1GH 3V95A 4NHCL 5LKNA 1T0MB 3B3IB 1Q9KB 4L3ED 1DQLH 1ZT1A 4OB5L 4QRUB 1UJ3A 1KC5L 2H3NB 1FLRL 3JV4A 4MS8C 3GSQA 4JRYE 5CP7B 4XPAL 4L1HA 5DVKA 2DOCA 1S5IL 5L7XH 2H9GB 1S8DB 4OGXL 2H1PL 3DV6B 4JHBA 2XACC 4JE4B 5HVWA 3M07A 3RVTC 5IV2B 3GJFH 3GIZL 4X4YB 3KPRA 5CJQL 2R4RH 4KJWC 4XP1H 5JW4R 5I1KL 4OCSL 4PJ5B 3RY4A 1V7MH 2SEBB 3JWDC 2OR8A 4PJBB 5K9JL 3ARDA 2HLFD 4Y5VA 1RIUL 3BZFB 3VXQA 3KPOB 2EEBA 4UTBH 2R4SH 1LE5A 4OJFH 1A7OH 4JQXA 3V5KB 3FB8B 3QH3B 4R4BB 2IBZY 1A3QA 2VMFA 1INDL 4LSQL 2EC9T 5GGUB 4HFWB 4NNYA 3OKDB 5IMMA 2W9EL 4LIQL 3PE9A 3FL7A 4R7NA 1FHGA 4X5LA 3N50A 4JM2C 4K3EH 2OL3H 5EOQH 4UB0L 3V4VL 3VCLA 3T77B 5K9OB 1YPZB 1FNAA 2J6EL 3NACH 4MXWL 1YEHL 1NANH 1HHIB 4FQJH 4LPTA 1IBGH 3HB3C 1S3KL 5KSBB 1KPUA 1BEYL 4X5XB 1DQDL 3B8SA 2WINA 5DA0B 4Y16A 2NY1D 1BIIA 5D1QD 2LQRA 1AGFB 4OUOA 2AK4E 5CIPH 3RWJA 5HYJD 4ZUUB 3ZTJG 5DR5H 3ALPA 3HR5B 1T20B 1R3IH 5M95B 5C0GB 1X5XA 4BSWB 1GC1C 1U92A 1EGJH 2BHZA 3L7FB 1WZMA 4NO2A 3QUYA 3QQ3B 3VA2C 4LGPB 4X9FA 3PIQB 4NT6B 4LLQA 3S96A 3LAFA 1UKSA 4O00A 5FKAA 5C09A 4JGJA 5K9KB 2GAZA 1HXYB 1I9IH 5B4MD 4XCCL 1VPOH 4J7RA 3THML 4OZIA 4HG4J 3CU1A 5D7JB 4ODXB 3TFKC 4EVNA 2HG5A 2Z4QA 4XNXH 2W9DL 4OM1L 4X6DF 3G6JB 3N06B 3SKMA 3WNMA 4K94C 1E28A 1IAOB 1EVTC 4Y2DC 3MBXH 3SGJC 1G9EA 1VHPA 3F5WB 4ZUSA 5EZIL 3O2WL 2DAVA 4ZOEA 3VWJB 4TNVK 2NX5E 3WXVH 5H37H 1WLHA 4QRQB 1RUMH 2EYSB 5DT1L 1T1YA 1FSKC 4E42B 1I7ZB 3BD5A 4HJJL 4KAQL 1I8KA 1YEFL 4OCMC 2HWZL 2PETA 3CNKA 2IAMD 5IHZB 5DD6A 3EYQC 1EFXD 5KTEH 1C16B 3NPSB 2OP4H 4JN2A 2MPAL 4BA8A 2OR7A 4KDWA 2VABB 3BQUB 3SDDB 3CC5A 3G5ZB 3IGAA 4WWID 4JFHE 3U9UB 4X6DE 2O93L 3D18A 4X7SL 4ZXBA 5KBNC 5CAYB 1MFCL 4XP5L 5ACMA 4ELME 4I9WD 1PYWA 1JMXA 2BFVL 3B43A 4DAGL 3CX5K 3ZE0E 4ODUB 4YIQA 4QTIL 5TDOB 4KY1L 2J12B 3VWKB 1A4KB 2Z92A 3NIDE 3OB0K 3K8MA 3QI9A 1HHGA 3EJZC 1RIVL 3TZVA 4TVPD 3K1DA 1DANU 5D1XB 3DVGA 1R5VA 5LAXB 4ZUWB 4S11A 3RUGB 3AVEA 4JPKL 5C0CE 5ENWA 3KPPB 3SJVD 4YHIA 5FO8B 4JZJA 2F15A 3NCYP 1JGDB 5C92A 1R3JA 3O81A 2BVYA 4RQQB 1KLFA 2PXYB 2PF6A 1NC4A 4X4XA 2H26B 1JWMA 3EYOA 3NMEA 5ITBH 3ZKSD 2VLMD 5J1AB 1J0JA 1RU9L 4V1DE 1S9VA 3MO1B 4LOUC 4XX1G 5L6YH 3MRLA 3CH1B 4EKXA 2A6DB 2OSLA 4OD2A 1PX3A 4AIXA 4XB8A 3TA3D 2X1WL 3EO0B 1JGLH 3MOAH 3BGFB 3VXUD 1OGAE 2F54A 1TCRA 4PRPD 4WI4A 3V0AC 2ESVD 3VFGH 2P5WD 1MCWM 2CK0L 4ZOBA 2P49B 2UUDH 1ZHLA 4HGKC 1E6JL 3MA9H 3LV3A 3GSVB 2ICCA 5C6TL 5T5NG 3FN0L 1T5WB 4FQXD 2EO9A 4KXZI 4NUGL 2JIXA 3TP4A 3UBXG 5GZNC 5SV3A 3QEGH 2O5YL 1F58L 5E8NB 1WEJL 1C08B 1XZ0A 1EEQA 4KKLC 3HRZB 3HPJA 1IC4H 3SDCC 3VH8A 1JZ4A 3QCUL 4D9RD 4I3GA 1S7WA 3M45A 5ALBH 3PWLA 1CDJA 2PYEE 4IOFD 3BKJH 5DJ2B 4NZRH 4OIIH 5HI5C 1T83A 5IB1B 2B4CL 3RDTD 4CW1B 4G8FA 1T5XB 1BJMA 3MFFB 4TTDD 1CICA 1T7WA 4OGZA 3S37L 3DTXA 3T4AB 3SGDI 5D2LA 4LPWA 1F5WA 4ZO7A 5CEYB 2J2ZA 3WHE1 5D6CA 5DZLA 5I18H 4LVHC 3TBWA 3O9WD 4MCZB 1CGSL 4MJ4A 5DK0B 4F7MA 4Y4HA 1MAMH 1II4E 3ARBD 3WLWD 3H3PL 4YDLB 1JF1A 1XGPA 4S0UC 4DGIH 3CFCL 3MA7A 2OR9L 4GG8A 4JRXE 4DKAA 1LD9A 1YZZA 1RUAH 4PRDB 1F6AA 4MX7A 3KNBB 4O02L 4QHNA 5KW9L 2BOBB 3WLBB 3HAEA 3MREA 4I18B 1D5MB 1T21B 1FZJA 3ZDYE 5HVHB 2QQLH 1ZA3A 1RULH 3BZ4B 4N0CD 4ONGL 3V7AE 3IVKA 5DD5L 3HC4H 1FL3A 1CXKA 2K7QA 1L6XA 3RBSA 1FYHB 1I9RL 2OJEA 1T1WA 3IRPX 2KH2B 3PGCA 3U0WL 1S7UA 3T2NH 5INDB 1MJ7L 5EOTB 1A6VL 1NUGA 4ZSOA 4JFPA 3MLVL 2I5YH 4WTXA 4P3CL 4XVSH 3FB6B 3HZVA 1ROWA 2ZUWA 4XXCC 1JGEA 1QSFB 1JWUA 5CUSL 3H0TB 4G8EA 2UVFA 4P48A 1F90L 1TJHH 1F3DH 4Z8FH 5ICXB 4KPHH 5IJVB 5IBLC 1EPFA 2V9QA 3KJ4C 4M7LT 2JB6A 5CBEA 3SGKC 3LZFL 3HLAA 4QXTA 2Z91B 5DMIL 1QSZA 1G7MA 4M48L 3BGAA 4MVBD 4NGHH 4Y19A 2YPKB 4U1KA 1EEZA 2VXSH 3MRMA 1UA6L 4WWKB 4G3YL 1CQKA 3P4LA 1YEGL 3VXRA 2DI7A 1WQVT 4UIKH 5K93A 4EUPB 4ALAH 3FB7A 3P9WB 3JUZA 3REWA 1E4KA 1I1FB 1MI5D 3V6OE 1E4XI 3GK8L 5A3ID 1K5NB 3PP4L 4WFFE 2AP2A 4F7EB 3MTRA 1C12A 5DFVD 3PQYA 1WFNA 3IXAB 3X3FL 4HUUA 4OD3L 1J12A 4K7PH 5FM4A 1IEHA 1ZXQA 2W60A 1EZVX 2X4SB 3QB7C 1TPXC 4IRSA 2LTQC 2WW8A 3ULSB 2V5YA 5I1JH 1UCTA 4OGAD 2O61A 4PS4H 5GSRB 1QSEE 5LGJB 4YHZH 3Q6GL 1KTDA 1HHKB 4JJ5A 4HZLA 3TBSB 3X3GL 2ZUVA 3TJEL 1KUMA 5J9PA 1DN0A 4RDQF 5HHQB 3EOTL 4GQ9L 2ZJSL 4L3AA 2DI9A 15C8H 1FVCB 2PW1B 4Y1AE 4MJ5B 2GK0B 4G8IA 3IJHB 3S34L 4X6CF 1CR9H 4L4JA 2Y36H 3ME0A 3KXFA 3MZTA 4RCAA 3CZFA 1OTTD 3D2UD 1FL5B 3QCVH 4GXVH 1J1OL 5C0BA 4Z7OF 3W81A 3EDKA 1OWRM 3BDXA 5JW3L 3K2UL 7FABH 3C5ZD 3LEXA 3UTQA 3C2SA 5A2JH 4TUOB 4NQDE 1HEZA 4Z7QF 2FO1A 1OM3L 3ZHLA 4L4TB 4HULB 5JW5B 2ITDB 2A9NL 4W68A 4Q6IC 3IDMB 3JTTB 2YZ8A 4QCIB 1MH5A 3F7YA 3UTZA 2BVPA 5FYKD 5GGTL 3ZSSA 3MV9D 4LVEA 3D9AL 5EN2B 1X5FA 3UDWA 1ZHBA 2UY6A 1IKFH 3EFFA 2MOVA 3TESA 1NFDB 3S5LA 1YEKH 2CRMA 4PJEF 2P8PA 1ZT4A 4FNLL 3O8XA 4JZOA 1WC7B 5DMKA 3S35L 3MBEC 2KDGA 4MS8D 5EUOA 1YYLL 4LLAA 2ZG1A 2R1YB 4GUPA 4PJFE 2ADGB 3V8OA 3PHOB 5EC2A 1G7HB 4LK4A 3LHPL 2ID5A 3WUWA 5FYLD 3V6FB 3C6LB 3SE9L 4OFVA 4KVNH 1WV7T 1M7IB 4Z7QE 1K8DB 1CGYA 1Z9SA 2AEQL 1OD7A 4U1MA 2H2PC 5FV1L 4YXKH 3RVUD 4S10A 4LEOB 5F93C 1DQJB 1PG7X 4JFEE 4O51A 1EMTH 4OQTH 4MJ2A 2JTDA 2OBGA 1RJCA 1OAYL 4Z0BH 5GS0L 5IHLB 1MEXL 1TQBB 2IG2L 2QR0B 2XQBH 3MYJB 4LLMA 2VDML 1BD2E 3MV11 4GW4A 4G9FA 4PY7A 4X5WB 4L4VD 1A7NL 3GMOA 5F8QC 1CFQB 4UMGA 3V8CA 1LEGB 1AH1A 3W5NA 4OI9A 3GBNH 1WCBB 5T3ZH 4L8CA 4M8QA 1QBLL 4JPIB 1N64L 3RZCD 3FOMA 4QHMA 5I9QC 4RFOL 1NMCC 4OLEA 3RWHB 3WKMH 2RAMA 1EO8L 2D7TH 3G08A 4CMMB 4R7DB 2R2CA 4OLYL 3Q5OA 1WUNT 4PJBF 4HIJB 1WT5C 3HB3D 2MHAB 4ZTPL 3P73B 4LRNH 3MJ9H 4ZFOA 1MPAH 4GBXD 2J3SA 2R2BB 1MIEL 1QRND 3FQNA 5D1QA 4ZS6D 5EPMA 2PN5A 3MRRA 3SCMC 1AP2B 1DQMH 4PV8B 3KLHC 5HYJA 4F9LA 1KTRL 2DBLL 4XRCB 2WBJC 3UXFA 2F5BH 4XNQB 5DFWH 4MNQB 4NKMA 1YPZF 1JHLH 1QHPA 32C2B 5GIRA 4M1GH 1ZWIA 4FZEL 4IOIB 3T0BA 4TSAL 4QTHB 2KL6A 3W0WD 1CU4L 1IM3A 3IJYA 4G43B 4DVBB 5KSBF 2AJSL 1XH3A 1CL7I 3QWRA 5E5RB 3H7BA 4XVJH 5D7KE 2B8OT 3FCTB 5ABDE 4Z7NF 4RRPA 4P2OB 3VFPA 4LAQH 3VXPA 1IFHL 2AGJH 1B0WA 3SE8L 3WNOA 3CDGA 3FRUB 1TLKA 3AREC 4IRJC 3VDBA 2OK0L 4UT6H 2GITA 1UXSB 3U48A 2P7TA 4KRPC 1CE1H 2FECL 1BVLB 1KCVL 2VH5H 4PUBL 5F9AC 3V5DB 1JZ5A 3E2HC 2W1NA 3FFCE 3QUMA 1YEIH 1DUYB 1FL6B 1TZHB 4L3CA 4LLWA 3CFJB 4APQC 2RCSH 3NIGF 5HHPB 2ENSA 1ORQB 1RZFL 2F5AH 4LNRB 3DRTB 1CLZL 3GSWB 3MNWA 2CMRL 3EYQD 3P0YH 2IAMA 2QV2A 1IEAB 1Y18B 3O6KH 3L95A 5BRZD 1NBZA 2BJML 1EFXA 3G6JF 4F7PB 1UWGH 4NO3B 4P57B 4FXKA 3NIFE 2BERA 4HWUA 5E99H 4HMCA 3VFSB 4KDVA 3SHSA 5H37G 3N9GH 3TF7A 3F12B 4Y4KB 5CILH 3SQOH 2UZIL 2Q3ZA 2LAAA 2QHRL 3LPGA 2IPUK 1PZ5A 4HS6B 5D5ME 4N1HB 1UB6A 2C1OA 4JKPL 3OKEA 2ICWI 2Q6WA 3UJTH 4ODWA 2DQGL 1NUDA 5H94B 2R2HA 5TJWK 3RAJL 1M4KA 5GGQH 4D0DB 3EJZD 4J1UB 1FYTE 4H25B 3NTCL 1HYSC 3X13B 1TETL 3ALXA 5FGSA 5CD3A 4JY5H 5F6HJ 2MQCA 3RGHA 6CGTA 3G6DL 3QNZA 4X6BA 3SKJL 2EDEA 4U1LB 1PKQA 1UENA 3FAXA 1AE6H 2KZWA 3NFSL 1NC2D 1IILE 3AFLA 3O2VL 3TBYA 5LWYH 4QOKB 3MNZA 1P7QB 2IBGA 1CZ8H 4HCRA 2WLYA 4RAUA 2ZPKH 3BESR 3SJVA 4AYFA 4WHCA 3W9EB 4OCYL 5AUMB 3CJJA 4NRYA 5ACLA 5CLWA 1MHCA 2XWJB 4PRHB 3RWFB 2IMMA 4YE4L 1MY7A 1D6EB 4WFHE 3ZE1F 2R0WH 1L7TH 4LOUD 1RZIA 1M1SA 1MCIA 3ARGB 1DDHB 1RIHL 4TUJB 3VRIA 1A7PL 2VDPL 2GFBA 5ECJE 3GI9H 1BZ9B 3QDMD 3S9DB 2Q86B 2DQFA 2MCPH 3C2AL 4YFEA 4WFED 4G6AD 3TA3A 2EIDA 1YJDH 3RUGF 3PHQA 2FWOA 5EU6A 2YN5A 1K2DB 5D72L 4Q7DA 3UTPD 1MJUL 5TFSH 3FT4B 5E9DD 5J8OA 5ITFB 1QOKA 2P5WA 5E2TL 3RHWF 5E8DH 4LF3B 4P23C 4ZPVA 3KDMB 2AJVL 2XTJE 2DQDH 2X9XA 3T2PA 4I2XE 3A6BH 4LCUB 5DI8A 4UV7H 2VQTA 2FX8L 1RHFA 1MLCB 3WFBL 2LVCA 4HC1A 1IAIM 1OW0A 2JKXA 1FV1A 3QNXB 3WIHA 2GJZB 5F7EH 3SDCD 5F88A 3QUKB 5IVXA 1U8OA 1MRCL 1T1ZA 1BQHA 4PB9H 4M61B 1SM3L 4XAKD 4OCRH 5IB5B 2R29L 4WEMB 4JZNA 3O4OC 3RDTA 4LCWA 4PJ7B 1GGBH 5EFIA 2P8LA 2ICES 1BJ1J 4PBVC 1H5BA 3B6SA 4EEEA 3S8WA 1U42A 3P4NB 1F4AA 5JXEC 2JELH 4P9HH 5B21A 3MRBB 2YR3A 4OLZH 5SV4A 3BOVA 5CEZD 4RAVB 4U6XA 2YBRB 4D0CB 5J13C 3MROA 4O5LH 3VDCA 4LPUA 4D3CL 2ICWA 1KIQA 4EDXB 1XF1A 3WEXA 2ZP0T 2YPLD 4P2QB 4JDTL 3W2DL 4AQ1B 5KVDH 3UTSD 4Z7WA 4FTVE 4U1HB 3VMOA 1FGNL 1XCQA 2D03H 3EDEA 1RV6X 5FIEA 4KKAD 1UT9A 3Q1SL 1D6VL 2AJXL 1I9JH 3WS6C 1J05A 2W0KA 4XMPH 3ZT7A 3BEWA 2J4WH 4YNYA 2OMNA 3V7AG 1W72A 4RIRA 5DMJB 4LLDB 5JHDA 1JN6A 1XR8B 1KB5A 4ZTOH 5IWLA 4N0CA 3VXMD 3BI9X 4GSDL 2PTUA 2VDOH 5GJTH 1HNGA 3H9SE 4K7FA 3T0WA 3KPSE 3L3IA 1A3LL 5LBSL 3P9LB 3PGFL 4RGNB 4XBEH 5BVJB 5FDWB 4OQ1A 5ADOL 2NY5L 5HYSG 5M94B 1P4BL 5EBWA 3HNSH 5HHOD 4OBRA 1FN4A 5EO9B 1KJVB 3O3DA 1H3XA 4JY6A 3GJFA 4J6RH 3JWOH 3SDXB 5B3JF 5IBLD 3L9RA 4OIAA 1HE7A 3JUYA 2VZ3A 2CLRA 2PCPB 5FO7A 1IGFH 3K46A 1OGTA 5F7NC 3OMZA 5HHMD 1OCWL 4HGWA 4JHWL 5F70A 3MCKB 2VTFA 1SEBB 2W0FB 1WITA 3GMPB 3P40A 3V7MA 1JI2A 4NCDA 5D96C 1I3RB 4YFDB 3DUHA 3VFOB 1U8IB 5MP6L 5SWSE 4Z76A 2X4UA 5EG6C 3O6FB 3PWPE 5SX4H 3RX5A 4A2LA 1G6VK 2OL3A 1MI5A 4LRIC 5JZ7D 2IPTL 1QNZL 4R26H 3OQ3B 3HE7B 2DQIL 2D4FA 5B3JE 5DUML 3ARFA 1KJ2H 3L3OA 4IHOB 1F11B 2V2XB 3QEQB 1MIMH 4KI1A 4HPYL 3DXAE 4O4YL 2YD8A 1KT2A 4P3DB 1ONQB 1T6WA 3U9PH 4Z0XA 2V17L 1AR1D 3BGMB 3SQBA 3QIUD 1J8KA 1NFIB 2EH8H 4PRBB 5IQ9B 4OKDA 2NXYB 4I0PC 2VXUL 3VMNA 1N8ZB 1XF3B 4XWGH 2ICEA 4KDTA 3ULUF 1EGJA 1U91B 4NFDA 4BH7A 5EZLB 1KYOK 1IT9H 1IJ9A 3L3DA 4HFUL 5IOPA 4EUPH 1ZGLB 3VXNB 4N8VB 4Z7UB 1T4KB 2HKFL 4FP8L 1YUHB 3B9KB 1U8MA 1DSFH 3MLZL 2BC4A 3MV7A 4Y0GA 4F37K 1S7XB 1WBZB 1A0QH 4WEUD 3ULVH 1F3JB 3MLXH 3FO9B 3WNKA 5DJDB 3MLYL 4WO4B 4QHUA 1QG3A 1KNOB 1MFDL 5TE4L 3CGTA 5DRWB 2D7MA 2DQHH 3C5ZA 2EDYA 4QRRE 3GJEB 1JGVL 1ZHKB 3CMOH 1J8HB 5E00A 2Y07L 4HHAB 2VJXA 3TPKA 4RDQG 2HN7A 1FLTX 4H5SA 1MFAH 1FPTL 2A38A 3EDDA 4JQIH 4DZ8B 5C07D 2XA8L 4LPCA 3ULUE 3MJ7A 1ZLUH 43CAA 4ORZC 1A14H 4XCYB 4TPRL 3EDJA 1DJSA 1T3FA 3B9DA 1QLEL 3OR6B 3RL1B 1NBVL 2NLJB 3QXDA 2QSCH 4MNGB 5F9WC 5F89A 5ICZB 3GSOB 4LHUB 1J0IA 3RIFK 4FFYL 3GSXB 5IBUB 3HI5H 3MBED 4PJGE 2N4IA 2NTFA 4I48A 3NCJH 5AZ2H 5DURD 2ERJB 3ZKXC 4UINL 3GMNA 2ZUYA 3MRHB 4LSUH 1WAAF 2DQTH 4PBWD 1VCAA 1KCSL 1QPPA 5TE6H 1P7KA 2ILLA 4HKZB 3L7EB 5B8CB 2AK1L 3MRDA 4UUJA 4L8SA 1TZGL 2VR9A 4AENB 1P6FA 2IH3A 4UNUA 4HWZB 5CZKA 1S78C 2UWEE 2B5IB 2YPVL 3PWNA 5I1EL 1NFDF 3AMKA 3GI8L 5ALCH 1YY8A 3GIVA 1B0GB 5I30L 3BAEL 4PJ9C 1DLHA 4JY4A 3RWCB 3O0RL 8CGTA 2RFXA 4KJQD 2OQJB 4Z95L 3TBVB 4JLRA 4PP1C 1U3HA 5I1DA 1IC7H 3RIAK 1JP5A 5KG9B 1P4IH 4L4VA 1B88A 1CLOH 3WFEH 5E4EB 5ESAA 5HGAA 4WUUA 1R5WA 2DJSA 1G7LA 1W8NA 4PRAA 4W4OA 3RZCA 1WAAE 3BQUD 5IJKC 3OWEA 4HQQL 3SDDD 3X12A 4P5TC 4XVTH 1UB5B 1U8HA 3ZKMC 5IT2H 1KBGL 4MMXC 2ADJA 5TQ2H 1DR9A 5GGVH 3FQUA 3GMLA 5C8JA 1WBXB 2OZ4H 4H26B 1MHEA 2MWCA 1RVFL 3WCYA 3MC0A 4HK3N 4GBXA 3T1FA 3WHXA 3RTQB 1QRNA 2DLFL 1D9KC 2NY2C 3AS0A 2NTSP 2QKIA 4LCYA 3KLHD 2JB5H 5E95B 3UTTE 1RJLA 5DEFB 3IDNA 3FFDB 4PRIE 1F4YL 3HFML 2WBJD 5EORL 5HHVH 1QQDB 4XVUD 1F2XK 3INUL 5DWUH 2H41A 1FCCA 5F96L 2EKSA 1LK3H 3DROA 3HE6C 2EDTA 3I6KA 4OLUL 1BQUA 4NJ9L 1R6VA 3MLRH 3W0WA 1MCNA 3B5TA 4DGVH 1H8SA 3BKML 3GSRA 5I8CA 5MEQB 1H8NA 4R9HA 4K8RL 4BK5A 4LIQE 1FZKA 1T7YA 3D87B 4FFZH 4CMHB 4HS3A 4IRJD 2IWGA 4CJ0A 5BW7C 4GFTB 4LSPL 5GJSL 4N1EA 3OTTA 4N9GA 4KRPD 2UZYB 3QA3B 2C3VA 5KSVB 4UDUA 4CNIB 1AXIB 4JPVL 5HI3C 3LEVH 2HFGH 1NJ9A 4ENEC 5BO1H 5ID0B 3EOBB 1HDMA 4J4PA 2VXVH 4HDIA 1YEDA 3RHWK 3RU8L 4J3OC 1HSBA 4CL7A 1JTOA 4I4WB 5JDJA 3MRKB 4XMLH 2V5MA 4WUKH 1SJHA 4O9HH 1NUFA 4CN6A 3U30C 5MHSE 2Y4SA 4BZ1H 2Z31A 4ZOAA 1R3KA 5FB8A 4HV8B 1VGKA 3AC0A 3EDFA 3HC3H 1TCMA 5BRZA 5KSAC 1ZANH 4PLJD 4Y5XB 4JRWA 5T1MB 5B39B 1X9QA 2XZCL 3VGHA 4QHKI 2DKUA 1ITCA 2H8PA 3TBTB 4XZUB 2IF7A 2JK5A 2Y5EA 4A6YA 2XWTB 1BGXL 5HYSA 2EH7H 2HT2D 4CADA 3BRDA 3AB0C 3D3VE 4WV1B 3HA0A 2DMBA 3ARXA 5HDOA 4HXAH 4QWWC 1B90A 5DK2B 2VLKE 5F6IC 3VMPA 1IQDA 4G6FB 3SDYH 3ILQC 5DEGA 4D9QD 3VFNB 4L9LA 1HYSD 1MRFL 2XV6B 2AJZB 5J11B 3QDGA 3HMXH 3EYUH 3PV6B 2BMKA 4NQSA 1EK3A 3AS2A 1FDLL 1NC2A 1TJIL 1JGUL 1WWAX 1CDCA 3BX7C 3OJDB 1JHTA 4JG1H 3DPBA 2XZQH 3UC0H 4JANA 1I4FB 1L7IL 4X99B 4KI5F 3F7QA 1QR4A 3C08L 1MUJB 2I27N 1FCGA 1HOCB 1FFNB 5DUBB 1G0XA 1X7QB 4R2GC 2VITB 1XR9A 2EDHA 2LAGB 1AGCB 1Q94B 4EN3B 2Z0BA 2GJ6D 5CINH 2BOCA 3D48R 3LDBC 3NN8A 1FNEB 4JGUA 5DA4A 3VA6A 4MAUH 4PJXB 4G8GA 4U6HA 1LNUA 3GMMB 4XP6H 3HG1E 2IQ9L 2OTWB 1QSFD 1U93B 2ZUSA 4PJIE 5D7LD 2GCYA 1H3VA 1OQXA 2DLTA 2EYTA 3QG6A 2XIDA 5IVZA 3RWEA 1QFWL 4ZQKB 35C8L 2FCBA 3V6OC 5C0IA 4YLQT 1AQKH 3VXOB 2R56L 5DD0H 5D1ZC 1YMME 2XN9B 3RWDA 5EZOH 3TPUA 1KLUA 2NY4C 5LGHH 4TN9A 3I75B 1IAIH 3MRQB 4NO5B 4QO1A 4Z77A 4WHDA 5ANMA 3BKCL 3K8KA 3NBNA 1UJ3B 2VO5A 3S3PA 3QFJA 4S1SL 4E5XA 1NAMA 3QIBC 1N0LA 5MENE 3A6CH 5JXED 3O11A 4XPTL 4NN6C 4LASH 4DTGL 1NCDL 4K2UL 5EU7E 1CG9A 3QQ4B 2YSSB 3ULVD 3U4BL 4RNRA 1RZJC 3VE0B 1T2QL 1J7VR 1MSPA 2AI0L 3TO4C 3H6JA 1ETZA 4G7YH 5I1GH 4OLXH 3STLB 4M93C 5IB2A 5D2NA 3UTSA 4JO2L 3QXUA 2R1WB 1ADQH 5BXFB 2YOCA 3C9NA 3I2CL 4PJ7F 5EOCH 1M05A 3NZ8B 3O2DH 4LVNC 5FHAH 1RURH 3GRWA 2YUZA 4Y4FA 1PQZA 3V52H 2A73A 1XT5A 1CVSC 3ECBB 4H8WH 4JVUA 4TUKL 3VXMA 1CXLA 1NGPL 3TNMB 3FO0L 4JFDB 1K85A 4YDVB 3FJTA 4D9LL 1HZHL 4O2CA 5CWSB 4YPGB 3VJ6A 1CFBA 4ZPTA 2C3WA 5HDQL 5T3XH 1NCCL 4LKCA 3T0AA 5HXMA 4AG4H 3OXSB 5IFHL 4NHUA 3EYSH 4MDIA 5F3HA 1D5XB 2O5XH 1OVZA 5HHOA 4F3FB 3T65A 4KHTH 4GXUN 4XT1C 4POYA 5GZOC 3EO1A 3CZJA 3MV8B 4JRYD 2LU4A 3CVIH 4HK0A 4L4TD 2OI9B 2F8OA 3RWJB 4OQTA 1T89A 4FQLH 1MCJA 3C6SA 1VERA 4YDKL 3LIZH 4ZFOL 5T1KB 4CU8A 3A6OA 4X7TA 3L3JA 4NC2B 2CKBL 1LGVA 3B3IA