1R3IC

Potassium channel kcsa-fab complex in rb+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab fragment light chain
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r3iC00
5EC2C 4PA6A 4BW5A 4DXWA 1XL4A 3F7YC 4P9PA 4PDLA 4QE9A 1G4YB 4PDMA 2IH3C 5CBGA 2Q69A 1QLEC 2W0FC 4QNHB 1BL8A 4LP8A 2AHZA 3K03A 5CBHA 1P7BA 1R3LC 2Y69C 3BEHA 3VOUA 2X6BA 4GX2A 2QKSA 4X8AA 2NLJC 2Q67A 4MVQA 3RW0A 4GX5A 1K4DC 2A79B 3KG2A 4J9YB 4R50A 3SYPA 1ORQC 2ITCC 3E83A 4MVZA 4PA3A 3SPCA 2ZD9A 5EBWC 2QTOA 2WLNA 4MTFA 3RVZA 3R65A 4MVMA 3T4DA 3ABKC 3EFFK 3FB7C 3OUFA 3GB7C 3LDDA 4I9WA 4CBCA 3SPIA 2DWDC 3OR6C 5B1AC 1XL6A 4P2ZA 4J9ZB 1V54C 4EKWA 3LNMB 2Q68A 3E86A 3AG2C 3AG4C 4WFHA 3ASOC 2DYRC 2EIKC 5KUMA 4F4LA 3SJQC 2KB1A 3LDCA 3ZJZA 1K4CC 3PJSK 2HG5C 3K06A 4P9OA 3X2QC 3F7VC 2WLMA 4G28B 4MS2A 5EBMC 4LBEC 2ITDC 3E8HA 3ABMC 3IGAC 2DWEC 4R7CA 1R3KC 5J9PC 1ZWIC 4RAIA 2DYSC 5EK0A 3E8FA 2EIMC 2WLKA 2WLHA 4MVUA 4R8CA 3LDEA 3SYAA 2WLLA 1R3JC 4H33A 3SPGA 4GX1A 4R6ZA 1OCOC 3FB8C 3TETA 2WLJA 3K08A 4JTAB 4PA4A 3OUSA 2WLLB 2A0LA 2AHYA 2YEVA 2HFEC 2HVKC 2JK5C 4PDVA 3SYCA 5CBFA 3E89A 2HVJC 4JTCB 2EIJC 2WLIA 4MVSA 3ABLC 2OCCC 4TWKA 4X89A 4GX0A 2HJFC 3LUTB 5B3SC 3UM7A 2R9RB 2BOCC 2WLIB 1R3IC 3E8BA 2ATKC 4PDRA 4RUFA 2EILC 3F5WC 3AG1C 3SYQA 3OR7C 4MVRA 3UKMA 2A9HA 3OGCC 4WFFA 5EBLC 3TCUA 4RUEA 4MSWC 3IFXA 4QE7A 5BZBA 1OCRC 4MTOA 1JVMA 3STZC 3RVYA 5E1AC 4LCUC 3K0DA 2H8PC 4G27B 3SYOA 4H37A 3T4ZA 2IH1C 1OCCC 5KUKA 3HPLC 3SPHA 1J95A 3K0GA 5IY5C 4JTDB 4MVOA 1M56C 4HYOA 3ASNC 1M57C 2X6CA 4PA7A 5EC1C 3SPJA 3WG7C 4X88A 3T2MA 2ZXWC 4MW8A 4MW3A 3FB6C 2BOBC 3STLC 1V55C 4OXSA 3ZRSA 2P7TC 2EINC 1LNQA 4XDKA 4MTGA 4KFMA 4P30A 2K1EA 4UUJC 3T1CA 4WFEA 4XDJA 4XDLA 4PA9A 4ZBMA 5B1BC 1S5HC 4RO2A 4WFGA 3RBZA 1KKDA 3AG3C 3E8GA 4HZ3A 2Q6AA 3JYCA 3FB5C 2X6AA 1OCZC 3K04A
chains in the Genus database with same CATH superfamily
2V4DA 4JYAB 4IYHA 5CBGA 2XUMA 5KA5A 4H0LB 2X6BA 1XREA 2GTSA 4MVQA 3ETQA 1QR9A 5EBWC 2WLNA 2UXDB 3CMAV 3JAWB 4K3AA 4X20B 2YIDA 2Q7GA 4YHHB 1PM9A 2YDEA 3L70H 3ASOC 3CC2V 1XEQA 3ZJZA 1HNZO 3P32A 3WG7B 3K06A 2ZDIA 4NXMB 4G28B 1KD1W 4LBEC 5F2VO 1KMIZ 1ZSPA 5LOVA 1G6UA 4TT3G 5GONA 4R7CA 1GN6A 4O2BA 4IIJB 5FPRA 2Y4UA 5H9CA 3WB0A 3JD3A 4OX9B 1M93A 1FKAO 4JTCB 1FFXA 4D7SA 1NTZH 3ABLC 2XAFA 2JS3A 1S76D 3E8BA 1YTFB 1BGYH 2R72A 1SA0B 1US6A 2CTRA 2GV9A 3K3WA 4WBNA 1NT2B 1F4NA 2IJKA 1GM8A 3MDSA 2Y48A 3DXRB 4LCUC 3CE2A 3NXSA 4JTDB 3QO7A 2CDYA 4UCTA 3ZN0A 1NVPD 3PN1A 1DF5A 1FS0G 4AHCA 1MSDA 4JV5B 1S5HC 1JMKC 3UCSC 5L3FA 4K8ZA 1JOYA 5EZYB 4PDLA 4Q20A 1AI5A 5BXZA 3IJ4A 3CEIA 4E4EA 4QPJA 4LFCO 4DV7B 1FXKB 1R3LC 5LMUO 3BEHA 4X9QA 3A2FA 4X1KB 1K4DC 2O57A 1YJNV 1K9MW 1E1RG 3R65A 2E75B 1B06A 2BSKB 3OR6C 1N4CA 1Q5OA 1H8EG 1R1BA 2CGOA 3ZHSA 3K5NA 3PJSK 2IW5A 3CJHA 5EBMC 4H13B 4BAYA 3ZRWB 4D7TA 1JJ2U 5LBQA 1U96A 4JI0O 1YEWA 4DV4O 2IM9A 4B3RB 3N2GA 1BT8A 1R3JC 3UQ8A 4O4IB 4JGSA 2ZR3A 2XASA 1O9HA 4BIZA 1BZKA 4ZI7B 2Y69B 1YIJV 5JVDB 4TUYB 3ETEA 1VQ6V 5IE9A 1VQNV 1GN3A 4FZ1A 1LR1A 1W0JG 1SQVH 2ZDIC 4NVPA 2A9HA 3AK3A 4UCRA 4JI8B 5IYCO 2V7QG 3OAAG 1ZL8B 2JGUA 3ZHRA 1CEZA 4LNUA 5JWPA 3OTOO 1PP9H 5CA3A 3ZRXA 3JAKB 4JI2B 3ZHQA 5EYPA 3SGIA 4UCSA 2GUZB 3T2MA 3ZEDA 4F6EA 1U97A 4UB8Z 3ML0A 1NR7A 3TJTA 3M99B 4MTGA 5FL7G 4DRXA 2X0LA 5IJ9A 1V54B 4LF9O 3F5TA 4X64O 4DXWA 3G6EV 2JIZG 4LC1A 1XHXA 2QM8A 1YCIA 1T5EA 1I0HA 1DK1A 4GX2A 1Q43A 2QM4A 3JALB 2NLJC 3RW0A 4J7KA 1QCEA 2KSDA 4ZKIA 1KB9F 1SKVA 3QTCA 3AG1B 4MVZA 2Q7HA 5LHGA 5LGUA 4UCVA 2VQFB 5LXTA 1NVPB 3LSQA 4ZOLB 1AI4A 4GZRB 3Q4HB 4K0KO 1DGSA 5LMNB 4DR3B 2RMKB 2UU9B 4I7ZB 4F4LA 4FLYA 3H01A 1OV9A 1O9GA 3C3SA 4O4LA 5B3SB 1VQ5V 1XMOB 2ITDC 2WPDG 2CTWA 1WPXA 3CCUV 2WLKA 1XBLA 5C8YB 4DR6O 4R6ZA 3ZCCA 4Q6GA 2JS5A 1WA8A 3L72H 5IT9N 5KLVH 4LF6O 1TAEA 5KAIZ 1BHBA 2WLIA 4JYYA 2OCCC 4U7OA 3FX7A 4RUFA 3SDLA 1N32B 3E2EA 1LUVA 3CCMV 1AJPA 4WFFA 1X59A 3SJAC 4IT5A 2KQXA 3CCJV 1OCZB 4I55B 1K5SA 4H37A 1KKCA 3K0GA 4XBFA 4X62O 4PA7A 2ZE7A 3WG7C 1I5XA 1KUQA 2YICA 4FM2A 3HKDA 2EINC 4O2AA 3H1LH 2RJZA 3EVKA 2M6YA 4XDLA 1Q90D 1Y74B 1I94B 2HJDA 4HZ3A 3JYCA 4YY3O 5DN6G 2BTQB 4HNAB 1P84F 4FK5C 4QE9A 1G4YB 1N8RW 2ZNJA 2OIGA 3D36C 2QM7A 1SQFA 1FJGB 2ZIMA 4B7KA 4BWAA 2HHHB 1Y76A 4MVMA 5CA0B 1YSCA 4OPHA 3KCXA 1NR1A 4I9WA 3SPIA 4KHPB 2L35A 2QKAA 1BS3A 2EZPA 3JSLA 5CB4B 3FFQA 1XI1A 1S0VA 3G6BA 4ABMA 3RFRA 1Z5WA 4DV0B 2H3OA 2ZE6A 1F23A 2P67A 2V1DA 2HR3A 4B7EA 2W6JG 4TV8A 1IXBA 5B1NA 3RWRD 5J9PC 4DV1B 4PELA 4JI5B 1XNQB 1A32A 5HFLA 4YJ3B 1TUBA 2Y4TA 4PDVA 1BMFG 1BQ0A 2EIJC 1RPOA 3CRMA 4TWKA 3N2KB 2R9RB 2P22C 1GAXA 1UPGA 2ZM6B 3W7TA 4JF3A 1EZJA 3OGCC 4Z1MG 2UUAB 1QNMA 4MTOA 2K9PA 3CCQV 2AGAA 2YIAA 2HP8A 2XAQA 3SYOA 3CP1A 2XAGA 2Z0AA 1RP3B 3T1HB 4X88A 3CXHF 5CN0A 1NH2D 2UXCO 3U10A 2ZCEA 2P7TC 1PNMA 1JPXA 3KZIZ 4IHJA 3IAYA 4FFBB 4PV1B 3B8MA 1KBHA 2E76B 3JD2A 4JYBA 1ZUQA 4UVBA 3JSNA 1HNWB 3CXCU 4GT1A 2AHZA 1RM1C 2Y69C 1S3JA 4DR4B 4KUMA 4OPAA 1W0KG 4FZ0A 3SPCA 3ABUA 1VQKV 5KHKA 2OWOA 2CUGA 3K9SA 4EKWA 1KC8W 1PKXA 1B3QA 2Y0PA 1M56B 1K4CC 5H6RA 1BE3H 2P4KA 1HR0B 4DV5O 1GMGA 1IBMO 4QPKA 1P7GA 1KU9A 1HDJA 5J2TA 1QQCA 4H44B 1NQTA 5LOVB 5GONB 4H33A 3D8CA 1URFA 1FXHA 1M90W 3DGEA 3K08A 1QLEB 2A0LA 1AP6A 3SYCA 1VF6A 2DOSA 3RYCA 1Z2GA 3SJBC 1FD9A 2WSSG 1H38A 4NKGB 2WA3A 1FFXB 4PDRA 1L8DA 1GM9A 3AG1C 1ZTEA 5CA1A 2B1IA 3ZHUA 3G71V 1EBOA 4KXRA 1VQ9V 1HNZB 4WBNB 1PL4A 2EIKB 2YC0A 4J10A 4NYKA 4NTYA 3D3IA 3OE7G 1EN6A 2X6CA 3BHPA 4AI8A 4QJFB 5JQGA 4MW8A 3SR2C 5L3GA 4MW3A 4O4HA 2F93B 3ZHTA 4JZ2A 1KKDA 5LHHA 3E8GA 2Q6AA 2WA4A 3HKBA 2ODMA 4PA6A 3JCUZ 2JGDA 4DUYO 4CS2A 5CBHA 4U3JA 4E2LA 4JAVA 3FD9A 4J9YB 1AP5A 3T4DA 2FB5A 5E79Z 1NH2B 1AJNA 1OCRB 3CS5A 4LF7O 1XL6A 4MTXA 5H6QA 4J9ZB 3RYFA 2Q68A 2XAJA 1GO3F 4TV9A 4X1YA 3SJQC 3OGIB 5FLXN 4X65O 3I55V 4TQDA 5BR8O 2OCCB 2XOKG 5C93A 4DR1O 3QO5A 5A2QN 1NJIW 2L6LA 2F95B 1R6KA 2YIBA 4UXNA 5ITZA 2Q7EA 3AK1A 3OTFA 1QHTA 1VQMV 2WLLA 3OEHG 1XILA 3TETA 1OCOC 4JI3O 4LFCB 4YIOA 3N2GB 5LMUB 5LYJA 1QBZA 2QTSA 2R9IA 3K5LA 4HAMA 2JEUA 4EEQA 4DR2O 1K33A 2EINB 4UVCA 3OT7A 3OM3B 5H2FZ 5L3BA 1Q86W 3OW2U 2LGWA 5KHIA 2N74A 4CH4A 4RWUA 1XNRO 3W7XA 4LFAO 2X7RB 4JI0B 1M57C 3OMAB 4DV4B 2B1GA 4LNUB 1IVSA 1VF6C 3FYIB 3STLC 5EYPB 3IC7A 3JARA 1VQ4V 1KP3A 1VF5B 4LWSA 4DRXB 2LQTA 2LW1A 5IJ9B 2Q69A 3FKSG 1SERA 1CP9A 2FMLA 4FLVA 1K7DA 5A9GA 5IWAO 3VOUA 1K97A 3AK2A 4GX5A 5H5NA 1VEWA 2PZSA 5B1OA 4I50A 4F6RA 3ABKC 4LFBO 1PL0A 5LXTB 4P2ZA 3OTOB 3JATA 4LF8O 1YXBA 4I4TB 3LDCA 2EIJB 2Q9LA 2YXYA 3LSSA 1RPRA 3L71H 3CCRV 4PHZA 5LA6A 2WAMA 4O4LB 4JI4O 4LF9B 1K34A 4X64B 2HEPA 3W7UA 4GLXA 1SZTA 1HP8A 1JX9A 1IURA 3TK1A 1XHZA 1BQZA 2IU3A 4PA4A 4O4JA 5CBFA 4GKJO 1WA8B 1Q6IA 1TVKA 1Q8IA 1H2MA 3B2EE 2BOCC 2WLIB 2QA4V 4LF5O 4K0KB 4MVRA 3ZN1A 2KG7A 3H1HH 5GTIZ 4YJ2B 3TCUA 2JDIG 2QWOB 3RVYA 3K0DA 3R66A 2ZNIA 1RM1B 4PI2A 1SQQH 1NTKH 1EZVH 1M56C 4GUNA 2DJVA 3CCVV 2A7WA 3A0RA 3BFRA 4DR6B 3K57A 4KL1A 5GW7A 1LNQA 4LF6B 2F4VO 2Q5ZA 4MT8A 4EB6A 4WFGA 3AG3C 3HKDB 2YI8A 3CCSV 1NKDA 4BW9A 4O2AB 4DW1A 1N0NA 4PDMA 1IDSA 3E22A 1QLEC 3RT3C 5CMUA 4X8AA 1MMMA 2A79B 3KG2A 1MSWD 4UB6Z 1WAZA 2C2AA 1Y76B 1CXZB 1SQPH 1BSMA 1QU7A 3LNMB 2B5UA 3E86A 4J7JA 4IGGA 4NB5A 4X62B 1THZA 2DYRC 1SS3A 2EIKC 3J7AU 3G67A 2CGNA 2EJ7A 4P9OA 4FLWA 1H2SB 3IGAC 3CHXA 2DWEC 3LNNA 3RYHA 4YY3B 3DXRA 4J7ZA 4TV8B 1VF7A 1ZLZA 1GRJA 2YSUB 4JI6O 3EHBB 2ARHA 1D5NA 3VQVA 2OTLV 2HVJC 2QR4A 1TUBB 3OFNG 2ETNA 3A0HZ 4J41A 3VBBA 3F5WC 3DTUB 3OR7C 2NN4A 5EBLC 2BTOA 4MSWC 1EN4A 3TXSA 2QEXV 1OCRC 1L1FA 1K8AW 3BA8A 3STZC 4X1KA 2IH1C 1J95A 1G1XB 2CAZC 1FXVA 4UCOA 4GKKO 3HKEA 2JRIA 3I56V 5KX5A 1GTOA 2W0XA 3ZRSA 1DF4A 3BPZA 4XDKA 3ZMVA 5LP6A 4FPPA 3L9DA 1IBKO 2W6IG 2LO1A 4IHJB 2PGGA 3ABTA 3GWKC 1TA8A 3M7MX 2PTMA 5LHIA 3LSUA 3B4SA 2YIBD 5B5EZ 2ZT9B 1NBMG 5DM6V 5J2UA 2IBZH 2YXLA 1MABG 1IX9A 4ZHQA 1PPJH 1JCHA 1OCOB 4WFHA 2XNDG 2UXCB 3O65A 3CMEV 2Q8VA 4X66O 1KP2A 2WLMA 2LP7A 5IYZA 3QO8A 4FFKA 5DEDA 4Z1VA 3ABMC 3BVOA 2DYSC 3HR0A 1P49A 1VIBA 3APQA 3G4SV 1JQ0A 3SYAA 5IJ0B 5J2TB 3DSQA 2GUZA 2HVKC 1Y66A 4DR3O 4LF4O 1L0NH 4UV9A 1M57B 2MW2B 1BCCH 1SQBH 2Q0AA 3CB2A 1R3IC 4U7NA 1J5EO 3SYQA 1HNXO 1YZBA 2DN9A 1N0JA 1XQ8A 3L74H 3AG4B 5CA1B 1K3EA 4CC6A 4N23A 5E1AC 3ZMUA 4DV5B 3JALA 4JI1O 1IBMB 3ZRVA 4ASUG 2CH7A 2XHBA 1W59A 4WFAV 1W2BU 1F4MA 1NTMH 5EC1C 4PJ0Z 1XOUA 3RYIA 4FM0A 3ABKB 5JQGB 1K5QA 1Y67A 5IYDO 4DV3O 1ZX3A 4O4HB 3ZX6A 4PA9A 4DUZO 4EFBA 2OTJV 2Q0OC 3FB5C 1AR5A 5KHHA 1D2DA 3MHHC 4DV2O 3H1KH 3HKBB 2GBOA 2DW4A 3CRRA 2AZ0A 1COWG 2JGDB 4U3JB 1WPBA 2IU0A 2ZD9A 3K79A 3OMIB 1NS1A 3QF7A 3GB7C 1GKFA 5BMVA 4D6TH 5LP6C 3ZHVA 3K59A 3BY6A 5KUMA 3L73H 3M8AA 3SJCC 1YJWV 2R9AA 4TV9B 5KMGA 4X1YB 4JI7O 5KAFZ 1R6TA 2H94A 3P30A 1GN4A 4MVUA 1PD3A 4UV8A 2ILMA 5ITZB 4DUYB 3AEIA 3SPGA 1Q81W 2F66C 2WLJA 3P3PA 1WP7A 2NR5A 3K5MA 4DK1A 4JTAB 2WLLB 2WWWA 2AW9A 3FYEB 2YEVA 4DV6O 1AB3A 4DR5O 2RNBA 2BE3A 3E35A 4B08A 3JAMN 1GM7A 5LYJB 1MOFA 3HKCA 2Q73A 1R73A 3A8TA 3LUTB 2A06H 4BIUA 1VMGA 3UM7A 4ICGA 4LF7B 4K8XA 4B3MO 3WU2Z 3UKMA 3CPWU 3AG3B 4QE7A 3B8NA 3T1YO 2IJIA 1H2KA 2JJ2G 4X65B 5BR8B 4DR1B 4O2BB 4G27B 3VQYA 2R70A 3T4ZA 1AR1B 1TGOA 1Z5VA 5IY5C 1IXMA 3UT5A 2OCHA 3JASA 3SPJA 2UUCO 1MG1A 3BCCH 3VQXA 2DE0X 5FPOA 4JI3B 5LL6Y 1AI7A 4UUJC 2ZINA 5D5QA 2GSMB 2UUAO 3JARB 2E74B 2DYRB 4P9PA 4W4KA 4QNHB 5JH7A 3THOA 4DR2B 2DQ3A 4LWSB 4KP4A 2ADPA 3FAVA 2LJ2A 2DQ0A 5L3EA 1UFIA 2FTKA 1RSOA 3J80N 4FMTA 4UVAA 3LDDA 5B1AC 4DK0A 5L3CA 1XNRB 2RN9A 4LFAB 4I50B 2YS8A 3BA9A 4F6RB 2P5OA 3NR7A 4I0XA 1Q3EA 4FLZA 1VQPV 3CX5F 3JATB 1SC5B 1N34O 1FFTB 2NNUA 3IC9A 1H2NA 1SQXH 2ZR2A 3LDEA 1JR9A 2VQEO 2RDCA 3JD1A 2Z5UA 5LA6B 4DR7O 5B66Z 5IWAB 1N33O 2FYUH 3C3TA 2LFSA 1D5AA 1XUQA 4JYCA 5JJJB 4DO2A 1VQ7V 1JFFA 3H1IH 1NI8A 2GTAA 4O4JB 2OT5A 1SRYA 4LFBB 2HJFC 4X1IA 2EZOA 3CRCA 4B3SO 1TVKB 3JD4A 2D2CB 2BCCH 3CRAA 4LF8B 1XDCA 3CJHB 4JAAA 2KKWA 2QE7G 3U11A 3AG2B 3QNEA 2KG7B 2FL4A 4NXNO 2H8PC 3WFVA 3CYOA 1OCCC 1SESA 3HPLC 1IBLO 3MHSC 2ZQMA 3EXAA 1KQSU 1MZFA 2AZ2A 2DMXA 4JAUA 2E5LO 4JI4B 2PYJA 4K35A 3DC6A 3JD0A 4FM1A 4JZGA 1K73W 2P06A 5D5PA 1Y4MA 4P30A 4TOIA 5B1BC 3RBZA 2QWQB 1WB8A 4GKJB 2PF4E 1QLNA 2CK3G 1EFRG 4EB6B 4FVMA 3CCEV 2YI9A 4LP8A 2UXBO 2GDSA 1TUEB 4LF5B 3MAQA 2UXXA 3E22B 5K1XA 3ABMB 2XAHA 1VQ8V 4R50A 3SYPA 3O9OA 2DYSB 4MTFA 1QR8A 2ZE5A 3C90A 1KYOF 3UO2A 4AQYO 4CBCA 1WJZA 1NZ6A 3AG4C 2FKXA 3ZMSA 2KB1A 2UUBO 3AG7A 2HG5C 1VQOV 1HWYA 3F7VC 1YITV 2F4VB 4DW0A 4RAIA 4C7UA 1XMQO 2A3QA 1I7FA 1N36O 2VS0A 1ZAUA 3RYHB 4B3TO 3OEEG 2HFEC 1VP7A 4JYAO 1WN7A 4A5UB 1I5YA 2E3CA 3CC7V 3H9VA 2VWJA 2VRZA 2D3OW 1G8MA 1NU1H 5FNVA 5BZBA 2PI4A 3GVMA 5IDJA 4CS3A 2UXDO 2N04A 3ZBHA 1GN2A 3N27A 4YHHO 4HYOA 4OXSA 3HKEB 4JI6B 4NXMO 3W7WA 4CC5A 5KX5B 1IZ3A 3WB1A 4XDJA 2YUAA 3ZS8C 2YXHA 3JCZA 2QWPB 3I5DA 5LP6B 3F7YC 2EJRA 1R6NA 1M4UA 2IH3C 5LGTA 2IJHA 1P7BA 4OX9O 3U0ZA 2Q67A 2QDOA 2JEXA 2Z3YA 3JAWA 3E83A 4PA3A 4X20A 3FB7C 5K1PA 4I5SA 2XTAA 1P4RA 4QIWF 5J2UB 3MD0A 4GKKB 4ZHQB 5KHJA 1PNKA 3RGBA 1YDXA 2AXTZ 1Q6UA 3BABA 2IJJA 1S72V 1FAFA 4IIJA 4LR3A 4RQEA 1IBKB 1Q6HA 1R3KC 1ZWIC 5IYZB 5EK0A 2GHYA 2EIMC 4R8CA 1OJHA 4CS4A 2ADQB 4DYLA 3B77A 3W7SA 1M9NA 3D36A 1WP8A 4JV5O 4YIPA 1PNLA 4WFBV 3L75H 2P6JA 5IY5B 2LFRA 4OGQB 3HB3B 4L8JA 1S77D 1SA0A 4GCZA 5TISZ 1K92A 4DV7O 1PV0A 2QGNA 1ENVA 2EILC 4UCUA 3S3WA 5EIBC 1DLBA 2ZE8A 5IYBO 3J81N 2JVDA 3KKYA 4X66B 4BR6A 1MA1A 2P90A 3K5OA 3X2QB 2CTQA 4NTWA 2CH7B 2ZXWC 4UFZA 1EM1A 1V55C 4BIOA 2N05A 1E79G 1AJQA 1OHHG 3H1JH 2K1EA 3T1CA 4WFEA 4ZBMA 3RYIB 4I4TA 5EZYA 5B1AB 1B6QA 3QG5A 2HLDG 4LF4B 2X6AA 4B3RO 1FXKA 1L0LH 4FIPC 4NR1A 2P4VA 1J5EB 3TXQA 1HNXB 2PYLA 4LH7A 3ETDA 1JA8A 4J80A 3KCYA 2BSKA 2QTOA 5JCOA 3RVZA 2QWRB 3TGUH 2F43G 1FPOA 3EFFK 3OUFA 4FLTA 1X4TA 4JI1B 3AG2C 4CZZA 4JI8O 5DECA 3ZRWA 2PY5A 3ASNB 5BMVB 5BY1A 1AROP 2QSAA 1FYJA 4DV3B 4YJ2A 1H2GA 4DUZB 2CTPA 4JI2O 4AILC 5KMGB 4O4IA 3E8FA 1YF2A 3ICXA 4DV2B 1Q82W 1SQGA 3WB2A 4ZI7A 3QVNA 5JVDA 4TUYA 1OCCB 2AHYA 2JK5C 1YI2V 3E89A 2UXNA 2YEVB 5LGNA 1F51A 5AG2A 3HKCB 4CH3A 3ZMZA 5B1BB 1ZL8A 4J11A 2LW7A 2VQFO 3ASOB 3JAKA 3B40A 1SETA 3RN4A 4JI7B 5LMNO 1AILA 2UU9O 2F23A 2Q4PA 4FJCC 1LUWA 1V9PA 3RYCB 3UT5B 4WCEV 3JASB 3DC5A 4KFMA 1XMOO 4J42A 2G38A 4DV6B 3CD6V 1YVWA 1Q7YW 4DR5B 2QWNB 4PD4F 5EC2C 4BW5A 3CCLV 1MNGA 4PI0A 3OD4A 2W0FC 3ABLB 2B9ZA 1BHAA 2RQ6A 1H2LA 4B3MB 5EIBD 2RCVA 5JH7B 2PUSA 3APOA 2ITCC 3T1YB 1WLEA 4ZOLA 2ZKOA 3Q4HA 1YHQV 4Z2WA 3FAVB 1EN5A 5KA6A 1N32O 4IYIA 1RSOB 1VQLV 1SF9A 2F1MA 1VARA 2UUCB 1UJWB 3CC4V 1AVMA 2VWKA 4I0XB 2HKOA 4I9QA 1FXKC 4MS2A 2XT9A 5C8YA 4NTXA 3ETGA 4YXWG 4GYCB 1M1KW 4GX1A 3FB8C 5JCOC 2PI5A 4U3FH 3G80A 1OZ0A 1I94O 5GTHZ 3VQWA 3RYFB 4L87A 1H8HG 1S5JA 4IL6Z 4G2KA 3CWBH 2ZIOA 1JFFB 3S3XA 1DTOA 1FJGO 4X1IB 4I55A 4RUEA 2HHHO 3IFXA 4WF9V 4EFEA 1N34B 3OMNB 3UO3A 4KHPO 5HFMA 4N21A 5JJNB 4MVOA 2LGQA 3FB6C 1WB7A 2VQEB 2BOBC 4DV0O 1Y74A 1E1QG 3K58A 2EULA 4DR7B 3GWOA 1HW7A 3P3NA 2BTQA 4HNAA 1N33B 4CH6A 4JASA 4DV1O 3K04A 1YJ9V 5JJEB 4JI5O 1XNQO 1XL4A 4LH6A 1BL8A 4B3SB 3K03A 1GK9A 2OIEA 1KECA 4TSFG 2QKSA 1I08A 3BRCA 5CA0A 1F7YA 5IJ0A 1ORQC 1WNSA 2EIMB 3BAAA 4FLXA 4NXNB 5CB4A 2DWDC 4HBNA 1IBLB 2ZM6O 1V54C 1B04A 2E5LB 4TQFA 1RFYA 1QVFU 1S5LZ 1YTFD 4RQFA 3X2QC 3CSXA 2M7WA 2CE4A 1QVGU 3E8HA 1SZXA 2EILB 4YJ3A 3T1HO 2WLHA 1JJOA 2UXBB 3CRQA 3D3QA 3OUSA 5KHGA 2EX3A 2EBOA 1AI6A 3A0BZ 3N2KA 4QGPA 4JPRA 4MVSA 1HNWO 1ROPA 2Y0IA 4CH5A 4X89A 4GX0A 2ZXWB 5B3SC 2JJ1G 4AQYB 1V55B 1Y6XA 2ATKC 3ZIAG 4DR4O 2OYQA 1AR4A 2UUBB 4ZIBA 1JVMA 5FNVB 4FLUA 3K9AA 5KUKA 3SPHA 3B09A 4W4LA 3ZMTA 3ASNC 1XMQB 1M5IA 2QJ1A 1CPYA 1MZEA 2MK3A 1N36B 4FFBA 1GH6A 4B3TB 1HR0O 5L3DA 4RO2A 2QKCA 1OCZC
chains in the Genus database with same CATH topology
3ABTA 3F7YC 2EJRA 3CXCU 1R6NA 4GT1A 5LGTA 2IH3C 5CBGA 2IJHA 2AHZA 5KA5A 1RM1C 1P7BA 2Y69C 1S3JA 2X6BA 5LHIA 4KUMA 2Q67A 4MVQA 1W0KG 2JEXA 2Z3YA 1QR9A 1NBMG 3E83A 3ABUA 4PA3A 3SPCA 5EBWC 2WLNA 5DM6V 3FB7C 3CMAV 1MABG 1VQKV 4I5SA 1JCHA 1OCOB 1P4RA 4QIWF 4EKWA 3MD0A 1KC8W 4WFHA 1PKXA 2XNDG 3ASOC 1PNKA 3CC2V 3ZJZA 1M56B 1K4CC 5H6RA 3P32A 3CMEV 3WG7B 3K06A 2ZDIA 1KP2A 2WLMA 2LP7A 1GMGA 4G28B 3QO8A 1KD1W 4QPKA 2IJJA 4LBEC 1S72V 3ABMC 4RQEA 4TT3G 4R7CA 1R3KC 1ZWIC 2DYSC 5EK0A 2GHYA 1NQTA 2EIMC 4R8CA 3G4SV 1JQ0A 3SYAA 3W7SA 3B77A 4H33A 1M9NA 5H9CA 3D36A 1FXHA 1M90W 3JD3A 3DGEA 3K08A 1QLEB 2A0LA 1PNLA 4WFBV 3SYCA 2HVKC 2P6JA 1Y66A 2LFRA 5IY5B 4JTCB 4UV9A 1M57B 3ABLC 2XAFA 3HB3B 1H38A 2WSSG 1S77D 4GCZA 1K92A 1S76D 1R3IC 3E8BA 4PDRA 4U7NA 1YTFB 1GM9A 1ENVA 2EILC 3AG1C 3SYQA 1DLBA 3K3WA 2B1IA 3G71V 1EBOA 5IYBO 1VQ9V 1F4NA 2IJKA 3AG4B 1GM8A 1K3EA 2Y48A 4N23A 4LCUC 2EIKB 5E1AC 3ZMUA 2P90A 3ZRVA 4ASUG 3X2QB 3NXSA 4JTDB 3QO7A 3D3IA 4WFAV 3OE7G 1W2BU 1F4MA 3ZN0A 2X6CA 5EC1C 4QJFB 1NVPD 2ZXWC 4MW8A 5L3GA 4MW3A 1V55C 1DF5A 1FS0G 1E79G 1AJQA 1OHHG 3ABKB 1K5QA 5IYDO 2K1EA 3T1CA 4WFEA 4ZBMA 4PA9A 1KKDA 5B1AB 1S5HC 5LHHA 1B6QA 3E8GA 2OTJV 2HLDG 2Q6AA 3FB5C 5L3FA 2X6AA 1JOYA 1FXKA 4PA6A 4PDLA 4Q20A 1AI5A 3MHHC 4FIPC 4QPJA 2DW4A 5CBHA 1FXKB 1R3LC 3BEHA 4E2LA 1COWG 4JAVA 3ETDA 1K4DC 4J9YB 1YJNV 2IU0A 1K9MW 2ZD9A 2QTOA 3K79A 1E1RG 3OMIB 3RVZA 3R65A 3T4DA 2F43G 3EFFK 3OUFA 1AJNA 3GB7C 1GKFA 1NH2B 1OCRB 3OR6C 1XL6A 4MTXA 5H6QA 4J9ZB 2Q68A 3AG2C 4CZZA 2XAJA 1GO3F 1H8EG 3BY6A 5KUMA 3SJQC 3ZRWA 3PJSK 3I55V 3ASNB 2OCCB 1YJWV 2XOKG 5C93A 2IW5A 3QO5A 1AROP 1NJIW 5EBMC 4BAYA 1H2GA 3ZRWB 1R6KA 4UXNA 1JJ2U 2H94A 5LBQA 3P30A 3E8FA 4MVUA 1PD3A 4UV8A 1VQMV 2WLLA 3OEHG 1R3JC 3AEIA 3SPGA 1Q81W 3TETA 1OCOC 1Q82W 2WLJA 4JGSA 2ZR3A 4JTAB 1QBZA 2WLLB 1OCCB 2WWWA 2XASA 2AHYA 3FYEB 2R9IA 2YEVA 4BIZA 2JK5C 1YI2V 2Y69B 3E89A 3E35A 4HAMA 1YIJV 1GM7A 2JEUA 1MOFA 2UXNA 3ETEA 2YEVB 1R73A 4BIUA 3LUTB 1VQ6V 3UM7A 1VQNV 5LGNA 1K33A 1F51A 1W0JG 2ZDIC 2EINB 3ZMZA 3UKMA 2A9HA 4UVCA 5B1BB 3CPWU 3OM3B 5L3BA 3AG3B 4QE7A 3B8NA 2IJIA 5IYCO 1Q86W 2JJ2G 3OW2U 2V7QG 3OAAG 3ASOB 4G27B 1SETA 3T4ZA 1AR1B 1CEZA 3W7XA 5IY5C 1IXMA 2X7RB 5CA3A 3ZRXA 1M57C 3OMAB 3SPJA 2B1GA 3T2MA 1MG1A 4FJCC 3FYIB 3STLC 3ML0A 4WCEV 1NR7A 1AI7A 3IC7A 3M99B 4MTGA 4KFMA 4UUJC 5FL7G 2X0LA 1VQ4V 3CD6V 1KP3A 1V54B 1Q7YW 2GSMB 5EC2C 4BW5A 2DYRB 4P9PA 4DXWA 3CCLV 3G6EV 2JIZG 2Q69A 3FKSG 2W0FC 4QNHB 1SERA 3ABLB 1CP9A 4LC1A 2QM8A 1BHAA 1K7DA 2DQ3A 3VOUA 4GX2A 4KP4A 1K97A 2NLJC 3RW0A 1QCEA 4GX5A 4ZKIA 2ITCC 3AG1B 4MVZA 1WLEA 5LHGA 5LGUA 2DQ0A 1NVPB 5L3EA 3LSQA 1YHQV 5B1OA 2FTKA 3ABKC 4FMTA 1PL0A 4UVAA 3LDDA 5KA6A 5B1AC 5L3CA 1AI4A 4P2ZA 1VQLV 1VQPV 4F4LA 3LDCA 2EIJB 1UJWB 3CC4V 3H01A 2HKOA 1FFTB 1FXKC 3LSSA 1RPRA 2NNUA 5B3SB 4MS2A 1VQ5V 2ITDC 2WPDG 3CCRV 2WAMA 1WPXA 1K34A 3ETGA 3CCUV 2WLKA 2ZR2A 3LDEA 4YXWG 3W7UA 3JD1A 2Z5UA 1M1KW 4GX1A 4R6ZA 3FB8C 1SZTA 3ZCCA 2PI5A 1JX9A 3TK1A 2IU3A 4PA4A 1OZ0A 5CBFA 2LFSA 1BHBA 4JYCA 2WLIA 2OCCC 4U7OA 4DO2A 1VQ7V 4L87A 1H8HG 2OT5A 1SRYA 2HJFC 2EZOA 4G2KA 3JD4A 2BOCC 2WLIB 4RUFA 2QA4V 3E2EA 3CCMV 1AJPA 1DTOA 4MVRA 3ZN1A 4WFFA 3TCUA 4RUEA 3IFXA 2QE7G 3CCJV 2JDIG 3AG2B 1OCZB 3QNEA 4WF9V 3RVYA 3K0DA 2H8PC 3OMNB 1K5SA 3WFVA 4H37A 3CYOA 1OCCC 1SESA 3HPLC 3MHSC 1RM1B 5HFMA 3K0GA 4XBFA 4N21A 2ZQMA 4MVOA 1KQSU 1M56C 4JAUA 4PA7A 3CCVV 3WG7C 1I5XA 3A0RA 3JD0A 3FB6C 2BOBC 1K73W 1E1QG 5GW7A 2EINC 1LNQA 3GWOA 1Y4MA 4P30A 5B1BC 4MT8A 4XDLA 3RBZA 4WFGA 3AG3C 4JASA 4HZ3A 3CCSV 3JYCA 1NKDA 5DN6G 3K04A 1QLNA 1YJ9V 2CK3G 1EFRG 1XL4A 4FK5C 4QE9A 1G4YB 4PDMA 1N8RW 3CCEV 1QLEC 1BL8A 4LP8A 3K03A 1GK9A 1TUEB 2QM7A 1KECA 4TSFG 5CMUA 2UXXA 2QKSA 4X8AA 3ABMB 2A79B 2XAHA 3KG2A 1VQ8V 4R50A 3SYPA 1ORQC 1MSWD 2DYSB 4MTFA 2C2AA 2EIMB 1QR8A 4MVMA 1YSCA 4CBCA 1NR1A 4I9WA 3SPIA 2DWDC 1V54C 2EZPA 3LNMB 2B5UA 3E86A 3AG4C 1THZA 2DYRC 1S0VA 2EIKC 3ZMSA 2KB1A 1QVFU 2HG5C 1VQOV 1YTFD 4RQFA 1HWYA 4P9OA 1F23A 2P67A 3F7VC 2V1DA 3X2QC 2M7WA 2HR3A 1QVGU 3E8HA 2W6JG 1YITV 3IGAC 2EILB 5B1NA 2DWEC 5J9PC 4RAIA 4PELA 2WLHA 5HFLA 2YSUB 3EHBB 3OUSA 2EBOA 1AI6A 3OEEG 4PDVA 2HFEC 1BMFG 2OTLV 2HVJC 4JPRA 2EIJC 4MVSA 1RPOA 1ROPA 3OFNG 4TWKA 4X89A 4GX0A 2ZXWB 5B3SC 2JJ1G 1V55B 2R9RB 1I5YA 3VBBA 2ATKC 3CC7V 3W7TA 3F5WC 3ZIAG 3DTUB 3OR7C 4JF3A 2D3OW 1EZJA 3OGCC 5EBLC 4Z1MG 4MSWC 1G8MA 5BZBA 2PI4A 2QEXV 1OCRC 4MTOA 1L1FA 5IDJA 1K8AW 1JVMA 3STZC 3CCQV 2XAQA 3SYOA 2IH1C 2XAGA 3CP1A 3K9AA 3SPHA 5KUKA 1J95A 1FXVA 3ZMTA 4HYOA 3ASNC 4X88A 5CN0A 1CPYA 1NH2D 2MK3A 3I56V 1GTOA 4OXSA 3ZRSA 2P7TC 1PNMA 1JPXA 1DF4A 5L3DA 4XDKA 3ZMVA 3W7WA 4FPPA 4XDJA 3B8MA 3JCZA 4RO2A 3JD2A 4JYBA 2W6IG 4UVBA 1OCZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EC2 C;  4PA6 A;  4BW5 A;  4DXW A;  1XL4 A;  3F7Y C;  4P9P A;  4PDL A;  4QE9 A;  1G4Y B;  4PDM A;  2IH3 C;  5CBG A;  2Q69 A;  1QLE C;  2W0F C;  4QNH B;  1BL8 A;  4LP8 A;  2AHZ A;  3K03 A;  5CBH A;  1P7B A;  1R3L C;  2Y69 C;  3BEH A;  3VOU A;  2X6B A;  4GX2 A;  2QKS A;  4X8A A;  2NLJ C;  2Q67 A;  4MVQ A;  3RW0 A;  4GX5 A;  1K4D C;  2A79 B;  3KG2 A;  4J9Y B;  4R50 A;  3SYP A;  1ORQ C;  2ITC C;  3E83 A;  4MVZ A;  4PA3 A;  3SPC A;  2ZD9 A;  5EBW C;  2QTO A;  2WLN A;  4MTF A;  3RVZ A;  3R65 A;  4MVM A;  3T4D A;  3ABK C;  3EFF K;  3FB7 C;  3OUF A;  3GB7 C;  3LDD A;  4I9W A;  4CBC A;  3SPI A;  2DWD C;  3OR6 C;  5B1A C;  1XL6 A;  4P2Z A;  4J9Z B;  1V54 C;  4EKW A;  3LNM B;  2Q68 A;  3E86 A;  3AG2 C;  3AG4 C;  4WFH A;  3ASO C;  2DYR C;  2EIK C;  5KUM A;  4F4L A;  3SJQ C;  2KB1 A;  3LDC A;  3ZJZ A;  1K4C C;  3PJS K;  2HG5 C;  3K06 A;  4P9O A;  3X2Q C;  3F7V C;  2WLM A;  4G28 B;  4MS2 A;  5EBM C;  4LBE C;  2ITD C;  3E8H A;  3ABM C;  3IGA C;  2DWE C;  4R7C A;  1R3K C;  5J9P C;  1ZWI C;  4RAI A;  2DYS C;  5EK0 A;  3E8F A;  2EIM C;  2WLK A;  2WLH A;  4MVU A;  4R8C A;  3LDE A;  3SYA A;  2WLL A;  1R3J C;  4H33 A;  3SPG A;  4GX1 A;  4R6Z A;  1OCO C;  3FB8 C;  3TET A;  2WLJ A;  3K08 A;  4JTA B;  4PA4 A;  3OUS A;  2WLL B;  2A0L A;  2AHY A;  2YEV A;  2HFE C;  2HVK C;  2JK5 C;  4PDV A;  3SYC A;  5CBF A;  3E89 A;  2HVJ C;  4JTC B;  2EIJ C;  2WLI A;  4MVS A;  3ABL C;  2OCC C;  4TWK A;  4X89 A;  4GX0 A;  2HJF C;  3LUT B;  5B3S C;  3UM7 A;  2R9R B;  2BOC C;  2WLI B;  1R3I C;  3E8B A;  2ATK C;  4PDR A;  4RUF A;  2EIL C;  3F5W C;  3AG1 C;  3SYQ A;  3OR7 C;  4MVR A;  3UKM A;  2A9H A;  3OGC C;  4WFF A;  5EBL C;  3TCU A;  4RUE A;  4MSW C;  3IFX A;  4QE7 A;  5BZB A;  1OCR C;  4MTO A;  1JVM A;  3STZ C;  3RVY A;  5E1A C;  4LCU C;  3K0D A;  2H8P C;  4G27 B;  3SYO A;  4H37 A;  3T4Z A;  2IH1 C;  1OCC C;  5KUK A;  3HPL C;  3SPH A;  1J95 A;  3K0G A;  5IY5 C;  4JTD B;  4MVO A;  1M56 C;  4HYO A;  3ASN C;  1M57 C;  2X6C A;  4PA7 A;  5EC1 C;  3SPJ A;  3WG7 C;  4X88 A;  3T2M A;  2ZXW C;  4MW8 A;  4MW3 A;  3FB6 C;  2BOB C;  3STL C;  1V55 C;  4OXS A;  3ZRS A;  2P7T C;  2EIN C;  1LNQ A;  4XDK A;  4MTG A;  4KFM A;  4P30 A;  2K1E A;  4UUJ C;  3T1C A;  4WFE A;  4XDJ A;  4XDL A;  4PA9 A;  4ZBM A;  5B1B C;  1S5H C;  4RO2 A;  4WFG A;  3RBZ A;  1KKD A;  3AG3 C;  3E8G A;  4HZ3 A;  2Q6A A;  3JYC A;  3FB5 C;  2X6A A;  1OCZ C;  3K04 A; 
#chains in the Genus database with same CATH topology
 2V4D A;  4JYA B;  4IYH A;  5CBG A;  2XUM A;  5KA5 A;  4H0L B;  2X6B A;  1XRE A;  2GTS A;  4MVQ A;  3ETQ A;  1QR9 A;  5EBW C;  2WLN A;  2UXD B;  3CMA V;  3JAW B;  4K3A A;  4X20 B;  2YID A;  2Q7G A;  4YHH B;  1PM9 A;  2YDE A;  3L70 H;  3ASO C;  3CC2 V;  1XEQ A;  3ZJZ A;  1HNZ O;  3P32 A;  3WG7 B;  3K06 A;  2ZDI A;  4NXM B;  4G28 B;  1KD1 W;  4LBE C;  5F2V O;  1KMI Z;  1ZSP A;  5LOV A;  1G6U A;  4TT3 G;  5GON A;  4R7C A;  1GN6 A;  4O2B A;  4IIJ B;  5FPR A;  2Y4U A;  5H9C A;  3WB0 A;  3JD3 A;  4OX9 B;  1M93 A;  1FKA O;  4JTC B;  1FFX A;  4D7S A;  1NTZ H;  3ABL C;  2XAF A;  2JS3 A;  1S76 D;  3E8B A;  1YTF B;  1BGY H;  2R72 A;  1SA0 B;  1US6 A;  2CTR A;  2GV9 A;  3K3W A;  4WBN A;  1NT2 B;  1F4N A;  2IJK A;  1GM8 A;  3MDS A;  2Y48 A;  3DXR B;  4LCU C;  3CE2 A;  3NXS A;  4JTD B;  3QO7 A;  2CDY A;  4UCT A;  3ZN0 A;  1NVP D;  3PN1 A;  1DF5 A;  1FS0 G;  4AHC A;  1MSD A;  4JV5 B;  1S5H C;  1JMK C;  3UCS C;  5L3F A;  4K8Z A;  1JOY A;  5EZY B;  4PDL A;  4Q20 A;  1AI5 A;  5BXZ A;  3IJ4 A;  3CEI A;  4E4E A;  4QPJ A;  4LFC O;  4DV7 B;  1FXK B;  1R3L C;  5LMU O;  3BEH A;  4X9Q A;  3A2F A;  4X1K B;  1K4D C;  2O57 A;  1YJN V;  1K9M W;  1E1R G;  3R65 A;  2E75 B;  1B06 A;  2BSK B;  3OR6 C;  1N4C A;  1Q5O A;  1H8E G;  1R1B A;  2CGO A;  3ZHS A;  3K5N A;  3PJS K;  2IW5 A;  3CJH A;  5EBM C;  4H13 B;  4BAY A;  3ZRW B;  4D7T A;  1JJ2 U;  5LBQ A;  1U96 A;  4JI0 O;  1YEW A;  4DV4 O;  2IM9 A;  4B3R B;  3N2G A;  1BT8 A;  1R3J C;  3UQ8 A;  4O4I B;  4JGS A;  2ZR3 A;  2XAS A;  1O9H A;  4BIZ A;  1BZK A;  4ZI7 B;  2Y69 B;  1YIJ V;  5JVD B;  4TUY B;  3ETE A;  1VQ6 V;  5IE9 A;  1VQN V;  1GN3 A;  4FZ1 A;  1LR1 A;  1W0J G;  1SQV H;  2ZDI C;  4NVP A;  2A9H A;  3AK3 A;  4UCR A;  4JI8 B;  5IYC O;  2V7Q G;  3OAA G;  1ZL8 B;  2JGU A;  3ZHR A;  1CEZ A;  4LNU A;  5JWP A;  3OTO O;  1PP9 H;  5CA3 A;  3ZRX A;  3JAK B;  4JI2 B;  3ZHQ A;  5EYP A;  3SGI A;  4UCS A;  2GUZ B;  3T2M A;  3ZED A;  4F6E A;  1U97 A;  4UB8 Z;  3ML0 A;  1NR7 A;  3TJT A;  3M99 B;  4MTG A;  5FL7 G;  4DRX A;  2X0L A;  5IJ9 A;  1V54 B;  4LF9 O;  3F5T A;  4X64 O;  4DXW A;  3G6E V;  2JIZ G;  4LC1 A;  1XHX A;  2QM8 A;  1YCI A;  1T5E A;  1I0H A;  1DK1 A;  4GX2 A;  1Q43 A;  2QM4 A;  3JAL B;  2NLJ C;  3RW0 A;  4J7K A;  1QCE A;  2KSD A;  4ZKI A;  1KB9 F;  1SKV A;  3QTC A;  3AG1 B;  4MVZ A;  2Q7H A;  5LHG A;  5LGU A;  4UCV A;  2VQF B;  5LXT A;  1NVP B;  3LSQ A;  4ZOL B;  1AI4 A;  4GZR B;  3Q4H B;  4K0K O;  1DGS A;  5LMN B;  4DR3 B;  2RMK B;  2UU9 B;  4I7Z B;  4F4L A;  4FLY A;  3H01 A;  1OV9 A;  1O9G A;  3C3S A;  4O4L A;  5B3S B;  1VQ5 V;  1XMO B;  2ITD C;  2WPD G;  2CTW A;  1WPX A;  3CCU V;  2WLK A;  1XBL A;  5C8Y B;  4DR6 O;  4R6Z A;  3ZCC A;  4Q6G A;  2JS5 A;  1WA8 A;  3L72 H;  5IT9 N;  5KLV H;  4LF6 O;  1TAE A;  5KAI Z;  1BHB A;  2WLI A;  4JYY A;  2OCC C;  4U7O A;  3FX7 A;  4RUF A;  3SDL A;  1N32 B;  3E2E A;  1LUV A;  3CCM V;  1AJP A;  4WFF A;  1X59 A;  3SJA C;  4IT5 A;  2KQX A;  3CCJ V;  1OCZ B;  4I55 B;  1K5S A;  4H37 A;  1KKC A;  3K0G A;  4XBF A;  4X62 O;  4PA7 A;  2ZE7 A;  3WG7 C;  1I5X A;  1KUQ A;  2YIC A;  4FM2 A;  3HKD A;  2EIN C;  4O2A A;  3H1L H;  2RJZ A;  3EVK A;  2M6Y A;  4XDL A;  1Q90 D;  1Y74 B;  1I94 B;  2HJD A;  4HZ3 A;  3JYC A;  4YY3 O;  5DN6 G;  2BTQ B;  4HNA B;  1P84 F;  4FK5 C;  4QE9 A;  1G4Y B;  1N8R W;  2ZNJ A;  2OIG A;  3D36 C;  2QM7 A;  1SQF A;  1FJG B;  2ZIM A;  4B7K A;  4BWA A;  2HHH B;  1Y76 A;  4MVM A;  5CA0 B;  1YSC A;  4OPH A;  3KCX A;  1NR1 A;  4I9W A;  3SPI A;  4KHP B;  2L35 A;  2QKA A;  1BS3 A;  2EZP A;  3JSL A;  5CB4 B;  3FFQ A;  1XI1 A;  1S0V A;  3G6B A;  4ABM A;  3RFR A;  1Z5W A;  4DV0 B;  2H3O A;  2ZE6 A;  1F23 A;  2P67 A;  2V1D A;  2HR3 A;  4B7E A;  2W6J G;  4TV8 A;  1IXB A;  5B1N A;  3RWR D;  5J9P C;  4DV1 B;  4PEL A;  4JI5 B;  1XNQ B;  1A32 A;  5HFL A;  4YJ3 B;  1TUB A;  2Y4T A;  4PDV A;  1BMF G;  1BQ0 A;  2EIJ C;  1RPO A;  3CRM A;  4TWK A;  3N2K B;  2R9R B;  2P22 C;  1GAX A;  1UPG A;  2ZM6 B;  3W7T A;  4JF3 A;  1EZJ A;  3OGC C;  4Z1M G;  2UUA B;  1QNM A;  4MTO A;  2K9P A;  3CCQ V;  2AGA A;  2YIA A;  2HP8 A;  2XAQ A;  3SYO A;  3CP1 A;  2XAG A;  2Z0A A;  1RP3 B;  3T1H B;  4X88 A;  3CXH F;  5CN0 A;  1NH2 D;  2UXC O;  3U10 A;  2ZCE A;  2P7T C;  1PNM A;  1JPX A;  3KZI Z;  4IHJ A;  3IAY A;  4FFB B;  4PV1 B;  3B8M A;  1KBH A;  2E76 B;  3JD2 A;  4JYB A;  1ZUQ A;  4UVB A;  3JSN A;  1HNW B;  3CXC U;  4GT1 A;  2AHZ A;  1RM1 C;  2Y69 C;  1S3J A;  4DR4 B;  4KUM A;  4OPA A;  1W0K G;  4FZ0 A;  3SPC A;  3ABU A;  1VQK V;  5KHK A;  2OWO A;  2CUG A;  3K9S A;  4EKW A;  1KC8 W;  1PKX A;  1B3Q A;  2Y0P A;  1M56 B;  1K4C C;  5H6R A;  1BE3 H;  2P4K A;  1HR0 B;  4DV5 O;  1GMG A;  1IBM O;  4QPK A;  1P7G A;  1KU9 A;  1HDJ A;  5J2T A;  1QQC A;  4H44 B;  1NQT A;  5LOV B;  5GON B;  4H33 A;  3D8C A;  1URF A;  1FXH A;  1M90 W;  3DGE A;  3K08 A;  1QLE B;  2A0L A;  1AP6 A;  3SYC A;  1VF6 A;  2DOS A;  3RYC A;  1Z2G A;  3SJB C;  1FD9 A;  2WSS G;  1H38 A;  4NKG B;  2WA3 A;  1FFX B;  4PDR A;  1L8D A;  1GM9 A;  3AG1 C;  1ZTE A;  5CA1 A;  2B1I A;  3ZHU A;  3G71 V;  1EBO A;  4KXR A;  1VQ9 V;  1HNZ B;  4WBN B;  1PL4 A;  2EIK B;  2YC0 A;  4J10 A;  4NYK A;  4NTY A;  3D3I A;  3OE7 G;  1EN6 A;  2X6C A;  3BHP A;  4AI8 A;  4QJF B;  5JQG A;  4MW8 A;  3SR2 C;  5L3G A;  4MW3 A;  4O4H A;  2F93 B;  3ZHT A;  4JZ2 A;  1KKD A;  5LHH A;  3E8G A;  2Q6A A;  2WA4 A;  3HKB A;  2ODM A;  4PA6 A;  3JCU Z;  2JGD A;  4DUY O;  4CS2 A;  5CBH A;  4U3J A;  4E2L A;  4JAV A;  3FD9 A;  4J9Y B;  1AP5 A;  3T4D A;  2FB5 A;  5E79 Z;  1NH2 B;  1AJN A;  1OCR B;  3CS5 A;  4LF7 O;  1XL6 A;  4MTX A;  5H6Q A;  4J9Z B;  3RYF A;  2Q68 A;  2XAJ A;  1GO3 F;  4TV9 A;  4X1Y A;  3SJQ C;  3OGI B;  5FLX N;  4X65 O;  3I55 V;  4TQD A;  5BR8 O;  2OCC B;  2XOK G;  5C93 A;  4DR1 O;  3QO5 A;  5A2Q N;  1NJI W;  2L6L A;  2F95 B;  1R6K A;  2YIB A;  4UXN A;  5ITZ A;  2Q7E A;  3AK1 A;  3OTF A;  1QHT A;  1VQM V;  2WLL A;  3OEH G;  1XIL A;  3TET A;  1OCO C;  4JI3 O;  4LFC B;  4YIO A;  3N2G B;  5LMU B;  5LYJ A;  1QBZ A;  2QTS A;  2R9I A;  3K5L A;  4HAM A;  2JEU A;  4EEQ A;  4DR2 O;  1K33 A;  2EIN B;  4UVC A;  3OT7 A;  3OM3 B;  5H2F Z;  5L3B A;  1Q86 W;  3OW2 U;  2LGW A;  5KHI A;  2N74 A;  4CH4 A;  4RWU A;  1XNR O;  3W7X A;  4LFA O;  2X7R B;  4JI0 B;  1M57 C;  3OMA B;  4DV4 B;  2B1G A;  4LNU B;  1IVS A;  1VF6 C;  3FYI B;  3STL C;  5EYP B;  3IC7 A;  3JAR A;  1VQ4 V;  1KP3 A;  1VF5 B;  4LWS A;  4DRX B;  2LQT A;  2LW1 A;  5IJ9 B;  2Q69 A;  3FKS G;  1SER A;  1CP9 A;  2FML A;  4FLV A;  1K7D A;  5A9G A;  5IWA O;  3VOU A;  1K97 A;  3AK2 A;  4GX5 A;  5H5N A;  1VEW A;  2PZS A;  5B1O A;  4I50 A;  4F6R A;  3ABK C;  4LFB O;  1PL0 A;  5LXT B;  4P2Z A;  3OTO B;  3JAT A;  4LF8 O;  1YXB A;  4I4T B;  3LDC A;  2EIJ B;  2Q9L A;  2YXY A;  3LSS A;  1RPR A;  3L71 H;  3CCR V;  4PHZ A;  5LA6 A;  2WAM A;  4O4L B;  4JI4 O;  4LF9 B;  1K34 A;  4X64 B;  2HEP A;  3W7U A;  4GLX A;  1SZT A;  1HP8 A;  1JX9 A;  1IUR A;  3TK1 A;  1XHZ A;  1BQZ A;  2IU3 A;  4PA4 A;  4O4J A;  5CBF A;  4GKJ O;  1WA8 B;  1Q6I A;  1TVK A;  1Q8I A;  1H2M A;  3B2E E;  2BOC C;  2WLI B;  2QA4 V;  4LF5 O;  4K0K B;  4MVR A;  3ZN1 A;  2KG7 A;  3H1H H;  5GTI Z;  4YJ2 B;  3TCU A;  2JDI G;  2QWO B;  3RVY A;  3K0D A;  3R66 A;  2ZNI A;  1RM1 B;  4PI2 A;  1SQQ H;  1NTK H;  1EZV H;  1M56 C;  4GUN A;  2DJV A;  3CCV V;  2A7W A;  3A0R A;  3BFR A;  4DR6 B;  3K57 A;  4KL1 A;  5GW7 A;  1LNQ A;  4LF6 B;  2F4V O;  2Q5Z A;  4MT8 A;  4EB6 A;  4WFG A;  3AG3 C;  3HKD B;  2YI8 A;  3CCS V;  1NKD A;  4BW9 A;  4O2A B;  4DW1 A;  1N0N A;  4PDM A;  1IDS A;  3E22 A;  1QLE C;  3RT3 C;  5CMU A;  4X8A A;  1MMM A;  2A79 B;  3KG2 A;  1MSW D;  4UB6 Z;  1WAZ A;  2C2A A;  1Y76 B;  1CXZ B;  1SQP H;  1BSM A;  1QU7 A;  3LNM B;  2B5U A;  3E86 A;  4J7J A;  4IGG A;  4NB5 A;  4X62 B;  1THZ A;  2DYR C;  1SS3 A;  2EIK C;  3J7A U;  3G67 A;  2CGN A;  2EJ7 A;  4P9O A;  4FLW A;  1H2S B;  3IGA C;  3CHX A;  2DWE C;  3LNN A;  3RYH A;  4YY3 B;  3DXR A;  4J7Z A;  4TV8 B;  1VF7 A;  1ZLZ A;  1GRJ A;  2YSU B;  4JI6 O;  3EHB B;  2ARH A;  1D5N A;  3VQV A;  2OTL V;  2HVJ C;  2QR4 A;  1TUB B;  3OFN G;  2ETN A;  3A0H Z;  4J41 A;  3VBB A;  3F5W C;  3DTU B;  3OR7 C;  2NN4 A;  5EBL C;  2BTO A;  4MSW C;  1EN4 A;  3TXS A;  2QEX V;  1OCR C;  1L1F A;  1K8A W;  3BA8 A;  3STZ C;  4X1K A;  2IH1 C;  1J95 A;  1G1X B;  2CAZ C;  1FXV A;  4UCO A;  4GKK O;  3HKE A;  2JRI A;  3I56 V;  5KX5 A;  1GTO A;  2W0X A;  3ZRS A;  1DF4 A;  3BPZ A;  4XDK A;  3ZMV A;  5LP6 A;  4FPP A;  3L9D A;  1IBK O;  2W6I G;  2LO1 A;  4IHJ B;  2PGG A;  3ABT A;  3GWK C;  1TA8 A;  3M7M X;  2PTM A;  5LHI A;  3LSU A;  3B4S A;  2YIB D;  5B5E Z;  2ZT9 B;  1NBM G;  5DM6 V;  5J2U A;  2IBZ H;  2YXL A;  1MAB G;  1IX9 A;  4ZHQ A;  1PPJ H;  1JCH A;  1OCO B;  4WFH A;  2XND G;  2UXC B;  3O65 A;  3CME V;  2Q8V A;  4X66 O;  1KP2 A;  2WLM A;  2LP7 A;  5IYZ A;  3QO8 A;  4FFK A;  5DED A;  4Z1V A;  3ABM C;  3BVO A;  2DYS C;  3HR0 A;  1P49 A;  1VIB A;  3APQ A;  3G4S V;  1JQ0 A;  3SYA A;  5IJ0 B;  5J2T B;  3DSQ A;  2GUZ A;  2HVK C;  1Y66 A;  4DR3 O;  4LF4 O;  1L0N H;  4UV9 A;  1M57 B;  2MW2 B;  1BCC H;  1SQB H;  2Q0A A;  3CB2 A;  1R3I C;  4U7N A;  1J5E O;  3SYQ A;  1HNX O;  1YZB A;  2DN9 A;  1N0J A;  1XQ8 A;  3L74 H;  3AG4 B;  5CA1 B;  1K3E A;  4CC6 A;  4N23 A;  5E1A C;  3ZMU A;  4DV5 B;  3JAL A;  4JI1 O;  1IBM B;  3ZRV A;  4ASU G;  2CH7 A;  2XHB A;  1W59 A;  4WFA V;  1W2B U;  1F4M A;  1NTM H;  5EC1 C;  4PJ0 Z;  1XOU A;  3RYI A;  4FM0 A;  3ABK B;  5JQG B;  1K5Q A;  1Y67 A;  5IYD O;  4DV3 O;  1ZX3 A;  4O4H B;  3ZX6 A;  4PA9 A;  4DUZ O;  4EFB A;  2OTJ V;  2Q0O C;  3FB5 C;  1AR5 A;  5KHH A;  1D2D A;  3MHH C;  4DV2 O;  3H1K H;  3HKB B;  2GBO A;  2DW4 A;  3CRR A;  2AZ0 A;  1COW G;  2JGD B;  4U3J B;  1WPB A;  2IU0 A;  2ZD9 A;  3K79 A;  3OMI B;  1NS1 A;  3QF7 A;  3GB7 C;  1GKF A;  5BMV A;  4D6T H;  5LP6 C;  3ZHV A;  3K59 A;  3BY6 A;  5KUM A;  3L73 H;  3M8A A;  3SJC C;  1YJW V;  2R9A A;  4TV9 B;  5KMG A;  4X1Y B;  4JI7 O;  5KAF Z;  1R6T A;  2H94 A;  3P30 A;  1GN4 A;  4MVU A;  1PD3 A;  4UV8 A;  2ILM A;  5ITZ B;  4DUY B;  3AEI A;  3SPG A;  1Q81 W;  2F66 C;  2WLJ A;  3P3P A;  1WP7 A;  2NR5 A;  3K5M A;  4DK1 A;  4JTA B;  2WLL B;  2WWW A;  2AW9 A;  3FYE B;  2YEV A;  4DV6 O;  1AB3 A;  4DR5 O;  2RNB A;  2BE3 A;  3E35 A;  4B08 A;  3JAM N;  1GM7 A;  5LYJ B;  1MOF A;  3HKC A;  2Q73 A;  1R73 A;  3A8T A;  3LUT B;  2A06 H;  4BIU A;  1VMG A;  3UM7 A;  4ICG A;  4LF7 B;  4K8X A;  4B3M O;  3WU2 Z;  3UKM A;  3CPW U;  3AG3 B;  4QE7 A;  3B8N A;  3T1Y O;  2IJI A;  1H2K A;  2JJ2 G;  4X65 B;  5BR8 B;  4DR1 B;  4O2B B;  4G27 B;  3VQY A;  2R70 A;  3T4Z A;  1AR1 B;  1TGO A;  1Z5V A;  5IY5 C;  1IXM A;  3UT5 A;  2OCH A;  3JAS A;  3SPJ A;  2UUC O;  1MG1 A;  3BCC H;  3VQX A;  2DE0 X;  5FPO A;  4JI3 B;  5LL6 Y;  1AI7 A;  4UUJ C;  2ZIN A;  5D5Q A;  2GSM B;  2UUA O;  3JAR B;  2E74 B;  2DYR B;  4P9P A;  4W4K A;  4QNH B;  5JH7 A;  3THO A;  4DR2 B;  2DQ3 A;  4LWS B;  4KP4 A;  2ADP A;  3FAV A;  2LJ2 A;  2DQ0 A;  5L3E A;  1UFI A;  2FTK A;  1RSO A;  3J80 N;  4FMT A;  4UVA A;  3LDD A;  5B1A C;  4DK0 A;  5L3C A;  1XNR B;  2RN9 A;  4LFA B;  4I50 B;  2YS8 A;  3BA9 A;  4F6R B;  2P5O A;  3NR7 A;  4I0X A;  1Q3E A;  4FLZ A;  1VQP V;  3CX5 F;  3JAT B;  1SC5 B;  1N34 O;  1FFT B;  2NNU A;  3IC9 A;  1H2N A;  1SQX H;  2ZR2 A;  3LDE A;  1JR9 A;  2VQE O;  2RDC A;  3JD1 A;  2Z5U A;  5LA6 B;  4DR7 O;  5B66 Z;  5IWA B;  1N33 O;  2FYU H;  3C3T A;  2LFS A;  1D5A A;  1XUQ A;  4JYC A;  5JJJ B;  4DO2 A;  1VQ7 V;  1JFF A;  3H1I H;  1NI8 A;  2GTA A;  4O4J B;  2OT5 A;  1SRY A;  4LFB B;  2HJF C;  4X1I A;  2EZO A;  3CRC A;  4B3S O;  1TVK B;  3JD4 A;  2D2C B;  2BCC H;  3CRA A;  4LF8 B;  1XDC A;  3CJH B;  4JAA A;  2KKW A;  2QE7 G;  3U11 A;  3AG2 B;  3QNE A;  2KG7 B;  2FL4 A;  4NXN O;  2H8P C;  3WFV A;  3CYO A;  1OCC C;  1SES A;  3HPL C;  1IBL O;  3MHS C;  2ZQM A;  3EXA A;  1KQS U;  1MZF A;  2AZ2 A;  2DMX A;  4JAU A;  2E5L O;  4JI4 B;  2PYJ A;  4K35 A;  3DC6 A;  3JD0 A;  4FM1 A;  4JZG A;  1K73 W;  2P06 A;  5D5P A;  1Y4M A;  4P30 A;  4TOI A;  5B1B C;  3RBZ A;  2QWQ B;  1WB8 A;  4GKJ B;  2PF4 E;  1QLN A;  2CK3 G;  1EFR G;  4EB6 B;  4FVM A;  3CCE V;  2YI9 A;  4LP8 A;  2UXB O;  2GDS A;  1TUE B;  4LF5 B;  3MAQ A;  2UXX A;  3E22 B;  5K1X A;  3ABM B;  2XAH A;  1VQ8 V;  4R50 A;  3SYP A;  3O9O A;  2DYS B;  4MTF A;  1QR8 A;  2ZE5 A;  3C90 A;  1KYO F;  3UO2 A;  4AQY O;  4CBC A;  1WJZ A;  1NZ6 A;  3AG4 C;  2FKX A;  3ZMS A;  2KB1 A;  2UUB O;  3AG7 A;  2HG5 C;  1VQO V;  1HWY A;  3F7V C;  1YIT V;  2F4V B;  4DW0 A;  4RAI A;  4C7U A;  1XMQ O;  2A3Q A;  1I7F A;  1N36 O;  2VS0 A;  1ZAU A;  3RYH B;  4B3T O;  3OEE G;  2HFE C;  1VP7 A;  4JYA O;  1WN7 A;  4A5U B;  1I5Y A;  2E3C A;  3CC7 V;  3H9V A;  2VWJ A;  2VRZ A;  2D3O W;  1G8M A;  1NU1 H;  5FNV A;  5BZB A;  2PI4 A;  3GVM A;  5IDJ A;  4CS3 A;  2UXD O;  2N04 A;  3ZBH A;  1GN2 A;  3N27 A;  4YHH O;  4HYO A;  4OXS A;  3HKE B;  4JI6 B;  4NXM O;  3W7W A;  4CC5 A;  5KX5 B;  1IZ3 A;  3WB1 A;  4XDJ A;  2YUA A;  3ZS8 C;  2YXH A;  3JCZ A;  2QWP B;  3I5D A;  5LP6 B;  3F7Y C;  2EJR A;  1R6N A;  1M4U A;  2IH3 C;  5LGT A;  2IJH A;  1P7B A;  4OX9 O;  3U0Z A;  2Q67 A;  2QDO A;  2JEX A;  2Z3Y A;  3JAW A;  3E83 A;  4PA3 A;  4X20 A;  3FB7 C;  5K1P A;  4I5S A;  2XTA A;  1P4R A;  4QIW F;  5J2U B;  3MD0 A;  4GKK B;  4ZHQ B;  5KHJ A;  1PNK A;  3RGB A;  1YDX A;  2AXT Z;  1Q6U A;  3BAB A;  2IJJ A;  1S72 V;  1FAF A;  4IIJ A;  4LR3 A;  4RQE A;  1IBK B;  1Q6H A;  1R3K C;  1ZWI C;  5IYZ B;  5EK0 A;  2GHY A;  2EIM C;  4R8C A;  1OJH A;  4CS4 A;  2ADQ B;  4DYL A;  3B77 A;  3W7S A;  1M9N A;  3D36 A;  1WP8 A;  4JV5 O;  4YIP A;  1PNL A;  4WFB V;  3L75 H;  2P6J A;  5IY5 B;  2LFR A;  4OGQ B;  3HB3 B;  4L8J A;  1S77 D;  1SA0 A;  4GCZ A;  5TIS Z;  1K92 A;  4DV7 O;  1PV0 A;  2QGN A;  1ENV A;  2EIL C;  4UCU A;  3S3W A;  5EIB C;  1DLB A;  2ZE8 A;  5IYB O;  3J81 N;  2JVD A;  3KKY A;  4X66 B;  4BR6 A;  1MA1 A;  2P90 A;  3K5O A;  3X2Q B;  2CTQ A;  4NTW A;  2CH7 B;  2ZXW C;  4UFZ A;  1EM1 A;  1V55 C;  4BIO A;  2N05 A;  1E79 G;  1AJQ A;  1OHH G;  3H1J H;  2K1E A;  3T1C A;  4WFE A;  4ZBM A;  3RYI B;  4I4T A;  5EZY A;  5B1A B;  1B6Q A;  3QG5 A;  2HLD G;  4LF4 B;  2X6A A;  4B3R O;  1FXK A;  1L0L H;  4FIP C;  4NR1 A;  2P4V A;  1J5E B;  3TXQ A;  1HNX B;  2PYL A;  4LH7 A;  3ETD A;  1JA8 A;  4J80 A;  3KCY A;  2BSK A;  2QTO A;  5JCO A;  3RVZ A;  2QWR B;  3TGU H;  2F43 G;  1FPO A;  3EFF K;  3OUF A;  4FLT A;  1X4T A;  4JI1 B;  3AG2 C;  4CZZ A;  4JI8 O;  5DEC A;  3ZRW A;  2PY5 A;  3ASN B;  5BMV B;  5BY1 A;  1ARO P;  2QSA A;  1FYJ A;  4DV3 B;  4YJ2 A;  1H2G A;  4DUZ B;  2CTP A;  4JI2 O;  4AIL C;  5KMG B;  4O4I A;  3E8F A;  1YF2 A;  3ICX A;  4DV2 B;  1Q82 W;  1SQG A;  3WB2 A;  4ZI7 A;  3QVN A;  5JVD A;  4TUY A;  1OCC B;  2AHY A;  2JK5 C;  1YI2 V;  3E89 A;  2UXN A;  2YEV B;  5LGN A;  1F51 A;  5AG2 A;  3HKC B;  4CH3 A;  3ZMZ A;  5B1B B;  1ZL8 A;  4J11 A;  2LW7 A;  2VQF O;  3ASO B;  3JAK A;  3B40 A;  1SET A;  3RN4 A;  4JI7 B;  5LMN O;  1AIL A;  2UU9 O;  2F23 A;  2Q4P A;  4FJC C;  1LUW A;  1V9P A;  3RYC B;  3UT5 B;  4WCE V;  3JAS B;  3DC5 A;  4KFM A;  1XMO O;  4J42 A;  2G38 A;  4DV6 B;  3CD6 V;  1YVW A;  1Q7Y W;  4DR5 B;  2QWN B;  4PD4 F;  5EC2 C;  4BW5 A;  3CCL V;  1MNG A;  4PI0 A;  3OD4 A;  2W0F C;  3ABL B;  2B9Z A;  1BHA A;  2RQ6 A;  1H2L A;  4B3M B;  5EIB D;  2RCV A;  5JH7 B;  2PUS A;  3APO A;  2ITC C;  3T1Y B;  1WLE A;  4ZOL A;  2ZKO A;  3Q4H A;  1YHQ V;  4Z2W A;  3FAV B;  1EN5 A;  5KA6 A;  1N32 O;  4IYI A;  1RSO B;  1VQL V;  1SF9 A;  2F1M A;  1VAR A;  2UUC B;  1UJW B;  3CC4 V;  1AVM A;  2VWK A;  4I0X B;  2HKO A;  4I9Q A;  1FXK C;  4MS2 A;  2XT9 A;  5C8Y A;  4NTX A;  3ETG A;  4YXW G;  4GYC B;  1M1K W;  4GX1 A;  3FB8 C;  5JCO C;  2PI5 A;  4U3F H;  3G80 A;  1OZ0 A;  1I94 O;  5GTH Z;  3VQW A;  3RYF B;  4L87 A;  1H8H G;  1S5J A;  4IL6 Z;  4G2K A;  3CWB H;  2ZIO A;  1JFF B;  3S3X A;  1DTO A;  1FJG O;  4X1I B;  4I55 A;  4RUE A;  2HHH O;  3IFX A;  4WF9 V;  4EFE A;  1N34 B;  3OMN B;  3UO3 A;  4KHP O;  5HFM A;  4N21 A;  5JJN B;  4MVO A;  2LGQ A;  3FB6 C;  1WB7 A;  2VQE B;  2BOB C;  4DV0 O;  1Y74 A;  1E1Q G;  3K58 A;  2EUL A;  4DR7 B;  3GWO A;  1HW7 A;  3P3N A;  2BTQ A;  4HNA A;  1N33 B;  4CH6 A;  4JAS A;  4DV1 O;  3K04 A;  1YJ9 V;  5JJE B;  4JI5 O;  1XNQ O;  1XL4 A;  4LH6 A;  1BL8 A;  4B3S B;  3K03 A;  1GK9 A;  2OIE A;  1KEC A;  4TSF G;  2QKS A;  1I08 A;  3BRC A;  5CA0 A;  1F7Y A;  5IJ0 A;  1ORQ C;  1WNS A;  2EIM B;  3BAA A;  4FLX A;  4NXN B;  5CB4 A;  2DWD C;  4HBN A;  1IBL B;  2ZM6 O;  1V54 C;  1B04 A;  2E5L B;  4TQF A;  1RFY A;  1QVF U;  1S5L Z;  1YTF D;  4RQF A;  3X2Q C;  3CSX A;  2M7W A;  2CE4 A;  1QVG U;  3E8H A;  1SZX A;  2EIL B;  4YJ3 A;  3T1H O;  2WLH A;  1JJO A;  2UXB B;  3CRQ A;  3D3Q A;  3OUS A;  5KHG A;  2EX3 A;  2EBO A;  1AI6 A;  3A0B Z;  3N2K A;  4QGP A;  4JPR A;  4MVS A;  1HNW O;  1ROP A;  2Y0I A;  4CH5 A;  4X89 A;  4GX0 A;  2ZXW B;  5B3S C;  2JJ1 G;  4AQY B;  1V55 B;  1Y6X A;  2ATK C;  3ZIA G;  4DR4 O;  2OYQ A;  1AR4 A;  2UUB B;  4ZIB A;  1JVM A;  5FNV B;  4FLU A;  3K9A A;  5KUK A;  3SPH A;  3B09 A;  4W4L A;  3ZMT A;  3ASN C;  1XMQ B;  1M5I A;  2QJ1 A;  1CPY A;  1MZE A;  2MK3 A;  1N36 B;  4FFB A;  1GH6 A;  4B3T B;  1HR0 O;  5L3D A;  4RO2 A;  2QKC A;  1OCZ C; 
#chains in the Genus database with same CATH homology
 3ABT A;  3F7Y C;  2EJR A;  3CXC U;  1R6N A;  4GT1 A;  5LGT A;  2IH3 C;  5CBG A;  2IJH A;  2AHZ A;  5KA5 A;  1RM1 C;  1P7B A;  2Y69 C;  1S3J A;  2X6B A;  5LHI A;  4KUM A;  2Q67 A;  4MVQ A;  1W0K G;  2JEX A;  2Z3Y A;  1QR9 A;  1NBM G;  3E83 A;  3ABU A;  4PA3 A;  3SPC A;  5EBW C;  2WLN A;  5DM6 V;  3FB7 C;  3CMA V;  1MAB G;  1VQK V;  4I5S A;  1JCH A;  1OCO B;  1P4R A;  4QIW F;  4EKW A;  3MD0 A;  1KC8 W;  4WFH A;  1PKX A;  2XND G;  3ASO C;  1PNK A;  3CC2 V;  3ZJZ A;  1M56 B;  1K4C C;  5H6R A;  3P32 A;  3CME V;  3WG7 B;  3K06 A;  2ZDI A;  1KP2 A;  2WLM A;  2LP7 A;  1GMG A;  4G28 B;  3QO8 A;  1KD1 W;  4QPK A;  2IJJ A;  4LBE C;  1S72 V;  3ABM C;  4RQE A;  4TT3 G;  4R7C A;  1R3K C;  1ZWI C;  2DYS C;  5EK0 A;  2GHY A;  1NQT A;  2EIM C;  4R8C A;  3G4S V;  1JQ0 A;  3SYA A;  3W7S A;  3B77 A;  4H33 A;  1M9N A;  5H9C A;  3D36 A;  1FXH A;  1M90 W;  3JD3 A;  3DGE A;  3K08 A;  1QLE B;  2A0L A;  1PNL A;  4WFB V;  3SYC A;  2HVK C;  2P6J A;  1Y66 A;  2LFR A;  5IY5 B;  4JTC B;  4UV9 A;  1M57 B;  3ABL C;  2XAF A;  3HB3 B;  1H38 A;  2WSS G;  1S77 D;  4GCZ A;  1K92 A;  1S76 D;  1R3I C;  3E8B A;  4PDR A;  4U7N A;  1YTF B;  1GM9 A;  1ENV A;  2EIL C;  3AG1 C;  3SYQ A;  1DLB A;  3K3W A;  2B1I A;  3G71 V;  1EBO A;  5IYB O;  1VQ9 V;  1F4N A;  2IJK A;  3AG4 B;  1GM8 A;  1K3E A;  2Y48 A;  4N23 A;  4LCU C;  2EIK B;  5E1A C;  3ZMU A;  2P90 A;  3ZRV A;  4ASU G;  3X2Q B;  3NXS A;  4JTD B;  3QO7 A;  3D3I A;  4WFA V;  3OE7 G;  1W2B U;  1F4M A;  3ZN0 A;  2X6C A;  5EC1 C;  4QJF B;  1NVP D;  2ZXW C;  4MW8 A;  5L3G A;  4MW3 A;  1V55 C;  1DF5 A;  1FS0 G;  1E79 G;  1AJQ A;  1OHH G;  3ABK B;  1K5Q A;  5IYD O;  2K1E A;  3T1C A;  4WFE A;  4ZBM A;  4PA9 A;  1KKD A;  5B1A B;  1S5H C;  5LHH A;  1B6Q A;  3E8G A;  2OTJ V;  2HLD G;  2Q6A A;  3FB5 C;  5L3F A;  2X6A A;  1JOY A;  1FXK A;  4PA6 A;  4PDL A;  4Q20 A;  1AI5 A;  3MHH C;  4FIP C;  4QPJ A;  2DW4 A;  5CBH A;  1FXK B;  1R3L C;  3BEH A;  4E2L A;  1COW G;  4JAV A;  3ETD A;  1K4D C;  4J9Y B;  1YJN V;  2IU0 A;  1K9M W;  2ZD9 A;  2QTO A;  3K79 A;  1E1R G;  3OMI B;  3RVZ A;  3R65 A;  3T4D A;  2F43 G;  3EFF K;  3OUF A;  1AJN A;  3GB7 C;  1GKF A;  1NH2 B;  1OCR B;  3OR6 C;  1XL6 A;  4MTX A;  5H6Q A;  4J9Z B;  2Q68 A;  3AG2 C;  4CZZ A;  2XAJ A;  1GO3 F;  1H8E G;  3BY6 A;  5KUM A;  3SJQ C;  3ZRW A;  3PJS K;  3I55 V;  3ASN B;  2OCC B;  1YJW V;  2XOK G;  5C93 A;  2IW5 A;  3QO5 A;  1ARO P;  1NJI W;  5EBM C;  4BAY A;  1H2G A;  3ZRW B;  1R6K A;  4UXN A;  1JJ2 U;  2H94 A;  5LBQ A;  3P30 A;  3E8F A;  4MVU A;  1PD3 A;  4UV8 A;  1VQM V;  2WLL A;  3OEH G;  1R3J C;  3AEI A;  3SPG A;  1Q81 W;  3TET A;  1OCO C;  1Q82 W;  2WLJ A;  4JGS A;  2ZR3 A;  4JTA B;  1QBZ A;  2WLL B;  1OCC B;  2WWW A;  2XAS A;  2AHY A;  3FYE B;  2R9I A;  2YEV A;  4BIZ A;  2JK5 C;  1YI2 V;  2Y69 B;  3E89 A;  3E35 A;  4HAM A;  1YIJ V;  1GM7 A;  2JEU A;  1MOF A;  2UXN A;  3ETE A;  2YEV B;  1R73 A;  4BIU A;  3LUT B;  1VQ6 V;  3UM7 A;  1VQN V;  5LGN A;  1K33 A;  1F51 A;  1W0J G;  2ZDI C;  2EIN B;  3ZMZ A;  3UKM A;  2A9H A;  4UVC A;  5B1B B;  3CPW U;  3OM3 B;  5L3B A;  3AG3 B;  4QE7 A;  3B8N A;  2IJI A;  5IYC O;  1Q86 W;  2JJ2 G;  3OW2 U;  2V7Q G;  3OAA G;  3ASO B;  4G27 B;  1SET A;  3T4Z A;  1AR1 B;  1CEZ A;  3W7X A;  5IY5 C;  1IXM A;  2X7R B;  5CA3 A;  3ZRX A;  1M57 C;  3OMA B;  3SPJ A;  2B1G A;  3T2M A;  1MG1 A;  4FJC C;  3FYI B;  3STL C;  3ML0 A;  4WCE V;  1NR7 A;  1AI7 A;  3IC7 A;  3M99 B;  4MTG A;  4KFM A;  4UUJ C;  5FL7 G;  2X0L A;  1VQ4 V;  3CD6 V;  1KP3 A;  1V54 B;  1Q7Y W;  2GSM B;  5EC2 C;  4BW5 A;  2DYR B;  4P9P A;  4DXW A;  3CCL V;  3G6E V;  2JIZ G;  2Q69 A;  3FKS G;  2W0F C;  4QNH B;  1SER A;  3ABL B;  1CP9 A;  4LC1 A;  2QM8 A;  1BHA A;  1K7D A;  2DQ3 A;  3VOU A;  4GX2 A;  4KP4 A;  1K97 A;  2NLJ C;  3RW0 A;  1QCE A;  4GX5 A;  4ZKI A;  2ITC C;  3AG1 B;  4MVZ A;  1WLE A;  5LHG A;  5LGU A;  2DQ0 A;  1NVP B;  5L3E A;  3LSQ A;  1YHQ V;  5B1O A;  2FTK A;  3ABK C;  4FMT A;  1PL0 A;  4UVA A;  3LDD A;  5KA6 A;  5B1A C;  5L3C A;  1AI4 A;  4P2Z A;  1VQL V;  1VQP V;  4F4L A;  3LDC A;  2EIJ B;  1UJW B;  3CC4 V;  3H01 A;  2HKO A;  1FFT B;  1FXK C;  3LSS A;  1RPR A;  2NNU A;  5B3S B;  4MS2 A;  1VQ5 V;  2ITD C;  2WPD G;  3CCR V;  2WAM A;  1WPX A;  1K34 A;  3ETG A;  3CCU V;  2WLK A;  2ZR2 A;  3LDE A;  4YXW G;  3W7U A;  3JD1 A;  2Z5U A;  1M1K W;  4GX1 A;  4R6Z A;  3FB8 C;  1SZT A;  3ZCC A;  2PI5 A;  1JX9 A;  3TK1 A;  2IU3 A;  4PA4 A;  1OZ0 A;  5CBF A;  2LFS A;  1BHB A;  4JYC A;  2WLI A;  2OCC C;  4U7O A;  4DO2 A;  1VQ7 V;  4L87 A;  1H8H G;  2OT5 A;  1SRY A;  2HJF C;  2EZO A;  4G2K A;  3JD4 A;  2BOC C;  2WLI B;  4RUF A;  2QA4 V;  3E2E A;  3CCM V;  1AJP A;  1DTO A;  4MVR A;  3ZN1 A;  4WFF A;  3TCU A;  4RUE A;  3IFX A;  2QE7 G;  3CCJ V;  2JDI G;  3AG2 B;  1OCZ B;  3QNE A;  4WF9 V;  3RVY A;  3K0D A;  2H8P C;  3OMN B;  1K5S A;  3WFV A;  4H37 A;  3CYO A;  1OCC C;  1SES A;  3HPL C;  3MHS C;  1RM1 B;  5HFM A;  3K0G A;  4XBF A;  4N21 A;  2ZQM A;  4MVO A;  1KQS U;  1M56 C;  4JAU A;  4PA7 A;  3CCV V;  3WG7 C;  1I5X A;  3A0R A;  3JD0 A;  3FB6 C;  2BOB C;  1K73 W;  1E1Q G;  5GW7 A;  2EIN C;  1LNQ A;  3GWO A;  1Y4M A;  4P30 A;  5B1B C;  4MT8 A;  4XDL A;  3RBZ A;  4WFG A;  3AG3 C;  4JAS A;  4HZ3 A;  3CCS V;  3JYC A;  1NKD A;  5DN6 G;  3K04 A;  1QLN A;  1YJ9 V;  2CK3 G;  1EFR G;  1XL4 A;  4FK5 C;  4QE9 A;  1G4Y B;  4PDM A;  1N8R W;  3CCE V;  1QLE C;  1BL8 A;  4LP8 A;  3K03 A;  1GK9 A;  1TUE B;  2QM7 A;  1KEC A;  4TSF G;  5CMU A;  2UXX A;  2QKS A;  4X8A A;  3ABM B;  2A79 B;  2XAH A;  3KG2 A;  1VQ8 V;  4R50 A;  3SYP A;  1ORQ C;  1MSW D;  2DYS B;  4MTF A;  2C2A A;  2EIM B;  1QR8 A;  4MVM A;  1YSC A;  4CBC A;  1NR1 A;  4I9W A;  3SPI A;  2DWD C;  1V54 C;  2EZP A;  3LNM B;  2B5U A;  3E86 A;  3AG4 C;  1THZ A;  2DYR C;  1S0V A;  2EIK C;  3ZMS A;  2KB1 A;  1QVF U;  2HG5 C;  1VQO V;  1YTF D;  4RQF A;  1HWY A;  4P9O A;  1F23 A;  2P67 A;  3F7V C;  2V1D A;  3X2Q C;  2M7W A;  2HR3 A;  1QVG U;  3E8H A;  2W6J G;  1YIT V;  3IGA C;  2EIL B;  5B1N A;  2DWE C;  5J9P C;  4RAI A;  4PEL A;  2WLH A;  5HFL A;  2YSU B;  3EHB B;  3OUS A;  2EBO A;  1AI6 A;  3OEE G;  4PDV A;  2HFE C;  1BMF G;  2OTL V;  2HVJ C;  4JPR A;  2EIJ C;  4MVS A;  1RPO A;  1ROP A;  3OFN G;  4TWK A;  4X89 A;  4GX0 A;  2ZXW B;  5B3S C;  2JJ1 G;  1V55 B;  2R9R B;  1I5Y A;  3VBB A;  2ATK C;  3CC7 V;  3W7T A;  3F5W C;  3ZIA G;  3DTU B;  3OR7 C;  4JF3 A;  2D3O W;  1EZJ A;  3OGC C;  5EBL C;  4Z1M G;  4MSW C;  1G8M A;  5BZB A;  2PI4 A;  2QEX V;  1OCR C;  4MTO A;  1L1F A;  5IDJ A;  1K8A W;  1JVM A;  3STZ C;  3CCQ V;  2XAQ A;  3SYO A;  2IH1 C;  2XAG A;  3CP1 A;  3K9A A;  3SPH A;  5KUK A;  1J95 A;  1FXV A;  3ZMT A;  4HYO A;  3ASN C;  4X88 A;  5CN0 A;  1CPY A;  1NH2 D;  2MK3 A;  3I56 V;  1GTO A;  4OXS A;  3ZRS A;  2P7T C;  1PNM A;  1JPX A;  1DF4 A;  5L3D A;  4XDK A;  3ZMV A;  3W7W A;  4FPP A;  4XDJ A;  3B8M A;  3JCZ A;  4RO2 A;  3JD2 A;  4JYB A;  2W6I G;  4UVB A;  1OCZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...