1R3JA

Potassium channel kcsa-fab complex in high concentration of tl+
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab fragment light chain
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3jA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3jA01
4PJ7F 1DBAL 4MD5B 3ARED 1RZIA 4WCYH 5BMFH 5I1AB 3V6FB 3DMMD 2NY2D 5D1QD 1H15B 2FLRT 2ZUUA 1VDGA 1FL6A 3KDMA 5KSUB 3ES6A 4K7PL 4C58B 3HG1B 3PP3K 2AGJH 4KAQL 1A7OH 2CMRL 3SKMB 2NMSA 1Y6MR 5F6IC 3D69A 1RFDH 4POZD 4NQCE 5GZND 5LQBH 3GSRB 1FO0A 1C5DB 2VUOA 3LCYA 5C0IA 3P0VH 1PEZA 4LHUA 4IHOB 1I7UA 2DLFH 1O7SA 2YBRB 4M6OH 1F4YH 5DR5H 4ZFZB 3VXSD 1RZFL 2BXZA 4U6HB 3FQXB 3ZE1E 3UBXA 3LB6D 4GLRI 5AYUH 5BXFB 4K8RC 5DJ6B 4JM4H 3GRWA 1CBVL 1U8JA 4HKBB 5HGAA 4MB3A 2A6IA 3INUH 2BNUA 3EYVA 1G7IA 3MRHA 2FJHB 4KI5E 1PSKH 1LO4L 2PNDA 2OTWA 1FNEA 4D94A 3T3PE 5DEFB 1QLFA 2JCCA 2APTA 4NZRH 5DHYA 3FQNB 1BQHB 1BM3L 4DGIL 1T21B 1PKQB 2PYEB 3I02B 3FRPG 4HPYH 3BXNA 4MXVE 1KJ2L 4XC3L 2WANA 5C0CE 3O8XC 1FFNB 4D0BB 4UQ2A 5C0ND 1YC8A 3I50H 1QA9A 2YXMA 4F8QA 5IMMA 4NQSA 2VC2L 4APQD 1AQKL 1K8DA 5FO8A 3GSVB 4UZGA 3FTGA 3R1GH 4XAKD 1UB5B 3O11A 4ONOA 4CJ1A 4XPFH 2DQIL 1CD1A 3ZKMD 4WI5A 4NIKB 1RUPL 2X4NA 2XRAL 1FIEA 2AJUH 1R3KB 2CO7B 1FZMB 2WP3T 5HHMB 5DSCB 2H45A 4JLRA 4U1HA 1JWSA 3KR3L 4QHUB 5JIIA 5LGHL 5HYQB 1AE6H 4OQ1A 3O2WH 3A6BL 1S9WA 1A64A 1WBXA 3C6LC 3VRLE 4LVOB 1WT5C 4MHHG 4PRIB 5D7KE 5FUOH 4OF6A 3RU8L 3O3AB 4QGTA 3L7EB 1I7ZB 1FP5A 1A6UH 3QIUC 4AM0B 5T5NF 4JANA 1WVZA 3RWDB 3RVXC 5FA3B 4HLZG 3LDBC 3QRGL 1FG9C 3QHFH 1AO7B 4OZHA 2OL3B 2B8OT 2NY4C 2Y06H 3E6FA 1YEHL 3TVMC 3LKPB 3T09A 2FIKB 1EHNA 3HFMH 4LCWD 3AB0B 2YPKB 3SKJH 5ID0B 2XZCL 4HPOH 5DD0H 2OP4H 5DWUH 4KGLA 4PJ8D 1JWMA 3S5LA 2DTML 4OAWB 3SJVB 3UMTA 2P5WD 1DSFL 3I9GL 3VFMB 5BV7B 1J7VR 1IZKA 1CK0L 4P46D 3DI3B 4Y4HD 4F3FB 3V7AG 2HG5A 4Q58C 1BQUA 2P7TB 3V7AE 3MRDB 3L3HA 5J11B 4J6RH 2F53A 4XPGH 1WCBB 5I1KL 3U0TA 1Q8MA 2IAMD 1OLZA 1OPGL 3S37H 4TVPL 4ZXBA 3CH1B 1ZLVK 3OJDA 5ESQB 4WTXA 1XEDA 4GRLA 1A7QH 1TQBB 3BP6B 3QUZB 5ITFB 1B4JL 3PWUA 4JFFD 1QVOB 3EOAA 4PBXA 2QR0A 4PB9H 4MD4A 1CFQA 4PRHD 3Q2CA 2HLAB 4C55A 1IKFL 3ET9F 3S98A 5E5UB 2BJML 4URTB 1KELH 4OGXL 1UACH 1JYVA 3I3EA 5D71H 4DWHA 5EZJB 1T1XA 3QI9C 1CDIA 4R6UA 1GRWA 1T22B 4WW1B 4TULL 3ULVE 1UZ6F 2GQHA 3EOTH 2ARJA 1CLOH 1KXVC 2VDOH 4G6MH 3O4OB 4FXKA 1JMXA 1U6AH 4OF5A 4Y4KC 4HKJA 2W0KA 4K55A 3V4VH 4PJAE 1GC1L 3D6GA 5DQDH 3VI4F 5L2KA 1LO2H 5L0QC 1CGVA 1KJ2A 2JKXA 4LPWA 4Q7DA 3FFCB 5FYJE 1FNSH 3K3QA 3TT3H 4QGYA 4LLQB 2VL5A 1BLNA 2V5SA 3P0GB 1WBZB 3AS3A 3KPRD 4HIIA 4D3CH 1HHGA 1WZKA 3HZMA 3KVQA 4FFZL 3GSXB 3OBAA 1INEL 1JGEB 3PP4H 5KVEH 3QT2A 5DJYA 1AFVH 5FM8A 5FKPA 5JW4N 3FT3A 3VG9C 3MXVH 2HT4D 2VXVL 4A2MA 5ITBL 3BOVA 5D2LF 2CIKB 5F7DB 3CZJA 4PJDB 4Z7NE 4XRCB 1MJJB 4N8CL 1YPZA 4LHJB 4MD0B 4Q9QH 1UJTA 4YHKL 1UA6L 2UYLA 5LJYH 1P2CB 4NRZA 3GMPB 4XBEL 4U3CA 2LU3A 2ICEA 4ENED 4JQXC 2VISB 4WFHE 5GJSH 1FZOB 4ZTPH 4DW2H 3O45A 4PJEB 5EU3A 1FVEB 3OG6B 4K3DH 3MA9L 4QOKA 4NZJA 1OLLA 1B0GB 3D2UB 4LARH 4W6YB 3MLSH 5JNYA 1BWMA 3BKMH 1A4JA 5F88A 1DEEB 2AK4E 4EVNA 3C60B 4OLVL 4DKFL 3I6GB 3MV7D 2V5YA 1BJ8A 3MA7B 4XP1H 5DEGB 1PKQE 4PLKD 3T0AA 5C6TH 3K81A 1H8OA 2CDGA 5CS7A 3GKWL 1GGUA 4P9HH 4XWGH 3NIDF 4K71C 1M7DA 4NKDB 5FUZL 5MI0C 3HE7A 4F80A 4HLZH 3RZCB 4IOFD 2AJXL 4LSSH 2BSTB 3WDJA 4GQPH 3OG4B 2YRLA 4LCCB 3GGWB 1SBSL 2R1YA 4KZEL 2DI7A 1OCWL 2QJDA 3BRFA 2VQ1A 4HZLB 3C2SA 3I75A 3RWJB 2YPLD 5I6XB 4XNYL 2Y36H 2DQCL 2Y5EA 4XVSH 3JBG7 4FG6D 5SV3A 2Z31B 2WIIA 1NLBL 1OAZH 4X5LA 2EDEA 3IFLL 4JRYA 3V8CA 1A6ZA 1ZT7B 3MRFB 4G6AC 1X4YA 3NZ8B 4LSRL 4YX2L 3ZE0F 3CFEB 4FQXA 3P2TA 5DJXB 3K7UA 4AEEA 1RQ5A 3P4OA 3LD8B 4GXVL 2C7UA 3SE9L 3RBSA 3O9WA 1ZLWH 4A6YH 2RFXA 4PR5B 3VD3A 3G6JF 1GPOL 4V2CB 1FYHB 4BQBA 3SDXF 5J6HB 3CLFL 1Z9SA 1F3JB 3DX6B 1OAQL 2DQHH 1H3TA 1H8NA 1P4LB 5IVXB 3OL2A 5EOCJ 4DQOH 5T1LB 5CGYC 1KTLB 1TVHA 3WFDH 2NYYD 1MCOH 3RJDA 2D0FA 1RUAH 3L1OL 3T2QA 1ZHKB 2DWEB 1N26A 3ULVH 5C0FA 2ZCLL 2BRRH 4NQED 4LLUA 1D5XA 4AENA 3UPAA 2VN7A 4PV9B 4OKDA 4NWTL 4LDOB 5DMIL 1YMHA 2N56A 2Z4QB 3BISA 3OKMA 1YEJL 1MCBA 4G9FA 1SYSA 3DUUB 1ZXQA 5FYJH 1BX2B 2YD7A 4U1SB 5DTFA 1K8IA 3ZDZE 5IM7A 2DDQH 3V6ZA 1HWGB 4NP4L 5EBWB 3U4AA 2YMXL 3ALPA 2HJLA 1P7QD 5H8DA 2VLJB 4PP2A 2Z8SA 4R97C 1BP3B 1G6VK 1IC5L 4GW5A 1S3KH 2PR4L 3G5ZA 1JPGB 4ODUB 5HHOD 3BN9C 5H94B 1QSVA 3VXRD 3GMQA 2R8SL 3CGTA 1WAAF 3HI6H 3QWOB 1CICD 4BFIA 3MLYL 1T83C 1OSZA 3U7YL 5IV2A 1MAMH 1T1YA 1CL7L 3ARXA 3NFPA 4X99B 3P9WB 3ZT7A 4OFDA 2FR4B 3FN9A 3U4EB 4MA8L 3VXUD 3KG5A 2A9NH 4XGZA 4NC1C 2R29H 5EUKA 1B0WA 4P2QA 1SMOA 3RAJH 4WUUB 5F9JB 1NGWA 2NY1B 5C2BL 4LU5L 5C70A 3UTPD 3BGMB 1TTGA 4ERSH 4WUKH 4G80A 1K2DB 4PTUA 4HWEH 2JB6B 2ENYA 1RULL 3O8XB 4I0CC 3HZVA 2OM5A 2GUOB 1TQCC 1A3LH 4PJBE 4X80L 3KLSA 3SGDI 1CR9L 5C0BA 3PHOA 4Y1AA 2UWEF 1S9XA 2PN5A 4TRPH 3RIFF 3QH3A 3EDFA 4LBEA 3WV0A 3LEXB 2JIXB 1LWRA 4PGDA 1U3HA 4TSCL 4L3EB 2O5ZH 3U2SA 3DRQA 2FL5B 3QFJA 3DVNA 1FFPA 5CJOL 4R7DB 4PG2A 5C0JB 3S34L 1VADB 1BOGA 2FECL 3OKOA 3H42H 2LV4A 4OF8A 5ICYB 1FORH 4OFYD 2FWOB 1ZAGA 3C6LB 4NUJA 1D5ZA 2AJYL 4IMLA 1VSCA 4OB5H 4RA0C 3QIUB 4JQIH 1ND0A 1VEPA 5KSVA 3CMOH 1S7SB 3HHRB 5DJ8B 1CWVA 1E6OH 1MEXH 4KROD 5EBMA 1FG2A 2R9HD 3B6SB 2YA0A 5JTWA 4HIEA 4PJIB 3MODL 4EZMA 1UJ3C 3GDBA 1FO0H 2NY4B 4NC0B 2CK0H 4X4XA 3MLTB 5HYJA 4HWBL 2VAJA 3C8KA 3M45A 4X5WB 3MMEA 1FAKT 3VW3L 5CINH 1J8KA 1S7VB 4ONHB 3RTQA 5HGGS 5ACZB 3WYRA 4WFGD 3PNWA 3UDWC 3GRWH 4TTDD 2YRPA 1U95B 1TJHL 1P6FA 2D7TL 4ZUTA 3W11C 2PTTB 3EDDA 7CGTA 2OJEA 3KPLB 2FO1A 1D7FA 3P30L 4YXLH 1A7RH 3ARFC 4F9PA 3TNNA 3DIFB 2FB4H 3MRJA 5GGVL 4YE4L 3TWCH 3U6RB 2O61A 5TH2A 3OJVC 5F6HI 4LCUA 5ACMA 2Q87A 2OI9C 2XNAB 1JZ5A 3TC9A 4YDJA 1JZ4A 3MRBA 4RFNB 2F54B 1YPZE 2ADIA 2XXCB 4HK3N 5J1AA 4QCIB 5MEND 4Y4FC 4O9HL 3NZHH 4LCYA 1EEYB 3C5ZA 3X14B 3BKJL 2L7JA 4YHMH 1AGDA 5TJWK 1MRCL 1OP3H 1EDQA 3V5KB 5DC4B 5KSBF 1FVCA 5L2JB 4UOJA 4LAJH 1BHGA 2IGFL 4L4VD 4D2NA 1J1OH 3QCTH 1RZGA 3T4YB 2XQBL 5CZVH 2GHWB 2HRPL 4BZ2H 5EOQH 3IB4A 4NFCA 4QOKE 3OGCB 4NQXA 3HS0B 1EJ6A 2Y5TB 4Y19B 5D7IF 1S7WB 4OLUH 4Y4KB 4CADB 3GMMA 4HUXB 1JF1B 3NIGF 4JFQA 1BQSA 4ZQKB 4RAVA 2IC2A 4OGZA 5L0QB 5HI4D 1KACB 5EBLB 1ZGLA 4OCMC 3CXHK 4RAUB 4GW4B 1N4XL 2W0FB 3QIBD 1JNNH 5CSBA 1XH3B 5K59F 1BJ1J 2P24B 2W9EH 3QAZC 4U1MA 1NCDL 3I2CL 4GUPA 4ZO7A 4QRRA 4G3YH 4DOHE 5I1IH 4RWHA 2EH8H 4F7EB 3B2UC 2B20A 4DN4L 4M7KH 2M8XA 3PWPB 4RX4D 3VG9B 3LS5L 5GS2H 2MMXA 1I85C 3MV11 1L7IH 5ADPL 4PJ5E 3MRRB 4JG1L 4PGBB 4LVHC 1IJ9A 3EGSA 4KK5C 5IVOA 4EI5A 4O4YL 3TO4C 3N85H 1DBAH 4RIRB 4S10A 1JZ6A 1FZJA 4ZAKA 1LP9B 3L5IA 1CXIA 3SDCC 3LKSA 1MWAB 1T2QH 1U91B 5DUPL 4K7PH 2H3NB 3LEYL 2GY5A 2CMRH 4ZMAT 4OLXL 5GIRA 1C7SA 5IWLC 1QZ1A 3L3DB 3P4NB 4C56B 3MRCB 1P7KB 3BUYB 4ONGL 5DK2A 2GW5A 1YNTB 4BKLB 4E41B 1QSED 1UB6B 4FXGA 4N68A 3W82A 4IRSC 2EH7L 5CWSB 2OMBA 4YGVA 5C09D 2R4RL 4HWBA 3T0EA 4O02H 2HA1A 5GGSY 3QG6B 1ZLUH 2BVQB 4CU6A 5C08D 4M1CD 4L3CB 4EN3D 1X5ZA 2HT3D 4P23C 3NCBB 4K3HA 5IBTL 3Q1SH 4K71B 3HMWL 1KCLA 5MI0B 1MCIA 2VDNH 2P1YA 4DK6A 2HMID 1MHCB 4QTHB 3RVUD 3S6CA 4HJJH 1LO4H 4QNPE 4JO4H 4U7SA 3HI5L 1O0VA 2H2PC 5ANME 1MAKA 3QCVL 3WIIL 4OJFL 2FEDC 5T3ZL 1QRND 1U8LB 2YN3A 2QEJA 3LKQA 4DZBB 4DGIH 4YHOL 1FPTH 4P5TC 4L3EE 4HX1A 2NW3A 4MAYA 2RQ8A 5J12C 2ZNWA 5T1DL 2ZOLB 2X4TB 3BQUA 2VC2H 4YDKH 3UPRA 4IOIA 4OSUL 5IJKA 4Y2OA 4MLSA 3RIFK 1J0YA 3O4LE 4ELKB 1I1AA 4BSJA 5IB5A 2DQIH 1IM3A 4R4ND 4MAUL 4KJWC 3KYMB 4LNRA 3D85A 2V9TA 2XRAH 1KEGL 1FZKB 1CLCA 2R15A 1HHHB 4E0RB 3GSNB 4I9WD 1UWEL 4IOSD 3KR3H 1DBKH 1G7PA 1X44A 5LGHH 3HE6B 5DMJB 5C9JB 2AJVL 3A6BH 1U8HB 5IW1A 3DROA 1PJ9A 2D4FA 3UZEA 1JZ7A 3F7PC 5D1XD 3KYKL 1VACB 2F5AL 1DVFD 1D5MA 3QQ9C 5I71C 4WO4A 4P4KB 4QEGA 4NQDB 2NX5A 3HAEA 3L3JA 3QWRD 3KS0H 1HI6B 1PGRB 1HINL 1ZT1A 5F9WC 1KG0A 1OTTD 3CC5A 2PXYC 1YEHH 2NZ9C 3MNWA 1D5BB 1EA9C 4JAMA 2XZZA 5I1LB 1TZHA 4YUEH 5D2NA 2DQUL 1HEZB 3VDCA 5GS0C 1MRDL 2GJ6B 2XZCH 2KQMA 3PGCB 5DJAB 2DTMH 2NXYD 3RY6C 1IAOB 4WU5A 2I27N 1YMMA 5JZ7D 2IFFL 3T3MF 2A0LC 4DUVA 2VLKA 2WLYA 1X5FA 3H9ZA 4KRPD 2EDTA 3KPQA 3LEVL 5MERA 2EDFA 4XNUH 3E3QC 1RIVL 4MA7H 4NQCD 1CVSC 2CXKA 1OPGH 3MV8B 3RIAF 1NBVL 4RSVA 2ZCKL 2X89A 1W0WB 1B4JH 3VXTB 2EEAA 3KYOA 2CKNA 1C5BL 4PY7A 1D5IL 1PY4A 3HC4L 1IKFH 4X9GA 3CMGA 1F4WL 4NO0D 1K9TA 4RGMC 4XVUC 1MQKL 3G5YA 3MYJA 1CQYA 2BJMH 4MSWA 5DD5L 3CPLA 5HDLA 4PY8J 2PW1A 2EXWC 2DLGA 3PF2A 4KI5D 1MELA 4TULH 2WSKA 5E9DA 4X4YA 1PG7X 1G7JB 2FSEA 5FYKU 1G1YA 1VB9A 5HDBE 1NFIB 3IDXL 2A74A 3PWNB 2DQFB 3IXTB 3EW3B 1TQCB 3HZYA 3GMLB 3Q5YA 5IIEB 5FGSA 1GC1H 2FYYA 3ZDYE 2XFXA 3QUKA 3QDAA 3OPZL 3PWPE 5C0CD 2JJTC 3QFDA 4Z18A 1KCVL 4ELMB 5F44A 4MWFA 1OP5K 2E6JA 4X7FC 2DM7A 1FNFA 1G9NL 1NAMB 4I1NB 5C0DB 4HV8B 5HI3C 1LP9E 1ZA6A 2NR6C 1ORSB 4WWKC 4Z0XB 1KYOK 1AY1L 5IQ7L 1OM3L 4H88L 4B41A 35C8L 1JYNA 1KIRB 4XBGB 5JXAH 4GRWF 4Z7QE 4C56E 3UJJL 1AD0A 5F1OB 5JO5A 4G6FD 2VXTL 4S2SA 5FKAA 4RMUA 4YHKH 1UA6H 5D7KD 4FTVB 4Y5YA 4NDMB 2IH3B 1BZ9A 5E95B 1KPRA 1A9EB 4D8PA 4PGEA 1A6WL 3SGJC 1N5AA 2AXGB 1EH9A 4PJ9D 1NKRA 3JV4B 3DX9A 3P4MB 3LMJL 2VL4A 3JTTB 2Q3ZA 1E4WL 1RURL 2IEPA 3DBXB 3T77A 3CSBA 1XGPB 5A16A 2BNRA 1UKTA 2JB5L 4Y2DA 2HTLD 1T7WA 5IEKB 1WBYA 4DKFH 2A38A 2YEZB 3ARFB 3REWA 3W2DL 4CN6A 4QRRE 3JTSA 5D9SA 3LPGA 3BZDA 4O58L 1NC2A 1J10A 4ZUVA 3GKWH 4P5KA 2OI9B 3HR5B 5CIPA 2OSLA 1QR1A 1C12A 2AJXH 4JJHA 1HQRB 2I07B 3QULA 5EZOL 1SBSH 2G60L 4JCMA 2AXHA 4Y4FB 3SQBA 4KZEH 1OCWH 1HXYB 2QSTA 2X4OB 1T1ZB 3DRTA 2VZOA 2DQEL 4Y5VC 1Z0MA 2DQCH 4XHJC 4JDZA 3LHPL 4F8TA 4KHTL 4QTIL 1JN6A 1QQDB 1E27B 4FQJL 1NLBH 1CD8A 3IFLH 2GSIB 4D9RE 4MJIB 2XA3A 3VGAC 3W0WA 4LSRH 4YX2H 4JPKH 1K4DA 4U6XA 5E8OB 3L5WB 3VFRB 4XP9L 4UMGA 4NCC2 1QHOA 4G7YL 2QQKL 3BDYH 3LKNA 3T0EE 1J18A 4GXVH 5F7EL 3SE9H 3ULVD 2VIRB 3KPNA 1J8HB 1GPOH 1XCTB 1CE6B 4ZTOL 4MD5A 4ZOEA 1AXTL 5FCUH 3OKNB 3R8QA 3CLFH 4N0CD 1MHPH 3UTSA 2OCFD 2J8UB 5EOCL 2G75B 4ZDHB 1MH5A 3HG1A 1J88A 3Q3GA 1FL5B 5FYJD 1LEKA 2MSPA 5HI5D 3SKMA 3KHOA 3QUXD 5GHWH 3F7VB 1OT2A 5JA9A 1XGTB 5GRWA 1FGVL 5LGKA 1FCCA 5MEPB 2NY6C 1ZV5A 4LVHB 2ZCLH 4J23A 3TO4B 3BH9A 5HY9B 1FV1A 1SJEB 3IDUA 4AY0A 4LSQL 2GYSA 1KSRA 4NWTH 3FQXA 4U6HA 3VFWB 4PRPB 1B2WH 1TPXB 3FO1A 1C16B 7FABL 4X6FB 3SDCB 3ARDD 2IALB 2C3GA 3DGGB 4FFYL 4QYOB 4HEPG 3MV8E 5CJ8A 3S88H 1M4KA 4UIMB 3ZHKA 4NP4H 3CX2A 4WFHD 5DD3L 4LFHG 5D93C 1X5XA 2ADFL 1IC5H 2PYEA 3C87A 4CGTA 3QEHA 3V9FA 4DTGL 5J6GB 2QTEA 2R8SH 1E6JL 2VDRL 3MRIB 1FFNA 3MLYH 4TUKL 1FJ1B 3U7YH 2YD1A 4H0GA 2V17H 3Q6FB 5CEXB 4L8DB 3RIAK 4P23B 1CL7H 4R2GD 5IESL 1FAIL 2AK4D 2NX5E 4ZOAA 4MA8H 2GK0B 4M7LL 5AZEL 3VFPB 1Z3GL 1EO8L 2OZ4L 1S5HB 1CG9B 3IF1A 1A1OA 1HH9B 3CFDA 1U58B 5DUML 3QDMB 5JOEA 1B6UA 3VDBA 5C2BH 4ZNCD 1G6RB 1ZTXL 2EZ0C 2CLRA 4KDWA 4P5TB 1T2JA 1YC7A 4ZD3H 4PD4J 1KN2L 2W1NA 3MJGX 3QZWB 3WDIA 5INDB 4KK8C 3ILQC 1ACYL 2MHAB 3U1SL 3WE6B 4ODXB 3WFHB 1XIWA 2WM0A 1OTSC 1OTUC 3TA3A 1Q0XL 3CFCL 4WW2B 1BVZA 3FO2A 2VLKE 2EDLA 2UVEA 4N9GA 1AC0A 1JRHL 5FA3A 4TSCH 4UB0H 4UAOC 4YDVA 2DLTA 1L7TL 3DVGB 4FABH 4IRJC 2BX5A 5CJOH 2AJZB 4JFHE 2EE9A 3WHE0 5HHPB 1J1PL 3OF6D 2UVFA 3S34H 1CIDA 4F15B 2FIKA 1DLHB 4HH9A 4YGAB 1KIPB 4L29B 3VFUB 3QCUL 5EDXA 4OF0A 2R0LH 5GS1C 3L3KA 4PGJA 3GSUA 2EDJA 3QNXB 4YZFF 5F93C 3LRSB 3H3KA 1QBLL 3MRKB 3RY5A 1P5UA 1MJUH 2GJZA 5I71B 4P2OC 2Q76B 2F74A 3BWAB 4GBXA 5E9DE 1RUML 1NMAL 2HAZA 3FB6B 4FFWD 3MODH 5F9WB 3MRDA 4LOUD 43C9B 2PXYB 2X4SB 2FHFA 2D3VA 2VB5A 2AAVA 3EFDL 2A73A 3VW3H 1TFHA 4LGPB 3CH1A 5LGJA 3RNKB 4JEGB 4XTRC 3OAYK 1FIGH 4JGJA 2YD4A 3BP6A 4GRMA 4BQCA 5ITFA 1AGFA 5DURB 1Q94B 3AY4A 5I75B 1NFDF 3EYQC 4G8IA 5MEQA 3P30H 4U2YA 4X8JB 5JQ6L 5GGVH 3PHQA 4YE4H 1KB5L 4I77L 4NSKB 3WO4C 3MBEA 4C83B 3GSQB 4LCIH 4G8GB 2P8PA 4Z7WB 3DVFA 1JPFB 2A2QT 4DVBB 1BMGA 5BS0B 2EO1A 1LK3L 5J56B 1J1XH 4FP8L 1CCZA 4MS8D 4O9HH 3L3GB 3UPCA 3P77A 1LNUA 3BKJH 3CIQA 2Y9RT 1MRCH 3FOMA 2EDOA 3GJFA 3X3FL 2HFFB 4O2CB 1K6QL 3K8LA 4BUHA 1J8HE 4H8WL 4RGMB 3RUGF 4LGSB 2IGFH 3FRUB 5HGBB 1WBZA 3SGKC 3ZT6A 2EO9A 3GSXA 3WJJA 1B4RA 2PCPA 2ATKB 1Q9OA 4Q6IC 4XVTH 3QR2A 4KK6D 3S7GA 1IQDB 1CE1L 1QPPA 5AWNL 2X09A 5GS2D 5LBSH 2R23B 4RNRB 1DFBL 5EFIA 1H3VA 3B4NA 2ZCHL 2M2DA 4PLJC 1UWXK 3PG2A 4Y16B 1KIUA 4PB0L 1VERA 5EB9A 4XB8A 1MHEA 1P2CA 4OZGF 4QXUL 3GMPA 2CIIA 1N4XH 4OLWL 1EGJL 3KPMB 3GKZA 3E8UL 2PW2B 4F33B 3HUJA 3I2CH 4JHAL 4PRPE 2DL2A 1XR9A 4L8BB 4YWGL 1JPTH 4PTTB 4WWKB 1NC4D 5CJQL 3MJ8B 5A3IC 1EZVY 3ALWA 3P40A 4ZXBD 3LS5H 4K8RL 1P9MA 4M9PA 4MA1C 4F9LA 5ADPH 3OZ9L 4JG1H 4GRLD 2VABB 4CKVX 5IFJB 1N5YH 4CBPA 4XXCC 2KDGA 4O4YH 4JCLA 4XH2B 3NTCL 1EXUB 3MROB 2GSGB 4XX1G 4LLVA 3SDDC 3G5VB 4XMPL 5DEGA 5B8CA 3WD5L 3PIQB 1LE5B 5DUPH 4D9QE 3LEYH 3QA3A 4NKDA 5KANG 1EZVX 1SMAA 3RZCA 1ZHNA 2BSTA 1AI1H 4LCCA 5HPOA 5DRZB 5DUBA 4ZPVB 5CZXD 3FB7A 3ARBA 3O6KH 2EH7H 1WJ3A 2H8PA 4RGNC 5E8NA 3UTSE 5L2KD 2WIMA 2R4RH 5DJ0B 3OKLA 3ULSB 2J5LB 2NY0D 3ZE1F 3MRLA 1YUHB 1RK1A 1XZ0A 2IPKB 5ISZA 2YUVA 3QZWG 3AREC 3DMMC 5IROA 3RPKA 5IBTH 2NY2C 4PJHA 5D1QC 4KTEL 3MV9A 2HH0L 5KSAD 4KI5F 3D9AH 3ARYA 2X4PA 3TCXA 4KUCF 4XZUB 1CIUA 5I1DA 3KJ6L 2B1HL 4HIXH 2Z8VC 4M3KB 1JYWA 1RJLB 1KB5A 4MQ7B 3QCVH 3WIIH 3EOBA 4OJFH 4CDGC 2A6DA 4HG4J 3E0GA 2Z31D 1J0JA 3V6BR 3REVB 2CJUL 3VFVB 4POZC 4PRAA 1F6AB 1F3JA 4GS7B 4XMKL 1JVKA 5T1DH 2P43B 1I3GL 1P4LA 3VCLB 5IVXA 2FZ3A 1KIQB 3TH4T 5A2JH 1JHLH 1KTLA 4RMQA 2X41A 4OSUH 2WW8A 1OAUH 1Y0LA 3LB6C 1SEBB 4FA8A 5J9PB 4JQVC 3OTTA 5ILTH 5CD5D 4MAUH 1BAFL 4WHYH 1H0DB 1GZPB 1KEGH 4QOKD 3S9DB 2HTKD 1UEYA 3QDJB 1T0NB 2IH1B 1UWEH 3BZFA 4I4WA 3OKDB 2AJVH 3VFOB 3DUSB 1I7TA 2PF6A 3B2VL 1ZLSL 1GGYA 2GJJA 5FO7B 4UNTA 1M6OA 1ZVSA 3KYKH 3BWUC 1JV5A 4J2XA 5C0NC 4JY5L 2EIZA 5C0EB 1EGJA 1GSMA 4NNPL 1XR8A 1I7RA 1HINH 1NUFA 2Z9TA 5DQJB 2JK5A 2H1PL 5TF1H 1I9JH 1JPGA 4ODUA 5EU7C 1NDMB 4YK4C 3ZKMC 1LE9B 1TVBA 2E8YA 5JHDA 4GKSB 1AHWC 1ONQA 3QWOA 4PJ5D 4XNXL 2CPCA 2DQUH 1MRDH 3TBSB 5ICXB 3BP5B 2GK2A 3TZVA 2DIBA 3U4EA 3VXOA 2ICCA 2R2BB 1P7HL 5CIPH 3B9KA 3ZO0A 2WV3A 5ADOH 1UQSA 3IJHB 3U9UB 1HKFA 3CU1A 5F9JA 1GIGL 3DXAB 3BGMA 4PJ7E 1J05B 5BZWB 1A47A 1RJYA 4F7CB 2YZ1A 3G9VA 1K2DA 3PV7A 1RIVH 1D9KB 1VFUA 2AEQH 2VR9A 3IS1X 4IIQC 3O8XA 3SKNB 3U9PL 3MRPA 2BERA 1NBVH 1HCVA 2BRQA 2ZCKH 3RKDD 4XCNA 5CBEB 2L0DA 1W8NA 5K9QI 2ED7A 3STLB 5FIEA 3W5MA 3WFEL 3V79C 1IGYB 5JPMA 5D2LB 2CKBB 2BNQE 1F4WH 4FZEL 4PJ8C 1MQKH 4OZFA 3THML 3ULVF 2D31A 4P46C 2D9CA 1QRKA 5C0JA 2P5EA 3WEXA 1OB1B 5FOBA 1CGXA 3IDXH 2H2SD 4G5ZH 4JFDA 2FWOA 4PJAF 3C6LA 1MWAL 4L3ED 1T5XA 5HDQL 5LG1A 4WV1C 2IAMC 3OPZH 3ZMRA 2AI0H 3VFNB 3PWLA 5ID1B 5JDSA 2HP4A 1KCVH 4TSAH 2GAZA 4X7DC 2Q86A 4JRXB 4K7FB 3QO0B 4CL7A 4JG0L 1MI5A 5KVGL 4HMCA 1P4BH 4YHZL 5JLZB 4WDIA 3D18A 1G9NH 4IRJB 5EU6B 2ZKHL 3O4LD 5JW4M 4UUJB 4AH2A 3TVMA 2IADA 3JXAA 3MLTA 1Q1JH 12E8L 4LVEA 5TDPB 1HHIA 4X5WA 4JN2A 1SJVA 4JO1L 2HFEB 5ICZB 5AUMA 1S7VA 5GS1B 1AGEA 2X1XR 1OM3H 4WY7L 4DCQB 1JK8B 5C9KA 2VXSH 4FQQB 4Z7NF 1SVZA 1U95A 1DANT 2VE6A 3FZUD 3UJJH 4JZOA 4NCDA 4WFFE 3KPLA 4NPYA 2VXTH 1IILE 2CO6B 5F7MC 2BK8A 3UEZA 2BFVH 1AGBA 4NWUL 1S7TA 4X7CC 4K9EC 2AV1A 2BOBA 2ICWJ 1A6WH 1A2YB 1ZLVH 4G9DA 1F4HA 5HGHB 5IEHB 1T4KA 3IFPA 2GY7B 3LMJH 2F54A 4N8PA 3VWKC 4QCIA 1RURH 3O3DB 4OCXH 5IFHL 1EEYA 5T5NG 1QFUL 2JB5H 3AU1B 4HJ0D 5K9OB 2WBJA 3G6JB 5L2JA 3LKOA 2HT4C 1GCFA 1CFVH 3HUJE 1U3HD 2FGWL 3FQUB 1B9ZA 5JOFB 3QBTB 2ZNXA 4KMTL 3I3DA 2KBGA 3WO4B 1JFQL 3QI9A 3T4YA 5T1KB 1A4KA 3VJ6B 1TCRA 1QO3B 1W0YT 3GSNL 1J5OL 4I2XB 2JELL 4QY8B 1JTPA 4Y4KA 4I18A 4HUXA 4ENEC 4R4BB 2FNBA 3ALXA 1PD6A 4OGAD 4H26B 1WTLA 2G60H 1NBZA 4P57B 1IGML 1W0VB 1MCNA 5EO0B 1WWCA 1V3KA 3MFFA 3MNZB 4D0CB 5JA8B 4P99A 4QTIH 2W0FA 5SWZB 2CK2A 3QDJE 1ACZA 4LLDB 4FQJH 4JY6A 2EDNA 3LN4A 4Q6IB 4P2RB 2FX9H 3MGOB 2OLDA 1DDHB 3IAQA 3RWIB 2UZXB 4PLKC 3RDTD 5TPWH 1BIHA 4G7YH 2QQKH 4BELD 1JZ3A 4LEXH 3HTLX 5F7EH 2AQ2A 5IB4B 2IF7A 2OR7A 1EMTH 3NCJL 4ZTOH 5ISZE 4IOFC 1QR4A 1IVLA 1AXTH 4RIRA 5E6IB 1JGDA 3H3BC 2FJFB 5CBAA 1RJZB 4OM1L 4FXLA 1F2QA 4PJHE 4FQPA 4RMWA 3MV9E 4YBLC 4N5ED 3U7WL 1MWAA 3PWPD 4JQXA 5EOCH 4HK3J 2H3NA 1CFTA 4NN7C 5IG7B 2JCCF 3EYUL 1XF5B 2G2RB 2G5BB 1MVUA 2OMNA 4HJGB 2E7LC 4BKLA 1T66D 3B8SA 4Z7VA 3PQYB 4M7LT 4MA1B 5DJ2A 3UP1A 5CWSA 4X7SL 3NIFE 5HHNB 5F1KC 2FHCA 3NN8B 4LSQH 4RA3A 1U8KA 3SDDB 2WMPA 1DUZB 1A7PL 4L3CA 7FABH 3OAUL 4ODHL 4TSBH 5I8KL 1SJXA 4UDTB 4PJFB 5FHBL 2HN7B 1T5WB 3BFOA 4DAGH 3GIVA 4FFYH 4TN9A 4ODSL 3ZDZF 3WUWA 1MHCA 3OKYA 4YFLF 5M95B 3WN5C 2UWEB 4MQTB 5IR1B 4KRLB 5F7WC 2J88L 1SVCP 5DD3H 5FB8B 4LSUL 1NCAH 3X13A 2NYYC 2QSCL 1FBIL 5HDOA 4DZBA 4N0YL 2ADFH 4RGNB 5FDYA 5C2UB 3T2PA 2AJ3A 3V52L 1PZUB 3LQZB 1ZLWK 4S11A 1YY9D 1RZ8B 4YBQC 3GJFH 2C26A 3H7BA 1E6JH 1QFHA 1S7QB 2VDRH 4TUKH 4G8EA 1T04B 1FAIH 3AREB 1IEAB 4L8SC 2PYFA 2NY2B 4GW1B 5D1QB 4QRRD 2VKWA 2XPGA 2AKRB 3F58L 4OZHF 2D7MA 4JJ5B 3OHXA 5F9OL 4M7LH 3MO1B 5FM5O 3K4AA 5AZEH 5FM4A 1Z3GH 1EO8H 3P73B 2OZ4H 2XY1A 4NO5B 3NCMA 3DURB 3GHBL 1OL0A 3KYMA 4HIHB 5DUMH 5JHDE 4PFEA 4XP5L 1FZKA 1XAUA 4EXPX 4JKPH 3GB7B 1ZTXH 5C0GA 1V7ML 4EI5D 3GSNA 1IRAY 1V8HA 1KN2H 5F96L 2DD8H 2FATL 2X4RA 1UXWA 4JPIA 5EU6E 3MLXH 4HDIB 1ACYH 4QXTA 3ARUA 4G43B 1U8HA 5GGSB 1NH6A 3L7FA 2K7PA 3MLUL 2J4WL 3I6KA 4OIAA 2B1AL 4RZCB 2H26B 2NY5H 2FBJL 1Q0XH 4BYHA 3CFCH 3Q0HA 4FQCH 3VXSB 3DOSA 4BQ6A 3GSOB 3KLAA 3OR7B 4QRUB 3M07A 1RHHA 3UTZB 5E7FA 4D9RD 1IAIL 3D1MC 5DC0A 4Q74A 4H25B 1G7HA 1HI6A 1L7TH 3HE6D 1DBBL 3MX0A 2AABH 3MSPA 1U2HA 2IQAB 3T0ED 3F6IA 4YR6B 4XCEB 1J0IA 3QCUH 4JFEE 2GJ6A 3L3IB 4P4KD 4WEBL 4XPBL 3VGHA 3PGCA 1NEZA 3CCHB 4GAYB 1GXEA 2HKHL 2XG5A 3UCRA 5IMOB 1FGNL 1JI1A 1QBLH 1IAOA 1NGXB 3MCLL 2C4XA 4S0TD 2V2XA 4H1LB 5JXED 5EO9B 1KF9B 2P5EE 4APQB 4YIQB 2ADGB 1NMAH 1YN6B 4JREC 5KSBB 3BPOC 4JFDE 3G6JE 1MCCA 3GUTB 4W6XB 4YK4B 4KZDL 3HCVB 5FYKL 5BRZA 3GIZH 1AHWB 3SDXE 3NAAH 3VWJA 1T83A 4KQ4L 2FLBT 3IT8D 4EQ2A 3C08L 2YC1B 5DLMH 5D7IB 3BQUD 2LQRA 2D0GA 1MI5E 4I2XE 2Z0BA 5K9QG 3U36B 2IANA 2OTUB 3DECA 4EEEA 1IC1A 3S3JA 1I1AD 2HRLA 4OD3L 1TTUA 1MCEA 4BSVB 4ODWA 1KB5H 5GGRA 4I77H 5GZOD 4KROC 1CDHA 2R9HC 3H9SE 3N0PB 4IIQB 4CVXA 5BCAA 3GZKA 1H5BC 2B7DT 1YPZF 3GMLA 4P2RE 2R0KL 5H35B 4FP8H 4QHKJ 3RGVA 3FQWB 4LCWB 2X9YA 4TOYL 5J4MA 1EX0A 3WXVH 4XXDB 4ELMA 1K6QH 3ETBF 4MNQA 4PJ8B 43CAB 2NX5D 4TTDC 1HILB 2P5WB 1NAMA 5C0DA 3IXAB 4P46B 3HI1A 1AKJB 1N64L 5DVKA 5GISL 4Y4HB 1N7ML 4Y5XB 3EHBD 1KXQE 1KXTB 2P8LB 1G0DA 1NJ9B 4P4RB 1VFMA 3JVGA 1P84K 1XCQA 2ILLA 3D3VA 4YHLH 1IZJA 5AWNH 3D39B 5IGXL 4RGOL 4BK4A 1DCLA 1BECA 1BIIB 2CKBH 2XG4A 1K3IA 3AUVA 3L5XL 4XAWL 1DFBH 4WV1B 4XBGA 1IQWL 4JZNB 3HR6A 2Q7YB 2BZDA 4XCYA 3BMWA 4FTVA 5H2BB 4JFFB 5CSGA 4OV5A 3E8UH 1EUUA 1FH5L 3KXFA 2VLKD 5IK3B 1BJ1H 1UJ3A 4PRHB 3VRIB 5CILL 4U6YA 3PDGA 3VRJA 5CEZL 4DEPC 2BSRA 3ZHLA 4YWGH 1NLDL 4K7PY 3JV4A 2EKSB 4PP1D 5CJQH 4JFHD 4HS8L 3JTTA 1IGIH 2FEEI 3VGFA 1OSPL 3UDWA 3OZ9H 1JI2A 3O3BB 2X89D 4UNVA 3HRPA 4ZUWA 1U8NB 3LIZL 5EIVA 4P5MA 3BD3A 4HGWA 2XI9A 3ARFA 4YHIB 3BEVB 1OP3K 3N1MC 4XMPH 4Q2ZB 5E94B 5HI4C 4K7PX 4I8DA 2ZSWB 4HS6A 1JBJA 1HSBA 3PL6D 1CVRA 5E9DD 4OTXL 5EU4A 4BUGA 3BYYA 1YEDB 3OKKA 1U8PB 3QIBC 3O0RL 3KPRB 3BIAX 1S9VB 2MPAL 2YA2A 1FVDB 4Y4FA 4UU9B 4JFYB 1HXYA 1P4IL 4Z95H 2RJMA 1U8IB 1T20A 4BSWA 2BVOA 2XN9A 4MDIA 4UOW1 1URLA 5FXCH 2IQ9L 1A1NB 4DN3L 1EHLL 3QO1B 4UQ3A 5DK3A 3WLWD 2ZUYA 4PJXA 1CU4H 2GSIA 4J12A 4OZFH 5BVJB 4Z7VE 5EWIL 1IM9A 4RWYH 4U1GC 2HH0H 5E8OA 3VFRA 4FQHB 1IAMA 4NO3B 5CLWA 5DK0B 1GJIA 1EAJA 3KJ6H 4GG6A 5E8EB 5I8EB 2PKDA 3VXSE 2E27H 2EDYA 4M62H 5CHNB 2VR5A 2XICA 2J12B 4N0RA 4PJCA 5CD3B 3VXMA 4JVWA 1M05A 1VKXA 1BZ7B 3NACH 4XMKH 2JJWA 1I3GH 3MNVB 2J8UA 2QKIB 2O26U 4ZOBA 3DVIA 1Q9WB 4LKCA 5D7JD 3IDYC 3SQOL 2J8HA 1J8HD 3MV7B 2W0PA 1JMZA 4M1CC 4IEFB 4YHYC 3QDGA 2HT3C 4TUJB 5GS0L 1XGTA 4JFPB 1I85A 4I0PD 3EO0B 1BAFH 1CGUA 1OARH 3WMSA 3RVUC 1FFQA 5HY9A 3FJTA 4Y2DD 2CR6A 2MQ3A 2V6HA 4ZFFB 1IGTB 5KSBE 4W4NA 4YBLB 3RKPA 2XQYK 1ZLUK 3CVHB 5ESVB 1NGPH 1ZLSH 1SY6L 4P49A 2YPLB 4NN7B 4WGWB 3OXSA 3W9DA 3NPSC 3RWGB 1VHPA 1JGVL 4ZFGL 4JY5H 1CLZL 4NNPH 4NHCL 3BE1L 3OGOE 4IRSA 4MQXC 1T0PB 2I5YH 3OKEB 1MLBB 4AL8H 2H1PH 1M7XA 3FONB 4KJYA 3BVNB 1KPVA 3M1BB 4R4NC 2V5MA 3QUML 3QHZL 3MRGB 1R5VA 4XNXH 2BVEA 3MACH 3BPLC 3CU7A 3Q6FA 4NGHL 3TV3L 4UT7L 3IJYB 1E4KC 2X1WL 1AGCB 1EPFA 2FCBA 1LGVA 1EEZB 4X7TA 2FDBP 2GK0A 5IQ9B 3AGVA 5HYSB 3WN5B 1B0RA 5B39G 1S5HA 2Z91B 3RRQA 4D9QD 2YD5A 1E4XL 5D1XC 3QXAA 3QDMA 5DVOA 3WNKA 1DVFC 1GIGH 3ESVF 2QQNL 1J0HA 1RK0B 5AZ2H 1YEFH 5CEYB 5EC1B 5INDA 5TDOB 3IETB 2MHAA 4MJ6A 4PPTA 1MSPA 5L6YL 4NQEB 4U1IA 4ODXA 3NPZB 1OTTC 3UTSD 2MOVA 3C6SA 1QEWB 3EIFA 3GMRB 1OWRM 3H3PL 1KOAA 3D39E 1UM6H 2WUBL 32C2A 4GRWB 4FZEH 5F3HB 2NXYC 5BRZE 3EYFB 1IEBB 3DVGA 4GAJH 2GFBB 4QT5A 5EPMA 2RBLA 3MYZA 3V0WL 4HC1A 3U79A 3J7HA 5JZ7C 1UM4L 1KIPA 2JE8A 3PABB 5HDBF 3QUYD 1P7QB 3VFUA 1Y6NR 3AXLB 4PRHE 2IANE 4AZ8A 5F7KC 4KRPC 3QNXA 1CTNA 5C3LD 3VXRB 3MRKA 3BHBB 1CICB 4EDXB 4M7JH 1HSAB 2WINA 4JG0H 4YHNB 5KVGH 5D7SL 3TPUA 1JWUA 4YHZH 4LDLB 4F7TB 4G42B 2AV7B 4Q9CA 2ZKHH 1MCWW 3VXUB 43C9A 4KXZI 12E8H 2WK2A 3UTTA 2Y6SD 5HD8C 5EOTA 4PREB 1BBDL 3WS3B 1EVTC 4JO1H 3MR9B 2A83A 5DD6B 4WY7H 5EORH 4KI5C 1QBBA 2YSSA 3EZ8A 4MNQE 4IS6A 4MVBC 1QLRA 5C8JA 3RY6A 3QEUA 4LPVA 1UEMA 3JSSA 3RY4A 1T7YA 3TJEL 3LS4L 3TIDA 1PLGL 4JREB 5BOPA 5EUOA 1SY6A 4NSKA 3BPOB 2AP2A 4NWUH 3SDAC 2ICES 3GSQA 3KJ4C 5FEBA 4G8GA 1NDGA 2VDPL 1R24B 5DURD 1N2RB 3NVQA 3W39B 2PUQT 4BK5A 1TETL 2BMKB 5L8JB 2Z35B 2ZUTA 4QF1B 4IDJL 4FFVD 3MRNA 2VXQL 4XNZB 1XIWD 3L3GA 4OGYH 3TA3D 3JV0A 1MCJA 3V4UL 5JHLL 2HFFA 1JGLH 1XGQA 4HBQA 3QUMA 1NGYB 4ODVL 3OAZK 4AK1A 2FGWH 1KLUA 4FQ2H 4UDUB 5HGBA 3PWVB 2J6EL 1LO3L 4F7PB 4X6EA 1JFQH 5KVDL 4TUOA 1OAYL 4X6BA 4KROB 4RRPA 1KCSH 1IQDA 3B9VA 3BSZL 1J5OH 1G9EA 4J3TA 1HE7A 2JELH 5IBLD 4CDHA 3AFLA 5B38B 1CGSL 3EFFB 4GMTL 3DYOA 1MLCB 5IF0A 1EUTA 4P9HC 3MZGB 1JCKA 2R23A 1MFBL 4PJ9C 2YRZA 2OX5A 3R0NA 1OP5H 1R6VA 2JJTA 1RSFA 5JORA 1ZOXA 2XT1B 5DMKB 4KVNL 2Q7NA 2HFGL 4GBXD 4QXGL 4FQLL 3P11L 3SOBL 4B53A 1EBPA 2HTLC 3SE8L 2BNQD 4KH2A 4J3UA 4PTTA 4WWKA 2WUCH 4YEFA 2Y07L 5FYKE 4PYGA 4KDTA 1A1MA 4OZ4B 4MNHA 2AEWA 3GMNA 1OAXL 3NCJH 5I66B 1S9YA 3G6DH 6FABL 1VPOL 3HRZA 4OKVB 1EXUA 5F89A 4WRLA 3CD4A 2XKUA 3D0VB 2AXFB 2G5RA 5MENB 4OM1H 3T08A 4NC2B 3P9LB 1OW0C 2I9TA 3B9EA 3PIQA 5F7YC 1ZANH 3HLAB 1XT5A 4JDVA 3KNBB 3MBED 3EYUH 5HVHC 4GG6E 5GQBA 4DEPB 3SGJA 4W6WB 1PG7H 4NO2A 4L4VB 1U92A 1DL7L 1AC6A 3G6AA 1JF6A 2CLZB 4PJCE 4NKIH 4OBSA 5TDNB 1S9KC 4EUPG 4N8VB 2EDWA 4C57C 5DQ9A 1YJDC 4JFXB 1GOFA 2OXGA 4KVCL 5MHSE 5DJ0A 3FOLB 3ULSA 1DN0B 4YXKL 3ULVC 5FUCE 4Z5RA 4GAFB 1A7PH 4M8QB 3OAUH 4YAQB 1N6QL 5CMAA 5I74C 3IKCA 5I8KH 4NHUA 4WFFD 5GSVB 2DL9A 5DDHB 3TF7C 5FHBH 5DRWA 1XF3B 1I8IB 4GO6B 3N1QC 4OUUB 1ZT4A 2QQLL 4N0CC 2V2TA 2AS5M 3QIBB 4Q9BA 1CTOA 3V5HA 5SX4H 4Z77A 2J88H 3BGFB 3LN5B 4LSUH 1P6AB 3VFGL 5HI5C 1FC2D 1FBIH 2E9JA 3REVA 3QUXC 2ICWA 4GRWE 5KN5B 3V52H 2IBZY 3C5SA 3VFVA 4Y5VA 5ESAB 1FYTE 4GSDL 3VA6A 5KVFL 3OR6B 3VCLA 4DKEH 1KIQA 1ZHBB 2ZG3A 3MUZ1 4FNLL 3RL2B 1I4FB 5TE4L 4GKNB 5C07E 1NL0H 4ZSOB 4OCLC 1OF2A 3CDGB 3RWCB 4U1GB 3F58H 4P59L 2VN4A 5F9OH 5ERWB 4WI6A 4V1DA 5ALBL 4YPGB 2J6EA 3GHBH 1H0DA 2X2YA 4GH7B 2G9HA 4XP5H 2IBZX 4BFGA 1T0NA 3AROA 1SJHB 1CDCA 2L7UA 5DVNA 1QSEB 2X40A 1UXSA 2KUTA 4ZS7L 3DUSA 3VFOA 5K9JL 1WWWX 5IB3A 1TNMA 3N1FC 1DZBA 3HNTL 3MLUH 2VZ3A 5DZLA 5C09B 3BN3B 5FO7A 1AIFB 4MNGB 2FBJH 1W8OA 3LZFH 1KJMB 3OMZA 4WTZG 5C08B 4YHYB 2E3VA 4EN3B 3BRGC 5FO9B 1CZ8H 1UM5L 4R2GC 5AD0B 5T5FH 4NJAL 4KKAD 1I9RL 2R2EB 5JR1L 5KW9L 5DQJA 3ARBD 5SWSE 1YEGL 3UTQB 3KPOB 1O5DT 4GKSA 3K2MC 1QFPA 3X11A 3ELAT 1EV2E 2VTFA 4OI8A 3K1KC 3RBGA 4Q9RL 1NSNH 1QSFE 4WEBH 4XPBH 5ISZD 4LKXA 1RD6A 1NBYA 4HT1L 1HNFA 2W65B 1FGNH 1CS6A 4LLMB 4EJ1C 5IOPB 2R2BA 1A22B 3MV9D 3MQIA 3MCLH 4HHAA 4N0UA 1WZLA 4NRYB 2APVA 3KPPB 1N6VA 1TXKA 2W9DH 3ZTJG 5IB2A 3HNVH 3DXAA 4X83A 3RUGB 4HMEA 4F7CA 1PW3A 3SE4C 2FH8A 4KZDH 5FYKH 4TPRL 1RUQL 3BZ4B 3ROOB 5EO1A 4HBCL 4KQ4H 1I9IL 3BPLB 3C08H 4YQXL 3O41B 5B38G 2FJGB 4M6NL 4EIZC 2LVEA 1NCCL 5I76B 3MRQB 3QG7H 1GGBH 3IDNB 5D5MB 4OD3H 4S1DD 5D1XB 3UTTE 1DVFB 3OXRB 4CVUA 3TBYB 4HS3B 4OZGB 5B4MD 5GPRA 2RCSH 1MJ8H 4XNMB 1T0MB 3O3UN 5DJZA 4HUVB 1F97A 4FFWC 3B3IB 3MV01 5JW5A 3WKMH 2R0KH 4EUPH 1Z5LB 3TBTB 3V95A 5FA4B 4X6CB 4N90E 5ID1A 3FO0L 1OAKL 4C59B 1CN4A 1MPAL 1WIPA 3SCMD 4NQVB 1F4XL 2NXYB 5IHZB 1D6VH 3BKYH 3T8XA 1JHTB 4UUJA 4KC3B 1N64H 5GISH 5HVGB 5J11C 1DBML 4FN0A 3VXPA 5TDPA 1KLFA 2C3VA 3G08A 5JHDD 2HFEA 4CJ0A 3GBNH 1HH6A 5GS1A 2AVGA 4KRPB 4RGOH 4Z7UA 5IGXH 1CXFA 4GRWH 4XAWH 1TENA 3QUZC 3UROR 4NQCB 1IQWH 4U1LA 3GBML 5EU6D 1NEUA 3TZVD 4WNQA 3CFKB 4N8VG 4P2OA 2E5EA 1WICA 3BEWA 5GS3A 3B9KD 3RVTD 4JGMA 3DX8B 1LHZA 4XBPB 4OCRL 5FHAH 1FH5H 1WZ1H 4Z7OE 2E7MA 2DB8A 5KG9A 3K74B 2H41A 1A2YA 1R3HA 2ZZUT 1HHJB 4NO0B 4MXQD 3QXDA 5IEHA 4HMDA 2BOCB 1DP0A 3ZYOA 4HS8H 2D7QA 9CGTA 3O3DA 1X5GA 3WNMA 4JFED 1XF2B 1PQZB 1MCRA 3WHXA 3T0VA 3F7YA 2GKIA 2R4SL 4AJ0A 2B0SL 3FQRB 3HZKB 5CSZA 3G9AB 5C0CB 3DGCR 1QD0A 1IL1B 3VJ6A 2A6JB 1QO3A 2P5ED 4QY8A 3PUCA 4LAQL 4RFEB 4I3SL 3C9NA 5DFWH 4JFDD 4J4PC 1LQSR 3ZZ1A 1U3ZA 3RWEA 1P4IH 1ULVA 4RBPH 1NGQL 3Q5TA 5EO0A 4ETQA 5T1MA 1DBJH 2DMBA 3PWJB 3CFJB 3MNZA 3RVXD 4TTGA 5ENWB 1Y6KR 2OTPA 2IQ9H 4DN3H 2EEBA 2ESVA 5SWZA 1EHLH 1MI5D 4N1EA 3SGKA 1GOGA 2MKWA 4K07A 4LLDA 3MJ9A 4HKXB 4G6FB 4Q6IA 1IAKB 4W70A 2HVJB 2Q8AH 3TVMD 5EWIH 3QPXH 4AT6B 5DHVA 1IGJB 4K2UH 3OB8A 3RWIA 1A3QA 2Q1EA 4HQQL 1UH2A 1JP5A 2VDKH 4LQ1A 5F3BA 3L5JA 2GI7A 3ZTJH 5IB4A 4JPVH 3H9SD 1HYRC 4XMLL 1GAFL 2EYTA 1ES0A 1NFDE 1WGOA 4OT1H 5E24E 5CZXC 1AD9B 2XA8H 3P9MA 5IG7A 1J0ZA 4XC1L 4HWZB 4XCFH 2G5BA 3R06A 4NOFA 2SEBB 1BVLB 5IVZB 4XNQB 1IKNC 4N0FA 2EC9U 3PQYA 3DPBA 4Q0XH 4RMSA 1G7LA 5GXBB 5KSAC 4XXCA 1UYWL 2L4OA 1DQML 3DV6A 3PGDA 2IJ0C 1RJCA 3ZKNC 3ARGB 2GTWB 3O6FD 2WBJD 3IDMA 1MFDL 1DUZA 4R7NB 1DQQB 2Z31C 3O6LL 2PO6D 1SY6H 4U2ZA 2VLLA 1UH3A 4ORGA 4NN6C 4PJFA 4F7MB 5HVHB 4S1QL 1DEDA 2HWZL 2BSSA 5IR1A 1GGIH 1JGVH 1OGAA 3LD8C 4CMHC 5FB8A 4NHCH 1YEEL 3O3EA 3TPKA 1UVQA 3QNYA 2PTUA 4PRDB 5E00A 5BVPH 3FT2B 4KXZH 2R1WB 2V7NB 1RZ8A 1OGTB 1YY8A 5CD5C 5FECB 2B39A 5CLTA 3ME0A 1S7QA 4DGYH 3QHZH 1A7BA 4TQEL 2E6PA 3VGBA 3PDOA 5I74B 3EKCA 4NGHH 4Z0BL 3BAEL 3BPNC 5DRNB 3WXWH 3HC0B 4NRXB 3DMMA 4PJAB 4NN5C 5D1QA 2X1OA 3VD7A 3MO1A 1HZHL 5IKCA 2Q20A 1UG9A 1YN7A 2FX7L 5E1AA 3UBXI 1E4XH 3RX7A 5FGCB 5M94B 2QQNH 2NLJB 3QUXB 2XWBA 1RVFL 1NCWL 5IW3A 2AXJA 1EBAA 4UIKL 5L6YH 1ZGLM 2C1OB 2CLVA 2P45B 4CVZA 3HPLB 4N0UE 3GI9L 4U0RC 3IJSB 1LD9A 4WI3A 4ZPTA 4ALAH 5BZDA 1GOHA 25C8L 3EO1A 3H3PH 3GSOA 2DTSA 5GRZA 3OR7A 1EFXA 3ARDB 4JQVA 2CQVA 1FRGL 1WIOA 1R5WB 1MCHA 3V5DB 1KJVB 2QV2A 3JUYA 1RZKL 2BVPA 5EZLA 3CLEL 2FO4A 4ISVA 3NCYS 4XCEA 3S4SA 1F42A 4POYA 1N59B 1U9KA 2GTZB 2V9QA 2APBA 3MC0A 1A6AB 2WZPD 4K9EL 3EJJX 2N7BA 1NGXA 1G7MB 3IGAA 3CXDL 4DGVH 1S7RB 1KN4H 1BFTA 4R2GB 1KFAL 3T1WA 1GC1C 3L3OA 2AK4B 1YN6A 5CP7B 4X5XB 1MFNA 4WU7B 2NY1C 3CX5J 2HVKB 2ITDB 1MNUL 5I1EL 2DQGL 1AHWA 5E6YA 1BBDH 2D03H 5D72L 1CT8B 1DQJB 3QJFB 1LDPL 5A40E 2YC1A 5FGRA 5C71A 2ZG1A 4K3JH 3BH8B 3AM8C 4NOBA 1DLFH 4OCYL 1RZIB 1UKSA 2H2SC 3BUTA 4JO3H 1C8PA 3TJEH 3B5HA 3LS4H 3LKRA 1FL6B 3I85A 4QRPA 3KDMB 3ES6B 5D7LA 4WJ5B 1YQ2A 1KEML 4R8WL 3STBA 5E2TH 1KTDB 3JWOL 1OT1A 3F62A 3L9RA 4FS0A 4IDJH 1FO0B 1N8ZB 1GZQA 5H35A 5DYOB 1I7UB 4YBHA 1NCTA 5SWQA 3V4UH 5JHLH 1RPQA 3HUJF 4LIQL 2CGRL 3SDYL 3UBXB 1IC7L 1ZGLP 5J7CC 1W2KT 1U8JB 5I17B 1LO3H 2A6IB 3FZUC 3IXAA 1MFEH 1CYGA 2P44B 5KVDH 1OAYH 2BNUB 1G7IB 1L0XA 1MF2L 3MRHB 2GIYA 3A67H 3MOAL 1FNEB 1OD7A 3BSZH 4YEEA 4EI6A 5SX5K 1QLFB 2CDEB 3X12A 1CGSH 4YC2B 5DHYB 1EK3A 3V6OE 1UWGL 2Z8RA 4LPUA 2IAMA 4GAGL 5GRUH 3BXNB 4WI2A 3BP4A 1C08A 3SY0A 1AKJD 4XI5D 4KVNH 1QA9B 3LSOA 4P3DB 4DUWA 2HFGH 4NQSB 4XHQA 5IMMB 2VMFA 5JW3H 3P11H 5E08L 1K8DB 4R96A 4OZIA 5IK3A 3S3PA 4HJ0C 3VRIA 3D39D 3FTGB 1ADQL 3SE8H 2WQRA 1YDPA 3BN9D 1CD1B 5BRZD 3C8DA 4RFNC 2WWMD 1RZJH 2X4NB 2Y07H 3VWJD 1C7TA 1U8OA 1CD0A 1QOKA 1MY5A 1T03L 1U8NA 4JLRB 4YLQT 2IWGA 1VPOH 6FABH 2IAND 1L6ZA 3LQMA 1T6VN 4L8CB 1S9WB 1WBXB 4R90L 1ORQA 4PJHF 4OGAC 2EE2A 5J06A 4M43L 1WFOA 4FQ1L 5E94A 2DYPA 3MUY1 1LEGA 5IT2H 5E4EC 4JANB 4XPTL 1A6TA 4Y89A 4U1NB 5E6ZA 4B7IA 1U8PA 1DL7H 2V5TA 3KPRA 2VR4A 3MGAA 3VWKA 1I8MA 5TF0A 2Y7QA 1ZEAL 3E6FB 2B4CH 2EE3A 3NIFF 4JFYA 1U8IA 4KVCH 5IVXF 3RDTC 4CW1B 3RGVD 1HKLL 3DTXA 1KTRL 2XKNB 1F2XK 1A1NA 5FGCE 4MNQD 1PVHA 1PX4A 3S5LB 1N6QH 3HC3L 4R0LC 2DQJH 5BVJA 5HYEA 4PJBB 3UO1H 1LVEA 3V7MA 3CSYB 5A1AA 5ETUA 1EO7A 2QQLH 5GSRA 1OWWA 2X4UA 4F9PC 4N5EC 4KKLD 3H9HB 5I8EA 2D7PA 3D3VD 4G6KL 1G9MH 3D87B 3L3HB 5IFAL 2EXYC 4HIJA 1SQ2N 4QHLB 5CHNA 3VFGH 4I5BA 1CF8L 1S5IL 2YK1L 5CP3H 1X6LA 3U0TB 2AEPL 1NC4B 4MCZB 3IAPA 1T66C 4ZXBB 5E2VL 1ZWIA 3OJDB 5INCA 1BZ7A 4GSDH 1CDYA 4GRLB 3BIKA 1U2CA 2O5XL 1CGWA 2BVYA 4FNLH 1Q9WA 2QR0B 5TE4H 3UAJC 2ENSA 1CFQB 4W81A 1OGAE 3MV7A 1PEWA 4P59H 4J3WA 1PBYA 3MCKB 1GHFL 4JKLA 4TUJA 3BPCA 5ALBH 1Q9LA 2PETA 3IS0X 2ARJQ 3TEUA 1AQDB 1ZVHA 1J9CT 3BZEA 3LVEA 2R2CA 1CLYH 4FXKB 1EAPA 3L6FA 4HKJB 1F58L 5F7NC 1ZKAA 5K9JH 5FGBC 5AG9A 4ZO6A 5ECJE 3HNTH 5L2KB 3CVHA 4KKCD 3QEQA 2YPLA 3AAZA 4Z8FL 1DQDL 2ZJSH 1YY9C 3VMPA 2NY0B 3C2AH 4CN1A 4LSDA 3RWGA 2VL5B 2CXGA 1BLNB 2NQCA 3FQTA 1UM5H 1NQBA 4QRQA 5I30L 1HHGB 3HZMB 1I9RH 4GKZB 5KW9H 4ACPA 5DA0B 5KSAB 1ADQA 1MLBA 4P2CG 3RGHA 4P3CH 4TNWF 5DJYB 1WISA 3FONA 1TZGL 4O51A 3QQ4B 5FKPB 5FYKD 5E2UH 2XN9D 4GXUN 1F8TL 4NKMB 4Q9RH 3GJFK 3VH8A 3IJYA 4HT1H 4NN6B 1YPZB 4CMMA 5AG8A 1EEZA 2X1PA 5EN2A 4DJMA 2R2HA 4LHUG 2UYLB 1IM9D 4CU7A 5HYSA 2VQTA 3WN5A 5HHQA 4NRZB 2CRZA 4ODTL 4J3VA 3L95A 5F8QC 2ICEB 3UTOA 1YEKL 1BD2A 4CMHB 3UBXG 2Z92A 2C1PB 3O45B 5D1ZA 4LMQE 5EU3B 2NXZD 2QQQA 3BO8B 2EE6A 2K7QA 4TPRH 3HE6C 4JB9H 4QOKB 3RX8A 4HBCH 4NQEA 1I9IH 3U83A 5EA0L 4M61A 4YQXH 5MHSD 3BPNB 3TGXA 3I6LE 4ORZC 5JNYB 1A4JB 3G5XB 1QEWA 2X9XA 3T0EC 4L8SA 4NN5B 4R9HA 4EVNB 5I1GL 2JCCE 3GMRA 2ED8A 5F1IA 1ERNA 5DHVH 4P4KC 5GGTL 2EIDA 1H9VA 2RIKA 1FNGA 15C8L 3S8WA 5BQ7A 2CDGB 1IEBA 3WSQL 3KPSA 4JZJC 2B2XH 1M7DB 2I60L 4CUCA 5JXEC 3PABA 2NY7L 1IBGL 1P7QA 3H6JA 4DOHB 3CVIL 3MJ7A 3NCFB 2R1YB 4HFUL 2VQ1B 5HHOA 2E7HA 3WO3B 4PUBL 1TMCB 4U0RB 3I75B 5C0RL 4QRPE 1FYTD 3BHBA 5D7LE 4PJ5B 1I8KA 3FO0H 3EAKA 1OAKH 1HSAA 4PRBA 3NCEB 1F4XH 5C07D 4F7TA 2QHRH 2AV7A 1A6ZB 4IRSD 3VXUA 3UXFA 5CEZD 4M1DL 2D2OA 1I1AC 1Q38A 5CJBA 1UCBH 1A7NL 3P4OB 1YECH 4JO2L 1G0YR 5K33A 2C7UB 3WS3A 2HJKA 3GO1L 1QBAA 4HH8A 4HZAA 5DD6A 2RFXB 1JNHB 5GZOC 2NTFA 1C5CL 1G0XA 1W72L 5BMFL 2OJZL 3GBMH 3MRMA 3LOWA 4OZHE 4PS4L 2BC4B 2EDDA 1U8QA 3D48R 4KJPC 3TBVA 1EO5A 1VA9A 1TVHB 3TYGL 4POUB 3GNML 3MLRL 3S5LG 1IFHH 4ZFOB 5C6PB 2BMKA 5LQBL 1NANI 5C0FB 1R5IA 3G04B 4QF1A 4X0KA 5SWSD 3MOBL 3FFDA 1D5XB 1U3JA 4M6OL 5ANMB 1T2XA 4AENB 5DR5L 1YYML 5FF6A 5I2IA 4OFYA 4OZIE 3MLPA 4U05A 1YMHB 1QSFD 5AYUL 3PDDA 1MCQA 2A9MH 4JM4L 6CGTA 3OKMB 2F53E 1A0QH 2R4SH 4OCWL 3VG0H 2B0SH 4KTDH 4HFWA 3QJHA 3D0LB 1VFBA 4Z78B 2DWDA 5DTFB 1K8IB 5IM7B 3V6ZB 2Q8BH 3X3GL 1P69B 3OB0K 2XQYG 4LAQH 4M48H 4ZUSB 5E5RB 1H5BA 4PP2B 3O4LB 1MLCA 3WNNA 4G6JL 4KKNA 2AK1L 4HPYL 1TCMA 4PP1C 1QLEH 2WWKO 3GMQB 2UY7A 3QQ9D 4BFIB 1OSZB 3ARTA 5IV2B 5DMKA 1VFAB 3NFPB 4ZS6D 2H32A 4GFTB 3ZDXE 5M7QA 3R1GL 4HXAH 4Z7VF 4EBQH 5KZCD 5DVMA 2V2WA 4WHDA 4XGZB 5EUKB 3MREA 5GGTA 5JMRA 5FK9A 5L2KE 3UTTD 4P2QB 4HQQH 1NGWB 4ZYKA 2AJUL 1CL7I 2DKUA 3PL6C 5A2FA 1OQXA 2DLHA 4XMLH 1GAFH 1AE6L 3CK0L 3N1GC 3O2WL 4L3AA 4U31A 1NUDA 3HZVB 3D0VA 2AXFA 5FUOL 1CXHA 2MKLC 5C0BB 1I3RA 3PHOB 3DLQR 1EJOL 4N90D 1S9XB 4LRIA 4JKKA 4XC1H 3IDIA 4HWUA 4PBWD 4N1CA 1A9BB 4PG9A 1U3HB 4OI9A 2BDNL 3TCLA 3KS0J 3DRQB 4U6VH 3WLWC 2MJWA 1ED3B 1FFPB 5DJDA 4WI7A 4KDVA 5EZIL 4X6DA 5TDNA 1BOGB 2ZOKA 4JFXA 4BA8A 3OKOB 3FB5A 1F3DJ 5DI8B 2YD6A 3SKJL 4TNWK 3IU4H 3QQ3A 1N0XH 2LTQC 5B3JF 4NUJB 1MQ8A 1MFDH 5DD0L 2OP4L 4KWUA 5DWUL 2BXYA 2GITA 1JZ8A 4LIQE 3QB7C 1W72A 3U30B 5GSVA 4RAHA 4R26H 1ND0B 1SYVA 5DRXB 5E4EB 4OUUA 4X98A 2FECI 4RMTA 1M71B 2HWZH 5EBMB 1FG2B 4NT6A 4PJGA 4Y5YC 5D96C 3C5JA 5D7JC 4M00A 5F9AC 1YEEH 2ZUXA 4J6RL 4X4XB 1T89C 4D0DA 4XPGL 5IB1A 3C8KB 3VFTA 3RDTB 3MMEB 3TN0A 3MOQA 3QEQE 5ESAA 2LAAA 4I0PC 1A5FH 3EJZD 3RTQB 3CZFB 1A7QL 4I3RH 3PNWB 4NZUL 4K94L 4R0LB 1ZHBA 3QHTC 2R0ZH 3F5WA 3BAEH 3S36L 1A3RH 1I4FA 3T65A 3UYRH 4GKNA 1BGXH 5DGRA 4ZUTB 1CXEA 2OJEB 3CDGA 3RWCA 1WC7A 4HUUA 3TNNB 2UZIH 1F6LL 3MRJB 4JE4B 5TH2B 4LCUB 4M1GL 4M5ZL 4TVPE 4MDJA 1KUMA 1CLOL 2DIAA 4LK4A 4YDJB 4Z9KB 3MRBB 1RVFH 1XF4B 4G6ML 1NCWH 2ADJA 4JRYE 1QSEA 4OIIL 4UIKH 3V4VL 2I24N 1TPXC 5J1AB 3FN3A 4Y7MA 2NNAA 3U46B 4DVRL 3S96B 1I1RA 1LO2L 3C5ZB 4LCYB 5C09A 4PGCA 3GI9H 4MNGA 1AGDB 1TJIL 3WL9B 4KAQH 1BD2E 1FVCB 3TT3L 4YHPA 1XGUA 2NY3D 5IW6A 5DD1L 4NJ9L 5D6CB 2COQA 1RZGB 2EEDA 2R2EA 3IDGA 4JM2A 1DTUA 3TNMA 3O6ML 1YEIL 2VJXA 2X7LB 4NQXB 1LO5B 1AFVL 1RZKH 4O2FA 4C4KO 1CXLA 3DV4B 3KWWA 3UC0L 1NBQA 4OLYL 5I19L 3GMMB 4JFQB 2DIJA 3CLEH 2W92A 3MXVL 1RZFH 1QRNA 4RAVB 3RJQB 3FB8B 1CBVH 2VXUL 2GT9A 2AW2A 3MXWL 2CR3A 2W65A 1ZGLB 1MCFA 4R3SB 2CUIA 3KPSE 1SM3L 1KFAH 3LH2L 4LP4A 3KPPA 4U1MB 4GUPB 4QRRB 1BM3H 4ZTPL 4YDIL 5FCSH 1MNUH 2CSPA 5I1EH 2DQGH 4G9FE 4E5XA 1KJ2H 5EBGA 4XC3H 5D72H 1G9NC 3MZTA 1LDPH 2VZUA 4ELMF 4EI5B 3EGSB 3O2DL 3BKML 5HHXL 1AQKH 4OCYH 3QUYC 4WW2C 4LSVL 3IRZA 1ZS8B 2HT2D 4XP1L 5D5MA 3LKSB 1FL3A 4BM7A 5D1XA 1RUPH 4P9HL 1HQ4A 4WTWA 1DVFA 3OXRA 2YXFA 3TBYA 4HS3A 1P1ZA 1RIUL 5GIRB 4F15C 4JFOA 5DK2B 4OCSL 4YNYB 4FXGB 4GG8A 3JWOH 2YS4A 4BH8B 1Z5LA 4YGVB 3RU8H 1X5KA 3T0EB 2Y36L 4P2QE 4X6CA 3FCTA 4LIQH 2CGRH 3SDYH 3RWHA 3BI9X 3QRGH 2XTJE 5IHZA 3KAAA 3W9EB 5DHXB 4HUWB 5FAAA 4JZJB 2NY6D 3B83A 3DSFL 1MF2H 1S7UA 4WI4A 4MCYA 3MOAH 5C0BE 5E5MB 1PFCA 2GCYB 4Y1AE 1NKOA 3GJEA 4A6YL 3RFZC 3SGEH 1RHFA 5I1CL 1FSKC 1KNOB 1UWGH 4NBXB 5E70A 1YA5A 2YD2A 4GAGH 1DSFH 3I9GH 2NW3B 3QFJE 3SPVA 5I75C 3CFKA 1CK0H 2DJSA 5DGQA 4QHMA 1T1WA 4FFVC 5GGUB 2ERJC 4LPXA 4NUGL 4DQOL 1XIWC 3BQUB 4MQSB 3UPRB 4IOIB 4OLZL 3TA3C 1K4CA 1MCOL 1YJDL 3U0PA 2AQ1A 1ADQH 2ORBL 4JN1L 1I1AB 5I9QC 5IB5B 4K23L 4NO0A 4NYLA 4HUMB 5I1KH 5DO2C 5ACLA 1IM3B 3K4DA 4U0QB 3TFKC 1Q9KA 4LNRB 4TVPH 3NFNA 3DX7A 3S35X 2BRRL 4ONFL 4H20L 3ROLA 3CFBA 1T03H 4PJXF 3EJYD 2IFGA 1G7PB 4WEMB 1TJGL 1PQZA 1H3WM 2UY6A 3DROB 4R90H 3OSKA 3IFOA 5HYJE 4V2BA 5IJVA 3ULUL 3FQRA 1PZ5A 4M43H 4FQ1H 3FRPA 4OGXH 3TBWA 4WI8A 5C0CA 3SDAA 3LAFA 4GG6F 3ILPA 4U7KA 2DDQL 4KUCD 4M02A 5GGRY 4RFEA 2NX5B 3HAEB 3L3JB 3ARZA 4PJCF 2F58L 2DI9A 3HMXL 1CFNA 1ZT1B 2EYRA 1M1SA 5DFTA 1ZEAH 3MNWB 1OTUD 3QIWA 3OAZH 2C4FU 2J8UF 4Y16C 1HKLH 3QNZB 1BEYL 3Q5OA 1WLHA 3BKCL 1QFWL 4JFZL 4YH6A 3O2DA 3HC3H 4HKXA 3JWDC 4OQTL 4FFZH 3T2NL 3TIEB 1IAKA 4BFEA 1V05A 1INEH 5TGBA 1OOAA 2A9NL 2R29L 3HA0A 2OQJB 3FO9A 2VLKB 2F8OA 2VXVH 5F6HJ 2QADB 3MBEC 1IMHC 5ITBH 3KPQB 4PJ9A 5C0AA 5MERB 1CF8H 4WUKL 1S5IH 1M7IB 2Z8WC 1I1CA 1V3MA 4N8CH 4M9OA 4P2OD 5E2VH 1JUFB 3JV6A 4XBEH 4QRTA 2O5XH 1T3FA 2KKQA 1QTYT 2XWJA 4G7VL 4PJGE 4QHNA 1MHHA 3VGGA 3KYOB 4PY7B 4AIZB 2O5ZL 1F00I 3MUGB 1GHFH 3G5YB 2VITA 4MSWB 1BVLA 2BVTA 2WP3O 3CPLB 4L4TA 3MA9H 3LV3B 4O2EB 5K9KB 3ECBA 3PL6B 5E9DB 2VLRA 1ZVYA 2JJSC 3H42L 2MCPL 4PRNA 1I1YB 4JHWL 1H3UA 3TYFA 3EYQD 4BQ9A 3DJ9A 2D7NA 1F58H 2J5LC 4OLVH 4A6YA 3HZYB 2I9LA 1OW0A 2FYYB 3B5GA 2XFXB 5GRXG 3ZKXB 4F7MA 4Z8FH 1ROWA 1DQDH 4F2MA 1MEXL 5KANI 5FUZH 4GOSA 4MWFB 4KHXL 5FM5M 1MUJA 3ARGD 2NY5C 5I30H 3GFUA 4LASL 2CK0L 4LVNC 5F7FA 1I8LC 2X9WA 2EYSB 3FT2A 1R3LA 2VLME 5EIQA 2V7NA 4XNYH 3KYNA 1OGTA 1TZGH 5FECA 5I16B 2LTQB 4JR9L 5DS8A 5KS9A 1HXMA 3QXWA 4GS7C 2BCKA 3O81A 3RNQA 4F9LC 1SEQL 4MX7A 2UUDK 3FT4A 3EYOA 1RV6X 3HC0A 2OL3L 5JO5B 1INQB 4S2SB 5FKAB 1XGRA 5EU5A 4YXLL 4Y5YB 5D96B 4ODTH 1FNHA 1BZ9B 5D7JB 1KPRB 4RQQA 2M1KA 4D8PB 4PGEB 3RI5F 1EFQA 5J3HC 1N5AB 1TIUA 3QUXA 1AXSB 5BV7L 1V7NL 5I1AA 1WIUA 3V6FA 4BZ1L 4I0PB 3QSKB 4KKAC 3HMXA 1NANH 1H15A 1OAQH 3ARBC 4PD4K 2NW2B 5E8DL 5EA0H 5KSUA 3T77B 5A16B 4Y2DB 3C09B 5E0QA 1WBYB 4ODBD 3REWB 3L1OH 2KL6A 1BFOB 5GGTH 3JTSB 1VESA 3QCTL 4ZG1A 15C8H 5DC9B 1F5WA 2J8OA 2C3WA 1NC2B 5CZVL 1R5WA 4OQTA 4HLJA 2FGZA 4BZ2L 3GSRA 5T33L 4P5KB 1C5DA 5IROC 4EQ3A 5CIPB 2OSLB 3MUJA 4IHOA 2I60H 1QR1B 2D9QB 1C12B 4OLUL 2YBRA 4DFHA 3QXUA 4ZFZA 3CDYA 4L9LC 5DMIH 3WJLA 3CVIH 5BXFA 4HFUH 5DJ6A 1N59A 5CCKL 1YEJH 5C0RH 3DRTB 4HKBA 3UJIL 1A6AA 5EUOF 4JDZB 5J0BA 2FJHA 1BZQK 5L9DL 4NNYB 5EULV 2XYCA 2YMXH 5DEFA 4DKDC 2W9EL 1OGAD 4X5XA 3FQNA 1BQHA 4E9LA 3W0WB 1BF8A 1T21A 1PKQA 2DQTL 2PR4H 3I02A 3IDJB 4M1DH 4M7KL 4L1HA 4S1DC 1D9KC 4UINL 1X9QA 3HB3D 4NKOB 4AG4L 3F12B 3KPNB 3QJFA 4D0BA 3STZB 3HAEG 5B4MC 3LQAC 3N85L 3BH8A 1C5CH 1W72H 2OJZH 3GSVA 3A0OA 1UB5A 2F5BL 4HSQA 2YOCA 4PS4H 3UTSB 1T2QL 1MH5B 4Z7OF 3Q3GB 3TYGH 1LEKB 5D2NE 1EEUA 1R3KA 4LU5H 1FZMA 3SE4A 3GNMH 3MLRH 2VAAB 2V7HB 2DICA 4WJ5A 5DSCA 3SCMC 4QHUA 1JGUL 5HYQA 1DQLL 1RULH 1KTDA 3WHE1 5IMKB 3GM0A 4OFIA 1N8ZA 4I3GA 3OF6A 4PRIA 2J2ZA 3MOBH 4X80H 3BH9B 2W38A 5DYOA 3O3AA 1YMME 1CR9H 2BVUA 1I7ZA 3EDJA 3L7EA 4O02L 1FV1B 3QUYB 4ZO9A 3U82B 4AM0A 5JDJA 1YYMH 1KBGL 3RWDA 3FO1B 1EFXD 1AXIB 4OCWH 5I17A 1AO7A 3TZVC 3Q1SL 2OL3A 2VDNL 3LKPA 3B9KC 3RVTC 4LHUD 2BHZA 4HJJL 4JO4L 2VRAA 3X3GH 2CDEA 2YPKA 5ID0A 3QRFM 2IPUK 2AJYH 4G6JH 1FPTL 2OYPA 2VZTA 4OAWA 1GYAA 2AK1H 3SJVA 4MXQC 3VFMA 3QEHB 2MTPA 3B9DA 4I0KA 4ZOCA 1FNLA 5L8KB 4F3FA 3I6LD 3WCYA 4P3DA 2P7TA 4YDKL 3OQ3B 1FNAA 3L5HA 4GMSL 5T3ZE 1WCBA 4HWBH 3IF1B 1A1OB 2DF3A 2P8MB 3CFDB 5ESQA 3RWFB 1FSKB 1V3JA 2CLRB 5HYIA 3QUZA 1QVOA 1TJHH 1DBKL 2ZUQC 2D7TH 1CDBA 5LCVL 3CK0H 2HLAA 3VGDA 4L8CA 5LAXB 5CUSL 3WUZA 2ERJB 1XIWB 4HUNB 4QRPD 3TA3B 1EJOH 4WHYG 4FQIL 5D7LD 5DZOA 3ESUF 5EZJA 3D25B 4KRMB 1T22A 4WW1A 3FO2B 5I9QB 4N9GB 4U1NA 2XTLA 1JNLL 3ZE2F 1X7QB 2BDNH 4YDVB 4MB5A 5C0AE 5D70L 1Q0YL 5EZIH 2CH8A 3SBWC 4HH9B 3V2AR 4CW1A 4RFOL 4YUEL 1JRHI 2XKNA 3FFCA 2Y1VA 4PJ7B 4RBPK 3L3KB 4LLQA 3GSUB 1CDGA 1S78D 5LKNA 2X70B 2XQBH 4L4TE 4PJBA 2GJZB 2HRPH 1G1CA 3CSYA 5C86A 1JGEA 1GGTA 3HPJB 2F74B 5F71A 1WF5A 3N9GL 4GBXB 2VLRE 3NGBC 2BNRE 3H9HA 4J4PA 1E4JA 4J7RA 4QHLA 2BNQB 4YO0B 1LK2B 2CIKA 4XNUL 5F7DA 4MA7L 3RI5K 4PJDA 1NC4A 4XRCA 5TQ2L 1MJJA 4MCZA 2A73B 5E6IC 4MD0A 4HG4K 5LGJB 1F11B 4NM8L 3HAEH 4GRMB 1AGFB 4NZUH 4K94H 1BQLL 4QWWD 3S36H 1UH4A 2VISA 1NCDH 5IHBA 3B9AA 3O6FC 2WBJC 1FZOA 4G8IB 5MEQB 4OCNC 8FABB 1U3YA 3O2VL 4PJEA 2F53D 3MCKA 5D8JL 1K5NB 3MCG1 4DN4H 1KCRL 1FVEA 1ITCA 3PHQB 2PO6C 1AQDA 1WSST 3MBEB 1AR1D 4LL9A 3D2UA 1B0GA 4M1GH 5KS9E 4M5ZH 2P8PB 3IFNL 2YR3A 3NCCB 1DEEA 1R0AL 2B5IC 3C60A 4I18C 4JVPA 4OIIH 4KTYA 3I6GA 4XP4L 4F37F 3MA7A 3W0WE 4DVRH 3P77B 1LNUB 2LE9A 1F6FB 2DYPD 1TJIH 2QHLA 3FOMB 3GJFB 5J89A 3ULUE 3DHMA 5B21A 1KT2B 4OLXH 4MJ4A 2NZIA 4ZFOL 4ONGH 5DD1H 2D0HA 4NJ9H 1IKNA 5MEOB 4LSTL 4GKZA 3VWKD 3GGWA 1IAIM 4FMFA 3TJHC 5I1HL 2PCPB 1Q9OB 5KSAA 3O6MH 4HZLA 4D9LL 1YEIH 4N5UA 3RWJA 1UCTA 4LP5A 4J8RB 3UJTL 3UC0H 3QQ4A 4OLYH 5I19H 3HG1E 3VE0B 2DBLL 2Z31A 4NKMA 5EFIB 5JXAL 2VXUH 3MXWH 4UT9L 1ZT7A 3MRFA 3NZ8A 3HMWH 3CFEA 5AYQA 4NNXB 1MHEB 5DJXA 3N50A 1SM3H 2CIIB 4RDQF 3HI5H 3LH2H 3HUJB 4PR5A 4LVNB 5T3ZH 2C1PA 1XR9B 2CRIA 4YHOH 4YDIH 3BO8A 4OF3A 5GZNC 5J6HA 4CNIB 4KKBD 3DX6A 3WS6C 3O2DH 5HSFA 5HHXH 3G5XA 5T1LA 1BQHG 1CFSB 4LSVH 1FQ9C 4LLVB 1ZHKA 2Y25A 2DWEA 5B8CB 2PYEE 4NZTL 3B5TA 3QA3B 4LRNL 4Z7UF 3SN6N 1RIUH 2DLIA 4WHCA 3GI8L 1ZHNB 4PV9A 4OCSH 1RU9L 1Z9OA 3LRHA 4XP6L 5DUBB 2Z4QA 3FB7B 3ARBB 1I1FB 2H8PB 5E8NB 1UGNA 3QEQD 5DMGD 3DUUA 5CAYB 1HNGA 1BX2A 3OKLB 2F5AH 4PJ5A 3MRLB 4J1UB 1WFUA 4U1SA 1RK1B 3HE7D 1XZ0B 2IG2L 3LY6A 5ISZB 5EBWA 5HHME 4APQC 1PYWB 2VLJA 1WEJL 1JL8A 2A6KB 1A6VL 4PLNC 4JHZA 4JPKL 4PJHB 3MV9B 5HPMB 3DSFH 4JGUA 5CJXC 5H94A 2X4PB 4PRIE 5I1DB 3BDYL 4L9LB 1KB5B 4TVPD 1UADC 3EOBB 5J57B 4AEFA 2A6DB 1JNHA 1B6DA 4X8XA 4UILL 5I1CH 4X99A 2E9WA 4PYHA 5FCUL 1J86A 4HUKB 4JRYD 1OQOA 2FR4A 4PRAB 2VDML 3H8NA 1AO7E 4HEME 4U6TA 1MHPL 4FQXD 2BC4A 2IFFH 3BP7B 4NUGH 2FZ3B 4B5EA 4WUUA 3ARSA 1BD2D 4OLZH 2IBGA 3O9WD 5HGDB 4Q6YA 1MJ7L 1YJDH 4JN1H 1Y0LB 2ORBH 3LEVH 5GHWL 4K23H 3BD5A 5D1ZD 4ZFOA 2JB6A 2JF1A 4YBQD 1TZIB 3SJVE 4F57L 3G04A 3SE3C 2GUOA 3HNSL 4OFVA 3NA4A 2MQ0A 4H20H 4ONFH 3AM8A 1N6UA 1DUYB 5ANMA 1N3NB 3BZFB 2EC9T 3LEXA 1B2WL 3MJ6A 2JIXA 1TJGH 4I4WB 2AJSL 3SO5A 5I15L 1I7TB 1C5BH 1D5IH 3HC4H 4L3EA 3W5NA 2FL5A 3AS1A 4KJQD 4XCCL 1M6OB 4H0IA 1ZVSB 5DD5H 3ZKSD 3ULUH 4R7DA 3EO9L 5E1HB 1BOYA 5MP6L 3KHQA 3D0LA 3S88L 3KPSD 1JV5B 4Z78A 5F6IB 1VADA 4Y4HC 1WQVT 4PV8B 4Y5XC 3SCMB 4E42B 4XI5C 3NA9L 4RMRA 5ICYA 2EIZB 4ZUSA 1XR8B 1I7RB 3O4LA 2F58H 4DZ8B 3HMXH 1WT5A 5EH1A 2JK5B 2MQCA 4G9FD 1BBJB 3QIUA 1TVBB 1QP1A 2WWMC 3ZHDA 5JHDB 1ONQB 1CGTA 1S7SA 5DJ8A 3VWJC 1BEYH 3DUHA 4G8FB 1VFAA 2V17L 3B6SA 3BKCH 1QFWH 4JFZH 4PJIA 2YWZA 3TZVB 4OQTH 4RCAA 5SX5H 3T2NH 3VXOB 3B9KB 3T4AB 3LN9A 1UQSB