1R3JB

Potassium channel kcsa-fab complex in high concentration of tl+
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab fragment light chain
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 37
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3jB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3jB02
4L8SB 4DZBA 1NCDL 2F9BT 2I9LA 3DX7B 1LO2L 1JZ8A 2BXZA 3I6GA 2GFBA 2X1XR 5HHMD 4HKJB 3NVQA 2BHZA 4MJIA 1J5OL 4DAGH 4FABL 2KZ1B 3FJTA 5SX5H 3D18A 3VFOA 3WV0A 1PSKH 1JWSB 3KYMB 1BM3H 2VDNL 1W72A 2OMNA 2BK8A 1PG7X 3PDGA 3MA7A 4KPHH 2CDFB 4PP1C 4DW2H 3Q6GH 2UUDK 2BSED 1VFBB 3CC5B 5GS0D 4RMRA 3U7AA 2E3VA 4IRZH 1J0HA 3CSBA 4LVHC 1GC1L 3HI1B 4PJ8D 2EDBA 1QFWL 3N1FC 4HGWB 3EO9L 4E5XB 4XMLL 1YMME 3NFSH 4BH7A 1QLRA 3B4NA 4Q6IB 4N5EC 1MCOL 3STZB 4LCUA 1RUPL 4GH7B 3QCUH 4TTDD 4UAOC 3E3QC 3WLBB 2XV6B 3T77A 5KS9F 4GRMA 4UU9B 3GMOA 2FLBT 3DXAB 4I8DA 3X11B 1KIRB 5KAQF 5GPRA 4XAKD 4H5SB 2RR3A 4XMPH 5CJ5A 3DETC 5A16A 3PJSB 2J2ZA 4ZO7A 4G9DB 1AGBA 4KDTA 3OKKB 4Y1AE 3O9WC 3B43A 3O11A 3W0WA 2W65A 3MNZB 4PUBH 2E9JA 4Y4HD 3SGEH 2W92A 1DL7H 4IIQC 3MV7D 4J4PD 4BSWB 3ZTJH 1KFAL 2MWCA 2FB4L 4KQ4H 4MWFA 2CPCA 3NPZB 5C0GB 1DANT 3S8WA 1G7LB 5K9OB 3FRPG 3QG7L 4E42A 4JDTH 4IS6B 3VFGL 3BH9A 2JIXA 4QXGL 4G3YH 1IEAA 4GJTB 2IQ9L 4NGHH 4YHMH 5D1ZB 3QZWA 1NEUA 4M9PA 1RZJH 3VXRA 4RFEB 3NCJL 1EEUA 4MAUL 3SQOL 1UACH 5DQ9A 1FAIH 1I3UA 4M7KL 3T1WA 2A6JB 1MNUL 4X6CB 3ZHDA 3DMMC 3BKCL 4RX4A 5DDHA 3V5HB 1R5WB 3W39B 3CFCH 4X6BA 1EMTH 5DRWA 2NW3A 3RPIB 3DURA 1OF2A 1QEWA 2VQ1B 1G7IA 3PNWA 4FQXA 4F7CB 1AE6H 1BFSA 5T1LA 1AQDB 3DI3B 3KDMB 2B39A 3ZMRA 5EU4A 4UDUB 2CQVA 3BQUC 3HB3C 1E4KC 2GITA 4LCWD 3SKNA 3ARZA 3DLQR 3ZSTA 1ZA6B 3FOMA 3P4MB 4YDJB 5LJYH 1C16B 2IALB 3TCLA 1ZEAH 1A6VH 1YEGH 1YZZA 4L8CB 3GNML 1FHGA 3OAUL 5HGAB 1CGXA 4S1QL 2VLRA 3HFML 1UEYA 2HKHL 5IQ7L 5KSAB 2IAND 3ARED 3RGHA 4LCCC 1S9VB 1FYTA 2OP4L 4R4NC 4AEHH 2ZOLA 1CFSB 2VITA 2FZ3A 3BESR 5C0AD 4IMKA 1FAKT 1PZ5B 4TRPL 3GJFA 4DCQA 3QEQA 3WHE1 3STLB 2DKMA 3I75B 4R97B 1NGWB 5GGUA 3TNNA 5BRZB 3GMQB 1DUZB 4HHAB 3O6FB 5A3ID 1BFOB 1GIGH 4O5LH 1Z9SA 1OGAE 1Y6NR 4GXVL 4KRNA 3KPNB 1IKFL 1MLCA 1MAJA 4PY8I 2OJEA 1FG2A 5KN5A 1F6FB 4OCWH 4ZUTB 1DUYB 3MFGB 4Z7VA 4MS8D 4IRJB 1AD0A 1F4HA 3TVMA 5MENB 5GGVL 2QKIB 3F65A 3GO1L 4LCYB 4XC3L 4MCZA 4PREB 2VDMH 3BIBX 1EUTA 1KPUA 4Z76A 1V3JA 4XPBH 3CFBA 4FG6D 4LF3A 5EU6E 4LARH 5C07D 1N6QH 4M5ZL 4NNPH 4U1KA 4PGZA 4XPHL 1OSPH 1ES0B 4DZ8B 3HMXL 2BVQB 1IM9B 3QIBB 1T4KA 5FYLL 1IJ9A 1CI5A 1SBBA 1N5YH 1FO0H 2AK1L 2R9HC 5DMIL 3C60C 1JK8B 3KNBB 2DLEA 2X44D 4LKXA 2ICEA 5TE6H 3WUZA 3RTQD 4KQ3L 1C5BL 5I16A 3BI9X 4OF8A 1HHIA 1DQTA 3SHSA 1RU9L 3U83A 3S35X 1K6QL 5C0ND 3O3BA 3D39B 3WEXB 3DIFA 3EFDL 2NW2B 1QBMH 4RZCB 5DQDH 4XRCA 5DJ0B 1GAFL 2H3NA 3G6JF 1FN4B 2DLFL 4I48B 4XAWL 3MCKB 2JELL 3Q1SL 4EUPH 1XF5B 3IDNA 3QFDB 3OV6A 5SWZD 4J3UA 1OGTA 4J6RL 2P5ED 4U1NA 5HPOA 3F58L 3QHZL 4KVNH 4Y2DC 1A14H 3C9NA 3JVGC 5IVZA 3BSZL 4K7FB 4OQTL 4PJ9D 3WL9B 4JO1H 5LQBL 3QFJB 1EH9A 2BVYA 1MCLA 1CG9A 5C0CB 5EORH 5EZLA 3VW3H 1TQCB 1S7WB 1H3UA 3ARRA 4K9EL 1KN2L 2Q6WB 3V7AE 3OQ3B 1FG9C 5GS0L 2H41A 4L9LA 4NQED 2X89D 1D9KB 3ARBA 3GSOB 5GZNC 3PP4H 2Q1EA 4X0KA 3MBEA 4J3WA 3VXTA 1ZSDA 1FRGL 4IDJL 1MHEB 2IGFL 5D2NE 4O02H 5IK3A 5CEZH 1HDMA 5IBUG 4U6HA 3SBWC 2J4WL 4PB9L 4U1MB 1XT5A 5JZ7C 3SDDD 5GJTH 4MJIE 1P4IH 1QYGH 2EYSA 3FMGH 2AK4B 2XNAB 1H3PH 5GRZA 4B7IA 1IQWH 4L8BB 1HIML 3V4PL 3BX7C 3BPLC 4G5ZH 1OAQH 2FR4A 5IQ9B 4IMLA 3OJ2C 7CGTA 1AGFB 5SWSB 5F6HI 4WI2A 5D71H 4EUPB 3SE9H 3T4AB 1XMWA 4OLWH 2OI9B 1CTOA 3HUJE 3O6ML 5D1XC 5DQJB 4LVNC 4ZFZA 5T1KB 4PYHA 2Q7YA 4ONHB 3HPJB 4HBCH 1WFUA 4X7TB 4AIXA 4EEEA 1W2KT 3EJYC 5JW4M 3SGDH 3T0VA 5FO7B 4FQLL 4ETQA 1CBVL 2DLHA 3PWUA 5BVPL 1F4AA 1E6OH 4Q58C 5IG7B 1HNGA 1RVFL 3OJDB 4KRPC 4LHUG 5JHDD 4Q9RL 4LAQL 1T1XB 2H9GA 4JKLA 1NGYA 3L7FB 5EUOF 4KTYA 3ULUF 4V2CB 5DURD 4G6MH 1T66D 3QCVL 3W0WE 1IAII 5JA8B 3TIDB 1QRNA 3QEGH 4FA8A 5AYUL 4C4KT 4NO5B 1AR2A 3T8XB 4ELMB 4YHPB 1UFUA 4ZXBB 5LGJA 1MCFA 4CNIA 1JRHI 3NTCH 3OXSA 3DRQB 3MV8D 4I0PA 3HZVB 4PGDA 4CVZB 1P4BL 2YPLA 4YBQC 3BP7A 5IV2B 4I77L 3QUMB 1FVCB 4GSDL 3SQBA 1BZQK 3S36H 2CKBB 3IGAA 4DGYL 4W6WB 4R96A 3H7BA 1IFHL 5C6TH 3DX8A 1QG3A 1YYLL 3JV6B 2D3VA 4NRXA 3RDTA 3GI8L 2ZCHH 1S5IL 3QUYA 2IQAB 3O2VL 3B6SB 2D03L 4LBEB 2X4UB 3CVHL 5DHVH 1MEXH 4FFYL 5F7LB 2AXJA 3AAZB 1BPVA 3D25B 3L3GB 4DN4L 5D2LB 1IT9H 1ZS8A 4NQDB 3DO7A 5JR1L 1OAZH 1MIMH 1QD0A 5SX5K 1M4KA 4JY6B 4AMKL 4TVPD 1AXSA 4MD0A 3FONB 1NH6A 3BN3B 1TTFA 3TN0B 4MHHI 5EA0H 1CCZA 3F7QA 4UQ2B 4LOUD 4NN6C 4X4ZA 3GMLA 1KJ3L 1NDMB 2VLRE 2WBJD 3U0TA 2J8UF 4HAGA 4X7FC 1BJ1J 3SCMC 4G7YH 2ZUWA 4NNYA 5EBMA 3TH4T 5JDSA 1FYTE 3GMMA 1I8KA 1I1AB 1G9MH 1JGEA 3QNXA 4F57H 2WQ8A 1MELA 3Q5YA 3QEQE 2VXQH 15C8H 5CBAB 1GRWA 4MA8L 3EHBC 1A6AB 1NGXA 3T2OA 2XWJB 2JKXA 3CSPA 4PG2C 2WUCH 2IFFL 3LH2H 4FZEL 4KMTL 1LE5A 4OM0H 2BFVL 5KSBF 5A2KH 2ADJA 3M07A 1MH5B 3ARDB 3DUSB 4QNPE 2X5PA 4HWUA 3U4BL 4JN2B 1ULVA 4AT6A 4U33A 1R24A 4AG4H 4NUGH 3OR7B 1JYVA 5I2IA 1QHOA 5AWNL 1SJXA 1FYHB 4Z7VE 1VGKB 4Z0XA 2Z4QA 4ZFOL 1U8KA 5HDBF 1X3DA 1BLNB 2XN9A 2GT9A 4GRWE 3IFOB 4MXVE 4XNQA 4QRRB 1HKFA 4TPRL 3TA3D 1U8PA 4HJ0C 4XTRD 3WXVH 4LSQH 4D94A 1SEBA 1O5DT 1X7QB 3G6JA 2OK0L 4EQ3A 5IMLB 1MQKL 1E4XL 3B2UC 5LAXA 3L1OL 2MPAH 3LN4B 4MA1C 5TDPB 3OKMB 3RNKA 2D7TH 4LVHB 1LHZA 4UMGA 1A7OL 4AM0B 1EFXB 1CVSC 1TXKA 2FJGB 2QQKL 4JE4B 3UP1A 5FV2A 4MDIB 4MJ6A 3DX9A 4XBEH 4JZJC 2F5BL 1G0YR 2FEDD 4P4KC 4OLVH 4KI1A 4HS8H 1KNOA 4GAGL 4JCMA 1WCBB 1D5ZB 1P6AB 1T03L 4XNMB 2X05A 3TZVD 5HHVH 3BP5A 3LRGA 2Z91B 1A3LL 3CFKB 4FOMA 5F6IB 4IRSB 1SY6H 4Z77A 4OFPA 4JM2C 3N9GH 5EO9B 5H94A 4NQCB 5GQBA 3DVGB 4I3RL 3SDCB 1RUAL 2NX5A 1D5IL 5HI4C 1XGQB 3VFRA 4KI5D 1MAML 1V3KA 3H3PH 1FVEB 2NY1C 4P2RB 4HC1A 4Z0BL 4XCEA 4OUUA 3SPVA 2NR6C 3GI9L 1ITCA 4HEPG 1T0MA 4S1RH 4QXTB 2HFEA 3G5YA 2BZDA 2VXTL 1X5LA 3O8XD 3UYRL 4JN1L 3ZTNL 2P5WB 2GY5A 3DMMB 4KXZI 3OGCA 4XB8A 4ZDHA 1J86A 4NZUH 4JFPA 1VESA 3P30H 3GJEA 4XGZA 5E2VH 3K8LA 5LWYL 1FNGB 3HI6L 2QHRH 1CIUA 1WWCA 5C9JB 4F7MB 1KTDB 3MJ8B 3DJ9A 1JE6A 5GSVA 1NLDH 4IOFC 3GSVA 4G42A 4H20L 1YPZA 1ZMYA 3DNKA 1IAIM 2NYYD 4QHUA 4KK6D 3OHXB 1J9CT 4IBLT 4XNZC 1HQ4A 2FL5B 4JFHE 1URLA 1BVKA 2FX8H 1W0YT 3QA3B 4JFDA 4NZRL 2F58L 1M7XA 4G6KH 4WHTA 1R3JB 1T2QH 4NO0A 5EUOA 3MV01 4P3WA 5CUSH 2Y5EA 1IEHA 2Y6SD 1OLLA 3DYMA 3O2WH 4LU5L 1WUNT 1RK1B 1CFNA 2UZXB 4C83A 3GIVB 3ILPB 3ARFD 4KROB 3EAKA 4Y1AB 3U4EA 4ZAKC 1C08A 2EDKA 1U2HA 1ZT4B 4PGCB 4XHJD 2PO6A 5F7WC 3NZ8B 1NKRA 5E1AB 4AZ8A 1HEZA 4GKOA 1OTSC 5DVNA 5T3ZD 1NC4A 4FQ1H 3SGEI 3QIWA 1U6AL 2AJVH 2PXYD 4YUEL 1R3HB 4QOKD 1IRAY 4LLWA 4ZUUB 3MX0A 4U1LA 3MQIA 1DQDH 4RBPH 2VLJE 1TTUA 5BW7A 1E28A 4BM7A 5FECB 5D7JC 4BA8A 1YYMH 3MO1A 4XCYB 1J8HE 1DLHB 3AU1A 1PX3A 2I07A 2MFNA 4GBXA 4AIZA 1QRNE 3UZEA 5I1KH 5BOZG 2AABL 3D0VA 2CH8A 5CMAB 1Y6MR 2JB5L 5DJDB 3FO1B 5F21B 2EIEA 1ZGLB 1PDKA 4J8RA 4FTVA 4NPYA 3GUTA 4TVPL 2XWBA 3VFSB 3PWNA 5DHXB 4G8GD 4GKSB 5EU3A 4MAYD 4PJXF 2YPLE 2DS4A 3WIHL 4YR6B 4PJ5E 1VKXB 4RGND 2VWEC 3VI3E 4QYOB 1AHWB 1DDHA 2J8UA 5EBLB 2OTWB 2IFGA 3KG5A 4LLMB 5DJZA 4EIZC 3KXFB 3V79C 2PYED 4LHUD 5GRJL 4LPXA 2Z93A 1U8NB 4KK8D 1UJ3A 3QHTC 3PIQA 2P24A 4ODBD 1D5XA 4CKVX 3LKPB 4P23A 3IDIA 2HFFA 1SMAA 3T4YB 2YEZB 2YD1A 4U3HA 1PZUB 1U3HC 4YNYA 5EB9A 2AJXH 2NPLX 1MWAH 3GMPB 4HH9A 5INDA 3KYNA 4Z18A 3V4UH 3ZKND 4RISL 4XPGH 1ZHBB 5TF1H 3VXSA 3QDGD 5D70L 3S88L 3I85A 1GJIA 3F7VB 4F80A 2GI7A 3BEVA 5B38B 4Y4FC 1OGAB 1S7SB 4F15C 2X4TB 3ILQC 4HKXB 3BIKB 4Y2DB 2RCSL 4UOJA 4F2MB 2WW8A 1CFVH 3BPOC 1BIIB 4N0FB 1DSFL 4M61B 2FECL 4PJDA 5ALCL 1J1PH 3FO2A 5F88A 2HLFD 2VTFA 3BXNB 1KCSL 1GSMA 1KT2B 4HK0B 3JWNC 4FQJH 3NCCB 1KIUA 3U2SA 3WKNA 1KG0A 4X5LA 4M1GL 4U6VH 1XGRB 4EDXB 1T1WA 2HTLC 1ZHLA 1BOGA 1WLHA 5EU6B 4J3VA 4ALAL 5HYSA 1YY9C 3NIGF 4LIQL 1ACZA 4D3CL 2WBKA 3WKML 3K74B 3EOAB 4JFEE 2YRLA 5GHWH 2CDEB 3RRQA 4BFEA 3OKNA 2FGWH 1I9RL 1CYGA 5DEGA 3QIUD 4R3SA 4TSAH 2OR9H 1IC5H 1KTKE 4QRPD 4XVJL 5INCA 2XN9E 4H8WC 2C4XA 4M7ZB 3ALPA 3BYTA 4G6JH 4Y5VA 5CHNA 4EXKA 4PJEF 4LLDA 3G6JE 4JANB 5CBEA 1IQDA 4NRZA 2WP3O 3K80A 1MWAB 4ZYKB 1N7ML 4R4FL 5EBWB 4Y89A 5IB1A 1NMBH 2XQBL 3C5ZC 1YNTB 1HILA 1W72H 1OP5H 1TVHA 1I7UB 1J88A 3NFPA 3GMRA 4MQ7B 3TO4B 4P2OB 3AUVA 3WE6A 1OAXL 4YHYB 1Q9LB 1BVLA 2UV3A 4KRPB 1QA9A 4XBGB 2Z92B 1NANH 1IGCH 2GJ6B 5KVDL 4OFYA 1KCVH 4Y7MA 4Q9QL 1HOCA 1AI1H 2A74B 3B5TA 5JUEH 1UENA 3RIAF 1PLGH 3HI5L 4M6AA 3EDDA 4JQXC 4GRLA 1HK6A 3BKYL 1V7ML 3QCTH 1JGLH 5HGDA 4XVUD 3FOLA 5ETUB 2AJYL 2B4CL 5KVFL 1T22A 2HWZL 4M03A 3EUUA 2NY2D 1QNZH 1RZ8A 2NY6B 1MIEL 1S9XA 4P5KA 4K94L 3C5SA 3CZFB 2AQ3A 3VFWA 3SGKC 3PHSA 4TYUA 4ACPA 4UTBL 3WFHA 1Q1JH 4XCCH 1FPTL 1HH9B 2PTUA 4U7SA 5E2WH 3V7MA 3A6BL 2Y36L 2VDQH 5J7CC 4ODTH 1YEJH 4GKNA 4YZFF 4JM2F 3TBTB 1Z3GH 5IF0A 4YPGA 4JGJA 4JG1L 3O6LH 1A4JB 3FFDA 4X9BA 4JQVA 3HE7C 4MJIB 1F4YL 3E6HA 3UPRB 4LSVH 1XGYH 4Y88A 2FLRT 2E8ZA 3D18B 1UWEL 4JO2L 5FO9B 3VFOB 2B0SH 3ZHLA 1MCWM 1S3KH 3P0VH 3H3KA 3VI4F 1W72B 3MLSH 3KYOB 3MA7B 1MRFH 3RAJH 5T3ZL 2BHUA 3PL6C 3RVUD 1RJYA 1YPZE 1NGQH 4Y8DC 4JKWA 3HUJB 5C0JB 3EYSL 4NOBA 4GG6F 1QLFA 3J8F7 4D0BB 3DV6A 2E9WA 2F15A 4OZFA 1NDGA 1QLRB 4JFDE 4NN6B 4LCUB 4FFVD 3TYFB 5EUOE 3SCMB 4OGXH 3ULUE 1MFCL 3T77B 5FYJD 3VGEA 4K7PH 4WI7A 5C86A 3GMNB 3PDOA 5T1MB 4NC1C 4P3DA 3SGDI 4RMTA 3MROA 5I8OL 2YN5A 2ZSVA 1R3KB 4F33A 4HG4K 5E08L 1AGBB 1OQXA 2BXYA 2JJVA 5DJXA 2G75B 4HS3A 1ED3B 1H5BC 1MFAH 4FRWA 4N90E 5IVXF 1TCRA 3CSYA 1RUKL 1V7NL 5ESVA 1WTGT 2OCFD 3T3PF 4GAYA 4MWFB 1UKSA 4JY5H 4LPCA 1KELL 4HQQH 4U1IA 2PKDA 1J87A 1N6UA 3BH9B 3VE0A 4RA3A 4YHKH 2WWMD 2FCBA 4KK5C 3P9MA 4TULL 1DP0A 3BEWA 1I7TB 3DXAD 3NGBB 2XWTB 1AXTH 3WNLA 2VDKL 5E56A 5FB8B 1L9MA 5IBLC 3HE6C 3H9ZA 4JR9L 4BQCA 3GSRB 2DB8A 4X5XA 3HZKB 1KPVA 1F58L 1BMGA 2AEPH 5J1SC 2CXGA 5DDHB 1ND0B 5HD8C 3MODL 3RWEA 4P9HC 4FTVE 4MA1B 4JFXA 2RAMA 4K2UL 4X6BB 1S5HB 2DMKA 4FQIL 1T1YA 2VLMD 1OF2B 1QEWB 5IESH 1G7IB 2Z8RA 2J12B 5T1LB 1SM3H 2WM0A 3KPSA 4I9WE 1EHNA 3OAZH 1UM4L 3S3PA 2XRAL 4OCRL 2HT3D 5DMGC 4S1DD 5D1ZD 1G7MA 2J8UE 3S5LG 2N1KA 5IUSA 4P4KB 5CZKA 3T2NH 1A7NH 3GK8H 2F19H 3HAEB 4M7JH 2CK0L 2R0ZH 5CZVH 2PTVA 1W8NA 4FN0A 2P8LB 2NZIA 4WFED 1JTPA 4APQC 4OCXL 4JM4H 1HXYA 5LVEA 4LLVA 2VLRB 5K9KA 3P11L 3HC3H 2VXSH 3D0LA 3NABH 3TF7C 2H8PB 1WC7A 4X4XB 1FYTB 2GUOA 2EDWA 5F89A 3W9DA 5ECJE 2HJKA 4M3JA 5GGTL 1NFIA 2FZ3B 1T5XA 4XCFL 4X6EA 2GK0A 2J88L 2QSVA 4RDQF 4DN3H 3GJFB 3MOQA 1L0YA 1DBAL 1E27A 2ICWI 2NY1B 4YGAB 4RGMB 4JO3L 5GGUB 1S7VA 3TNNB 3VXSE 2F53B 3CUPB 1AQKL 4WHCA 3MFFA 3LSOB 2G5RA 3SKMA 2B8OT 1V5JA 1OD9A 2DD8H 4NKQB 1QBLH 1ACYH 1JRHL 3LQAH 4O9HH 4XHQA 3OPZH 3ARQA 2P4AB 1NMAL 3RBGA 4BYHA 3X3GH 4PJDE 1FG2B 5KSAD 3NPSB 5CP7A 3QI9C 1ZT1B 3MRQA 1OOAA 2VO5A 4ISVA 4NP4H 5DT1H 4RIRA 1OAUL 2X42A 3MRMB 3QAZC 1LK3L 4FQCL 1UM5H 2BMKA 1J11A 4GRWB 5TJWK 2ZOKB 1T83C 3LOWA 4MCZB 4QHKI 4RBPK 4U6XB 5FHBH 2AXFA 5DJ6A 3FZUC 1KPUB 5T1DL 3CFBB 3JWOL 5BRZD 4CJ0A 2Y4SA 3RY4A 1YN7B 4Y5XC 3B2VL 5IB5B 4U1KB 3O6FD 5CSGA 1IEBA 4XNZB 3DTXA 1T4KB 1MI5B 4WDIA 1B0RB 5E03A 1ADQA 5HVHC 1IGIH 4WTZA 2XA8L 2I60L 2HT4D 5D7KD 5DD0H 3W2DL 4AEIL 3MLRH 3WIFA 1EJ6A 3KPPA 4LKXB 3ARPA 2ICEB 2ERJB 2V5YA 5EH1A 4E0RA 4IRJD 4O2EB 1AD9A 4TNWK 3WUWG 5F7YC 4NCC2 5MEND 3ARGC 5IB2A 2DQIH 1EJOL 5HJ3A 4EXPX 4XPTH 3EO1A 1YUHB 2PCPB 1IC1A 4GW5A 4TVSa 4UQ3A 1RHFA 2APVA 1MLBB 4Z5RA 4ZAKB 3O3BB 3OZ9H 4KGLA 3VDCA 1GGBH 2PW2B 2CO6B 4FQ2H 3E8UL 2V5RA 1X4YA 5L2KB 3HNSH 4XMKH 1IGFL 1MOEA 1IM9D 3QIBD 2OXGA 3VD9A 4XPFH 3IDXL 1KTRL 5C9KA 3GBLA 3IDNB 1RK0A 3MOAH 5GRUH 1UVQA 2K3TA 4JG0H 4KTEH 5C0BA 2JF1A 3FN0H 2FHCA 5IW6A 1NC2A 1JWUB 4NJ9L 2H45A 4XC1H 4MJ2A 1A7QL 4OV6F 4K9EC 4FFZL 2QSCH 4QHNA 2D7QA 3F8UB 5GS0C 1JZ6A 5F93C 4PJ8C 1UCBL 3U0WL 5BV7H 1OP3H 5IVZB 4FP8L 3S96B 3D39D 3IFLH 3TT3L 1CG9B 1M71A 1RMFH 1PX4A 5EZLB 2DBLH 1FNSL 1OTTD 3H9SA 5GGQH 1OCWL 4TTDC 2ARJA 1VCAA 3WFEH 2OZ4L 4L9LB 1OT2A 1BFTA 2BHYA 4LEXL 4WWKD 3S9DB 4X8JA 4KZDL 3AM8A 3OL2A 3D69A 1MCBA 3ARBB 4M8VA 2RIKA 1X5XA 3FQWA 1RZ7H 4OUOA 4UILH 3MBEB 3VXTB 2GTWA 1ZSDB 3FQXB 3OKDB 3BMWA 3I02A 5EOTA 3RWDB 3Q3GA 2EXYD 2ESVA 2YUWA 3GBML 3PP3H 8FABA 4ZNEA 1I1YA 4XXDA 4J4PC 4EI6A 1XGPB 2JJTA 3QFJD 3VD5A 5C0CD 1KXQE 4NWTL 2ZJSL 4GW1A 5KW9L 4U0QB 3L5IA 3UO1H 3KPRD 2FR4B 1PEWA 4PGEB 5HDLA 4XWOD 2YK1L 2VB5A 4DKEH 3P73A 4HLZG 2H32A 5FCUH 1F3DH 1D9KD 4HULB 3CFJA 1DBML 1QHPA 1TTGA 3D6GA 4G6AD 4KJWD 5IB4B 4HIHA 1BHGA 5JQ6H 2HT2C 3GSXB 1YNLH 3I3BA 2MJWA 4R7DA 1Q9KA 1P7QA 4F15B 4ETQB 4TUKH 5DMKA 4XP6H 3WFBL 3PWUB 4UT7H 3BPOB 25C8L 2AK4D 1QKZH 5K93A 5C3TA 1OP5K 4X9GA 4NWUH 1NGYB 2B1HH 4QRUA 2VNCA 2VLJB 2WAHA 4LSSL 3TPUB 1MFNA 1KC5L 4U49A 5SWSD 3BH8B 4YHZL 1J8HB 5SX4H 2MNUA 4ZTPL 1QRNB 1YEEH 1ORQB 5T1KD 4JY4A 1XCQB 3MREA 3VXNA 1AY1L 1X5JA 4DAGL 4CNIB 5JPMB 5IHLB 2Z31C 1INQA 4I0PB 1BQHA 1U95A 1PSKL 2XTJE 4RAUB 3BP7B 3I2CL 3OJVC 5D9SA 4PJ5B 2NXZD 4XP4H 2AEQH 4TN9A 1QP1A 3Q6GL 4RAVA 3D9AH 4PR5A 3H9YA 5I19L 1OQOA 3D2UA 1ZWIA 3D5OF 3E6FA 1P5VA 5HHXL 1FFQA 4L4VA 3RX7A 2E6QA 3RDTB 5JW3L 1SJVA 3PQYB 2D9CA 3NFSL 3QUYB 3V4VH 1GPOL 2DQDH 5DWUL 1M05A 1LMKA 4NDMA 5ICZA 4UV7L 4UT6L 5CEZD 3C5ZB 4B41A 1INEL 3MRJA 1Q0XL 1RUQH 4ZXBD 3QJHB 2OS7A 2HP4A 4MVBD 1B4RA 2H2SD 1ZS8B 4R0LA 3BZFA 3FHAA 5DFWH 4HWEH 3QWOA 4XMPL 4MS8C 2IG2H 3QBTB 5F44A 1UCTA 1JNLL 5B38G 1A02N 1AXSB 4MD0B 1DVFC 2YA1A 4CJ1A 5JTWA 5F7KC 5I8KL 4LHJB 3E2HC 3NCBB 4PUBL 3FQRA 4HFWA 4LQFL 3MRDB 3MUHL 5DD5L 1U3YA 1T20B 1UZ6F 3U0TB 3O45A 3G6DL 5I17B 3LY6A 3ZYOA 3L95A 2QQLH 4HUVA 1MCNA 4NNYB 3QH3A 4N0RA 5F7HA 5JDSB 1JPGA 1R5IA 5ALBH 4N1HB 5TPWL 5CJ8A 1NAKH 3QYCA 3QWRA 2B2XL 1I8KB 2IMNA 2BVUA 3QNXB 5A40E 2PUQT 4R7NA 2O26U 2HRLA 5TE4H 4NQDD 5HSFA 1FAIL 2X40A 3NIGE 5H37H 3O4LA 2E9BA 3RTQC 3VFUB 1I8MA 5GS2H 2ED7A 4NO3A 4D9LH 2LQRA 1AC0A 3TN0D 1LEGB 1A3RL 3MNVB 5I18H 3AC0A 3HNVH 4J1UA 4N68A 3MGAA 1F90L 1JHLL 3U7YL 3LN5A 5C0NC 1NAMH 1K9TA 1RI8A 3CNKA 5AUMA 2BJMH 1J0YA 1FZJA 2DQHH 3CFCL 1G6RA 2BY1A 4HC1H 4JFEB 1I3GL 4NRYB 4YXKH 1DQMH 5D8JH 3MRPA 4Y4KD 1KUMA 2W9LA 2XTJC 2AS5M 4KC3B 2Z4QB 5C7XH 5K9JL 4LQ1A 1I1AD 2DRUA 5D93C 3C8DA 3L3OB 1A9EB 1U8PB 2XXMB 4PTUA 3EDKA 3GKWH 1AFVH 3RWCB 2HVKA 5D5MA 1G6VK 1B4JH 3KAAA 3G6JB 4PJ7A 2Q8AL 2FJFB 4NSKA 5LKNA 2X4PB 5ACZB 4QKXB 4F7EA 1EBAA 2FNBA 1FGNH 1JZ5A 1KGCD 1YEDA 5CCKL 5FOBA 4HIIB 3ARDD 1LO3L 4PJ9C 4RFOH 3LQZB 4EQ2A 1GGUA 3AVEA 3HTLX 4MJ6B 3DX9B 1G9NH 4CADA 3FQTA 5F7MC 1LE9A 5CEYB 1KNOB 2NY7H 4Q2ZA 2Z0BA 4OIAA 4FFWD 5D72H 3I9GH 1KEML 1OPGH 1DBKH 3RU8H 4QRRD 2G2RA 5I75C 1H8NA 4OZHA 2IWGA 1CGTA 3ZL4L 3ZO0A 3HC4H 1NANI 2GCYA 1LD9A 3DSFH 3KGRA 4ONGL 1JUFA 5DJAA 3ULUH 4U1GC 5LCVH 4MDJA 4ZG1A 3SDDC 1G0DA 2Y5TB 3L3JB 4Q0XH 3VFRB 4ONFH 3IT8D 1EFXD 4JJ5A 5D6CB 4HG4J 4ZTOL 4R9HA 4WFFD 4ZOAA 4N5ED 2VERN 2BOCA 1I1CA 1ZXQA 5D6DC 1LO5A 2FYYA 5C0BE 4XCEB 1SEQH 3MOBL 2C7UA 5GRVK 2VDML 1IARB 2WINA 2D0FA 4HKZA 3BE1H 1L0XA 2HFEB 1CE6A 1A1NA 3G5YB 1CLOH 4GKZA 4XPBL 5KOMC 3UJTL 4YHOL 2YKLL 2RGSA 3BT2H 3K8MA 5DI8A 3OGCB 5MP6H 5EZIH 5JW4R 4ZDHB 4P99A 1OSPL 1RJCA 3ZT6A 3VI4E 5ADOH 4IRSD 4JFPB 1ONQB 4RSVA 2KQMA 2Q20A 3L9RA 3H9SE 2IBZX 4NQCD 4GLRH 2V7NA 2R0WL 4UV4H 3ZZ1A 3SDCD 1VHPA 1SVZA 2MHAA 5EU5A 2ZUQC 3IETB 1Q9OB 2V9QA 2CDGA 1XF2A 4DK3A 1I9IL 5CSZA 1CT8B 2D7NA 1LO4H 3S37L 1WZMA 3ET9F 2IADA 1YEFH 2ZP0T 5HHNB 4LK4A 1MJ8H 1YPZB 4YIQB 2J1KA 5IOPA 5FM5M 1T66C 4QHUB 1G7JA 2ESVE 3SN6N 1WCQA 4DQOL 1HQ4B 4ZNEE 5EPMA 4DUXA 3DI2B 1Q38A 1QSVA 4APQB 1K4DA 2NY3B 4JFDB 4Z8FL 4R2GC 3DMMD 3V6FA 4PRNA 4J3TA 4WHTB 4NO0B 4NHCH 4FXKA 2AEWA 5BMFL 2NQCA 3MJ9H 3ZLQC 5JXAH 2E9IA 2VH5L 4ZQKA 2XQYG 1HH6B 3DWTA 3Q0HA 3TBSA 1CFNB 3NIFE 2VMFA 4OSUL 3RVXD 3ULVE 4CMHC 4HW6A 5MEQA 1KJ2A 2EH7H 3U4EB 1C08B 3ZE1F 5CWSA 5B22A 5CD5D 1MUJA 4KZEL 1UKTA 4HPOH 1S7TA 2PO6B 5JHLL 5DJYA 4N1EA 3U46B 1N64H 1A14L 4V1DA 1HEZB 1RUMH 1KCRH 1FLTX 3RI5K 3VRJA 3QIWB 4I13B 1YJDC 3VW3L 4R6UA 4XVSH 4A6YB 5HDOA 3VWKA 4KY1L 1DLFH 4LLWB 4MA3A 4NBYB 4RMQA 2LU7A 2RBLA 2VXVH 2D31A 4JAMB 1XF4A 3V52H 3QI9B 2VZ3A 3BKMH 4R4ND 5I1GH 5IBTL 1EEYA 3C09C 3MO1B 5F7FA 2NTFB 1H9VA 3OG6B 2BSSA 3AU1B 4GBXB 3F12B 1CLZL 4KROD 4JHWH 5CEZL 5BCAA 4Y1AD 1JFQH 1W0WB 2NY5H 2L7JA 4O51A 1OD7A 2UWEF 1R0AH 1SBSL 4GQPH 5ICXA 5E8PB 2WBJC 4J8RB 4PGBA 1PY9A 4NPYB 3CJJA 1OP3K 1CZ8H 2DTMH 3HAEG 3RGVC 3SDAC 3QUML 1IGTA 5L0QC 2DOCA 1MCCA 4YXHL 1NCAH 1IQWL 2FX9L 2YD6A 4MQSB 4P5TA 3PABA 3Q6FA 2CKBL 1XIWC 2OSLA 1OAQL 1YDPA 4WJ5A 1LO0L 3QQ3A 4IM8A 2OQJA 1DDHB 1CQYA 3BZ4A 5D71L 1UWXK 4MJ5A 3W9EB 2VR5A 1XCTA 1A1OA 3ARGB 3HNTL 4YX2L 3T0DA 3UXFA 4L4VE 3BGMA 1VADB 3Q48A 4R4BA 3HS0B 2IPTL 3BP6A 5HVGB 2GSGA 3R06A 3C87A 1UXWA 3PP3K 4UDTA 3MLXL 4NM8H 1HKLH 4HV8A 3DOSA 2AVGA 3PIQB 3LKNA 3MXVH 3WJJA 2NNAA 1FNHA 3QO1A 3IDIB 2HFFB 1DN2A 1FIGH 3P4OA 4AJ0A 4YNYB 4HH9B 3KYNB 3VA6A 2DQEH 4FXLA 4Z95H 5FA4A 3TA3C 1WICA 2DTSA 4UT9H 1MCHA 5EC2A 1TZHA 3JWDL 1P2CA 3PWJA 2DQTH 2FGZA 4PJ8B 2AP2A 4LVOC 3ZDYF 1BECA 5EIIA 4PJDB 1T3FA 5EO1A 1QSFA 2APTA 3C6LA 5I9QC 3FO2B 3CZJA 4LEOA 3LZFH 5EO0A 5F88B 5DHYA 3AXLA 4M43H 5IFAH 2FEDC 3QDHA 3O4LE 3QQ4A 1T1WB 2R0LH 1FE8H 3T0XA 1QQDA 1EHXA 4RAHA 4YGVB 4Z7OE 3TZVC 3ZKSD 4X9IA 5I76A 4KKCD 3NCYP 3B8SA 4AH2A 2GJZB 1OGAD 2PTTA 3D3VA 43CAA 1MEXL 4M1DH 4JKKA 1HHHA 3OKNB 2R1XA 4D9RE 4MA7H 2ZKHH 5DEGB 4R3SB 2H6PA 4KI5C 5INCB 3PWLA 1OAZL 1FVDA 4PG9B 1ZVSA 5CHNB 5DK0B 3CLEH 5SV4A 5D5ME 4M4RA 3MXWH 4UINL 4PJ7E 5DRXA 3MLPA 2J7LA 5CBEB 5EN2A 4EI5A 4X99A 2R2HB 2V5SA 5JORA 1OM3H 4P48A 5EU6D 4EJ1C 4OAWA 3QDJA 3TO2A 5E2UH 1RZFH 1FFNA 1HILB 1HYSC 2XIDA 5I71B 5IEHA 1H3TA 3UEZA 1TVHB 3NH7L 3IXTA 3NFPB 3WCYA 2Y07H 3WE6B 5IEKB 1IZJA 2HRPH 1BVLB 2G5BA 1QA9B 5DMYA 2OJZH 4YXLL 3H8NA 1HI6A 5J13C 4OZFH 3S37X 1HOCB 4OZHE 3LMJL 3LH2L 3V6OA 4PLJC 5I1JH 4H25A 4DUWA 2NYYC 4H26B 4KK6C 4RGOH 2Z35B 2NZ9C 2JTDA 2HKFH 4HDIB 1YNKH 3S97C 2DWEB 4NUGL 5KVEH 2CD0A 1FSKC 5HYQA 2WMPA 1T22B 3QEHA 4RDQG 2IPKA 3WS3A 3BWAA 1S9XB 2Z31B 3V95A 5I1LA 4P5KB 2Y6SC 3WS6C 3TO4D 1X4XA 4P2OD 1ZV5A 1Z5LB 4RQQB 3WXVL 2A73A 3ARFC 4KRPD 3QUZA 2EYTA 5DK3A 2YUZA 1KJVA 5ITFB 4LSUH 1QTYT 2MPAL 3MTRA 3CD4A 5I1CH 5IF0B 4YPGB 3BAEL 2AJUL 4HK3J 3ROOA 1UKQA 5JOPE 1QLEH 3MLUH 2HLAA 1I9JL 2PXYC 2BNUA 3BJ91 1G7PA 2Z9TA 5EG6C 3OGOE 4Y4HA 2BNQA 5F7DA 1J10A 4PBWD 4DVBA 4UUJB 3MV7A 4BFGA 2NY6D 1DEEA 4HS8L 4MXWL 5F8RC 5DSCA 3M8OH 3S98A 4JJHA 1DVFB 4EVNA 3I6KA 5E99H 3QNYB 4HH8A 1ORSB 2KL6A 2VUYA 3E2HB 3DV6B 1CK0L 3ZYIA 1SY6L 1NL0L 4OZFB 1NDGB 5ID1B 3N9GL 2DLIA 4ZPVA 1BZ7A 4LLYA 4JFYB 2VOTA 4NC2B 3IDJB 5AZEH 1JGVL 4ODUA 1WBZB 4OZGE 4WCYH 2A6KB 4MJID 4MSWB 4L29B 3ZKMD 3BPCA 3PDOB 4CAGA 4P3DB 5HYJB 1VFOA 2AGJL 1KLGA 2VR4A 4MCYA 3MLWL 4MAYC 1W8OA 3X14A 3DRTA 3NA4A 4F33B 1J1XH 2UWEA 4RGNC 5GZOD 5DJXB 3EYFA 1YMHA 4G80B 3WN5C 3SDYL 3ELAT 4MNHB 3N0PB 1TCRB 3CSYB 4JQIH 3K7UA 4WV1C 1I1RA 4V1DE 1EGJL 4ZS6D 2YXMA 5DD1H 5SX4I 2R8SH 2QHLA 4LCWA 1K5NB 1GZPA 3P30L 1Q72L 3EYOB 4U1IB 1Z9LA 2JCCB 3VE0B 1FFOA 4KK8C 3QNZA 3VD4A 3P9MB 2LAGB 4I3SL 2R1YA 2YBRA 2XTJB 1KPRB 5F9OH 1HZHL 3EBAA 1U92B 3KPMA 1NBYA 1D5MB 3HRZB 3AREA 3ZKNC 4X5XB 5SWZB 4Y16C 3O3EA 1JV5A 2WBWB 4W4NA 2W9DL 3B83A 3CH8A 3W0WD 4HJJH 1TJGL 2M1KA 3EHBD 4AY0A 4WVRA 2MOVA 1T6VN 3GSWA 2FX8L 4RMVA 5FGCE 2EDHA 3RWEB 2CLZA 3VGGA 2LAAA 4OCNC 4JDZA 1R3IH 4M48H 1FL3A 4N0YL 2AEIT 1T1YB 2QL1A 4NYLA 1CQKA 3UDWC 3V0VB 1DEDA 2FX7H 5CUSL 2V5MA 1KYOK 5J1TC 1A6ZB 3O2WL 1KENL 5GGSA 5F3BB 1YEIH 1KULA 1UZ6E 5FKPB 4HIJB 1GGCL 1G7MB 3L7EA 5J6HB 3SJVA 1F2QA 2A83A 4X7SH 1II4E 4ODVH 3SE3A 2FRGP 2W0PA 5DTFA 2HH0H 1ADQH 1HXYB 3MSPA 2R4RH 5DD3L 5AEAA 3O3AA 1HHGA 5I6XB 1B3JA 5DRZA 1U8QA 1VDGA 4RX4D 5DZOA 5ILTH 4FQ1L 5I8EA 5IIEA 1F13A 3A6OA 4XNXH 3UBXA 1WC7B 3KJ4C 4DJMA 2GUOB 2C3VB 4JO4L 4LRNH 3W9DB 2ZCLH 1CE1H 4KFZC 4IJ3C 2HJKB 5D4QA 4YE4L 5A43C 5HHPA 2HN7A 4FQXD 1FL6A 1D6VH 4X6EB 3V0AC 5T1LD 3QPXL 4CW1A 3QIUC 1C12A 1E27B 3LS4H 4R26L 4XXCC 2R1WA 2R29L 3VCLB 2PETA 4P4KD 5E8EA 3MFFB 3SKMB 5MI0C 2OL3B 2I27N 1CD9B 2KKQA 1S9YA 4LRIA 1NBQA 2NY0B 1JZ3A 4LSTL 5LXGH 4MMXC 3IJYA 2HFTA 1BX2A 2XI9A 3FT2A 2VLRD 5BO1L 4FXGA 1T0NA 1QSFE 5CP7B 4HEME 3A67H 4PBVC 5CJXA 4J23A 3JWOC 4D2NA 1FYTD 4ISVB 4DFHA 3DVFA 4O4YH 4L8DB 4RIRB 4R90H 5ENWB 2VLLA 2ZUQB 2J8OA 2BMKB 4PB0H 4C54A 4ZUSA 3K8KA 2GAZA 3QEQD 3CK0H 3P4LA 5DJ6B 2NY1D 1C1EH 3TIEA 2F53D 2NR6D 1DTUA 1CICA 1T80A 5FK9A 1CDIA 1IEBB 3KHOA 1A9BB 2YMXL 3RVTD 5FYLE 1J12A 4P46A 5GS1C 4WDIB 5C0DB 3FO0H 4M5YL 1SQ2N 4R2GB 3RUGF 1S9WA 3S34L 4XVUC 2DJUA 4CVWA 2CIKA 3HMWL 1BGXL 2NY2C 5HPMB 4ODSL 1P9MC 2F5AH 2NCMA 3RNQA 1AD9B 1MY7A 1MWAL 4I0CC 1HINH 1TETL 3UYOD 1LDPH 2A2QT 4IOIA 4XPGL 3BUYA 4XNYL 4YWGH 5HJ3B 4CMHB 3QUKA 4GW5B 4IOFD 2EH8L 4UQ3B 1JCKA 4Z5RB 1CDCA 3L5WB 4CU6A 5KG9B 3NACL 3QDJE 2ZPKL 2X89A 3C6SA 4K3HA 4G43B 3VH8B 1F00I 2B5IB 3NA9L 1KOAA 2AI0H 4GQ9H 4KI5F 1J1PL 5F97E 3P9LA 2H32H 4HWZA 1JHKH 1UVQB 2AJZB 4PJAA 5IGXH 3UX9B 5HHME 5IW6B 4C59B 1NC2B 1ZHKA 2YD4A 3V6OE 3L3KA 2W0FA 4H88H 3AS1A 1LP9F 3BDYH 1DE4A 4PJFA 2PR4L 1CDBA 5EFIB 2GYSA 2VZOA 4ZAKD 4DTGH 1PG7H 4U3CA 4L8SC 1U41A 4IOSD 4FNLH 2WBJB 3WO4C 3H9SB 4FFVC 2AV1A 5GHWL 3RL1A 5L2KD 3UTSE 2ARJB 4KKLD 4OCMC 2FGWL 2AJSH 3TNMA 1OTSD 2BOBB 3B9AA 3KPOA 3RGVB 2ORBH 1UJTA 3DUUA 3SDAB 2YC1A 1BAFL 2OR9L 1IC5L 4X8JB 4GLRI 1BJ1H 1F3JA 1XIWB 1RZKL 3H42L 5EOQH 3HZYB 3VJ6A 3MRIB 4DVRL 2H1PL 2GTWB 1H3WM 3I02B 4N8CL 4PJBA 1DBJH 5DR5H 3Q3GB 1NEZA 2ESVB 2L7UA 1MFDH 2EDRA 1PKQA 3AY4A 2FO4A 8FABB 2VXUL 3E0GA 3GSUA 1NCBH 1CXHA 5FUZH 3CXDL 2VL5A 3HN3A 4XP9L 4WTXA 4HZAA 5DUML 4MYWB 4OFIA 1W72L 5ACMA 1UB5A 1P84J 5F9WC 3UROR 4GW1B 3CDCA 4Q6IC 5CINL 3ZE1E 3BOVA 2FBJL 2BNQE 3GSNH 1I85C 1J1OH 2WWMC 5HI5D 1JI2A 1IBGL 5IMOA 2VYRE 1DR9A 2VKWA 4YFEA 3LEVH 1FZKA 3V2AR 1TNNA 2XT1B 1KCVL 3ARBD 4NN5B 2BY0A 4OD3L 2R23A 3MBED 2APBA 3L6FB 3MACL 3MV8A 4LFHG 2JLLA 4R7DB 3QQNA 1Q9KB 3QCTL 1P7QB 3HA0A 4JFHD 3QXVA 1M1SA 4QF1A 1F11A 1AJ7H 1A2YB 2QBWA 1IM3A 3IFPA 2UWEE 4QRUB 4S1DC 5IMKB 4JLRB 4PJGA 1F3DJ 4LASH 2DQUL 2PF6A 2VDQL 1DFBL 2LE9A 2CGRH 2GY7B 1NUGA 4PJIB 4UB0L 3ZYZA 5I30H 1XGTB 1YEJL 2Y7QB 4F7TA 5MERA 1MJUL 4LCWE 5J89A 2XYCA 3O6LL 3GEWB 3LHPH 1S7UA 4P2QA 5DMJB 1G1CA 2BSTA 5C8JB 3P77A 4UNUA 1RIVL 1FZOA 4L5FH 4LP4A 1RURH 5FIEA 3P0VL 1M7DB 2X1OA 5D9SB 2FIKA 4DKAA 3MLSL 4YFLI 2YWYA 2Y06H 4JRYE 4K3EH 1BJMA 2VLJD 1EA9C 3FCTA 3D85A 4X5WB 5DF0A 3E6FB 1G6RH 1J8HD 5E2JA 3OR6A 3VRLF 4K3JH 3UPAA 1QRND 3VFVA 2HTLD 5MHSE 4JKPL 1M05B 1ZLVH 4NDMB 4Z7UA 2R69L 3FTGA 1EHLL 3LCYA 1U3ZA 2EEDA 4TOYH 1NFDB 1IKNC 2ENSA 3BZFB 5I15H 3CDYA 4I0PD 3MCLH 3QWOB 1N4XL 1SJEA 1R3LA 1NBVH 3LD8C 2YPLD 3SJVE 1MPAH 3SY0A 4H8WH 4NZTH 4PJ5D 3NCYS 3S3JA 1EV2E 2XOTA 1MFAL 3X3FL 2ZUYA 4F9PA 4C57C 5ID0A 5J13B 1MRCH 1TITA 2CJUL 2QR0A 1SYVB 4EOWL 1NQBA 2X7LB 1UQSB 4UOW1 3O45B 2UYLA 3SOBL 4U7KA 4LLAA 3WLWD 2VLKB 3O6FC 4GXUN 1KJMA 2VQUA 3L95B 3RDTD 4CN6A 5ADPH 4HQQL 3QUYD 2GHWB 4BFBD 1JF6A 4NT6A 3VXQA 4H0HB 4ELKB 2QQQA 1Q9WA 1UXSA 4WWID 1NBZA 2HJFB 1IVLA 5DGQA 1E4WH 4R7NB 1ZKAA 4G7VL 2MCPL 5EU7E 3EFFB 3LIZH 4S1SH 4IRJC 3MRCA 4X6DA 4NO3B 3K2MC 3JUYA 3PF2A 3TWCH 1JPTL 3IRZA 3RUGA 5ELIA 1UB6B 4J1UB 2UVFA 2GEEA 4PBXA 3LN5B 5AUMB 5GIRA 2I5YH 2DIBA 5F7EH 1C7SA 3WHXB 3MLVH 1PQZA 3MMEA 4LSPH 4BQ8A 2WUBH 4NKIH 4JZNA 3V0WH 3MRPB 3S35H 5CJQH 2PXYB 4Y5YA 4NUJB 1WZLA 4QTIL 4QTIH 5KVGL 1NCDH 1RIUL 4PTUB 3K0WA 4RMUA 2HVKB 1LO2H 1UGNA 5D5MB 2IC2A 4PJ7B 3MA9L 4BKLB 3HRPA 4NSKB 43C9A 1HHKA 1J5OH 4F7EB 4FABH 3HR5A 2VDPL 4M6ML 4X6FA 2FO1A 4HF5L 1FC2D 3FB5A 1JGDA 3RY6A 4NQXA 4ORZC 4RWYH 2BY3A 3T0EA 2VDNH 3OXRB 1OSZA 1QACA 1S7RB 4M6OL 2EDFA 2VAAB 4UOW0 1OTTC 4JFED 3O8XA 3PWPA 3IDGA 5DEFA 1GC1H 3MLTB 4WWKC 1JHTB 4Q2ZB 3V8CA 1MCKA 4LHQB 2XN9D 2G2RB 2E7BA 3B9VA 4OZHB 4ZFFA 5FDWB 1I3RA 5EZJA 12E8L 1RUPH 3MRRB 5J9PA 2GCYB 3GSQA 1JUFB 4O9HL 4OKVB 3QXAB 2PN5A 3H6JA 4MDJB 1T89C 2KPNA 2XZQL 5JPNB 1UM6L 4PY7A 4I2XA 8CGTA 1CWVA 1RPQA 1U91A 1DQLL 1MREH 3IAPA 4JJ5B 4UBDD 3RIAK 2VABB 2QTEA 4U6YA 5DD6A 2BOCB 1KJ2H 4NP4L 5DT1L 1TQCC 5E70A 3U48A 2FYYB 4PJAE 3RVWD 2XXCB 3MUZ1 4N5UA 3I84A 1N5AB 2CKNA 1KFAH 2D2OA 35C8L 4XWOC 4HKZB 3L3DB 4GKZB 3HG1B 1NJ9B 1D9KC 2KUTA 1M7IA 2EIZB 2MTPA 5DI8B 1T7XA 3RVVC 1IILE 2BVOB 4KJWC 4PJFE 1KB5A 4Y16B 2BX5A 2WIMA 1ODAA 2IQ9H 1KV3A 3WXWL 3U6RA 3NCJH 3SQOH 3DGGA 4F8TA 1IGIL 2V7NB 3KLHD 4I18A 3TBVA 2VSCA 3VFNA 5HI3C 2OTUA 4HS6A 2MHAB 5EU5B 3MLRL 2JJSA 4M3KB 1MNUH 2XKUA 3BKCH 5FGSA 1TJIL 2X9WA 5AYQA 5F9JA 2IADB 3PV6A 2E7LA 4PLKD 3UJJL 1EXUA 4PJBE 5ICYB 3EGSA 4PFEA 4YEFA 5HVFB 4XWGH 1G7JB 2P8PA 3LKQA 1PKQE 4QWWC 3OZ9L 3UTZA 2R2BA 1CR9L 2OI9C 3INUL 1FCCA 1K4DB 3CH1A 3GBNL 4HGMA 4FQ2L 3V6FB 4PRNB 5DJ8A 2YHGA 2VE6A 1LVEA 2FEEI 4AENA 4XPFL 4NKOB 4OZGB 3EOBB 3WJLA 3KJ4B 5C2UB 3C08H 3REWA 4ZQKB 4NJAL 2E7HA 3GNMH 4JG0L 3SKJL 4P3CH 3OAUH 4OT1L 2NXZC 1KJ2B 4S1QH 3HFMH 4XC1L 2HKHH 2VAJA 3MV8E 2LVCA 5J1AB 5I1DB 2OP4H 4MAYA 4RRPG 3EYVA 4V1DB 1CLCA 1RIHH 4JPVH 5KJRL 4HX1A 3VRJB 3PWVB 4APQD 1GZQB 4V2BA 2NY3D 3VWKB 4IDLA 4JFDD 4WHYG 2UVEA 3BPNC 4NO0D 1IE5A 1BF2A 3WFEL 3ULUD 2QQNL 4ZXBC 2C3XA 2D31B 3IF1B 1XF4B 4MVBC 2PYEA 1N0XL 2H2SC 4U3XA 1CF8L 1DN0A 3AS2A 3BYYA 5EOCL 4PJGE 1EEYB 5K9QG 2BSSB 2EO1A 4HUKB 1IKFH 2FATL 1ZVHA 1GGTA 3TJHC 2FDBP 4PJCA 2YSSB 2WIIB 3MUGB 4N90D 4PS4L 2V2TA 2PO6D 1OW0C 3AGVA 3O3DA 5FGCB 4P2QE 4EBQL 1J05A 1EEZA 1NC4D 4WFHE 5GGVH 5GS1B 3ROLA 4U1SA 1IGTB 3QIWD 3GO1H 2X4OA 3RX5A 5M95B 4P5TB 4OF6A 2VJXA 3PABB 5H35A 3UO1L 3Q6FB 3G5ZB 2OSLB 4BH8A 3I50L 1YDPB 4OB5L 3QQ3B 3DBXA 3VXOB 3QI9D 4M5ZH 3T3ME 4XPHH 4MJ5B 1U8MA 1I8LA 4RNRB 1XCTB 1YC8A 1A1OB 4N9OB 5FYLH 1A6UL 4NO2A 4XCNA 2AK1H 1WZ1L 3TN0C 4U6TA 4Z7NF 2P7TA 4X6CF 5DMIH 4GBXD 2XFXB 4ZUVA 5JQ6L 2EZ0D 4XPAL 1UADC 4R4BB 2ITDB 1YNLL 4YAQA 3S4SB 1BOYA 4G8FB 4PJHE 4Z7UE 1WIOA 3BW9A 1UXWB 4TUKL 3ZDZE 1D5BA 1IAKA 4XP6L 4JDVA 4KQ3H 1C5BH 3VMPA 4LPYA 2V9TA 4LLUB 5GGTA 3LKNB 4F9LA 2NNAB 2ICES 3QO1B 4FQPA 4Y4KC 3H0TB 1IC4L 3JWDC 5CKGA 3P4OB 4I9WD 1RU9H 1K6QH 4OIIL 4WU5B 5CLTA 3SGJA 1S8DA 3VDAA 5C6PB 3C8KA 3EFDH 1RJZA 5FA4B 5TH2A 1GAFH 1YEEL 1X5KA 3NFNB 1C5CL 2DLFH 4X7EC 3X12B 4XAWH 3PWJB 4QRPA 2JELH 3UTOA 3Q1SH 1GXEA 1NMCB 1CDHA 3U9UA 2Q3ZA 3LV3A 5E00A 5C0IA 1OB1A 3CCHA 4LNVA 3ARDC 3OKLA 1IMHC 3C6LB 2WP3T 4J2XA 5EO0B 3WO4B 4J6RH 4WW2C 3ETBF 4QRSA 2R56H 4DEPC 5CILL 3QHZH 4H1LH 4XP4L 5HTSA 4PRPA 2AEQL 4A2LA 5JXEA 3WNOA 1ZGLP 1BQSA 4X6DE 4FFWC 3QJFA 5ISZA 4BZ2H 3VXSD 3KS0J 2QLVB 1L7IL 2P49B 3BGAA 2BRRH 4K9EH 5EDXA 4OBSA 1XH3A 5GS0H 2Y23A 3O41A 5FGRA 4POZD 4I1NB 2CRYA 5IHZA 1RUQL 4P57A 2IH3B 2R1XB 4TQEL 1HSAA 4IDJH 2IGFH 2H6PB 3DARA 3F7PC 5F9WB 3PWLB 4HWEL 3LVEA 2IG2L 5CIPB 1EDQA 1P5UA 5E95B 2DQFB 3QHFL 1I4FA 4WW1A 5FUOL 3VH8G 4ZSOE 4KHXH 4EI5B 3MRBB 2D0HA 4X99B 5DYOB 1G9MC 4YDIH 3FN9A 3CDFA 3LPWA 4C56E 1BFVH 5IFHL 5JO5A 3W5MA 3LEYH 4UIKL 1CFQA 4I4WB 4OAWB 3EJZC 2UY7A 1XFPA 2MKWA 5E6IA 3T0EE 3V4PH 5M94B 5E1HB 3RZCC 3SDXA 5F6IC 4IRSC 1VGEL 4BFIB 1D6EB 4KUCD 3HKFA 5IEHB 5DUBA 1Y0LA 1ZLVK 5ESAA 1KF9B 3IXTB 3PWPE 1P7KB 1XF1A 5C09A 4PRDA 4XH2A 3SDCC 3MJ7A 3GDBA 4WRLA 5JLZB 4KDVA 1XR9A 3QXWA 4LPWA 4M4PA 2OTPA 1HI6B 3BVNA 5L8KB 1AO7E 4D9LL 3EOTL 4FQLH 3HNVL 4WGWB 3BMVA 4JHAL 4H25B 3TPKA 4KRMB 4OZIF 3O2DL 4F3FA 3VG0L 1RVFH 5ESQA 4Q9RH 1V05A 1FGVL 4I2XE 2AQ2A 4HC1L 1CD1A 5BQ7B 2HT2D 1DQML 2GTZA 3DPBA 5HYQB 1FJ1B 3QEHB 2B1AH 1MJ7H 4L4TA 4WENB 3UTSB 4QHMB 3MNWA 3RBSA 1Z6JT 5ERWB 3QCVH 4MXQC 5I1LB 5CD3B 2HVJA 3BKJH 4YQXL 1CDYA 3ZE0F 1RJLA 2J6EL 5AYUH 3R8QA 1A6WL 3BFOA 3RVXC 3DX7A 1WAAF 3QUZB 2EYTB 4GUPB 5FUCE 4HKJA 3U36B 1KJVB 4YO0B 3W11C 1TZIA 1K3IA 4P9HL 3ULSA 5CD5C 5IM7A 2CO7B 3KPQB 4WEBL 3DROB 3KYMA 4I77H 3KR3L 2YZ1A 3PG2A 3NZHL 1G9NL 4YDLC 2CMRH 5IR1B 3BISA 1KBGL 1VFBA 3CC5A 5F7DB 4HKBB 4DVBB 1X5GA 4DGYH 2G60L 1RHHA 3HI1A 4QEGA 2O61B 2NY7L 2Z31D 1Z0NA 1IFHH 1YYLH 5DSCB 4ZD3L 5I1IL 3LD8B 3GI8H 1OPGL 1FQ9C 1S5IH 4XP1L 3O2VH 1BZ9B 4Q6IA 3I6KB 4BQ9A 1NCCL 4ZFGL 4NN7C 5D7IA 4ZS7L 4KROC 3WLBA 4UU9A 3ULUL 1U8JA 3M17B 3X11A 1FC1A 4ZPTB 3VWJA 2R2CA 1KIRA 4S10A 4ZPVB 1BZ7B 4XP5H 4DN4H 5E6YA 5JR1H 1OAKL 1HXMA 4ODUB 3KWWA 3PJSA 4AMKH 5CJOL 2E5EA 4WO4C 3OKKA 4OF0A 2EICA 2VKXA 5C0EB 3WFDL 2GW5A 5HHQB 3MNZA 1FFPA 1SEQL 3IFNL 3QUXA 2W9EH 2W0LA 3JTTA 4Y19A 3EYFB 4ODWB 2E6JA 5C0GA 3EOYG 5K9OA 3SE4A 5E4EB 1DVFD 4IS6A 4Q6YA 1EFQA 4A6YL 3MLZH 2VZ1A 5EZIL 1VACB 5IWLA 4X4YB 5D1ZA 2A1WL 5HBBA 1A6TA 3TM6A 1JNJA 5FFLA 4YDKL 1FFOB 4UV4L 4MA8H 1ERNA 3QNZB 4OTXL 5H2BB 2YBRB 3T1FB 2XZCL 2PYEE 3VRLE 2A6JA 4X6CA 2IFFH 5B4MC 1LO4L 5HYJD 4KMTH 3TH3T 2W38A 2BFVH 4U2ZA 2YZ8A 2O5XL 3V5HA 5KSVA 4YHLH 1YEFL 4JRYB 1R5WA 4WI9A 3RL2B 3TEUA 1AHWC 3BWUC 4ZO8A 4PJCE 3UPCA 4MNQA 1CGYA 2VQ1A 5AWNH 4F7CA 1R5VB 5FO8A 1CD8A 3GSWB 3FB8A 4JDZB 1KEGL 2C5DC 1FL3B 3DYOA 3KJ6L 1OARH 4ELMF 3RKDD 4TPRH 3WHE0 2WZPD 3ARXA 2IALA 2OK0H 4L8CA 5ITBH 1MQKH 1E4XH 3L7EB 1AP2A 3L1OH 3MR9A 1HWHB 5HGAA 2XTJD 3SJVB 2A83B 4WWKB 2A77L 5KSAA 4JREB 1A7OH 2MSPA 3A0OA 3H3BC 4U4BA 2AW2A 4HT1L 3JXAA 5FA3A 1A21A 4L3EB 5I8EB 5IIEB 4KKCC 1PZ5A 5IROC 2JJWA 3UBXB 5IMMB 4HXBL 4JFZL 5F70A 4GAGH 3STLA 3MBXL 3I75A 5FEBA 4IEFB 3K4AA 1T03H 4PRIA 5HHPB 3GMQA 4OLUH 4YEEA 4HHAA 3BKML 5D2LF 3O6FA 4CW1B 3SO5A 3MPCA 5D7LA 4ENED 3KPRB 3KPNA 1FO0B 4I3RH 1JGUH 1RUAH 3TP4A 4KV5E 1S9YB 3FFCB 4BQBA 4QRPE 5B8CA 2XA3A 1FZMA 2A6DA 3IJYB 1BX2B 3NIDE 5B3JF 1FDLH 2DTML 3P0YH 5KS9A 1P4LB 2QKIA 3GI9H 5JOFB 4JVUA 4PREA 2IPUK 2ITCA 4LKCB 1KCLA 1VPOH 1CXIA 2BCKA 4OCSL 2VLLB 3UYRH 3IKCA 3M1BB 4PRPE 3ZTNH 2Y25A 2XG5A 3JV4B 3RA7L 2GAZB 6FABH 2OX5A 4OF5A 1ES0A 4DZ8A 2X2YA 1IM9A 3QIBA 5ISZE 4M7ZC 4FHBD 1V8HA 1RULL 1CICB 5FK9B 1JK8A 3F7YB 3HI6H 4XNUH 1PY4A 2ZUXA 4P46B 3UAJC 3KNBA 2NY0D 3HPLA 1CXFA 1J18A 3KPLB 1J0IA 2NLJA 3BD5A 1S9WB 3LKSB 1IC7L 5DVMA 5IKCB 5CKAA 2CIKB 4GFTB 4H20H 4Q9CA 1FIGL 4OQ1A 4OZIA 3N1PC 3DECA 3J7HA 3TO4C 3PHOA 3WEXA 2NW2A 4P2OC 5JW4N 4IOIB 4WFGE 2DQEL 4Z95L 5DZNA 4YHYC 4Z9KB 3LQMA 4NZRH 1RQ5A 3QUKB 1JNHB 2CRMA 2NXZB 4P2YA 5DJ0A 1UZ8A 1FN4A 1WT5C 4OLXL 3RWIA 2W91A 2DQTL 3K3QA 1SYSA 3SDXE 4LU5H 5DZLA 4KMLB 3IDYB 1T6WA 2P8MB 4Z7QF 3P9LB 5C09E 4R2GD 3MGTA 4HWZB 4KUZL 3BPNB 2YA2A 3UTQB 4QGTA 5IFAL 2EDJA 4PJAB 4PIRF 3O3UN 2NY6C 1FNEB 1ZHKB 1X4ZA 2E27H 4EN3C 2R0LL 4RA0C 4N8VA 5DJCB 5FYKD 1U6AH 2ATPA 3REVB 3VXRE 3IAGC 4YUEH 1VB9A 5C0RL 5T5FL 2FBOJ 4PJFB 2CIIB 3BO8B 4J12A 5D2NC 2Q6WA 3QO0A 1U8LA 1RZKC 2FWOA 1LQSR 3B9KA 1D3CA 1OVZA 4BZ1L 2AV1B 4K3GA 3GSOA 4L4TE 1MF2H 4M1DL 3B5HA 2X4SB 4MA7L 2ZKHL 3DUUB 3OKOA 1MHEA 4WI6A 3ZKMC 3GIZL 1O7SA 3GM0A 2EKSB 4CMMB 1I1FA 4QO1A 1YN6A 5C0BD 5I1EL 3MXWL 3IJSB 1MCIA 2P44B 5GZOC 2ED8A 1NC2D 4PJBB 3TJEL 4BQ6A 4TVPH 1NEZB 1BQLL 3U0PA 1LK2A 1PKQB 3KLDA 4ZS6C 5E2UL 2VL5B 1RZFL 1YY8A 5IQ9A 5A2JH 1JJUA 2DYPA 4Q7DA 3L3IA 1UB5B 4F7PA 4NM4H 3ZDXE 5JOEA 5CZXD 2X1PA 3H9SD 1JNNL 3T4AA 5K33A 1N2RB 2AV7A 4HPYL 5DQJA 5IMOB 5EZOH 1ZHNB 3RGVD 3SDAD 2XG4A 4Y4KB 1MCWW 3QRGL 4WEUD 2EECA 1XIWD 2BVTA 5ANMB 4D9QE 1QOKA 3CFEA 2R23B 2V17L 5D7IE 2I24N 5I1JL 5D1QA 4KDTC 4GMSL 1A0QL 5IG7A 1MHCB 2ESVD 4MX7B 1T1XA 2HFGL 3FT4B 5KVEL 1UG9A 3C5JB 3OF6A 3L7FA 1MHPL 4QF1B 2X4NA 4RISH 5TQ2L 1F11B 5HHOB 5D70H 5EULV 3IFPB 3FRUA 3S88H 4N0UA 4WW2B 1B2WL 4O58L 2F74B 4MHHG 4PJGB 4DEPB 4Y19E 3NGBC 3T8XA 3ULVD 2RCSH 1U93A 1FBIH 3QWQB 5DHVB 4LSUL 1U0QA 1O0VA 5E8DL 5I1CL 3DRQA 5CJBA 3AS0A 1G0XA 3HZVA 1KCSH 4MLIA 4P2QB 4WY7L 3LDBC 5E8NA 2IAMA 5IV2A 1RFDL 1QLEL 1P7QD 4M1GH 5DRNB 4OCLC 1CFTA 2EO9A 1FZOB 3VG9B 5L9DL 2CKBA 4TNVF 4Z7NE 4X6CE 3NN8A 1CL7L 4FQXC 3S4SG 3UTTB 3JV6A 1EO8L 4G9FA 2IQAA 4D3CH 3WKMH 4MNQE 5FGBA 2ICWB 3D25A 2EYRB 5D2LA 4NQSA 4S0TD 2DM3A 4I5BB 4B5EA 4XVJH 4PJHB 4Z7UB 3VXMA 3MRKA 3FONA 3RZCB 5IJKA 4ZUWA 5HXMA 1TPXB 4MNGA 3ARUA 1OHQA 4QXUL 1SJEB 1R3LB 1N7MH 1MFBL 4UQ2A 2JJUA 4LSDA 1BEYL 2C1OA 1NDMA 1NAMA 2DWDB 4IMKC 2D7MA 3S5LA 2GSIA 1EVTC 2XQBH 5ID0B 3ZE2F 4LLQB 4JQIL 4D0DA 2DM4A 2QR0B 4RGMC 3D2UD 3MV9A 2OMBA 5BVJB 4LPTA 1C5DA 4CVUA 2R8SL 1I1AA 4L4VD 3RVTC 4NQVA 3DYPA 5CBAA 5BJTB 4NT6B 3VGAC 3BN9D 4OD1L 1Q9WB 1NBZB 4PRIE 4QXWA 1EZVY 4FQQA 2F54A 3NPSC 3LEXB 1HYSD 4JPIA 3HI5H 5F9OL 2FHBA 2OL3L 1ZLWH 5D7LE 2I9TB 5FHAH 1KTLB 1MH5A 3ARDA 3TVMC 3MRCB 4JN2A 4X6DB 3MRHB 3RHWF 1EBPA 1V7MH 4O2FB 5IB3B 3OR7A 1OAYH 1QFWM 1YECL 2AJYH 2B4CH 1J7VR 2HWZH 1VGKA 5GIRB 1ZLSH 1MIEH 1R3IL 5C92A 2C1PB 1BLNA 4K94H 4HIEB 4PLJD 2NXYC 5SV3A 2UY6A 2VLKD 5KS9E 3IFOA 4UTBH 4JZNB 5DJ2A 2CLRA 4CU8A 3SKOA 1FPTH 2NZ9D 4CVXB 5J6GA 2FX7L 3A6BH 2Y36H 3OG4B 1X7QA 1GGIH 3QWRD 1YMMB 4YDLB 2J8HA 1TJHL 3LN4A 1RZIA 4X7SL 4WNQA 1KB5H 3MLYL 4LSRL 2ERJC 3LKRB 4JG1H 4ZSOB 4AM0A 1HHKB 2MKLC 5J0BA 2FJGA 1F4YH 2P43B 1ADQL 3HR5B 5CGTA 1JP5A 4X6FB 1GOFA 4C56B 2ZUSA 1WEJH 4NN7B 1UWEH 4GW4A 4JO2H 4M7LT 4OM1L 1WVZA 4L3AA 3MRGB 4OCYL 3RY5A 2NTSP 3UJIL 1WCBA 5E94A 5T3ZH 1D5ZA 3PWPB 2VISB 4KKLC 4HMDA 5FYKL 3IDGB 3DX6A 3PHQB 5DEFB 3VFTA 4WO4B 4OZIE 4D9RD 3EYSH 3O9WA 4WUUA 3CFKA 4W6XB 2Z8VC 3WUWA 3EYUL 4IIQA 1AO7B 4NQCA 4ZFFB 1I3RB 4PP2A 3DVGA 5E5MA 5J9PB 1MFCH 5IW1A 3GSQB 5GSRA 1XGQA 5LG1A 5HY9B 1VFAA 1YJDL 5TGBB 3UC0H 3ZE0E 4P2RA 4H0IA 3AMKA 4I2XB 1U8IB 2YD5A 5I8OH 5E08H 2DQJL 2YPVH 4XX1E 4U6YB 4KWUA 5DD6B 4QXTA 3T0BA 1J0ZA 4P59L 5KANI 4R90L 4G8EA 3WD5L 5HI5C 5I74C 2P5WA 2YD7A 4L9LC 3DMMA 3N85L 5DVOA 3CK0L 2HTKD 5DUPL 1YC7A 3ARBC 4BSVB 3RWGA 2C3HA 3MBEC 3MJ9A 1KB5B 1ZOXA 4F58H 4LCIH 4TULH 2OXHA 4HSQA 4F7MA 2DDQL 3U6RB 2QSQA 3ZTJG 4ORGB 1LEIB 3DGGB 4PRAA 3BQUA 3VFNB 1E4KA 2OTUB 4HS6B 2HMID 3FT3A 4JR9H 3IS0X 4LMQI 3FAWA 5LGHH 3OHXA 4X80L 1FCGA 2FL5A 1MRDH 4YWGL 1ZT7A 3EGSB 4K2UH 4HJGB 4FQIH 1R3JA 2P8PB 3LKQB 5KSBA 4HD9A 2WWKO 3HG1D 3RJQB 3ECBA 1FH5L 4LCCA 4OJFL 3D87B 4NQTA 3GKZA 1UM4H 4G6FB 4Y16D 4OCRH 5DJ8B 1RK1A 4Y8AA 4AENB 1KLFA 3GIVA 4PV9B 4QTHB 4YHIB 3ULVL 4M1CD 5JOPD 3REWB 2CK0H 5J11C 5BV7C 1WIUA 1YQ2A 1ZT4A 3AB0B 4PGCA 4OCXH 3NZ8A 4KVCH 5E1AA 1WGOA 3P11H 3RWFB 4DUVA 5JNYB 4BSJA 1H8SA 2MMXA 3HUJF 3BDYL 1EGJA 2O5ZH 1KLUA 5BZDA 2DKSA 3GZKA 5GGTH 3SE8L 2ZUUA 1F5WA 4WUKL 2J88H 3C2AL 3UBXI 5B39B 1DBAH 1YEHL 2VIRB 3QULB 5E2TL 5FECA 2AJSL 1TENA 4HUWB 4JO3H 1DBBL 1TQBB 4URTB 1DLHA 5I66A 1AQKH 5KTEL 2ZSWA 1DN0B 4N0UE 4QY8B 1QUNA 3G6AB 2L0DA 4I0PC 4UIMA 1ZTXL 2ATKB 5DJDA 1ZGLA 1FORH 4P9ML 5TQ0L 2ADGB 5L88L 4QT5B 5DR5L 4PJCB 5L7XL 1Q0YL 5TE7H 5TFSH 5HYIA 3QP3A 1TIUA 3O3DB 5FUZL 2XICA 3C60A 4V1DD 3WLWC 5SWQB 1XGUA 4L4JA 4YR6A 1EEZB 1VKXA 2UZYB 3RDTC 1LK3H 4U1SB 4QYOA 1AHWA 3QUYC 2X4OB 3VWKD 1U42A 5EBLA 2OTWA 5H35B 2P46B 2KZWA 4BH8B 2DL2A 4ETYA 3MV11 3LEVL 4LLMA 3B2VH 3KXFA 3MRFB 4M62L 4F37F 4G9FE 1U8MB 5FF6A 5EWIL 5IJVB 3WFCL 1CLYL 1Q94B 1E4XI 2Q86B 3GGWB 1U8NA 4NO2B 2P7TB 4F8QA 3SO3B 2D9QB 2XA8H 5D2LE 1DQJA 1RV6X 3LKPA 3W2DH 4AEIH 3BW9B 3T4YA 4Z7WF 3VXME 1F3RB 1IAKB 4NCC1 1XR8B 3GMPA 3R0NA 1ZHBA 4MNGE 1EJOH 5FKAA 5F1NB 4QRTB 1AJ7L 1NCTA 4P5TD 4CDGC 4OD2B 2NX5E 3F7VA 3C8KB 4KH2A 1RJZB 4J7RA 4HKXA 3BIKA 4Y2DA 3A6CH 1HCVA 3U79A 3JVGA 4MZ3A 3E8UH 4EN3B 1BIIA 1IGFH 2FJHA 4M61A 1K8DA 3MV9E 3NAAL 4LAJH 5IW3A 4OF7A 1H0DB 4HK0A 3LV3B 5D2NB 5C0IB 1AGCA 3P0GB 3O0RL 4K23L 4DZBB 3CSGA 1XGRA 4NJ9H 2I9LB 4XI5D 4EDXA 1CGSL 1QBBA 1A7QH 1TZGH 5AAWA 2F54E 3I6GB 2GFBB 1S7QA 4FFZH 3FB7A 3PGFH 1EIBA 4PRPB 4EUPG 2V7HA 1UCBH 3LS5L 3U0WH 3SBWA 5ISZB 3TT3H 4X9HA 1N6VA 2CDEA 4HFUH 4MJ4A 3RWJA 3PGDA 3O41B 2EDNA 4LEXH 4QNPF 1F8TL 4EIGB 3IYLW 5IHZB 4GS7B 5FM5O 3ZKQD 1K85A 1CGWA 5IHUL 2GKIA 4WGVB 4P57B 4DGIL 4UBDC 2K9UA 3IRPX 3C6LD 4BH7B 5I15L 5JA9A 3CFIC 5D1XA 3GBMH 1I4FB 3RVWC 4GRWF 4GRMB 4NZTL 5EBWA 3GMOB 2A9MH 1JPSL 2X70A 1FNLA 5J12B 2APWA 1U3JA 5C2BH 1MRCL 1YNTA 1FL5A 3TV3L 5A16B 4OV5A 3IU4H 4NWTH 5JO5B 5KW9H 1I7UA 5F71A 1CFQB 4MQ7A 3OBAA 5E6IB 3O11B 3SDXB 3W0WB 2W65B 1OLZA 2YK1H 4XBGA 2Z92A 3DHMA 2DI8A 1MCRA 3THML 1Y0LB 2GJ6A 5ESAB 3CDGA 4PJXA 3KLHC 5C09B 2A74A 4HZLA 5EBGA 4WUUE 4TSCL 4E42B 4EDWH 2JIXB 3BVNB 1IEAB 1N59A 2YWZA 4NQCE 1A5FH 3VD7A 4K3DL 4PLKC 3QZWB 3V6ZA 3VXRB 3RFZC 3WFBH 5T5NG 3EJJX 5GJSH 2XZAL 5DQ9B 3T0AA 4EI5D 2WQRA 2VDRL 25C8H 3VMOA 4F3FB 2X4QA 2A9NH 4P2RE 5ESQB 3MLVL 4LSPL 3EYQC 4K8RH 1U8HA 3LDBB 4WI4A 4L4TB 4LSSH 1KN4H 2EDYA 2LTQC 1HH9A 5JW4Q 1KC5H 4YHZH 5GISL 1NEZG 5DS8A 7FABL 4ZTPH 2HVJB 5DRWB 3CFDA 2NW3B 3BGFC 2P5WE 3LPGA 1RJLB 4JB9H 3TBTA 2ADIA 2YS4A 3DURB 2X6MA 1B88A 3PNWB 4FQXB 1L7TL 4YHNA 4HUXA 2UZIL 5L8LB 1PVHA 1A4JA 1AY1H 1ZLWK 2YOCA 5EU4B 1G9NC 1SHMA 1FV1A 4M93B 1TZIB 2EEBA 2Q8BH 2GITB 3SKNB 3UPRA 1RZGA 3ULSB 5IM7B 1JF1A 3FOMB 1XEDA 3TCLB 5FO9A 4RWYL 5A2FA 2NY4B 3I2CH 3R1GL 3KYOA 2NY3C 1IZKA 4MZ2A 4KTDH 4DFIA 4JPKL 4WTWA 5KSUA 3JUZA 5I19H 3UTSD 3HUJA 4XVTL 3ULUC 4GAJL 5C0JA 1RHHB 2M26A 1FLRH 4MQXC 5HHXH 4D0BA 3RJDA 5MEOA 2ZOLB 1T7VA 5JW3H 3CXHK 3O4OC 1GPOH 5DWUH 2VITB 1X5HA 3TYFA 3QUZD 5KSBE 4UV7H 4O00A 5D7IB 3SCMA 1IAIL 4DCQB 4UT6H 3QEQB 1INEH 5F1SA 1Q0XH 1U8JB 3VWJB 2RB8A 3GMNA 4JPWL 5T1MA 2JB6A 1IGJA 3P3YA 2PO6C 4OGAD 1HXMB 3CMGA 1R3KA 3KWWB 1JNLH 3LRHA 1MREL 3RI5F 3WYRA 5I8KH 5HDBE 3QIWC 2G75A 3VGAB 1KJ2L 4HIXL 1ED3A 1HWGB 1MLCB 2DLTA 4LQFH 1FFPB 2BNQD 2OJEB 3QUXB 4PG2A 5DD5H 5KN5B 5EIQA 5T33L 4M9OA 3U1SL 1GH7A 3JTTB 4PJEA 4Y19B 3G6DH 4Z7VB 1QPXA 3PGCA 1CGVA 1AD0B 5BW7C 2Q7NA 3TVMB 1B9ZA 4M6NH 2BRQA 5TPWH 3ZT5A 3DVIA 3V5DA 2B2XH 1S78C 4GBXC 4OFKA 2EZ0C 3OKEA 4Z76B 1I7TA 2FECI 5F8QC 2XWTA 1WWWX 2DMCA 4LF3B 2DKUA 1A6TB 5FB8A 4ODXA 2NXYB 5F1OB 3GSRA 3HZKA 4KJYA 1CN4A 2IBGA 1A3RH 1AR1C 2CLVA 2AXGA 1F90H 1JHLH 1ND0A 2R4SL 3U7YH 5KSVB 5JW5A 3DSNA 1A7RL 4Z7WA 1S5HA 4XWGL 2W1NA 4RMWA 3MYZA 1I3GH 4MNQB 3AFLA 2F8OA 5I16B 5FO8B 2EC9U 2CRZA 3HLAA 3FB8B 4X7DC 4NKMA 1HHIB 4PGJA 5FCSH 5K9JH 3IVKA 2O93L 5H8DA 4JZJA 2VUOA 4GOSA 4P4KA 2KQNA 3ZE2E 3DIFB 5DGRA 3HAEA 3C08L 2Q8AH 2P8LA 2VDOL 4XRCB 4OKDA 5J3HD 4J3OC 1UJ3C 2P45B 4P3CL 1AP2B 2H3NB 3MR9B 3KXFE 3CLFH 4P23C 3VI3F 4DGVL 5CCKH 1LO3H 4JRYD 2H8PA 4JM2A 4A2MA 4X4XA 1K2DA 1F4WH 5FA3B 1RIHL 4FZ8L 4JPVL 1OGTB 3G08A 5F3HA 4AL8H 4UTAL 4JEGB 4U1NB 3S6CA 5MHSD 1VERA 4POZC 1NCWH 1KIQA 3C9NB 1KEMH 4PRIB 1WISA 1EO5A 2FSEA 2F53A 2NY5C 3CUPA 2R0KH 2HG5A 3ZL4H 3LSOA 5MEPA 1T7WA 2DI7A 3P4NA 4ONGH 1YEKL 1UT9A 5D7LB 5I74B 1EK3A 4K7PY 3SJVD 1UWGL 4GG6A 3D1MC 1UWXH 2VC2L 4OLYH 3U9PH 1AGEA 4ZTOH 5B8CB 1EX0A 1FZMB 1ZT1A 2A6DB 4X0KB 5IK3B 3FQNA 4L3ED 1SJHA 1HDMB 3MOBH 3MRMA 4U6HB 9CGTA 5FYJL 5KS9B 2ZOKA 1X5AA 2ZNXA 3H9HA 4U6XA 4P2CG 1BD2A 5F7UA 4GG8A 2ITCB 3UJTH 4YHOH 2YKLH 2EYSB 2BCKB 3IKCB 3UTPE 2DICA 1YN7A 3IDMA 2WLYA 3OB8A 1LEKA 5IB5A 1QO3A 1ZA3A 1WFNA 4M7LH 1T21A 2FH8A 2IBZY 1MI5A 5IVXA 1B0RA 4Y5VC 3IKKA 4ZOCA 2R0WH 4IMLB 5D7SL 1WITA 4CN4A 1PBYA 3FFCD 5I0DA 1I9IH 3RVVD 3HPLB 4ZFZB 3S37H 3LRSA 4O2EA 2NLJB 5BS0A 2Q7YB 1AKJA 4JRXA 1ZAGA 4P4RA 1YUHA 2PCPA 3UZQA 5I71C 4OZIB 1MLBA 4ZAKA 5J11B 4HWBA 4DQOH 5HI3D 3PHOB 5BV7B 5I1AA 2PW2A 3R8BB 4L3CA 4Z8FH 1N26A 1B6UA 5L2KA 3WIIL 1UZ8B 2H9GB 3U7WL 5BMFH 1WBYA 4U7MA 3PDDA 3FO9A 3RWIB 2VH5H 3ZKXB 2V5TA 4HCRL 1RD6A 1CICD 2DQCH 1SYSB 4OSUH 4P46D 4QWWD 2GJ6E 4GRLC 3H2WA 1JWUA 4PJXE 4YH6A 3MGTB 4PRHA 3S7GA 5D7JA 2R56L 1IGMH 4JZOA 4KZEH 5LGJB 5JHLH 2RFXA 1UH2A 3OXSB 1PW3A 5F7NC 3S96A 1CDUA 4N8VB 4PGDB 4BZ2L 2ATPB 2YPLB 1BM3L 2X10A 3EDJA 4KY1H 4R8WH 2BRRL 4H0GA 4KPHL 4DW2L 5E24E 3QO0B 1U8LB 3WDJA 3GSNA 3RWHA 3VRIA 2FWOB 3IGAB 4IRZL 3B9KB 3DHJA 5A2LH 4W70A 3O81A 5IBTH 4R96B 3H7BB 5F1KC 4JQVC 3WBDA 3DX8B 1U58A 4NRXB 3OKOB 3FQXA 3OKDA 1BBJA 2BP3A 1CLZH 3VMNA 3RWDA 1I1FB 3QCUL 1FFRA 3AS3A 4ODHH 2V9RA 4JFFA 1YN6B 3KPSE 1SBSH 2YUVA 2H26A 4KHXL 3DO7B 1XGPA 2MQCA 3U0PB 1LK2B 3QUMH 4YDIL 1BFVL 3LEYL 4YXHH 2FX9H 1JPFA 4FMFA 2CKBH 2A0LD 3TJHD 1MY5A 1YY8B 3VGHA 4PGEA 5TDNA 1F4XH 2DYPB 1LO0H 3L3IB 4F7PB 3C8HA 1DL7L 5L6YH 3GMLB 1LWRA 1U3HA 3BRFA 5J06A 2R39A 2AV7B 1B0GA 1B90A 4KQ4L 4HXAH 5EBMB 3HNTH 4YX2H 5IB4A 3W5NA 4JDTL 4AEEA 1X6NA 3MCG1 4G3YL 3GSXA 3GMMB 2IPTH 5B39G 3QRFM 4NGHL 5HYEA 4YHML 5L8JB 1JGEB 3CFEB 2OLDA 3MLXH 1YPZF 4Y4FA 1RZJL 2EEAA 5D1QB 1BIHA 1UC6A 4W68A 1UACL 4K07A 2H2PD 1NGXB 1MCJA 1NUFA 4QRQA 3RKDC 2VLJA 3G9VA 1LE5B 2B1AL 1MJ7L 2ADJB 2X4NB 3TPUA 4PLOB 2R2EA 3BH8A 1J8HA 4AT6B 3F6LA 1R24B 3FB6A 3BKJL 1EMTL 1T2XA 3FRUB 1ORQA 4N0UB 5CGYD 5AD0A 3JWDH 4PJEE 5I2IB 1AE6L 1XCQA 4Z0XB 3GRWA 1U93B 1U8KB 3VFMA 5JPMA 2XN9B 2GT9B 4XNQB 1ZEAL 1SEBB 4RAUA 5E8NB 2C9AA 2IAMB 1A6VL 1YEGL 2VL4A 4PJ5A 5LAXB 1CFTB 1QR1A 1INDH 4OBRA 2CMRL 3RNKB 1QFHA 5CGMA 1GOGA 4UZGA 3K81A 3NN8B 2VZUA 2Y1VA 3TCXA 4HUNB 5HHOD 4AEHL 3P9WB 3PQYA 4Z7WE 4G9FB 1YQVH 4ENEC 3NCMA 4XZUA 2Z8WC 3C5ZA 2YXFA 1JZ7A 3QJHA 3TGXA 1BREA 1S9KC 4XP5L 2Q76A 4NQSB 3BP5B 4KK9D 3VXMB 1PAMA 4P2QD 3MRKB 5I6XC 1I9EA 3V7AG 1GIGL 4O5LL 1DANU 4ZUWB 2BNRA 4UINH 4WFHD 4Z77B 4MNGB 4FQHA 5H94B 5I1HH 4Q97A 3MRDA 1MHHA 1HQRA 2W9EL 2NX5B 2M8XA 1T20A 3SEPA 2C1OB 4OCWL 1ZANH 1NAMB 3BP4A 5I17A 3S5LB 2GSIB 3UTTD 4YZFE 1LNUA 4JQXA 1KXVC 4D0DB 3VDBA 4OUUB 3D85D 3QPQD 3MV9B 3MLZL 3SPVB 1C5DB 3NH7H 1A1MA 1A6PA 3VXUA 1T0MB 2CUHA 4LGSB