1R3JB

Potassium channel kcsa-fab complex in high concentration of tl+
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords Antibody Fab fragment light chain
total genus 37
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3jB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3jB02
4WUUE 3O0RL 4C4KT 1D5IL 4OCRL 4LEXH 4FQXA 3OAYH 4I5BA 1BD2A 3HZMA 1ZHLA 4OLEA 3NFPB 1VADA 2VUOA 3LKQA 2W9DH 4EN3D 3HMWH 1JP5A 1OY3B 2VXTL 1MJ8H 1J1OH 3ZKMD 1LDSA 2E9BA 1Y6KR 3RL1A 2JF1A 2IMMA 2MCPH 2AK4E 3T2NL 4FZEL 1UFUA 1OF2B 3O2DH 1XCQA 3IFNH 5J0BA 1IVLA 1WBXB 3U4EB 1VKXB 5IB3B 2R1XB 3UBXG 3TCXA 1IRAY 1QSEB 4J8RA 4U1MB 4HPOH 4U1LA 4L4TE 4XVTH 3CVHA 4X4MA 4JFDA 4IMKA 3WO3B 3D85B 3FFCA 5HPMB 2R2BB 1JWUA 3S5LG 5IKCB 4IIQB 1KEML 4ZUUB 3ZE2F 4PP2A 2BSED 4GMTH 4PRNA 3KPTA 1GSMA 1U41A 3LRHA 3PV6B 1FLRH 3KPQA 1WIUA 1DANT 4PGBA 5HGDB 43CAB 2HRPH 3DSNA 1XCQB 2LV4A 3WKNA 1OTSC 5LCVL 1TQCB 4GAJL 3LKRA 4YO0B 3QNYA 3G5XA 2A77L 3RWCA 1IGCH 2WSKA 1ZEAH 5C08E 3PP3H 4QTHB 1CBVL 4YXKH 2ED7A 5B38G 4DVRL 4JY6B 4TULL 1T83C 3AUVA 4ZFZB 4KI5C 1KYOK 3OAUH 5EO1A 1P9MA 4IRJD 2Q7YB 5A16A 5F71A 1MFBH 2APXA 4DUXA 5CBEB 12E8L 3QWOB 4JO4H 5DSCA 1P2CB 2BSTB 4LLWB 4M02A 2FSEB 2YK1H 2P8MA 4K9EC 5E4EB 1NDMA 4ELKB 5IIEA 3QH3B 5C08A 2ADGB 5I16A 3P73B 1HQRA 3ZKXC 4M43L 4QNPE 5I17B 2ED8A 5GGSA 4LARL 3WFEL 4HWUA 1FNGB 2BNRB 4XH2A 1ZLSH 3LEVL 5CP7A 2P47B 4CMMB 2ZUYA 3REVB 3I75A 1D6VH 4NO0D 3VI4F 2V5RA 1XF4A 5EZOL 3F62A 3ZE1E 3QI9D 1JWMB 5FA3B 3KLDA 3PG2A 2FATL 4KK6D 1CFQA 2WP3O 1UKTA 4IMLB 4PY7A 5BO1L 1RUQL 1OGAB 1T1YA 3NCJL 3QUZC 5IT2L 3MRJB 1BWMA 3QEQA 3E2HC 1ND0A 3FQNA 2AEPH 3N85H 1XEDA 1BZ9A 4HBQA 5I8EA 2H2SC 4KK9D 2B20A 2CXKA 5DURB 4NWTH 1JGUL 1ORSB 2NY7L 2P5EA 3H9SE 1WC7A 1FQ9C 2EE2A 4X8JA 5F9WB 5EU5B 4U1JA 2HN7B 4GO6B 2NXYB 4F9PA 5IR1A 1H5BB 4DN4L 4ETYA 3BEWB 4GUPA 4JG1H 2WIIB 1T2XA 1QD0A 4NJAL 3B9KD 5L2JB 1N4XL 1CL7H 1IL1B 1XCTA 2F54D 5HDQH 4KQ3L 4YXLH 3U6RA 5DJ0B 1Y0LA 1R5VA 2H26B 1ZVHA 2NTSP 5L8JB 4JE4B 1NMAH 3VWJD 3LB6C 1A6WL 1R5VB 3D48R 5DJ0A 3B43A 5KAQF 1CR9H 3GZKA 4NQEE 1IAIH 3MOQA 4I13B 4FNLH 1DCLA 5C0EB 2B1HL 3QP3A 2ZPKL 5D7LB 3S35H 1YEDA 3QUYA 1MRDH 3EJZD 3MBEB 2E5EA 3BQUD 1CL7I 5EUOF 3SDCB 3VFNB 3H9YA 3SDYL 4HD9A 5EU5A 4TN9A 3C60A 1NJ9B 4ZUTA 1ZGLP 2AK4B 5KSBF 4ZTPL 4WV1A 3CSBA 4JFFD 3H3BC 4X80L 1GGBL 2F74B 3S36H 3FQNB 5TE6H 1K8DA 2AJ3B 1CR9L 4PJDF 3U4BH 2XTJB 2V2TB 1OTTC 4JFYB 3T1WA 1JPTL 4NRYB 4M8QA 5SWZD 5ACMA 2FO4B 4GRMA 2I5YH 2YD5A 2V7NA 4G5ZL 2C7UB 1C5DB 5FO8A 1VESA 2ZKHH 1I9IL 4OD3H 4KKCC 1J8KA 5TPWL 3OKKA 4XPHH 5DRXA 5DUML 1YN6A 3ZDZE 4JQXA 3T4YB 1X4XA 2P1YA 1A3RL 1NDGB 1ZVSA 4UQ2A 4ODSH 3RZCA 2F8VA 4QXGH 2YA0A 1I1YA 1FPTH 4WU7B 2X10A 3ROOB 5I8EB 3CCHB 3FB7A 1IKNA 2XFXB 1IBGH 3E1F1 2NY3C 3VU2A 1LHZA 4M1DL 4MD4B 3TO4D 5HHPB 5IQ9A 5DMKB 3GSOB 3RVTD 3BRGC 4JPWL 1CDBA 3S37X 1N6UA 1WCQA 4HIEB 1LDPH 1BQHA 4G8IB 4GT7A 4F7TB 4FXGA 3MUJA 2GTWB 2G75B 3VFSB 2AXFA 5IOPB 4YQXH 4MA7L 4Y8DC 2EXYD 1MFEH 4OD2A 1MH5B 3QDHA 1JPFB 4G43B 4YX2H 4PJEA 5CBAA 2FBJL 4TUKH 2D0FA 2VXVH 4YDIH 2CH8A 3KYAA 3MXWL 2HH0H 3OZ9H 2G2RB 1RIUL 1HQ4B 4NO0A 4FP8H 5E8NB 5TQ0H 1SYSB 1RZJL 5DR5L 4NN6B 3CSYA 4OF5A 1UB6A 1H0DA 3QUKA 4KRPD 1Z0NA 3BZEB 3GO1H 3S7GA 4F58L 4XBGB 5I1KL 1Z6JT 3BD3A 2EEBA 4WGWB 1DBML 4OUOA 3HC0A 3MLPA 3FQWA 3OG6B 2CK0L 3UTOA 1AHWC 1QLFB 3ULVE 5EBGA 1ZA3B 5IGXH 4WUUD 5GS0L 2R2BA 3CCHA 4ORGB 4KRNA 2EIBA 3QI9C 4X7CC 3LPGA 4Q6IB 2LAGB 2Z8SA 4UI2A 1KENH 5EUKA 4RZCB 4UTAH 1CS6A 4HGWB 3K46A 3L9RA 4PGEA 4HFUL 3DV6A 4KTEH 3RTQD 1G7LB 1H3UA 4KKNA 3KPPB 1RSFA 2FEDD 3W5NA 1I8IB 4LQ1A 3UTTB 1WZKA 1F5WA 4P46B 4F2MB 4WVRA 3VGGA 3F8UB 1G84A 1GCFA 1FVCB 1UZ6F 2DQTH 2IFFL 4NKIL 2LQRA 5KVEH 4YHIA 4HIHB 5D1XC 2XTJE 3C09B 5DK0B 3C09C 1AQKH 4JO1H 2AK4A 4LGSB 3JXAA 1NFIB 4O4YL 1BBDL 1L7IH 1XF2B 3EYQD 3MLYH 3F6LA 3W39B 2CUMA 5JW5B 3O3UN 4JFEA 1JHTA 1KYOJ 4WI7A 4Q9BA 4Y5XB 3J7HA 2FGWL 5CJXC 4O00A 2RB8A 2L4OA 2W60B 3MR9A 1ZT4A 2WZPD 5HHMB 1D6EA 4TVPH 1PKOA 3ULUE 3RHWF 2H9GB 3QEQD 4MQ7B 1CF8L 2NMSA 2NNAA 2Z4QA 3VFPB 5D96C 1X5JA 3H7BB 1HYSD 1ZVYA 1Y0LB 2H26A 5DD6A 4BA8A 4URTB 4HWNA 2GYSA 5CSZB 1BBDH 1L7IL 3FRUA 2P43B 4JFZL 4GQ9L 4ETQA 3S96B 2JIXA 4JRYB 3HC4H 3WHXA 1RVFH 1TCRA 1UB5A 3X11A 1MJ7H 4WW1A 1E4WL 4NOBA 4PJBA 1DSFL 4RCAA 3CFEB 3VFOB 1NAML 5F8RC 3D2UD 1S8DB 2VYRE 2D03H 3VRJB 1CD0A 2Z93B 4O2EA 4G9FD 1CLCA 4GKSB 4JZNA 4OLZL 3DXAB 1FL3A 3QDJB 4RGOL 1W0WA 3DHMA 4N8VG 1A6WH 3VXNA 4F33A 2PN5A 3INUL 1EIBA 1INEL 5HGHA 4UUJB 4PIRF 1T22A 1FAKT 2YS4A 2Y25A 4M48H 5I15H 1MVUB 1W0WB 2EO1A 2VDPL 4UV7L 1D7FA 3LDBC 4Y5VB 1KJ2H 4N8CL 1WFUA 3P11H 2QTEA 4HUVA 3P4NB 2CSPA 1IC5H 4DKDC 1T04B 4PJBE 1R3IH 2AJVH 3U7AA 2P8LA 4ZOBA 4FQXC 1M4KA 5INDA 1IM9D 4S1DD 4D9QD 1G7MA 1FNGA 2BNRA 4XH2B 4GG6B 6FABH 1PYWA 4H26B 4F7CB 2X4UA 5FF6B 3N1FC 3TBTB 1CXHA 4MNQE 4KH2A 3VWKA 2DLTA 2WWMD 5LG1A 5JOPE 3LOWA 2VZUA 5HD8C 1N6QH 1S9WB 4R6UA 3QEGL 4N5ED 4XP9H 4JDTL 4LP4A 4D9RD 1K3IA 1MIEL 2P8MB 5DUPL 1NEZG 4JZJA 4WW1B 3K8LA 3QUML 4NSKA 1UWXK 4G9FE 2CRIA 1I75A 1FCGA 5K33A 1CLYH 1HZHH 1AQDA 4TNWK 5IBLC 8FABA 3I6GA 1IC7H 2V2WA 4KROB 4BUHA 3H7BA 4X4ZA 4UAOB 3UPAA 3WSQH 1R3KA 7FABH 4NQVB 2KDGA 3CMGA 3O0RH 4ELMB 5C0BE 3IRZA 2D4DA 1V3LA 1G9NC 2HTLC 4NT6A 3CUPA 4R0LC 3VWJB 1J0IA 1GHFH 5DO2C 5F7EL 2OTWB 3AREC 1TJGL 1F00I 4AT6A 4MCZA 4ZUWA 1Q1JL 1Q9KB 8CGTA 1G7PA 4L8SB 4KC3B 5C86A 2HT4D 2Y36H 3BYYA 2VE6B 2WAHA 3MUGA 3DETD 3ARDB 3MQIA 5ID1A 2F5AL 3BDYL 1QRNE 1NGZA 1VHPA 5HI3C 3SGKC 1BFVH 4PJAA 1C1EH 1JRHH 2E7CA 4OT1H 4U1NA 1FVDB 1B9ZA 4MNQD 1S9YB 3EJJX 2H2PD 4HIHA 5HPMA 5IKCA 4LCYB 3UTZA 4Q0XL 1TQBB 2HKHH 1CD1B 5FUZH 5LGHH 1CG9A 2UWEB 5FEBA 5K9KB 1EK3A 4G3YL 1FO0A 5HTSA 1TJGH 5HHNB 4MAYA 2E9JA 2EC8A 3MLTB 3OKNA 2FR4B 1T1XA 4NBZB 4NRXA 1G7LA 4GAJH 1B2WH 1H0DB 3QUKB 2CK0H 3A6CL 2IBZX 3G5ZA 1ZLUH 5L7XH 1R3HB 3S36X 4ZAKA 2C3WA 3IXTB 5DJ8B 5F96H 1QRNA 4RMQA 3MCG1 2AV1B 2YEZB 3QUZA 3QIUB 5ISZD 4HMDA 1LEGA 2VR4A 3O4LD 4X98A 4LCCB 1RU9H 3JTTA 1JRHL 3M17B 2BY0A 4TVPE 3ULUH 2VLRB 5FKPB 4OIIL 5C8JB 4UNUA 4MXWL 3OXRA 2FX8L 1NBYB 1RIVL 3LQZB 1U8JB 3AM8C 1PDKA 5GGUB 1C12A 1EO5A 2WWMC 1R5IA 3BRDA 5H94A 4YBQD 3F7YB 2F5BL 4FQLH 3MTRA 2QKIB 2I9LB 4Z5RB 2GY5A 3RWGB 5F8QC 3NPSC 5J57B 2VDQL 3WDHA 4QXTB 4N0YL 1HKLH 1KB5A 2Q7NA 3RVVC 4RRPA 3DMMB 2DKUA 2IFFH 2R1WB 4LPUA 1Z9SA 1AO7A 4PY8I 3GB7A 4P49A 1CGVA 3BP6A 3FB7B 1XZ0A 3B8SA 3D3VA 1QHPA 4LCWE 4XBEH 1BD2E 1ONQB 3QNZB 4HEME 2OMNA 3QEUA 4F7EB 4JDZA 4N9GA 2YC1B 1EPFA 5DTFA 4Y19D 3TPUB 1JFQL 5HYJB 5GS2H 4YWGL 5EZOH 1ZMYA 4OFYD 4BZYA 2AKRB 4C4KO 1NCDH 3R1GH 4NWUL 4YDJA 1F3DJ 3VFTA 3ZE1F 3H2WA 4E5XA 4EI5C 4CNIB 3OKYA 1OLLA 3GSXA 4L29B 4Y2DC 5GISH 4JFYA 3AREA 3NCJH 2LTQB 4Z7QE 3IB4A 1QR1A 3V6BR 4OZIF 1V7NL 4BQCA 4L9DA 1IAOB 4KKAC 4PJ9B 2XFXA 2D7TH 2AEIT 3GBNH 1NGPH 4LSSL 3TNNA 3QPQC 3SDXF 5KVFH 5I6XC 1L7TH 5SWZE 3KAAA 3BHBA 5KS9B 2Q8BL 4P4KA 2PO6C 3SE8L 4X7EC 1BD2D 4N0FB 1A0QH 2C3VB 1AC0A 1OSPL 2JCCB 3MBEA 3MCLL 1U92B 5D2LA 3GSRA 5K9JL 1A6ZB 1RMFL 4G9DA 4IJ3C 5IEHB 1M7XA 2J1KA 5J6HA 4MJ6B 4OZIA 5E7FA 3RX7A 2E6PA 4S1SL 3WD5H 1V7NH 5JDSA 4KKCD 3H9HB 2VDPH 1QTYT 3HRZB 1CIUA 2HFTA 3C6SA 3FTGB 3BHBB 3FT3A 5KS9A 5HGAA 4LVHC 3BDXA 3B9EA 4LSPL 1G6RB 4WEBH 2RJMA 3O3BB 4AEHL 2DRUA 4EJ1C 1H9VA 2EYTB 4GUPB 2C1PB 4LLVA 1JTPA 4K9EL 5D2LE 2HJFB 1OCWL 5EOQL 5AUMB 2BRQA 5D5MF 4PV9B 1UC6A 3V52H 4WRLA 1QFWI 3ECBB 1IGJA 3GIZH 4HDIB 3W0WE 4ZODA 4HXBL 5I1CH 5C6PB 4GBXB 3MSPA 1YEKL 3TF7C 5C8JA 3MA9L 3I50L 5GGQH 1S5HA 4I4WB 2R23A 3TPUA 4NDMA 4HS6A 3F7RA 1YYLH 4PTTB 1P7QD 1JPTH 4IOIA 3Q6GL 1KCSL 4W6XB 1EFQA 4U3HA 4K3JH 2D7MA 4YFEA 2UZIH 1H15A 5GGTA 5JW4M 4P59L 1I1FA 3BT2L 3KHQA 2HFGL 4OD3L 3I75B 3MROB 3N06B 4XZUB 3RGHA 3K2UH 2YBRA 3EO9H 4NO5B 4FFWD 1AKJB 1FPTL 5TDNB 5JNYA 3HPJA 1I3GH 5GZND 2BFVH 3MA9H 4M4PA 5F7EH 4ZXBB 1JN6A 1TZIB 5ICZA 4KVNH 3O2VL 4U6XA 2Y36L 4GKNB 5CSBA 4R97B 3CK0H 4WDIA 1FGNL 5BW7A 2VN4A 1DBJH 5D7JA 2UZIL 3IJHA 4ZDHA 1R3HA 4MAUL 2D4FA 2KZWA 2DQDH 1CFNA 5ANME 2CDEB 2R69H 3TV3L 2NTFA 5TFSL 1LE9A 4P2OB 1ZS8A 3HRPA 2AI0H 4XCEB 2FLRT 3I3DA 5JHLH 2AEQH 3V0WH 4MJIB 3ZYZA 1XIWA 2F58L 1Q94A 1RV6X 4X9IA 3ILPB 1RJLB 3BP7B 4ZNEA 2I24N 1NCAL 5D7LD 3GO1L 1U3HA 2PF6A 1KCUL 4F58H 1HYRC 2VAJA 5F7KC 1QO3B 2VZTA 2JELL 2OQJA 2KQNA 1DBJL 3SDAA 2X4RA 1DTUA 5D6CA 4LHJB 4JZJB 3O9WC 2E9IA 4G7VL 1LP9F 3BESR 3MLXL 4JPVL 4LKCA 2BC4A 3PQYB 3ULUL 4JFOB 4MMXC 1OGTA 5HYJD 3FRPG 5FIEA 4AIXA 2X1WL 5ICXA 1DLFH 2YPVH 2WUCH 4U1KB 2DBLL 3UEZA 1AFVH 2F58H 5GS0D 1HHGA 3UJIH 1NLBH 2IMNA 3LV3B 1QFWM 1HCVA 4HPYH 2ARJA 3SY0B 1CLOH 4IRSD 5SX4H 4V2CB 3PXJA 2IPUG 1DQML 5IWLA 4JANA 1U8NA 4RX4A 2FZ3A 4PJGE 4L4JA 2FHBA 4LIQH 3WDIA 3QDAA 4A2LA 3T0ED 3MACL 1QBAA 1GZQA 2IH1A 3L95A 2BSSB 3MGOB 2VWEC 1K2DA 2DLGA 1AQKL 3S34H 4ZXBA 4YAQA 1BAFL 3CVHB 1E6OH 4BSJA 4GXUM 3F6IA 4P5KB 4MNQB 5D1XA 5KSAC 5L8LB 4LPTA 3ROLB 3UYRH 4JFQA 1T22B 4B53A 2RCSH 3O6FC 5F3HA 4OFVA 2DDQL 2DQEL 1OF2A 2FB4H 1MRFL 3SJVB 3VG9B 3QR2A 1XR9B 3WN5B 5GISL 3DGGA 5GJTL 2D7NA 3DTXA 3FAWA 1JGVL 4OZGA 5E4EC 4DN3H 2BMKB 4PJ8A 4A6YB 4TVPL 4KUCF 1XMWA 2XZAH 4MCYA 3RU8L 1KG0A 3VD3A 4KY1L 5DT1L 4F15B 3GRWH 3G6JA 3TVMA 3WJJA 3QHFH 4KDTC 3QUXC 1UACH 2R23B 1W72L 2FLBT 1KGCE 4KMQA 1QA9B 1X5FA 1SY6A 5I74C 4WCYL 2AQ3A 2VAAA 4TOYH 2B2XL 3L3JB 1DBKH 3BZFA 1E4WH 2IAMA 3BH9B 2IEPA 3GGWB 2YSSB 4EUPG 1J0KA 4Q6YA 3O3AA 1S9KC 4E42B 4W81A 2YSSA 3BXNB 3C5JA 4XI5D 3EDFA 3RNQA 4H0HB 3KYMA 3C6LC 3RWEB 1GXEA 2EDLA 3V5DB 3ROLA 3QXUA 4WGVB 5D2NA 1HCFX 1N2RB 1YYMH 1RUKH 3EHBC 4MXVF 1W2KT 1PX4A 3PHOA 3P11L 5DK0A 5GJSL 4U3CA 3WHE0 5DD3L 3PDDA 3VFUA 1FL6B 2X4TB 3WIIL 1UT9A 1R3IL 3I2CL 4PBXA 3TN0B 1DQLH 4MLSA 5KANG 1BFSA 4XMLH 3P2TA 2AJYL 3WN5A 3BGMB 2BNQA 1TDQA 1FIGH 2HRLA 5CEYA 1IGIH 2I60L 5B38B 2PTUA 4MD5B 4OKVA 3I50H 2CLRA 1MFDL 1IGCL 4O02L 1QFOA 1KB9J 4HULB 3WFHB 1UCTA 4LSTH 5ICXB 2NR6D 1F13A 1MCHA 1PG7X 4M6MH 4CAGA 5F7HA 4OJFL 1REIA 1EAPA 4YJZL 4WTWA 2VDKH 3QEGH 3DYOA 3JV4A 4P2CG 3RL2A 3WN5C 43C9B 1EGJL 5CEZH 3U4AA 3K7UA 5HGBA 4JVWA 1LWRA 2X42A 4WW2A 3FQXA 4WWKA 3G6AB 3T08A 1S5IH 2NY6D 3RI5F 1MJ8L 2JCCE 4CJ1A 2D3VA 2NQCA 5T1LA 4QGYA 4FQXD 3BIKB 3ZTNL 3CFKA 4LK4A 1SM3H 2DQCH 4U1KA 4KVNL 4LSTL 5L9DH 3R8BB 1E0OB 3FMGL 4J6RL 5GSRB 4YK4B 1YEEH 3TBYA 2W9EL 4DKFL 1KPVA 1TZHA 3KDMB 3QQ4B 4KQ4L 3GSNB 1KB5B 3WFZA 4O51B 2WUBH 4LCCC 5C2UB 4Y1AE 2I9LA 3V2AR 3TV3H 1NMCB 4NC2B 3NABL 4LVEA 4XP1L 3UPRA 4B50A 1UJ3C 4GRWB 1D5MB 3LEXA 5EIIA 1KACB 2A6KB 3H3PL 3EDKA 4PD4J 2VLRA 3BZDA 4Q0XH 4YXKL 1P7KA 4B41A 2DICA 5DD1L 3BP4A 4WU5A 1ULVA 3BKML 2RR3A 4KMTH 5A2JH 1A9EB 2BY3A 3BEVA 3H9SA 4LLQB 4NN5C 1UWEL 1AIFA 1I7UB 2OL3A 3G5ZB 1UENA 4LLQA 4LQFL 2Q87A 5TH2A 1VGKB 5E6YA 4PREB 4QF1B 1TZGH 4LKXA 1OT1A 1N4XH 1RU9L 3KPRB 4MA1C 5D7IB 4ZSOA 5K9QG 1OP3K 3U9PL 3PHQB 2WUCL 3ZT7A 2F9BT 4NBYB 3TJHD 5F1KC 3PABA 3W2DL 1F90H 4DVBB 1I3RA 2XKUA 4M43H 4TUOB 1RIVH 1O7SA 2EDJA 3HI5L 4U1IA 3WO4C 2E6JA 4Y16A 3VXPA 4M7ZC 1YY8A 4X6BB 1GGIL 3PQYD 1G9EA 2ZUXA 3FN3A 3IFPB 2DBJA 4DAGL 2NR6C 1EXUB 1K4CA 4WFED 3TC9A 3MUGB 4NQSB 3V4VH 4U1GC 2X4PB 3SDCA 3BPOB 4HS3B 4RSVA 5JR1L 1KPVB 2CK2A 4K2UL 3V5HB 1GZPB 4Y4FD 2EYTA 4L3EA 3BVNA 3UTPE 2NY5H 5E2JA 2QQNL 2P24B 5C6TH 1IM9A 4R4ND 3O3BA 4JR9H 4Y5YB 4DKEL 5BO1H 3MRHB 2YRZA 1PLGH 2EIZA 4LRIC 1S7WB 4NHCH 2F74A 1MCOL 3PWPB 4HAGA 3AVEA 5T3ZE 4L1DA 3L5XL 3O11B 4QOKE 3S5LA 4HSQA 4N1HB 4MJ6A 4WWKB 3VXSE 3O6FD 2DI7A 2DQUL 3PP4L 1HXYB 1R3JB 5DT1H 5DMJB 4YPGA 1JNNH 3AU1A 2WBWB 2MQ0A 3AC0A 1KTRL 5DDHA 1BVZA 1J5OH 5BOZG 1NGPL 3L7EB 1J1XH 4X8JB 4ZQKA 4XPGL 2O26U 3T09A 1QFWH 3J8F7 3LIZH 3TVMD 3REWA 4XB8A 4QXGL 4M1GL 4HZLB 4J4PD 5BRZE 1EUUA 1IGFH 4PG2A 4MSWB 3X13A 4BUGA 3TJEL 2FCBA 5CJ5A 1HHIB 2Z92B 1DUYB 4H0GA 5HYSA 1OGAA 1T1YB 2W0FA 5E8EB 2P8LB 1J0ZA 1MCKA 3HNTL 1N5AA 4R8WL 4OFYA 1HINH 5E5UB 4B5EA 1MRDL 4OLYH 4MA7H 1T1WB 1QFUL 4UT7H 5E70A 2ZG1A 3SGKA 3OF6A 2IQAA 3O3DB 1CE1L 3ALXA 4M6NH 1A7PL 1ONQA 4HKXB 2ATPB 4FFVD 1KTKE 2OJEA 4WJ5B 4G6KL 5AAWA 1K4DA 1A6TB 1MWAA 1H3PH 4MQXD 1TTFA 1NKOA 3HI6H 3HMXH 3LH2H 3U2SA 4RMSA 4QOKD 3RX8A 3SJVD 4LFHD 4KJYB 1C5BH 3SE9H 4Z5RA 1B0WA 1MIML 5FYLL 5FOBB 3DX6B 4P2YA 3DX7A 4DGIH 4P57B 5C09E 3O4LA 3QUYD 5DRNA 1FHGA 3QQ9C 1C7TA 4OLUL 1SQ2N 3CPLB 5AZEH 4NCDA 3LPFA 1BEYL 4TRPL 5DA4A 1OD7A 3BYTA 2NLJB 4JDZB 2NNAB 2Z4QB 3VFPA 3VH8A 3S3PA 3BGFC 4LCUB 3DUSA 4GMTL 4UT6H 4P2RD 5L88L 5JA8B 1DUYA 5HYSB 5J6GA 3A67L 3QZWB 1IAKA 3GI9L 4NPYB 2ED9A 1F6AA 4UIKL 1KIQA 4KTEL 2EDFA 4HAFA 1WIPA 3G04B 1IGMH 3WS3A 1P4LA 3U30C 1S7UA 4JFQB 5T3ZL 4Z76A 3EOTL 2YZ8A 1ZHKA 2Y4SA 4RFNC 3AS3A 1SM3L 2DQCL 3MRBB 1QYGH 3DUUA 3P3YA 3DI2B 4DVRH 3WE6B 3QRFM 4UQ3A 5L9DL 4NKIH 4XP5H 5M95B 3SKJL 1MPAL 3QXWA 4TSCH 1KJVB 4QRSA 4QRPA 1GZQB 5HVHC 4PJGB 5KJRL 3LD8B 3OZ9L 2EDYA 1RK0A 1ZTXL 1JL8A 4PJ5B 4OZHE 5EBLA 4O9HL 3ULVD 3OKMA 1G7QB 3LKPA 1S7TA 3QO1B 3LAFA 5JIHA 3SBWC 4NZRH 5IHUH 3DROA 5C0BA 1A14H 5EBLB 4Y5YA 1AY1H 2NPLX 4LF3B 1MI5B 4MDIB 3M45A 3LHPH 3T4AA 1FDLL 4XP5L 1OGTB 4ORGA 1UZ8A 4TUJB 5JUEL 1TFHA 1AGCA 1FFNA 2Y6SC 3D85D 1JE6A 2BNUB 5FDWA 1A02N 1NUGA 5JIPA 2IALB 4LQFH 3AY4A 2UY7A 4YHLL 5DJXA 5ID1B 1P4LB 3FAXA 2HP4A 3C2AH 1QO3A 4WI2A 4L8BA 5JQ6H 1FNHA 4LHUA 5GHWH 2VITA 5LGJA 1QHOA 3FQUB 1LO5A 4X6CE 4WWID 5GS1B 3E6FA 3QUZD 3QA3B 3FO9A 3QIBC 4H0IA 1U0QA 5MEND 3KPRA 4KPHH 3BUTA 5F1NA 2RAMA 4RA0C 4F7CA 4QGTA 1KCVL 4NQVA 1QNZH 1OTSD 3KXFE 3DIFA 2YRPA 4BZ2L 3RVWC 1DQDH 1WWAX 1CCZA 1HXMA 4PTUB 4S11A 4R9HA 4Y2DD 5E2WL 3MBED 4G6AD 3SO3B 1NFDE 4PRHE 3C2AL 4S10A 5IV2A 4UILH 2J8UF 5IVXA 1BVKA 3I6KB 1FYTB 4NHCL 2H6PA 4H20L 2EDKA 2XN9E 5IMLB 1JHLL 5D6DC 3EYOA 5HXMA 2QQKH 2N56A 1WZLA 3TNMB 1ERNA 4UQ2B 3GSNA 1JUFB 2F54E 1KN2L 1SY6L 4KHXH 2C7UA 4U1SA 4HV8B 4NGHH 3T0VA 4JO2H 1J9CT 3S3SA 2QQLL 1BIHA 3D3VE 1HHHB 2H3NB 4G8EA 2VZVA 1LO0H 1SJVA 2DQJH 4L8DB 4HIXL 5GS1C 1Q8MA 2GQHA 4KTDH 4ZMAT 1JF1B 4JKWA 3QPXH 3VXUE 4YC2B 3TZVD 1IAMA 1NLDH 1LEKA 1ZLUK 5CINL 3CC5A 4GKSA 4I0KA 1AGBA 1Z5LB 4JZNB 5BZWB 4R8WH 5IQ7L 2B0SH 4M4RA 4V1DD 1IC5L 5JOFB 3ULSA 3W39A 2M2DA 1HILA 2F5AH 2J6EH 4HT1L 1UA6L 4HIXH 3B3IA 1MLCA 2QQQA 3PL6C 1J8HD 5DD6B 2NW2B 1I1RA 5E99H 5DD5L 3UDWA 2A73B 1H3PL 2WMPA 5I1EH 3KPLB 5FGCB 4G8GD 4XCYB 1S7SA 2XQBH 5B39A 1P1ZA 3RY6A 1RFDL 3KPLA 4PJHE 1C5BL 4IRSB 4YC2C 1PGRB 3H3KA 4KFZC 1OM3H 4L3EB 1AXTH 3O6FB 5IJKC 4IDJH 2GAZB 1SYVB 4YGVA 4HS3A 2DN7A 3V6FB 1MSPA 4J3SA 1J88A 3DO3A 1MCSA 4JKPL 3HG1D 3PHSA 3T0EB 4C58B 4YDLB 4RFOH 3C6LD 1OP5H 1I7RA 3VJ6A 1TETH 5T1KA 4EI6B 3BD5A 4OB5H 1ZV5A 4K94L 4FQ1L 3EO0B 3K1KC 3HZVB 4KJWD 4EVNB 4XPAH 1RD6A 3KLSA 2XNAA 5T1MB 3H0TB 3SQOH 4ZOAA 1EEZB 1ZAGA 3BPLC 4O5LL 4KUZH 3RWDB 3QIWA 2CLZA 3P4LA 4LKXB 4ZSOB 3IF1A 3VCLB 1QSFA 2O5XH 3QAZB 3VRIB 4RMUA 2VDQH 3SPVA 1EHLH 4KAQH 4XBPB 1B4RA 2OL3B 5IB2B 4L4VD 1FNEB 3GHBL 5HHXL 3H9SB 3GRWA 2MQ3A 3IGAA 1KG0B 3O6LH 4N0UA 3PWUA 1WAAF 4J4PA 3HN3A 4PJ8B 4A6YA 1WT5C 3TJHC 5EU3B 4J6RH 4EN3A 1MY5A 3DTXB 3FQTB 3MRDB 5FCSH 5GGVY 2VZOA 1E27B 1EVUA 2ITDB 1T83A 4PRIB 1UWXH 2IGFL 1KIRA 4HC1H 3U0TB 3V6ZB 2XZQL 2FSEA 1ORQA 4OZFB 4KUCD 4NZRL 4GBXC 5INCA 5IJVA 1N5YL 2BDNL 2OL3L 5D2NE 4MA3A 4ALAH 5CBEA 4OLVL 5T1KD 5FO7A 2WV3A 5GRJL 2MCG1 5CZVL 4L5FH 2BSRB 1CFVH 4FQIH 5FKPA 3T0EC 3DETC 4GAYB 4P4RA 3RZCD 4GKZA 4X6FB 3PE9A 5EU3A 4WY7H 4ZFZA 3JTTB 1BZQK 1U2HA 2R0WL 3K4AA 3NH7H 4ZPTA 3X14A 4QNPF 3GSNH 4XMKH 2ATKA 1FNFA 4PJXB 2LVCA 3VXTA 2X6MA 1S7XB 5FYJH 2ESVE 4HC1L 5IB1A 1RJZA 4D9RE 2D31B 4L9LA 4GMSL 1F58L 3QNXB 3R06A 3WXWL 4S2SA 1T4KA 5I8KL 3FQXB 1TZGL 2GT9A 5DJYA 3VGFA 4POYA 3HUJE 4P23A 3WNPA 4D0BA 2KQMA 1BVLB 4H5SA 5EN2A 1P6FA 2Q20A 4IEFB 5IMOB 3FJTA 3N85L 1LO4H 3NIDF 1G7JA 1FCCA 4AK1A 3LRGA 1JWUB 5F70A 3D85A 3FFCB 4NP4L 3FB8B 2A9MH 2R4SH 1UM4H 3OBAA 1WZ1H 3SDDD 1WEJL 2BNUA 5IK3B 4DJMA 4LLYA 1HN1A 4C83B 4YWGH 4AEHH 4K23L 2DJ4A 3RL1B 3Q5TA 3U9UA 1MVFA 1WWWX 2X05A 4KTYA 2FECL 1KF9B 2V7NB 4NJAH 4OAWA 3ARWA 1X5AA 2BNQD 4CRPA 1I8LC 4DKEH 1MCBA 2BZDA 4RGOH 1I3VA 4QHMA 2JJTC 3DV4B 4NFDA 3MLUH 1K8DB 1R3KB 2OR9H 4U0QB 4DFHA 4YDVA 2ICWI 3U6RB 4U05A 4HIJA 4WHDA 3ARZA 1NJ9A 4ZUTB 5HPOA 5LWYH 5TE4H 5HI5D 2X1PA 4U6XB 3PP4H 4G9FB 1NGWB 5I18L 5C0NC 4CBPA 2XA8H 3FFDB 2OJZL 1CQYA 2WIIA 5I75C 4PB9L 4HEPG 3VG0H 1NSNH 3B2UC 2VLRE 1DEEB 3LS5H 5D7LA 1X6LA 1FV1A 1ZHNB 1FFOB 5CJQH 4LSVH 1PYWB 2ICWB 3VXOB 4D2NA 3V4PH 1IZJA 3QWQB 4ZFOL 3WLBA 4M7JH 4GG6A 4R26L 3BMVA 4NPYA 4WFHE 4TTGA 3RDTB 2Z35B 1TJHH 5JHDE 5CEZE 2AJSL 2BVOA 5LWYL 5DHVA 1F2XK 1TQBC 1LP9A 4NUJB 1TPXC 2GITB 5E6ZA 4FQ2H 3ZSTA 1INDL 5L2JA 4PYGA 5E8OB 5T5NG 2GITA 2CKBH 3OJDA 2D0GA 3IDGA 2J6EL 4KI1A 5MEPB 2ARJQ 5IR1B 2D9QB 3IETB 1SEBB 4PJXE 2VZSA 1HH6B 4ZOCA 4BZ1L 3DX7B 1OQXA 2DIJA 2EH7H 4C56B 5DD5H 3BQUA 4KJYA 5D93B 5HGHB 1UM5L 5GGSB 4HH8A 5EPMB 4PRHD 5I16B 1GVIA 3QXDB 1PG7W 3LH2L 3BKJL 2R0LL 1AXTL 2NY0B 4M93C 1INDH 2HVKA 1EEUA 3FONA 4X4YA 1E4XI 4ZO7A 1LEIA 2QSQA 3M1BB 4BQ9A 3QIUD 3BT2H 3AFLA 32C2A 3MOAL 3NOIA 2NZIA 4EDWH 4ODBD 2MHAB 1ZLVH 4FQ1H 5I0DA 4JRXE 4XVSH 2BNRD 3I84A 4OSUL 4G6FD 1R24B 3O45B 1JRHI 3BQUC 5FUCE 3UBXA 2KL6A 1DLFL 2NY1B 3WCYA 3FOMB 4YHKH 4UNTA 1HHIA 5EIVA 2VH5L 3UO1L 4JN2B 2J5LB 1ETZB 3C87A 2BC4B 2ADFL 4XP6H 3ALPA 5LGJB 3L1OL 5JQHC 4KAQL 2VITB 1G7IB 4PJIE 2I07B 3DMMD 1KNOB 3QO0A 3QWOA 3ABZA 1WBYA 1YZZA 3HFMH 1OTTD 1AP2A 5DDHB 3BOVA 2V6HA 1F4XL 3CIQA 1AGCB 1CXIA 1QR1B 5HHOE 3DI3B 1OTUC 1UZ8B 1VFBB 1WSST 5JXAL 1IGTB 2J8HA 3ULVF 3L7FA 3MRNA 2AI0L 4AEIL 4PRPB 3EYSL 2BVEA 3Q6FA 2JKXA 3D39D 1ZS8B 4AH2B 4JHAH 4ZO9A 1WFTA 1JPGB 3AS0A 2YPLE 5ISZB 2ESVB 5IROA 3GSWA 3RAJL 4OZHF 2W0PA 5CZVH 4YEFA 3GSQB 1S7TB 1X5LA 3EJZC 2WP3T 5IFAH 1A6VH 2EYSB 1RZKC 43CAA 1EEYB 3V0VA 4QHUA 4YIQA 2YHGA 3D0VB 4XBEL 3ARDD 6CGTA 1HIML 3NH7L 4QRSB 2ZCLH 4I18B 3ARSA 2EICA 2G5RA 1VFMA 1CDHA 3IDJB 4PRDA 4MNHA 3KJ6L 1QEWA 1I1AB 4UIMB 2VB5A 5TDNA 5JNYB 1RI8A 4MQXC 2R8SL 1NBZB 2X7LA 4JAMA 4XBGA 5BZDB 3IVKB 1I1FB 3QJFB 2AW2A 5H2BB 2AXJA 2AK4D 2G5BA 3B5GA 4X6CF 1PG7H 2R2CA 3DHJA 3GBNL 4LSSH 1AJ7L 5CCKH 2R4SL 2W1NA 4Y19A 1WEJH 4OUUA 2X89D 3P30H 1OAQL 3RY5A 1TMCB 2DQGL 2E7HA 3UC0L 4F3FA 1FN4A 3BEVB 5IW6A 2ICEA 5BZDA 2G9HB 2R2EA 5CGYC 1LILA 2VLRD 5FXCH 3UYRL 5DEGB 2RCSL 4CW1B 2GTWA 2CLZB 1A5FH 5IBUB 1DSFH 4HWZA 1MI5E 3LKNA 5FYLD 5D6DA 4KDTA 1BLNA 3OAYK 3O41B 4UU9B 1YMHA 1D5XB 4LAQL 4JPIB 4OIAA 1AI1H 1MAML 4PS4L 4LLMB 5DEZA 1QQDB 2IH3A 3BI9X 4QHUB 4QOKB 3RKPA 3RZCB 4QRQB 5TE4L 3KG5A 4YHML 2BRRL 2HT4C 1YJDL 5HGAB 5HYQA 2BVQA 4RISH 4KV5F 1VACB 3STZB 4KHXL 3JWOL 1DE4B 4RGMC 2Y06L 3MJ8A 5E9DE 5ERWB 2HMIC 4TOYL 4S1RH 1B90A 1A4KA 4NC1E 4K71B 4JQVA 2FO4A 4GRMB 4CADA 2FEEI 5D7JD 1FC1A 4X9HA 4Z7WE 2PXYA 4I2XB 1AHWB 3B9VA 5AG8A 5E2UL 3VXSB 4OCSH 4OGZA 1ACZA 3F65A 3CX5K 1CZ8H 3H7LA 3MGTA 5C0CA 1T2QH 4Y4FA 5C7XL 2BVPA 1G6RH 5K59E 3NIFF 2AERT 3FO0L 4KJWC 3IDYC 4OQ1A 3MCKB 2DYPA 4QRRD 3WKMH 3A6OA 1ZHBA 3DPBA 1RZKL 1R3JA 1AGFA 3F7PC 5F9JA 4WNQA 1RK1A 3R0MA 3LSOA 1FZMA 5BJTA 3EHBD 3R0NA 1OAKH 1VPOH 4YBLB 1JGLH 2YK1L 2Y07H 5HHMD 1DUZB 4XC3L 2C5DC 32C2B 1S7QA 1YNTA 2E7MA 3NFNA 3RVVD 2CJUH 7FABL 3V5KA 5IVZB 4D8PB 4G8EB 4WEUD 1HNGA 3LN9A 4FXKB 2MFNA 1T7YA 4EZMA 3GMPB 1MQKH 2BVQB 5HBBA 3KJ4B 3U0WL 2EH8L 3HNSH 2B4CL 4F15C 1XR8B 3H42L 2DWDA 4K8RC 1A3RH 2NXYC 3I9GL 4LGPB 5GGSY 4GS7C 1FL3B 1GIGH 3QDJA 3RKDC 4HUUA 1C1EL 3B6SB 2EYRA 2R0ZH 1NBYA 3ZTNH 3SKOA 5I8OH 1QLRB 2VLLB 1BVKB 1DQQB 1X3DA 3PABB 4X5LA 2IAMB 5CZXC 4M9PA 2VR9A 1A6AB 2IPUK 2M1KA 5EU7E 4N8VA 4OLWL 4NO2B 2XYCA 3T3PF 3QUZB 1GGIH 2PXYD 5JHDB 1C08A 5JXEC 1E4KA 5FAAA 5GGVL 4HJJH 3MYJA 4HF5H 4JO3L 4JM2D 3MLTA 2VXVL 3ARFC 4L1HA 3RRQA 3L6FB 3QG6A 9CGTA 4M6AA 3QEHA 2BMKA 1JCKA 3D5OF 1IKFH 2DM3A 5GGRY 3I02A 1KEMH 1U95A 3BSZH 4MLIA 5F9AC 3L3DB 3QUXD 2AJXH 5EZJB 1AE6H 4QRTB 2B39A 3VA2C 4D9QE 4G9FA 2AABL 1CLOL 1BBJA 4KMTL 5DSCB 1D9KB 3NVQA 5JXEA 4HIJB 4S1QL 4QHLB 1HKLL 3O2DA 2RIKA 3DXAE 2JJSA 1B6DA 4K3DH 1CFVL 3K1DA 4GRLD 4PJFF 4D3CH 4JM2A 3STBA 2PR4L 3ESUF 1JNNL 5F6IC 3C5SB 4ODXA 1RZ7H 4A6YH 1KULA 1J1XL 4JFFE 2VL5A 5D2NC 2Y7QB 4JRYE 5F6HI 3CH8A 3HB3C 1FORL 1ZANL 5IB1B 1D9KC 2DLEA 4XX1G 1BWWA 3UTSE 1JPGA 4JM2C 3VXTB 4WHTB 2GUOB 4N90E 3QIBD 2ZCHL 4WFGE 4ODWB 2EDXA 1EGJA 3LMJL 2VWEE 3VA6A 1KV3A 3S3JA 4LKCB 3TZVB 3LN5B 3HG1B 4F80A 5D1ZC 2HTLD 3ARFB 3PL6A 3MRBA 1EAPB 4LAJH 1QKZL 5TPWH 4BH8B 4Z7NF 4OZIE 4JR9L 1QLEL 1R6VA 4Q9QL 4U1LB 4R0LB 5J3HD 1YNKH 1SHMA 5IFHH 3ZKSD 2P5WD 5MHSE 3U0TA 4Q2ZB 4R90H 2R1YB 5A40E 4HXAL 1OSPH 3CFDA 3OQ3B 2Y7QA 1QSZA 1OWWA 3NFPA 3VI3E 1IEAA 2EDEA 4XPTH 4HUWA 1X5ZA 3BKCH 4OF6A 2UZXB 4GAYA 4PRAA 1U9KA 2CQVA 1MFCL 1BM3H 5D7LE 4PG2C 2PYEE 3O4LB 1KJ2A 4RWYH 2SEBA 5CKGA 1QSFB 3MRGB 3KYKH 1V3JA 1HHJA 3PGFL 1BQHB 4N8VB 1IGFL 3X3FL 2C3GA 2OJZH 4I9WD 1JN6B 3TJEH 5JORB 3U2SB 3A67H 3QXDA 4TPRH 4M7LH 1K4DB 4NM4L 5EFIB 1CK0H 4GG8B 3BE1L 1P5UA 1FIGL 4KRPC 1J1PH 2YA2A 3EO1B 3C5ZB 1T5XB 2YD7A 1RUMH 3SOBH 5J12B 3OKEA 4TNWF 4OLYL 2BP3A 4XMPH 4ODHH 5D5ME 5FYLE 4M48L 1YN6B 3VFVA 5IB2A 2EDBA 1RUAL 3A6BL 35C8H 1OP3H 3C8KA 3GM0A 5HDBE 4WTXA 3BN9D 5GGQL 3N1MC 5CHNA 3ZHKA 4AZ8A 1I9JH 4RMVA 4IRSC 1M05B 4XRCA 4M8QB 1U8MB 4K94C 4NO2A 3CX5J 1JNHA 2KH2B 3Q6GH 4HS6B 3HUJA 3TIDA 3O2WL 3PQYE 1EEZA 1EZVX 4M7LL 1FGVH 4G7YH 4Y89A 4PJCA 1NMCC 2CDFB 1F4AA 5I1DB 4GBXA 4M62H 1TVHA 3VGHA 3ZLQC 3KR3H 3U46B 4G6AC 2J8UB 3SDXB 4BZ1H 1E4XL 4E41B 3ELAT 1UEYA 4RMWA 3VXQB 3OPZH 4JVUA 4HUXB 4D0CA 2ZSVA 5CP3A 4L8SC 5KVEL 3KXFB 5KSVA 3EOBA 4MDJA 3MCKA 2ZOLA 3VXRE 5E56A 1YMMD 3ULUC 3HZKB 5D1QA 3FT3B 1KELL 5CLWA 1A9BA 4NKOA 4P2RA 4H88L 3H9HA 4OZFH 3G5VA 5IBTL 4WI9A 2EEDA 5I9QC 3NIGF 5DA0B 5IEHA 1T5WB 1T0NB 2HFFB 4XXDB 5DQJB 3UTTE 5IHLB 1SJHB 2NCMA 1DVFB 3VGDA 4P2QD 1OHQA 1PKQE 3W5MA 3OGCB 1CF8H 5DZOA 5BQ7B 4XP6L 1D3CA 1OQOA 2Q3AA 1E28B 2FEDC 1WC7B 5F9OH 1ZA6A 2P5EB 1YPZB 5FUCC 3Q3GB 4NQCA 5F3BB 4PJIF 3ZKNC 2FATH 3B9KB 4GFTB 3I3EA 1HI6A 2H6PB 3MLXH 1FYTA 5IBTH 4OT1L 5LBSH 5J7CC 4UDTA 4QRUB 4HWEL 3DO7B 3LKNB 3RWFA 4NO0B 4NC1C 1WVZA 3S35X 2B5IC 4Y4KD 5DJAA 4KRLB 4BH7A 5C07E 1BQUA 1TQCC 4XWGH 3IDIB 3OG4B 1V3MA 2F8OA 1PSKL 4JDVA 3RAJH 4F3FB 4WO4A 4BELD 3IXAA 1SY6H 3BP5B 4PGCA 1JI1A 5CWSB 5I1JH 3PDOA 2VQTA 4ONGL 1PZ5A 3IS0X 2G75A 4EOWH 5KN5B 3GMRA 4U2ZA 1T6VN 1NGXA 5F97E 3DMMA 1BLNB 4RRPG 1QVOA 3EYUH 4JQIL 3RWIB 4NIKB 1NCCH 2CIKB 1KLGB 1MLBB 5I1HH 2WWKO 4KXZH 3DRQB 3E6HB 2X4SA 4ZFOB 1KCVH 1KENL 1T6WA 4Y19E 4U1HB 5DEGA 5B21A 3RA7L 1QEWB 2DDQH 5EC1B 1RJYB 2HJKA 2G9HA 2NY4C 2R4RL 4Y0GA 1I1AC 3L3GA 3PV7A 4RMTA 4X6DA 4M6OL 1NAKH 1L9MA 3FN9A 2DQFB 4W6YB 5EZIH 3TVMC 3EGSA 4L4VA 5DMGC 3WJJC 1KEGH 3RDTD 1JTOA 2BJML 2GSIB 5F7NC 3U36A 5HHQA 4KXZI 4TNVK 3DO7A 2VN7A 4OCMC 2XWJA 5T1LB 1FH5L 5E6ID 1NGQL 5SWQA 5EDXA 4LCIL 1T7ZA 4P3WA 3HZKA 4NWUH 1MCWM 3UROR 3Q6FB 1I85C 4H1LG 1PX3A 4DGYH 4MNHB 1CQKA 1MAKA 3LB6D 1WAAA 1HINL 3B9DA 5E1HB 1CYGA 1ED3A 3D0VA 3QUYB 1AP2B 4MD0A 3EFDH 2ZKHL 1KC5L 2HLAA 1DL7L 5FYKD 4YIQB 5DUMH 3U30B 1IEHA 3G04A 2G60H 1MY7A 3BPLB 2L7UA 1YQVL 3FTGA 4Z7UA 4AIZB 4AG4L 5CJXA 5CSGA 5BXFB 3HRZA 5JW4Q 4NM8L 5C0RL 1I9RH 2VDOH 2CKBA 1WV7T 2ZCKL 3PWPD 4N5EC 2CRYA 3EDDA 1FL6A 2X70B 1DJSA 4YFDB 5HD8D 3MJ7B 2HJLA 3OX8A 1UYWL 1XGRB 3QIBB 1MOEA 1U92A 1QSFD 4OGAD 1NMBL 1OL0A 3TT3L 4EXKA 4LPWA 1B2WL 4YUEL 5HY9B 3IFNL 2V9QA 3PJSB 1F3JA 1D5BB 4Z7UF 3T2QA 3RWEA 3VE0A 4HCRH 4XVTL 2PW1A 4DGVH 5C0FA 3EW3B 1KBGH 2D7OA 3NIFE 2H1PH 5CFHA 2OXGA 4FP8L 2X41A 1OPGL 1KT2B 3GGWA 3B9AA 5JORA 3SEPA 1WUNT 5J6GB 4GQPH 3W9EA 4X99B 1FL5B 4XNMB 4LSDA 1I8LA 1KB5H 1YA5A 1G7MB 3ARGC 3GMOA 1BQHG 4LU5L 3O3DA 2P44B 4XP4H 4EUPH 4EUPB 4MJIE 1OP9A 4LVHB 4L8DA 2K3TA 4ZAKD 2P7TA 4GJTB 1BFOB 5E00B 4PJDA 5EULV 5T3XD 4XCNB 5EOCJ 4KRPB 4K94H 5EU6B 4HV8A 4OV5A 1SMAA 3MV7A 2YN3A 3GSNL 3TCLA 3DGGB 3JTSB 4JN1L 1MWAB 1OB1A 3GFUA 3PNWA 4KQ4H 2IANA 1BZ7B 1YEJL 5F9DC 3MLSH 5L0QB 4LLWA 1F58H 1X7QB 4JO4L 4FZ8L 3M07A 4P5TA 4JRXB 3KS0J 5CILL 4CVUA 1GC1H 5H94B 15C8H 1AY1L 1RZGA 2P8PA 4WFHD 3VGAB 4BH8A 2J2ZA 4QCIB 5SWSE 2M8XA 3VD7A 4YPGB 1R3LA 2IH1B 2JIXD 4QRRE 3TZVA 3GIVA 2N7BA 3LRSA 5AD0A 2D7PA 2N1KA 5IVOA 5JOEA 4OM0H 4ODWA 5DHVB 1ZLSL 2Z92A 4JY4B 3P77A 3MRFB 3IU3A 4K7FA 1UQSB 2WBJB 4M61B 3MC0A 2NW3B 3C8HA 5C0GB 5T33H 5D7JC 3VXOA 2FR4A 3RVUC 4ZFFB 5IMMA 4PJEF 4KWUA 5I30H 4HWEH 5JW4N 5TFSH 3MJ9A 1KIPB 5EOTB 3U79A 4EIZC 3U9PH 1IKFL 4QYOA 4KHTH 2A9NH 4X6EA 1S9YA 2VKXA 1LE5A 1ZWIB 2KBGA 4B7LA 4IHOA 3RP1A 4JFDB 1Q38A 1I8KA 2YD8A 2NX5E 1BBJB 3T0EE 2E3VA 1I8KB 3LS4H 1IGYB 5EZLA 1PEWA 3WHE1 4PJ5D 4YDLC 4HMEA 4JY5H 5JR1H 5IMOA 4DVBA 1FP5A 4K9EH 5FM5O 1EA9C 4MYWB 3QQNA 1WBZA 4P23B 4S1DC 3KS0H 1NCCL 5EO9B 2A2QT 3VD4A 3PWNA 5JO5A 1IM9B 3JWDH 4MA1B 4D9LL 1T4KB 5EO9A 1WBZB 4YHYC 3CH1A 4LNRB 2V5YA 2WM0A 4R26H 2FX8H 3WIHH 3EUUA 5LGKA 1J10A 3F58L 3MLVH 3QISA 3IFPA 5IK3A 5JHDA 1IC4L 2FDBP 1D9KA 4S0TD 5BMFH 1A21A 3H8NA 4JO2L 3LS4L 2OMBA 1A6UL 3DXAD 3WYRA 1ZWIA 4GKZB 4X6FA 4IM8A 1TENA 3N1QC 3PWLA 4H5SB 5DFVD 5EN2B 2A0LD 2R29H 4LCWD 1BAFH 3ARVA 5FO7B 4CVWA 4JQXC 3VWKB 3G08B 4AJ0A 2VUYA 1BJ8A 3L6FA 1IEBA 5D72H 2O5YH 5TGBA 5F44A 5M7QA 4Z7NE 4KZEL 4FTVA 4J2XA 3BAEH 3RWHB 5EIQA 2C4XA 1I3GL 5GRZA 1OAXH 1M6OB 1SYSA 5LXGL 1CDIA 3MBXL 1A1MA 1CTNA 2ZNWA 4QXWA 3UTSD 4BYHA 1PQZA 4OGAC 1PFCA 4X0KA 1HOCB 5MP6L 2APTA 1X44A 1CGSH 3CPLA 4I4WA 2VLLA 3JV5A 3QEQE 4J3OC 4EUPA 3MRPB 2GJ6B 1JPST 4NUGL 5DWUL 4QCIA 1YNLH 3GBML 4V2BA 5IJVB 3VXRD 1FYTD 2AJZA 2VRAA 3PGFH 3HLAB 1JWSB 1OTUD 1ZA6B 1T0MB 4CVXB 1DEDA 3L3IA 4PRIA 5GS2D 2X09A 2OCFD 1FO0H 5LXGH 3O9WD 3TCLB 5HHVH 4WJ5A 3NCEB 3GSUA 4N0RA 2ORBH 1BECA 3ILQC 1CI5A 3RY6C 4FMKA 1RUAH 3HHRB 1TETL 4P2QE 2B8OT 4JG0H 4Z8FH 5JDSB 4NBXB 3WDJA 2C9AA 4D0DB 3TZVC 4R4BA 2P4AB 5GRYA 5JPMB 1IILE 1AO7D 5E7BA 3IJSB 3MA7A 1OARH 1JZ2A 3BN3B 4GRWH 4K7PH 1ZT1B 1XGYH 4PRID 5FGCE 2YPVL 5FUZL 5LGHL 1A4KB 1IC1A 2CKBB 1W0VA 3NAAL 1AFVL 1CU4L 5BS0D 1MCJA 2JK5A 4JRXD 5DMGD 3TH4T 3QIUC 2BOCA 5C2BL 4WWKD 5J8OA 3A6CH 4CMHB 3D87B 3U7WL 4JFPA 1MLCB 2ZUSA 4ZTOH 4HUXA 3BIBX 5I74B 1NEUA 2GKIA 3SDCD 3QB7C 1OAZL 4PUBH 4M7KH 5CEYB 4LRNL 4RA3A 4LIQE 4GKOA 2ZCLL 5EBWA 5D1XD 4K3GA 1KXVC 3UZQA 5CEZL 3QQ9D 4XCYA 4ZO8A 5DVMA 5DJCB 4OI7A 1KELH 1CU4H 4FZ8H 1FAIL 5JPMA 4J3XA 1GC1L 3KPPA 1SBSH 4F7PA 3ZYIA 4LLUA 1FG9C 4KK9C 3PWJB 3F5WA 4HKJB 1NCWH 3GUTB 1V05A 2F54B 1A4JA 3NZ8A 1B3JA 1ZEAL 2OR8A 4DZ8B 2IQ9L 3NGBB 1QQDA 2P24A 2HLAB 4LHUD 4ELME 1OW0C 4PUBL 2ARWA 3BEWA 3NIGE 3L5WA 5I66A 3WNNA 5DZNA 5AG9A 1WFOA 5IESL 2XOTA 5JXAH 1V5JA 4PR5A 2W59A 4DKFH 3MUZ1 5C3LD 5KTEH 4GMSH 2WBKA 5GRVL 1IQWL 1I1AA 1LO3H 1ZE3C 3HPLA 4LPYA 4ZYKA 2BHUA 1A5FL 3BZEA 4RFNB 4L4TD 5IW1B 2J6EA 3C5ZD 2GJ6A 1I1CA 4CUCA 3V79C 2LFGA 3TVMB 3I6LD 3WFCL 4Y19B 2CGRL 3U36B 3VMNA 3IU4H 1HWGB 5DD1H 3NTCL 5I71B 3NCMA 4LSRL 4MXQC 3QUXA 2VLKA 2XTJD 1UH4A 2NY0C 3HA0A 3T65A 2ZOKB 1ES0B 5IM7A 3D69B 2FBOJ 3G5YA 4JDVB 4MVBD 4RISL 1G9ML 4XNZC 4IRJC 4QHKJ 3UJTL 3UX9B 1BF2A 5FFLA 2X4QB 1HEZB 2DD8H 2EXWD 3HC4L 1UVQB 4N68A 5TDPB 4GRLA 2J4WH 4X4XB 4X9BA 4P5MB 2UWEE 5I1LB 3ULVC 3OV6A 4G8IA 2GJ6E 2CIKA 4U0RB 4UDTB 5EC2B 1FVDA 4Q6IC 2Z8VC 1UZ6E 2XPGB 3RGVA 4JGJA 4H20H 5DMYA 3TO4C 3W81A 3NTCH 4IRJA 1CE6B 1KN4H 1T2QL 3OJMB 1J11A 1T7WA 3OB0H 2F53B 4NNYB 1ACYL 2A1WH 4M9OA 1MCLA 1A7BA 3IXAB 5SWSA 3DBXB 1J0YA 4X4ME 1CD9B 2X2YA 3UXFA 5IHZA 4MCZB 4ZUWB 3LD8C 3IDIA 2NX5D 4MX7B 3ILQD 4H1LB 4X9FA 3MNZA 2O5ZL 4MDIA 1KEGL 4LIQL 2A38A 4NZDA 3MACH 3JV6B 5D72L 1FZKB 4KQ3H 4OBSA 3L5HA 1CFNB 4YHNA 2F19H 1A7NH 2YPKB 3VXMA 5I1CL 4LPXA 4WV1B 1MUJB 1GPOL 2FX9H 1ACYH 2A1WL 3UPCA 3QDGD 3THMH 4Q7DA 5FDWB 5CD3B 4DGYL 1G1YA 3QHTC 1MRCL 4H8WC 5JW3H 43C9A 1NFDF 4IHOB 4QRPB 1PW3A 5C9JA 2CKBL 2DJUA 1S9WA 3VXUD 3S37H 3OGCA 4FFZH 3QWRD 1U3HC 1CT8B 3O6KL 5HYSG 4GBXD 2HFGH 3HTLX 5JMRA 3HPJB 5C0DB 4JZOB 4WUKH 4WHYH 2X4QA 4P2OA 4PLNC 3DROB 2CLRB 3HAEG 4G6FB 2CDEA 3SDXA 4U7KA 1IC7L 3G5VB 2BNQB 2F19L 4GAGH 4M1CC 2WBJA 3OKOB 3MRLB 1O7VA 3B5HA 3H3PH 1U58B 3UYOD 4CN6A 5C0CD 4KDWA 4HJGA 3P9MA 1Q0XH 5DLMH 4KK5C 3KLAA 3G6DH 4DTGL 4MDJB 1TZIA 2Q6WB 5DZLA 1D5ZA 4P46C 3TT3H 4OZFG 5E0QA 3PGCB 5DHYB 5ACZA 4WFFD 5AEAA 3B2VH 2JJWA 3B6SA 1N6VA 1EJOH 2V9TA 5I1IL 1TNNA 1AKJA 4NCC2 3BMWA 3VXNB 5FOBA 4F33B 4C56A 2DL9A 3DVFA 3RZWA 1A2YA 2XTLA 4I3SL 1YDPA 1MCDA 4CL7A 3D39B 1G7HA 2AEQL 2IJ0C 3SQOL 1D5ZB 1F11B 5DLML 1GC1C 1UB5B 3S4SA 3KLAB 2D0HA 1T03L 5B8CB 2GCYB 3Q2CA 1KCUH 5TQ2H 4Z7VF 1T3FB 5IUSA 4OZ4B 2JELH 5D7SL 3R8QA 2VSCA 4HKJA 2Z31C 4HG4K 5J12C 2EH8H 3WNLA 4UBDC 1WFNA 3VFVB 2AEWA 3KYOB 4LRNH 4G7VH 1WF5A 3Q5YA 5DD0H 4MA8L 1IARB 3VW3H 3IKKA 1X4ZA 3HZYA 1NAMB 4HK0A 2HH0L 4XCFL 3MR9B 4XVJH 3BKYL 2DMKA 3P73A 4PG9B 1WAAE 2WK2A 3UJJL 1EHAA 2C1PA 4LLVB 1ZLWH 4Y5XA 5IBLD 3B83A 5I75B 3VRLE 2R0KL 3PL6D 4ZS7H 5C9JB 5JW5A 2J3SA 1QRKA 4L4TB 1KPUA 1RURL 5DJ2B 4Z0BL 3WUWA 1EFXA 2FWOB 5DI8A 1FFPA 4KJPC 5FYJE 2J8OA 5J9PB 4V1DB 5GRJH 1MHPH 1DN0B 2E27H 5B4MD 5E9DD 4KVCH 1Q9OA 2HLFD 5C0BD 1B6UA 1FZKA 1MEXL 4IOSD 2ESVD 3E0GA 4C57C 1QLEH 3HE6B 4XCFH 1ZTXH 4U31A 2QADC 5ITFB 1JFQH 1RJZB 4L9LC 5JIIA 2C3VA 1BJ1J 4HLZG 4YO0A 4N0FA 5CD5C 2IPTL 3SCMB 1EBAA 4C83A 3ARUA 4AIZA 1EZVY 2NX5A 2WUBL 1U8IA 5BS0B 1B0GB 5A43C 5JW4R 3MRHA 1MCCA 3VDCA 3L7EA 3FB8A 1MCPL 4I0PD 4ZQKB 3RHWK 5IG7B 2PXYC 5JXED 3QQ3A 2YUXA 4PJ9A 4P4RB 3V5HA 3OR7A 4ZUUA 3HUJF 4N90D 5EC2A 1BVLA 2CLVA 3K3QA 4PRBA 3U82B 5ENWA 2VQ1A 1HXYA 1XGPB 4F8QA 1G9MH 4OGYH 4UT9L 4ZAKC 5FM5M 3UJTH 3KYKL 3IFLL 4KK8C 4BFBD 1CXFA 2R2EB 5JQ6L 1VDGA 4LBEA 1F4YH 1DBAH 1I3RB 2MNUA 4DEPC 2ILLA 2GTZA 3HMXL 2CPCA 1U8OA 4NM4H 4EN3B 4EN3C 3KPRE 5ICYB 3IJYB 3MBEC 3X3GH 2CKNA 4PREA 1RUQH 5MHSD 4NQEB 5J1AA 2FO1A 3IGAB 2GY7B 5ECJE 3GB7B 2NYYD 1HYSC 4ZAKB 3TA3B 2VLJB 1TVBA 4NRXB 4HIIB 4RBPK 1XGQA 3Q0HA 3RFZC 4M3JA 4LNVA 4R7DB 4UIMA 1JBJA 5IVXE 3BP4B 3V6ZA 5EZJA 1U8JA 1T80A 4OLXL 4XPBL 3E3QC 3VGBA 3QXVA 3L3DA 2A6KA 1XIWC 3DARA 1BIIA 3SDDA 1OT2A 2C4FT 2IPKA 1IQDB 3WMSA 1RQ5A 1A7NL 4LCCA 2EDDA 1I7RB 5HDQL 3GK8L 2YBRB 2VDNH 4UZGA 1AR2A 5CJQL 3B4NA 5CP3H 2VXUL 4P48A 5T3ZH 4UV4H 4UAOC 3WIHA 4LSQH 1RZ8B 1TJHL 1T1XB 3WKML 1WWBX 1ZOXA 1IAIL 5GSRA 4Q74A 3TPKA 3VCLA 5DJCA 3PWNB 4NT6B 5CJ8A 1FLRL 3FT4A 3MRCA 1QBBA 2DQJL 3DVNA 1CK0L 3DMMC 5H35B 1DUZA 1CVSC 3SDYH 4GXVL 4KROC 4F37K 1HI6B 3MO1A 5MENA 4PJAB 4WV1C 1JNLL 5L6YH 4W4OA 4PJXF 2EKJA 3FT2B 1HILB 5JTWA 3FB6B 5KSAD 1LE5B 4JLRB 3UTQA 4X6EB 2VDLL 2W0LA 4XCCH 4DTGH 2F53D 3CSPA 3AAZA 5FDYA 2EDQA 3HG1E 5BQ7A 1KCRH 1JZ4A 1XF5A 1KIPA 3HNSL 3W11C 5B39B 1YUHB 5BV7H 3GHEL 3CK0L 5GGRB 2AK1H 3MX0A 1GIGL 4D0DA 1I9IH 3ZDXE 5INDB 3LKOB 2MHAA 4RGNE 4IOFC 3ZYJA 3LPWA 2R0ZL 1IKNC 5E99L 4YR6B 2ZZUT 1TNMA 4O2FA 5DEFA 4J12A 5EO0A 2IF7A 1IBGL 2HFEB 1DANU 5MERA 5DJDA 2O61B 2QJDA 3JWDC 2JTDA 5F7UA 3KXFA 1LDPL 5H37H 1CDGA 3L3IB 4EKXA 3WUWB 4HJJL 4D0CB 4OZHB 5E9DB 4R7NB 1WQVT 3PDGA 4IJ3B 4GW4B 4QHNA 4DGIL 4EXPX 3BZ4B 1U42A 2J8UA 1M7IA 5T5NF 3VFWA 4O2EB 3VWKD 3O41A 3MRJA 1CICD 3MRPA 3EYUL 4KKLC 2PO6B 5FCUL 5TE7L 3MRMB 4IS6A 4LEXL 1VGEH 3ZDYF 4YDJB 1QSFE 1F6FB 1LK3L 3D25A 3O6MH 1QA9A 1RURH 4NUJA 3TFKD 1F4WH 3MJ6A 1P7HL 4DAGH 4RIRB 3CZFA 1FNSH 3B9KC 5E2TH 4K3DL 4Z95L 3B2UD 2VIRA 2PR4H 4JG1L 3EOTH 2V2XB 5DJ6A 4EIGB 4HPOL 5F1NB 2HT2C 3KYMB 5GS0C 2G5BB 3CNKA 3DSFH 1CL7L 3O3EA 1LO0L 4GG8A 4MQSB 3E6FB 2CR3A 5GSVB 4ELMF 3BRFA 4GLRI 5IESH 5EU4B 5FCUH 4P99A 4KTDL 1JI2A 2PW1B 4YHPA 4YXHH 3OHXA 1OP5K 3WL9A 2X7LB 4JAMB 3ZO0A 3BIAX 2VAAB 4HLZH 3F7YA 4UINL 1LO3L 1QZ1A 1MRFH 5CSZA 3EFFB 2ICEB 1T7VA 4OLVH 4FQCL 4L5FL 4QT5A 3SGDH 3NFSL 3LKSB 3ETBF 4TTDC 1HDMA 1EHXA 1A14L 2AJUL 2DJSA 4K3EH 2FGZA 1DDHB 4WY7L 4HJGB 1MI5A 5HDOA 3TA3D 2VLJD 4Z77A 3N9GL 5J89A 4QLRA 4MAYD 1RULH 3UTSB 1AXIB 3IFLH 4POUB 5T1DH 1QBLL 2ESVA 1W72B 4OKDA 3UTPD 4X80H 1QSVA 3L9RB 1JHTB 4OFPA 4PGEB 1NBZA 1YY9D 2BVTA 4L8BB 3O9WA 2MKWA 3TO4B 3QXAB 4NJ9L 4AH2A 1N64H 3WXVL 1C7SA 1Z3GH 5LAXB 3SGDI 1CT8A 4JFHD 4MHHI 5F88A 4FMFA 3X3GL 3MRIA 3CFCL 1EEQA 1PZUB 3MV9D 5CMAB 3LQAC 1CICC 3MRIB 4CJ0A 4IDJL 3CSGA 4QYOB 4UT7L 3QFDB 4N0CC 4YUEH 4D0BB 2YA1A 4LF3A 2OXHA 2BJMH 5DJYB 4CDHA 3O9WB 3TO4A 3N9GH 5TJWK 2BRRH 1FZOA 3MLWH 2BNQE 1CLZH 2ZSWA 3ILPA 2FRGP 1H5BC 3P9LB 4PJAE 2BY1A 4J1UB 1KBGL 4JN2A 3CSYB 1JYNA 1A3LL 3P77B 2GSIA 5DD3H 1RVFL 4KV5E 3QDME 1MJ7L 4ZXBC 1T21B 1F02I 3L3HA 3CFCH 1XGTB 2GSGB 2W9DL 3GKZA 3QJHA 5BV7C 3L3GB 1MFEL 4IOFD 1EMTL 1QLFA 2NY1D 4KJQC 3GSVB 5KG9A 3FOLB 2FJGA 4NNXB 1ZHKB 4Z76B 4PY8J 1N0XH 3BH8B 5CGTA 4TQEH 4CDGC 2B4CC 1TJIH 4YE4H 3W11D 3QPQD 4WHCA 1NANH 4P3CL 1F6AB 1WIOA 3NZHH 2RFXA 5HHPA 3VG0L 4U4BA 1JZ8A 1HQ4A 4JREC 5FB8A 4PGJA 3HE7A 3MV01 2QR0A 4MJ4A 1UVQA 1HEZA 3MLSL 5E6IA 2HRPL 1E4XH 4MNGA 1CTOA 3BWAA 5J56B 3BP5A 3MOBL 3RVXD 5LVEA 4FTVE 1NMBH 3W0WA 5C0ND 1DBMH 3MYJB 3P0VL 4G43A 2JJSC 5HI5C 1LO2H 4XC1H 3TLRA 4HK3N 1KLUA 2AQ2A 4FS0A 4P57A 1U93A 3DURA 4Y16C 5C0AA 1NLDL 3S8WA 5HI4C 1T04A 4QTIH 5JOPD 4FQ2L 3ARBB 3OKDA 3S4SB 4UB0H 3BJLA 5FKAA 3RWDA 2BVOB 3OSKA 4EI5A 5DMKA 3TBVA 4XHJC 5ESVA 3RNKA 4WW2F 3B9KA 3K8KA 2EYRB 2D2OA 4R4FH 1DP0A 3ESVF 3ARED 2YD4A 5DO2D 2DWDB 2ZJSH 3WLWD 3T8XB 1YEIL 2Z31B 4FHBD 4R3SB 1F45A 2IWGA 1UJ3A 4IRSA 1ZGLA 1N26A 3UP1A 3PGDA 4YLQT 3S96A 1P1ZB 2X89A 5T3XL 1U58A 1FGNH 4Y4FC 1GAFL 5SWZA 3UTTD 4OCWL 4Y4KA 5ANMA 2YKLH 4HHAA 4YHOH 3TN0D 2GJJA 4MA8H 5JPNB 3BDYH 1F8TL 3OAZH 4ODSL 4HWBA 4OQTA 1BFVL 3RX5A 1VGEL 4OCNC 2C3XA 4R3SA 3MLUL 2COQA 1VFAA 4Y8AA 4YK4C 1PSKH 1AGBB 2DTSA 2YUVA 4M7LT 3HI5H 3R4DA 3EDJA 1IM3B 4JFPB 3VXUB 3CLFL 4QXUL 4HHAB 3T0BA 1BJMA 4Y4KB 5I1DA 3GHBH 4OGXL 1F4XH 4OCLC 3QEQB 1NAMH 1R5WB 1JPSL 2F53E 4X7FC 2IG2H 1X5XA 5AYQA 4P46A 3S97C 4F2MA 5BVPL 1CFQB 4OAWB 4OV6F 3EYSH 5DQ9A 2DBLH 3CVHH 1RZJH 1FORH 3QZWG 1JWMA 3U9UB 2Y5TA 2P49B 3FQRA 1S7XA 5I2IA 2R4RH 4QWWD 4FQCH 4GG6F 4HPYL 1A9EA 2YC1A 5ADPH 3NFSH 1YY8B 4X6BA 2DQUH 4RNRA 1UCBL 2A6JA 1VCAA 2H32A 4P9HH 3ZKXB 2VISA 5MP6H 4FQIL 5F72S 5FV1L 3AXLB 2ADGA 4KDVA 1OGAE 2CMRH 4JHBA 3PHQA 4HS8L 4HBCL 4L29A 1JYWA 3ES6B 3JWDL 4R7DA 3EYFB 5EBMA 1JV5B 4XMKL 2JJTA 4RBPH 4NO3A 5GGUA 2IAMD 2VLKD 3HI1A 4MB3A 4WTZG 2ERJB 5JDJA 2ITDA 1FN4B 5TE6L 3BPCA 1XH3B 5IQ7H 1P7QA 5EA0H 4MB4A 3HR6A 1Y18B 4JM4L 3L3HB 2X1QA 2YR3A 5E6IB 4KI5F 3QI9A 2CIIA 3W0WD 5ICYA 3QIUA 1P7KB 3BP6B 1DL7H 3VI3F 1A1NA 4RWHA 3IXTA 3G5XB 1FNEA 2X1XR 3BUYB 3QHFL 5DK2A 4JO1L 2D7TL 3UPRB 5DC0A 4NO3B 5A2FA 2RGSA 2UUDK 3DX9A 4XVSL 3WNKA 3TWCL 2I26N 1A3LH 2O5YL 3G08A 2IALA 1CG9B 1SJXA 5ENWB 3QIWB 3PL6B 1E28A 3OXRB 4GXUN 1E27A 2VH5H 4X83A 4LDEB 3FQTA 3MRDA 3UO1H 4N9OB 5HI4D 2Y72A 5IHBA 3EZ8A 2HT3D 3MLRH 1LNUB 1RZIA 4U1MA 3UZVB 3DYMA 4JKPH 2WLZA 3MJ9L 1CFBA 2GUOA 5C0BB 2EYSA 1FFQA 4TQEL 4JPKL 3P40A 3ZHDA 1IT9L 3BO8A 1AGEB 1G7PB 2XWTA 4L8SA 4P3CH 5EWIH 1BEYH 2JB6B 1FVEB 5ITFA 4F57H 3LKQB 4GQ9H 4Z77B 4WUUA 1S7VA 2EDWA 5HGDA 4PJ5A 5I18H 4NRYA 3VWJA 1GOGA 4H25B 4I5BB 1RK0B 2BX5A 3Q1SH 3UTZB 5I8CA 1HDMB 1H8SA 4N1EA 5HHVL 4V1DA 3P0VH 3KYNA 2OK0L 4PJ7E 3HE7C 3C60B 4KJQD 3INUH 4NKDA 3WS3B 4NSKB 1X5HA 1WBXA 3OHXB 2BVYA 1NMAL 3PWVA 4TSBL 4K8RH 1MPAH 3I02B 2JK5B 1ETZA 1YYLL 4HK0B 1OARL 3S88H 4FFWC 4K7PL 1AC6A 1VB9A 1U8MA 4XRCB 5KTEL 2EXYC 5IBUG 1N5YH 5DRZB 1J12A 2HG5B 5HYEA 5SWZB 5EOCL 4QEGA 1N8ZA 4NQTA 1M71B 1N7MH 1CBVH 5AD0B 3RVWD 4X4YB 2QEJA 3WL9B 3TM6A 4X6CA 1FBIH 3OWEA 3QDGA 4IIQC 2XKSA 2HN7A 1MQKL 2FH6A 4NN5B 5BZWA 3UC0H 1MIEH 3ARDC 5J1TC 2KZ1B 4CVXA 1T0MA 2OJEB 5HYFA 1UXWB 5EG6C 2YKLL 2V2XA 2ATPA 1PY9A 4OI8A 3R1GL 4P2OC 5SX5H 2E7BA 3I9GH 5C92A 1J05A 1BZ9B 5KSAA 2FYYB 1NL0L 2MPAH 4CKVX 4I0PA 2NY2D 1ND0B 2FGWH 2IQAB 3MPCA 2R2HA 3CD4A 1FC2D 4OSUH 4JQVC 2Y6SD 2FHCA 1N7ML 1T1WA 2EE6A 4X6CB 1ZGLM 1FLTX 4NRZB 4U6HA 5J06A 4KPHL 5JHLL 3P9MB 5DYOB 5F7DA 4J4PC 4NRZA 3IDNB 4U6HB 3O6ML 1A1MB 4YR6A 1LP9B 5BOPA 1AD0B 1KJ3H 4MWFB 3UAJD 5FM8A 5C71A 4PTUA 4JPWH 3CFDB 4MVBC 1UEMA 3QHZH 2Y5EA 2HG5A 1KTLB 3D9AH 1NGYA 2GJZA 2ITCA 4JFZH 4XNQA 2FHFA 4FG6D 4HZLA 3U1SL 1WJ3A 3MCLH 4NHUA 5E9DA 3F7VB 5EORL 1YUHA 3C60C 1N3NB 3GMNB 2IG2L 1JNJA 5D96B 5I17A 3LSOB 2DQHH 5FHBH 1JGEA 1RMFH 2XXMB 2P5WA 1FNAA 3QA3A 3ARFA 4E41D 3CDCA 3FQUA 3WFCH 2D03L 3W2DH 3BSZL 4YDIL 3MXWH 2NY3D 2HKHL 4YHZL 3VFGH 3KXFD 3MREA 3X17A 2P5EE 5BMFL 4NNXA 1JZ5A 3FRUB 3S5LB 1U3HB 2R56L 4AYFA 3QHZL 3ZKQD 2ID5A 2DTMH 3T2OA 4PB9H 4OF0A 5FYKH 3GMLB 4FFZL 5KAQG 4H1LH 4L8CA 2NY1C 2P5WE 2KPNA 5JO5B 1XF5B 1I8IA 3MV11 3FO9B 3W82A 1Z9LA 4TYUA 2ADIB 4NKMA 1FSKB 5LQBL 1SMOA 2XWTB 3DV6B 4G80A 3H9ZA 1ZANH 5HYQB 1MI5D 3BO8B 3QCVL 3HKFA 4RGNC 5HGGS 3QPXL 5GZNC 4LLYB 3FB6A 5KVGL 4NJ9H 3WFDL 5F6HJ 2DYPD 4XGZB 4GOSA 1FFNB 2XWBB 3ZL4L 1ED3B 2XPGA 3G6DL 1IQDA 3KPMA 1MNUH 2J8UE 2UY6A 3GKWL 1KCSH 1KJVA 2HWZH 4XXCC 2VXSH 3T4AB 1FVCA 2Q8AH 5I1LA 1PG7L 1QKZH 2B4CH 1DZBA 1S7UB 5CCKL 4HT1H 1F3DH 2NTFB 2ZG3A 2XT1B 4E0RB 5FV2A 4FFVC 4XZUA 5HHOD 4YFLF 1W72A 2HKFL 3G5YB 1U8KA 4ZTPH 3VWJC 5GXBB 1YEGH 1NBVL 3WSQL 5C0RH 3NBNA 4JY4A 4PBVC 5FGBA 1EX0A 1MFAL 4WDIB 3BKJH 5CEZD 1L0XA 4JJHA 4RFEB 1NPUA 5F21B 3VFMB 4MAYC 2VZ3A 2CR6A 2HWZL 5KVMC 5D71H 1KCLA 4X6DB 1NC4A 1KLFA 2HYMA 1GOHA 5CIPA 3CFIC 1T89C 3O6KH 4XPHL 2HTKD 3QWRA 3FQWB 3I6LE 2PUQT 3ARBC 3VDAA 3ECBA 3EOAA 3DECA 4NO5A 4DUWA 4XB7A 5C1MB 1L7TL 3BX7C 4LCWB 3E6HA 3IKCB 4JB9H 3N0PB 4FG6C 3QDJD 1P84J 1QVOB 3ALWA 2HAZA 1NBVH 3D18A 4TPRL 3ZE0E 4FOMA 4N0UE 3P4OB 3UAJC 5DJ6B 4AQOA 3T77B 5KW9L 1PZ5B 4WU7A 4FXKA 4WO4D 4G3YH 3WNMA 2ZNXA 1B0GA 4OCSL 4S1SH 3GSQA 3O4LE 4RIRA 3WD5L 2YD9A 3OKKB 5DRXB 4FA8A 3KGRA 4FZEH 5ISZA 4YX2L 4XC1L 3TBSA 5C7XH 2FBJH 1DN2A 1GL4B 3WJLC 4JM2F 4M3KB 4WEBL 3ET9F 2XKNA 5D1ZB 3L7FB 3MRNB 2VQ1B 4K7PX 3SO5A 1HHKB 4P4KC 1RIUH 1RK1B 5E03A 3HNVH 1JF6A 2H32B 1NLBL 4APQD 3KR3L 4K7PY 5C0FB 3Q3GA 2ZCHH 1CWVA 4NQCB 4XVUD 1S5IL 4EI5D 1NC2D 3VWKC 1J0HA 2GW5A 2F8XC 3UZEA 1G9MC 1AR1C 1VFAB 5C07B 1SYVA 1PY4A 3BGMA 5GS3A 5DD0L 1INQA 3FO1B 1SJHA 2WANA 2XQYK 3GJEA 3V4UH 1TIUA 1T5WA 4Z0XA 1HKFA 1U6AH 3MXVH 5KOVC 2A6DB 4OM0L 4Z9KB 3VFUB 1GAFH 2EECA 4I48A 5DUPH 5EB9A 1DE4A 2DIAA 1KXQE 2FB4L 3VFRA 4KZDL 2LU4A 5T33L 4PLJD 4TSAL 5D4QA 1I8MB 1T3FA 3RPIA 5I30L 3B3IB 1KPUB 1Y6NR 3FZUD 1JGDA 4KGJA 3K2MC 5I73B 1D5XA 1P4IL 4HKBB 1N59A 4UDUB 4LLDA 4KHTL 1MFCH 4PG9A 3DVGA 3HAEA 3AM8A 1JWSA 5B3JF 1HHKA 3V6OA 4LARH 3WFEH 3SCMC 4F9LA 1BP3B 1U6AL 3BKMH 5F7LB 4ZD3L 1BFTA 2E8YA 3ZTJH 4Q58C 5EORH 5ANMB 5GGVH 2A83A 4PJ9C 3TBVB 1VSCA 3L5IA 2DQDL 3EJYC 3PGCA 4I0CC 1GGCL 3FN0L 4ZFGH 1NCNA 4G8FB 5HHQB 5B8CA 1F97A 1JTTA 3TBWB 1NCUA 4MCYB 4W70A 1CFSB 4XWGL 4CN1A 3T8XA 5C09A 2X4PA 4NYLB 2OBGA 3QULA 1JUFA 3OKNB 2AABH 4APQC 2HJKB 2QKIA 1U3ZA 3GJFH 5K9KA 1H3WM 4U1HA 4NQDE 5C0DA 3QUMA 5FB8B 3V4VL 4PJEE 3LQAL 4LASL 4L3CB 2N7AA 1JHKL 4HMCA 1NC4B 1YECL 3JVGA 5HJ3A 1DQTA 2EDRA 1JZ6A 4EDXB 3N1GC 5CEXB 5I0ZA 5C6TL 1RHHA 1HHJB 3ARBA 4X98B 3NIDE 3TP4A 1LEGB 1VGKA 5TF0A 4YNYA 5MI0B 1Y6MR 2YEZA 3NA4A 1XIWD 2Z31D 3DURB 3V4PL 2VLJA 4YDVB 4P3DA 3L5XH 1U8KB 5HVGB 1FZJA 3TBYB 1WTGT 5EA0L 5GQBA 4M6OH 4NQEA 5J1AB 5HHNA 1FO0B 2GK2A 4WI8A 1A1OB 4QRPE 3ZKMC 2B1HH 5KOMC 4JZOA 4H1LA 4GAFB 1LK2A 1U8QB 2R9HD 4WUKL 2GTZB 3IDYB 4K3JL 3RTQC 4WEMB 1YECH 3BIKA 4AL8H 2R1YA 5IIEB 3TEUA 3S34L 4NUGH 5DWUH 4NZTH 3ARBD 1CXLA 2Y07L 4JHZA 3ARGB 4JCMA 5F93C 2BSTA 5D8JL 3IYLW 4JGMA 4WW2B 3MRRA 3KPQB 2YUWA 4POZD 2Q7YA 1MCQA 4I3RL 3OR7B 1FNLA 3MV8A 1FO0L 2K9UA 1KJMA 5ESQA 1PD6A 4K3HA 2GT9B 1KC5H 4X4XA 5IMMB 5A1AA 4NHUB 1P6AB 4L9LB 1LE9B 2LABA 3HC3H 3SDAC 3DX8A 5D1QD 4UOW1 2AVGA 4EDWL 4PJIA 2ZSWB 2ATKB 5A2LH 5T5FL 4M5ZL 5KZCD 3GBLA 4YFLI 1QOKA 2W38A 1A7PH 2VL5B 4JFHE 4PJ8C 3QUXB 2B2XH 3LRSB 4YHKL 1A0QL 3FB5B 4IBLT 4M1DH 3JUZA 1MWAL 4MS8C 4PB0L 1RPQA 2GEEA 3CDGA 1MJJA 5F89A 5E94B 5I71C 5IF0B 2R2HB 3AB0B 1YN7A 3MRQB 4Y4HD 3G6JF 5K9JH 4MA3B 1J05B 4ZTOL 4GRLB 1SJEB 4LPCA 3WS6C 3VXQA 2VSDA 1VKXA 1UXWA 2EDTA 3K8MA 3RVTC 3DVIA 3WV0A 1OWRM 1E4JA 5CJOH 3C5JB 4DGVL 4EEEA 5FM4A 1M7DA 4TUKL 4NYLA 3MNWB 4MWFA 1NCBH 1AD0A 3UCRA 5EU6A 3IDNA 4XAWL 2BCKA 5E8PA 3S88L 2VLKB 1R0AH 1BD2B 3HZMB 4KUZL 5E00A 2OP4H 2XN9A 3W9DA 2OSLB 3MRKA 4HKZB 3TH3T 1I4FB 2FIKB 1SBBA 4AMKL 5I19H 1FAIH 4LOUC 4QT5B 3GDBA 4Y88A 4I0PB 5E8DH 3EFFA 3T2NH 2APWA 2DI9A 3V52L 5DRNB 4OCYH 4OCXH 1IGJB 3OKEB 1NFKA 2I25N 1EAJA 1QYGL 4YHPB 3C5ZA 4FQQA 2PO6A 1PLGL 4LDLB 1Q0YH 1NBQA 1AKJD 4LLDB 1WISA 1A6TA 2IANE 4AEEA 3PWVB 4APQA 3QIWD 3FO2B 4J3VA 3GMMB 1LK3H 3P0YH 2MMXA 4NKDB 3RGVC 3MRGA 3SN6N 4OZHA 5CILH 3RQ3A 2DLFL 3CZFB 2GAZA 3VFRB 1XFPA 2BNRE 2XY2A 2YRLA 1W8NA 2BSSA 3CAFA 1AXSB 1I4FA 2HTKC 2VO5A 3DV4A 2QBWA 1MAJA 2DLHA 3WNOA 3RVXC 2EDOA 5J6HB 3C5ZC 1IEAB 3CGTA 3PIQA 4DKAA 5BRZD 3MRLA 3CXHK 3MLWL 2MOVA 1M7DB 2JCCA 4P2OD 1H3VA 1WICA 4ZG1A 3F12B 3BZ4A 2WW8A 4G8GA 4P4KB 4PJ7A 1I9RL 3D0LB 3G9AB 5E1AB 12E8H 5BJTB 1KGCD 1VEPA 3DRTA 3WXWH 2B5IB 3FN0H 4MD0B 5FHBL 2X4NB 4XP1H 4XX1E 4JEGB 3VXRB 2Q76B 2WINA 3L95B 4FRWA 3U0PB 1NC2B 5A2IH 5DRWA 3P0GB 1KPRA 2FH8A 1MAMH 1AI1L 1I7ZB 1L4IA 1V8HA 4H25A 5AAMA 1OOAA 4YHZH 4RWYL 2QV2A 1YQ2A 4LVOC 5KVFL 1F42A 3MV7D 2UYLA 3VXMB 5GRUH 1UWEH 1JF5A 2OTUB 3LV3A 3O11A 3O4OB 4NQED