1R3LB

Potassium channel kcsa-fab complex in cs+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab fragment light chain
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3lB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3lB02
8FABA 2A83B 3QNXB 2R1WA 4HULB 3S4SA 4ZUVB 8FABB 2AJXH 3S4SB 2BFVH 3WEXB 1FCGA 1FZJA 3QZWA 5EZJB 1AGFB 2FATL 4CVZB 3QZWB 2X42A 2SEBB 4OFDA 1MCFA 1A14H 3GO1L 3W11C 5JUEH 1AR1C 2YD2A 3H42H 3LQAL 3PHOB 2Z91A 5KSAA 1EO8H 3VXSD 4JN1H 3SO5A 4PJ8A 4GS7B 3WFEH 4PJ8B 4XCYA 4ZUTB 4YC2B 4N0UE 3QEGH 4G9FD 1CF8H 1HSAA 2CRMA 2D9QB 5F7DB 5EIVA 1QUNA 5I1EH 5IW1B 5JA9A 4L3ED 3VI4F 5T3XL 2NY1B 1MFBH 4QTHB 5F9WC 1NGYA 3TA3C 1JZ4A 3MV7A 4OD3H 5EG6C 3WL9A 5ISZB 4JVWA 1NBYB 4DJMA 3ORJA 2A6KA 1NCBH 3JV4A 4OCWL 1B4JL 4OTXL 2GHWB 2VDML 3QFJE 2UZYB 3EOAA 5IBLD 1ZLWH 4LAJH 1AHWA 1DEDA 2NXZB 3UDWA 3WFDL 1P4BL 4JZJA 1AHWB 2FX9L 4NHUB 1IZJA 1U3HB 5EZLB 2FIRT 4TNVF 4HS6B 2XNAB 3TNMA 3NCFB 1E4XH 1OGAE 4KVNH 4EN3B 1YEJL 3TNMB 3UO1H 4KTDH 3DVFA 5HI3D 2BNUB 1CD1A 2A77L 3G6JF 4HD9A 2W60A 4J3SA 4YFLF 4NP4L 3T0BA 3TPUA 5B22A 5EORL 3TFKC 2W60B 4DVRL 1XGTB 1OP5K 2C1PB 1W72A 3QWQB 4JFZH 4NJ9L 5FHAL 3VI4E 3VXUE 2GK0A 3P0GB 3FFDA 3HZVB 4OKVA 1W72B 4F7MB 1L9NA 1JRHL 4NFDA 4RX4A 5J56B 4OKVB 5EFIB 3IDXL 1KIPB 4FN0A 3LSOA 1KENH 2DQDH 3BOVA 5CD5C 4P4KD 1KELH 2NY0D 5KANG 5DYOB 1QSFE 4J7RA 4YFEA 4E41D 1FPTH 1AI1H 2HT2D 4KU1A 5DVMA 1TZIB 2MFNA 2FECI 5JNYB 3EIFA 3LIZH 3T4YA 1RSFA 3PP4H 2P1YA 1S8DB 5KG9B 1KYOK 2GKIA 3CSGA 1C16A 3IU3A 2R0WL 1MQ8A 2CJUH 3IRZA 4J4PD 1C16B 1ZHKB 3TV3L 1SJHA 3VFGL 5SWSE 3I85A 3SDAA 1IQDA 3IU4H 4LF3B 3G6JE 4EQ3A 1EGJL 3K2UH 3THMH 3QPXL 1IQDB 1I9RL 5FFLA 1DEEB 3ARGB 5JPNB 3L3OA 2P45B 5I1HH 2ARJA 1WFTA 2OMBA 3QB7C 2ARJB 2MWCA 1GGBH 1CZ8L 4I3SH 1KSRA 3HN3A 5E5RB 4ZSOB 3MCKA 3MV8D 4F33A 4PJ5B 4NNYA 2AK1L 2Q3ZA 5HYIA 4P23D 3MXWH 4OLXH 3ARZA 1IM3A 3U46A 1MIEL 4U1JB 1BJMA 1Y6NR 4U3HA 5EU6B 2FD6H 1FZMB 4LSVL 3CVHA 1QSEE 2X6MA 3W5MA 1N5AA 1V7NL 3BXNB 1JI1A 2AKRA 1F4XH 1N5AB 4TVPH 5GGTH 1G0XA 5HHPA 2AKRB 5IOPB 4LVNC 3W0WA 1CXFA 4H1LG 2AP2A 3Q3GA 3CXDL 1FAKT 5I2IB 1DBBL 3Q3GB 1NC4A 4M7ZB 4F7PA 5TE6H 3S36H 5EZIL 5E9DE 3VA2C 2D7OA 4TUKH 3CU7A 1XIWD 3VFSA 4M8VA 1P2CA 2QHLA 4XNZC 4CAGA 2YKLL 1JZ2A 5DD5H 2YPLA 3VFSB 1L7IL 1WF5A 2BDNL 2IAMC 1B90A 3MRQA 1XF2B 1G9MC 3MRQB 4ZFGL 1G9ML 3IDNA 3TBTA 5KW9H 3MSPA 3K4AA 1H3TA 1DBKL 3PE9A 1MWAA 3TBTB 3MO1A 4U7KA 1NUDA 3T0XA 3L9RA 3RVWC 3MO1B 1AO7D 3ARFA 1LEGB 4HKXB 4MNGA 3BVNA 4FQ2H 3GSOA 4YHNB 1AQKL 5HD8C 1A3RH 3QIBA 1PKOA 1QRND 4TUOB 1A9BB 4MDIA 5B3NA 1NC2A 4MDIB 3FOMA 1YEGL 1DQJA 3E3QE 5MP6H 4AZ8A 1DL7L 3KNBA 1MCDA 4GS7C 3KPNA 2ZG2A 4NO3B 3KNBB 4PJ8C 4PLKD 3SCMA 4RMQA 3MCLL 3EO1B 1WWAX 3UTTA 4NRYA 5C08D 2QQQA 2NY1C 3HUJB 4Q6YA 2Q86B 4NQCE 5C0BE 5C0FB 1L4IA 3T4AA 1KJMA 1ND0B 1PVHA 2V7NB 4TRPL 1S9VA 2M2DA 2WBJB 3WFHB 3EYVA 3O9WA 1S9VB 1CDIA 3BP7B 1DSFH 3EYVB 3Q0HA 1CFTB 5B38G 3VGGA 6FABH 2NXZC 1MF2L 5ICYB 4WIQA 1NSNH 4M6OH 4G43B 1AHWC 4I0KA 3UDWC 1U3HC 3O45A 4JZJC 3U0TA 1OAQL 3KPRE 3BPOB 3O45B 1D9KD 2CDFA 1RUQL 4FQJL 1T6WA 2R1XA 5DQ9B 1OTUC 5LGKA 1V5JA 5DSCA 4JN2A 1VACA 1QBMH 2Z93A 3VXTA 2XICA 5DSCB 3OKKA 4JN2B 3U9PL 1VACB 1IARB 1IGCH 1XGRA 2CLVA 3OKKB 1XGRB 2CLVB 1N64H 4K8RC 1KLFA 4I8DA 1H0DA 1JHLH 1H0DB 4K8RL 2Y25A 3MV11 1W72L 4PRIB 3VXSA 4PJHE 1CICD 1CLYL 5LQBL 1CXKA 2DM3A 5DMGC 1BQLL 5FYKH 5LKNA 1N5YL 1IEAA 4Y19A 4AG4H 3FO2A 4BM7A 4X8JB 1I3GH 5CJOH 3FO2B 2V5RA 5DHXB 5E8DH 1KTKE 3TO2A 4L3EA 5TQ2L 1BFTA 4N8CH 1UM4H 1S3KL 1U2CA 4LOUD 3HPJA 4PS4L 4QOKE 4R90H 4EVNB 2OL3B 1PKQB 5KS9E 4KWUA 5EU3A 4D3CH 4Z7VB 3CXHK 5EU3B 3MRNB 3QG7H 3EDJA 2YZ1A 3VXRB 1D5BB 4N0CD 3U82B 2OTWB 3ABZA 1XR8A 4NO0B 1IGIL 4Q9RH 4QRTA 2FH8A 1LEKA 1XR8B 4U6YB 2UVEA 4QRTB 5HYFA 3CX2A 1CG9B 5EWIH 2IFFH 1L6XA 1CDCA 1ZS8A 5KTEL 4Y1AA 1OD9A 2XA3A 3TBVA 1U2HA 3MBXH 3MUJA 4X0KA 2X4RA 1INQA 4F2MB 4X0KB 2ESVD 1INQB 4GRWB 4OF5A 3NIGF 5J3HD 2YUXA 1U41A 4HUVA 4CW1B 4H26A 3DIFA 5J1AA 3I6KA 4IIQB 4G6ML 1ZT4A 3UP1A 3QDMA 4TOYH 3CVHL 3I6KB 3LAFA 3T2OA 3QDMB 4MXQC 3T04D 5JDJA 3MNZB 3FQRA 1EUUA 3WNOA 3GIZL 4N8VG 5JZ7C 2VLRA 3EKCA 1U8KB 3KPSA 2VLRB 1X7QA 5AEAA 1M4KA 3KPSB 1X7QB 1ORSB 5AD0B 4M9PA 1KPVA 3FJTA 2BXYA 5MHSD 4AQOA 1R0AL 4KZDL 1KPVB 4N0YH 4DGYL 3C5SA 5F72S 2RAMA 1I9IL 3BQUA 2OCFD 4LDOB 3D9AL 4P59H 4ONOA 3SOBL 3BQUB 5JHDA 2IGFH 5INCA 3HMWL 3ARPA 3K2MC 3C5ZA 4NDMA 4XP4L 4BZ2L 3MGAA 1E28A 2XRAH 5CP3A 1ZKAA 3ZHLA 2X4UA 1VFMA 1MWAL 2F54E 2X4UB 2DIJA 3ARFC 5F88B 3QUZB 1DE4A 2VR4A 3SE9H 4FXKA 2BVQA 4WGVB 32C2A 3TYGH 4KROB 4NZRL 5JMOC 4FXKB 2GTZA 1BD2A 4NNXA 5A3ID 4HUXB 1BD2B 2HKFH 3S35H 1DVFA 1XF5B 2BSSB 4L9LB 1FNSL 1MI5D 1VCAA 4P9HC 3VFRB 4KRNA 1X5JA 4DK6A 3DVGB 4HUKB 1P7HL 1M7XA 4FXLA 4RDQF 1EJOL 1UGNA 1YEEH 3OKEB 3NCYP 3NTCH 4MNQE 2KL6A 5KSUA 3FB6A 4Z8FL 3VXPB 5D8JH 5FYKU 4YZFE 2DQEL 2WBJC 4MB4A 1J0IA 4KJPD 5F44A 1RURH 3RVUC 5CSZB 3GMMA 2FRGP 4A2MA 3O9WC 2QTEA 3BO8B 3BGFC 1W0YT 3AXLA 4ZTOL 4OF6A 3AS2A 4FQIH 5C8JA 1FORL 1JYWA 1LDPH 4F9LA 1MNUL 2W0PA 4JGUA 5IFJB 4AH2A 2R2HB 1WWCA 3BPOC 2BOCB 1YDPA 4AH2B 3MZTA 3ZKXB 3IRPX 1ZWIB 5GRVL 1H3GA 4PRAA 2F53A 3QEQE 5D1QD 3KYOA 4HJJH 4NIKB 4M61A 1TDQA 5GJSH 4YX2L 3Q6GL 4LRIA 4AM0A 1LE5B 3A6OA 5AZEL 1P6AB 5C2UB 4IMKA 5IMKB 4AM0B 3KYAA 1YYMH 4HK0B 4PJAF 1YUHA 5CWSB 3VFVB 3VW3L 1GGTA 5IG7A 2XT1B 3HR5B 3FAXA 1EEZA 5KSBE 2R0KL 3X12B 2EDWA 5I15H 2CSPA 5LG1A 4ZG1A 1FH5L 4WI4A 3K4DA 4G6JL 2VSDA 3MJ7B 4AIZA 3E1F1 1U8IA 4OZGF 4YQXL 2G5BA 4IHOB 3TJHD 4YPGA 2G5BB 4XP9H 3PQYD 1ZAGA 3CK0L 3BT2H 2J5LC 2N56A 1I4FA 2J6EH 4UNTA 2RQ8A 4XX1G 1ZT1B 5EU7C 1I4FB 5F7EL 5HY9A 2YPVL 3JUZA 4I5BB 5FUCC 3TPKA 5I71B 4M62H 5IVXF 3VJ6B 4RA0C 4JFFD 4MD5B 5C0RH 5I1CL 3ZE0F 5TE7L 5KJRH 1FC1A 1UVQB 3M17A 4LVHB 3M17B 4I9WD 4NQVB 2ZZUT 3GSUA 1WUNT 3BKCL 3IVKA 2XQBL 2FIKA 3GSUB 2VLKE 3IVKB 1RZJC 3ET9F 3QDGA 4RFNB 5IR1B 4LLDB 5DRZA 1NH6A 3MQIA 3QDGB 1RZJL 4QEGA 1J9CT 4HPYL 4IIQC 1CL7H 1R24B 1SJEA 3KLSA 4WVRA 3U4BH 1CICA 5F96H 1IGTA 5DUBA 2BY1A 4HDIB 2IPUG 2BJML 1BBDH 5DUBB 4JHWH 4PD4K 1MLCA 3ULUH 1X6NA 5BZDB 3BP5A 4JY5L 1MLCB 5FO7A 3CCHA 2DM7A 1YPZB 3LS5L 4U1NA 5FO7B 3ZE0E 4JO2H 4PB0H 3NMEA 2CIIA 1PZ5B 4OZFB 1GPOH 4X4YA 1PG7L 5MI0C 4PG2A 1FSKB 1KJ3H 2XZQL 4ORGA 4NFCA 2EE3A 2VDNL 1C5CH 1YJDH 3BQUC 4X5WA 4YDJA 4C83A 4C83B 5ERWB 2JLLA 1HH6A 4DW2L 3C5ZC 4UBDC 4PRHA 3S37L 1J8HA 3W2DH 1HH6B 2PYED 5ESAA 2QV2A 1HOCB 1IC5H 4WUUA 2P47B 3QUZC 3CJJA 5ESAB 1HK6A 5C0IB 3HE6B 4KROC 1U0QA 3HNTL 4XAWL 5CSGA 4TSBH 1G0YR 1P4IH 3OKNB 1KLUA 1Q38A 4FFWD 1KLUB 4GFTB 3O6FA 3D39E 3EO9L 4P2OD 4LSQH 4L9LC 4GMTL 1DVFC 1JWUA 3QH3A 3H3BC 3CLFL 1GIGL 1Z9MA 4OJFH 2VZUA 3QDAA 3QH3B 1CE1L 1CGSL 2FB4L 2A1WH 4YPJA 5I16A 4P9ML 1KEGL 5L88H 2JK5B 1TZGL 3MPCA 3OB0K 2N7BA 5TDOB 3VGDA 3O2VH 2J7LA 5HHOA 4M6ML 1MLBA 5KVFL 3WIFA 3OAUL 1MLBB 1IE5A 1JNHB 2EYTA 3BDYH 3SE4A 2ICWJ 2DTML 1PLGH 4OLWL 5ADPL 4MCYB 3PGDB 4AEIH 3DO7A 5K59F 3L95B 15C8H 4OIBA 2DJ4A 4F9LC 5EC1B 4L1HA 4J12A 3ZKXC 4WO4B 2WM0A 1YN7A 2EYRB 1Q9LA 5E1HB 1YN7B 1Q9LB 3LV3B 2I07B 5I9QB 1Y0LB 1GH7A 4IBLT 4KAQL 3NABH 3UEZA 2X9YA 4LRIC 1FVDA 1C7SA 4WEMB 4I1NB 5KBNC 5DD0L 1V3LA 1II4E 4RMRA 2GTWB 4XMPH 1L7TL 4XCNA 3K81A 4JR9L 4JKMA 2HMIC 4QCIB 1KN4L 1QOKA 5FYLH 4XVUD 3NZHH 1U93A 4HHAA 1ZLUH 1WTLA 2OR9L 3C6LD 5KAQG 5T3ZH 1DBJL 3T2NH 1MEXL 4AEEA 1RUPL 1C1EH 1UZ8B 3ILQD 3SGKA 3T2PA 1SBBA 3GMRA 5T1KA 3GMRB 3ULVD 5T1KB 2VH5H 5ECJE 5I71C 1JE6A 4WI5A 2FATH 5D1XA 2QR0A 4BSVB 4NQDD 1MSPA 3GO1H 4LNVA 1R6VA 2I26N 2X4QA 3VRJB 4S10A 3LQAH 4GKNB 4G80A 4AY0A 3IDGA 4Z0BL 4LVHC 2WW8A 4KJQD 1A1MA 5C2BH 3PJSB 3V5DA 1M6OB 4JRXA 1ZGLP 4LPCA 3QG6A 4YXLH 4ENEC 2NX5A 1ZANH 4JRXB 4M6AA 4OBRA 1IVLA 5CKGA 1BGXH 2NX5B 3P4OB 3KVQA 3GSNB 3N85L 2B1HL 3AB0B 1KCKA 4I0PB 4Y4HB 5T3XH 3RUGF 4QRPE 1F97A 1N8ZB 3MLRL 3ZDZE 1I1AD 4M43L 3OTTA 3QCVL 4X83A 4CUCA 3VU2A 3P4NB 3W39A 1H15B 2O5XH 2YSSA 2YA0A 4OCWH 4OTXH 2VDMH 2ICEA 2V17L 2DYPB 4UU9B 3VFWA 4K3JL 1HEZB 3QXWA 3UAJD 3VFWB 2JB5L 2FX9H 4POYA 2GJZB 1FSKC 4YDIL 5FDYA 43CAB 4PG2C 3E6FB 2FNBA 4J1UA 1YEJH 4W4NA 1AY1H 2A77H 5KSVA 3LKNA 2CLRB 4NP4H 2X4OB 5EORH 3D85D 5CJ8A 4DVRH 4GG6F 1H3XA 5FHAH 2HFEA 4BFIA 3RUGE 3EDEA 1JRHH 4WW2A 3V4VL 2HFEB 5JIKA 3IDXH 4X5XB 3HE6C 3GIVB 1JGEB 4HWZA 5C07B 3WS6A 4TNWK 4LCIL 4XVJL 4WFHE 5EOCL 1A7NL 3LEXA 4K7PX 3WO4C 2GJ6D 5B8CB 4EI5B 3RAJL 5J1SC 5FYJL 4QHKI 2AV1B 2Z31A 1KTLB 3QNYA 3RVXC 3X17A 5SWQB 1CVRA 1FJ1A 5F8QC 2Z31B 3AREB 5J11B 3QJHA 4FQCL 5IMMA 1WIOA 2R0WH 2C1OA 3WN5B 2ENSA 1Q9WA 4PGBA 3TV3H 3MBEB 2C1OB 4J3WA 3VFGH 3BWAA 3WS3B 4MYWB 2EC9U 1EGJH 1IFHL 5JIIA 3QPXH 1I9RH 5IV2B 5CSBA 2QKIA 2QQLL 3IAPA 3TIEB 5C0AE 3QQ4B 1MHEA 5JW4R 4V1DB 1U3ZA 2CR3A 4DQOL 2PXYA 1OB1B 2IANB 4WENB 5DQJA 4D0DA 3H3PL 4HKJA 4CGTA 2WBKA 2C26A 4MJ4A 3SE4C 4HKJB 2AK1H 4PJIB 3MA9L 1YY8A 3HC3L 4G9DB 1MIEH 5KZCD 1TITA 1YY8B 4LLUA 3Q6FB 2DLIA 2DTSA 3AM8C 4WO4C 4F7CA 2PYEA 2YXMA 2AXFA 4LSVH 5HGHA 2AJYL 2JIXA 4HCRA 4NZDA 4DCQA 1V7NH 5HGHB 5I9QC 3ZTJH 3FTGB 2JIXB 4RMTA 4F7TB 3MRHB 5J9PA 5INDA 2E5EA 4NKMA 2YEZB 5J9PB 5H37H 3MV9D 3CXDH 4JFXA 1P9MC 4MGXA 5BQ7A 2DBLL 1DBBH 4WI7A 2ZUVA 4EUPG 5BQ7B 1QSZA 4IOFC 5EB9A 3H8NA 5EZIH 1KT2A 3PWJA 4PJXF 2YKLH 3IJHA 3PWJB 3TBYA 1EMTL 5CGYD 4HT1H 1L7IH 4HKZA 3IJHB 3KYNA 5IW3A 5HJ3A 4HKZB 4ZFGH 3KYNB 4NZTL 4GSDH 5HJ3B 1G9MH 3IJYB 4HZAA 4JDVA 3QDJE 3TO4D 3RIAF 1YY9D 4ZNCD 5FO9A 5I1IL 4JFPA 1DBKH 2V7HB 3VRLF 3FO0L 3IGAB 5F7FA 4DVBA 1G7MA 3QFJD 3SGKC 1Y18A 5E2WL 1N0XL 1G7MB 4RWHA 1YECL 1Y18B 1BEYL 1VEMA 1AQKH 4CN4A 5CAYB 1JZ3A 4NT6A 4NCC2 3INUH 5D1XC 3MA7B 4NT6B 3UZEA 3PWPB 4UQ2A 5IMOB 5F1SA 3OKYA 4X6FB 2HFTA 4UQ2B 4XBPA 1DL7H 3OL2A 5IK3B 1BPVA 3FB7A 3VMPA 5F7NC 1SJXA 5HPMA 1N7ML 4XBPB 1MJ8L 4PJXE 4NUGL 3B9KA 5HPMB 1A6VL 3VXUD 1I8IA 4P2RE 5JW4M 3MCLH 1RZFL 3U1SL 1A6PA 1OP9A 4IRJB 1CK0L 2FEEL 1T0MA 3OX8A 1KXTB 4QYOB 3AB0C 2PW2B 5HPOA 1T0MB 4N1HB 4Y4HC 4I0PC 4XCFL 2HKHL 4Z7UA 3Q2CA 1FAIL 4Y88A 5FCUH 1QSFD 3DVNB 4JFEA 4XRCA 4TRPH 3F8UB 4F58L 3OGCA 4JFEB 4XRCB 4EKXA 1VADA 5SV4A 1HH9A 4O2CA 5I8EA 3C6LA 2DL9A 2R23B 1VADB 4DTGL 2VDKL 2EDHA 3DSNA 1P7QD 4XHJD 1MF2H 2D7QA 4P4RB 4KRMB 3VG0L 5F70A 5SWSD 1OAQH 1S7RB 3MLUL 1RUQH 3BIKA 4PTTA 3DGGA 3VWJD 3AVEA 5MEOA 3U9PH 3FHAA 3B3IB 5ANMA 2YD8A 2APBA 3AS0A 4U1IA 5ANMB 1AGDA 3GJFA 4K8RH 5FIEA 3GJFB 3WXVL 1CDHA 2OJZL 1W72H 2Q1EA 4I77L 4NN6C 4WW2C 2NYYC 1CR9L 1CLYH 2DDQH 4KKBC 3WS6C 4HW6A 4UOJA 1BQLH 4LLQA 1EHLH 1N5YH 3VH8A 3S34L 1QSED 4OSUL 5DURD 5LGJA 4FHBD 3T1FB 1P4LA 5B8CC 4EI5C 5FM5M 3A0OA 3VWKD 5DS8A 1CTOA 5TQ2H 5IB4A 2E27L 2Z31C 5J11C 1S3KH 3MFGB 1TIUA 4PS4H 3H9SD 3WSQL 3WN5C 4QGYA 4JFDE 2ERJB 4R26L 4K71B 3GB7A 1MCKA 3RDTD 4QRRE 5JPMA 2X9XA 4LIQE 5E9DD 3PIQB 1MJUH 3BEVB 3TT1L 1DLHA 4NWTL 3UROR 1N3NB 1IGIH 5E5MA 1A3LL 3HNSL 4NSKB 4F3FB 3D2UD 2VLJE 4JRYE 5CIPA 1HZHL 1CDBA 2LAAA 2BNQE 4Y8AA 3RWIA 1A22B 3F5WA 1QP1A 5KTEH 3UZVB 3RWIB 3F5WB 1CGWA 3OPZL 4GBXB 2DQUL 1ZVHA 2JE8A 3KPLB 1CQYA 4W6YB 3D85A 3DYOA 1ZHLA 2H8PA 2BNRE 4KK6C 4N5UA 4R4FL 1ZHLB 1YNLL 2PCPB 4UDTA 1NGQL 3O41A 4G6MH 4LHQB 3CVHH 5I73B 1KXVC 4OUOA 4HCRL 3O41B 1QBBA 2DMCA 4LCCB 5F89B 4P5KB 4JVUA 4WU5A 2QSQA 3GIZH 5ALCH 4WU5B 1RZIA 2M1KA 3RVTD 4RSVA 1RZIB 1DBML 2EZ0C 3OQ3B 4JFYA 4NKIH 1RHFA 4FQHB 2AK4B 4JFYB 5HYSG 1LD9B 2D0GA 2GFBB 1I7RB 1YYLL 2JJSA 4KZDH 5E8PA 4DGYH 5C0BD 1I9IH 4GH7B 5DGQA 5JHLL 3L3DB 3RI5F 2B2XL 3SOBH 5DTFA 5I8CA 5D7IA 1U8QB 1B9ZA 3HMWH 1JV5A 4M7KL 5DTFB 5EU4A 3PUCA 3N1FC 1KJVA 2HFFB 5HGBB 4XP4H 5DJ0A 4BZ2H 5HXMA 1KACB 4X9GA 1T1ZA 2BP3A 3KDMA 1MWAH 1JHTB 4MJ5B 4OV5A 3KDMB 4XPGL 5D72L 4CBPA 3KPRD 4NZRH 3NCCB 4ZPVB 1HHHA 1KF9B 2IG2L 3ULUE 1RAMA 2KZWA 4YGAB 3KJ6L 4Y4FA 3PNWB 2DLEA 4WU7B 4Y4FB 3B9AA 3SY0A 3ARBD 2Z9TA 3ZE1F 3D48R 1X5YA 2R0LH 2HT4D 1KB9J 3V6OE 3SY0B 3B9KC 1WIPA 2E7LC 4IRJC 4P9HH 1T1XB 1YQVL 1DQQB 5HYJA 2NR6C 3V6FB 3ZTNH 1IQWL 1EJOH 3P4MA 3S3PA 5HYJB 3HI6L 4N0UA 1RK1A 4X7CC 4Z8FH 2NTSP 3BE1L 1T20B 1RK1B 3RQ3A 1WZ1L 2DQEH 1JWMB 5DEZA 1P6FA 1CGXA 3AROA 4QOKD 4UT6L 2RB8A 4UT7L 2MJWA 1TVBB 1ZTXL 2ENYA 4ZTOH 4DFIA 25C8L 2VAAA 2XN9E 1G7PA 1FORH 2VXTL 5ELIA 3TO4A 1MNUH 1OQXA 5IB5A 2C3VA 1FFPA 4O2EB 5IB5B 5FGBA 2C3VB 3QFJA 1FFPB 3PWVA 1WAAF 3X11A 1UB6B 3Q5YA 1WEJL 1YQ2A 3H9HA 2F74A 2IH1A 1HDMA 4KI5F 3H9HB 3X3GL 2IH1B 4IM8A 1FV1B 1I3RA 2DQJL 3O8XD 4YX2H 3Q6GH 2COQA 4MAUL 1JPTL 3PF2A 1MCSA 5AZEH 1OGAA 1Q0YL 2FX8L 3VFMA 5DD3L 3RGVD 1A6TA 3VFMB 2HJKB 3VW3H 1A6TB 1NKOA 5CGMA 4OLVL 3FT2A 2NMSA 2R0KH 2QHRL 3DROB 3MRIA 5T1LA 4E0RA 1FH5H 4ZUWB 3FT2B 5T1LB 4E0RB 4C55A 4GLRI 2YD6A 4YQXH 4QF1B 2RR3A 1R3KB 4OQTA 5HHME 2RFXA 3ES6B 4L8CA 4QRQA 3QIUD 5GGVL 4NM4L 3CK0H 1WAAE 4PJEF 1IKFH 4K71C 4PJ7E 4UMGA 1PEZA 4NC1C 2A6JA 5C09B 5F7EH 3VFPA 3WNNA 3DBXA 5GIRA 3V7AE 3QHFL 2YPVH 4MS8D 3SDCD 5GIRB 1AKJB 3MNVA 1P7QA 2YRPA 1SYSA 3TBSB 2FGZA 3TESA 3MNVB 2XIDA 2WWMD 1SYSB 5E8NB 5SWSA 5I1CH 3MRFA 3G6JA 1OP5H 5TE7H 5FA4B 3WMSA 4HSQA 5IIEA 2W0KA 2YWYA 3C9NA 2LU7A 3F7YA 1IEBA 3BKCH 2DOCA 2E9IA 1JGVL 3LD8B 1IEBB 4IMLA 2F54D 1GGIL 4GRWH 4L3CB 5C0CD 1HQ4B 4R4BA 5T3ZE 1RZJH 4HPYH 5CZXC 4N90E 1O7SA 4KUCD 3T0EB 1Y6MR 5GRZA 5I73C 3WKNA 1GAFL 2BJMH 4YBQC 1W2KT 3WIHH 3FQXB 3QA3B 4JY5H 3KLDA 4Q97A 4L8SA 4TUJA 1IGYB 3O3DA 4MCZA 4FA8A 5GS0D 4TUJB 3O3DB 4GUPA 4MCZB 4MJIE 4ZDHA 3O2DA 5JOFA 5B4MD 5GJTL 1A1OA 1NBVL 3HLAB 5C0NC 3RDTA 5GPRA 1X5KA 2VDNH 4MNQD 2JB6A 2LU4A 1T04B 4S1DD 4ELME 4DW2H 2DLTA 5SX5H 4XB7A 4U6XA 5BXFA 4JG1L 5BVJB 1QNZL 4MNHA 1K8IB 2QL1A 3T0AA 5IB3A 1LNUB 4YHZL 3GZKA 5BXFB 5CP3H 5HGDB 3P9LA 3HNTH 4XAWH 3I3EA 5D1ZD 3P9LB 5I8OL 4G9FB 3QRGL 1WC7A 4XMLL 3EO9H 4Y4FC 3HA0A 1KB5A 5GS2H 5JORB 2I5YL 5D5ME 1KB5B 1GIGH 4Z7WB 1R3IH 1CE1H 1CGSH 2FB4H 4GJTB 1WCQA 5HYEA 3DRQB 4L8BA 3LB6D 3O3EA 5EOTA 1R3JA 3EJZD 4F7EA 3O6LH 3BYTA 1TZGH 3G5VB 5D7JB 2V2WA 3O3EB 1JPSH 5E6YA 1R3JB 3GKWL 3WHE1 4F7EB 4LAQL 3TBWA 5GGQL 4M6MH 5KVFH 2FH6A 2Y5TB 3TBWB 3OAUH 5DD1L 2HTKC 1XCQB 4JPIA 2QJDA 4M7LL 5D2LF 4OZ4B 4NQCA 5JQ6L 2DTMH 3JSSA 4KQ3L 5ADOL 4OLWH 5ADPH 4LLMA 2MPAL 4PJGB 3UPAA 4B53A 3EO0A 2NY6B 4LLMB 5D71L 2GSIB 1NLDL 4HUMB 3STZA 3PV6A 4AENA 3OJDB 2VLME 1XZ0B 2KQMA 2W9DL 4U1GB 3VFNB 4AENB 5EUOF 3VXME 2ZOLB 5EUKA 1U8HB 1BQHB 1UXWA 4HG4J 4KAQH 1AH1A 5EUKB 3KPRA 3S88L 1KLGA 4PUBL 4U6VL 1J18A 1TXKA 1UADC 3IS1X 5DD0H 4E41B 1KNOA 1L7TH 4YO0A 4JR9H 1FC2D 2VLKD 1KN4H 1YEDB 4KXZI 3DX8B 1KIQA 4ZAKD 3SJVE 5F7UA 4N9OB 5FK9A 5D2LE 3U7AA 4XZUA 4PV9B 3M8OL 2YOCA 2XPGA 4IRSD 5E4IA 2OR9H 3G04B 1HXYB 1BWMA 2XPGB 1DBJH 1OLZA 1MEXH 3TN0B 1RUPH 2MHAA 3BHBA 1W0VA 3M45A 2MHAB 3TH3T 4OQTL 3BHBB 1GGYA 3NCYS 1IMHC 4MJ6B 4YXKL 4K9EC 43C9A 3HCVA 4FS0A 4QOKA 5ESQA 5B39A 4LPTA 3MV8B 4K9EL 3HCVB 5ESQB 5B39B 2X4PA 3SDXF 2G60L 3RKDD 1MIML 1DBAL 2GK2A 2G2RB 5A2LH 4Z0BH 5EBWA 3UC0L 1VFAA 1B0GA 2E8ZA 1RJYB 3H6JA 1N59A 2JJVA 4JM2D 1UB5A 4CU8A 2FO4B 4ETYA 5J8OA 1UB5B 5FKAB 2FGWL 1IAII 2APVA 3N85H 2B1HH 4M1CC 3U0WL 3I3BA 4ZPTA 3RGVA 2WV3A 3SKNA 3T0EC 4ZPTB 2XTJC 1UKTA 3MLRH 4XTRD 4M43H 3QCVH 3CFDB 4KC3B 3DMMD 1XIWB 3EHBC 4PV8A 2W9LA 2V17H 2BVTA 3MGTB 4L8SC 3KHQA 4R0LB 2PKDA 3OF6A 2JB5H 4KK8D 4WJ5A 2VQTA 4YDIH 1EVTC 3O3BB 3GSWB 3O2DL 2ZPKL 1ZLVK 1QPPA 1BZ9B 1EH9A 2KZ1B 4PJFB 3UTOA 7FABL 4XH2A 1CFVL 4MXVF 1MJJA 3PXJA 3PL6B 4XH2B 1N26A 1QRNB 4KKCC 5I19L 1MJJB 5KVEL 4OFYD 1E6OL 4YHOL 4JAMB 3V4VH 2GIYA 4N9GA 3BAEL 4X7FC 4PJCB 4LCIH 4XVJH 3OMZA 3CPLA 4LCUA 5EOCH 1M7DA 1QKZL 1AIFB 4LSDA 1A7NH 5D6DA 4LCUB 5F7MC 1M7DB 4HKBB 5ISZE 3FQUA 5A2FA 1FDLL 3RAJH 5FYJH 3WDHA 5IEKB 3NFPA 1I8KA 1JCKA 2P5EB 1PG7W 2P8PA 2FEDD 4ODHH 4TSAL 3NFPB 1CFSA 2H6PA 4FQCH 4K23L 3BWUC 3VGAB 4YDVB 4BUGA 4OI9A 1GZQB 1KB5L 1TCRB 4E5XA 3KPPA 2IMNA 3ROLB 4E5XB 5D7JC 4NQSA 4B7IA 3AAZB 1IFHH 2KQNA 4KV5F 2E6PA 1XF4A 4MXVE 3CAFA 1CE6B 2QQLH 3A67L 2ORBL 2BSRB 4DQOH 4PGCA 2CDGB 5ESVA 5E1AB 2X44D 5IHUL 3QISA 2AVGA 4MD4B 2ICWA 2ICWB 5CLTA 4MNQA 3LN4B 4YBHA 3QO1B 4ACPA 2NY6C 3MA9H 2VDOL 3EYOA 5DHYB 4Y5YA 5LCVL 3EYOB 4A2LA 2W59A 2YS4A 3L3GA 2AJYH 3TCLA 4TVPD 3F65A 4OM1L 2MSPA 4R7DB 5AUMA 1KFAL 3HMXA 4LSPL 4HV8B 2R29H 4I3GA 1UENA 2HRPL 2E6JA 1F4AA 2L4OA 4KV5E 5EU5A 3QEQA 1MHHB 2I25N 2DBLH 1BJ1J 2UUDK 2XV6B 4RISL 1F3JA 4G8GB 1LVEA 3K1KC 3WYRA 4JEGB 2GAZA 4DGVL 1F3JB 3UTPE 1RJLA 1FL6A 4KKAC 3IDMA 1EMTH 4KGLA 1I8MA 3G5YB 2NY2D 1NGZA 4QRPD 2VYRE 3IDMB 3UPCA 1IL1A 3TN0C 2LABA 5L2JA 1QZ1A 3O0RL 4LCYB 4XPTL 2UY6A 5I1IH 3FO0H 4H25B 4LLWA 5E2WH 1MUJB 3FQWA 1N0XH 3WNLA 4IS6A 3SDYL 4UB0L 2E7MA 1YECH 5DXWA 1BEYH 1MCRA 4G8IB 1NLBL 5ITFA 4QXTA 4Z7NF 3U0PA 5ITFB 2AERT 2ESVB 2CIKB 4KTEL 3SQOL 3ZYZA 1MJ8H 1CU4L 2UZXB 4NUGH 2VUOA 4PTUA 4CN6A 1KXQE 2JELL 4PJAA 3WE6B 1RZFH 3U1SH 2K7PA 3ARDD 3VGEA 1CK0H 1FFNA 1D6EA 1YMHA 1CIDA 3G9VA 3L5WB 2O61A 1XEDA 1FFNB 1DLFL 1YMHB 2HKHH 2YPLE 1MRFL 2EDKA 4WFHD 5BCAA 4ZODA 2XZAL 2VLKA 2UYLB 1Q0XL 4OZGA 3HUJF 1BBJA 4Z78A 3QQ9C 1IGML 3R06A 1DN0B 2ZKHL 5IBUB 4F58H 4OZGB 2EDTA 3BX7C 3I6LE 1ORQA 1OT1A 4ZFOA 1EEQA 2Y7QB 4DTGH 2VDKH 1T0NB 4R0LC 4RGOL 4ZFOB 4UI2A 1SM3L 3WFBL 3VG0H 3EFFB 3PDOB 2YD4A 3N1MC 3BGMA 1D5MA 1LDSA 2Z92B 3D3VA 5DC0A 3BW9A 5IVXA 3U2SA 4UIMB 4MLSA 3QYCA 1MAKA 3BW9B 1G7JB 1JYNA 4I3RL 3VGHA 4I48A 4M5ZL 3P0VL 1IAOB 5ID1B 4CRPA 1LILA 4I48B 4I4WA 4U0RB 3PL6C 2HFGL 4MA3B 3ZKQD 2KH2B 3DLQR 3BD3A 4XXDA 4XXCA 1ZE3C 4NPYB 1JUFA 2B20A 1G7QA 5CMAB 3WXVH 5FYKD 4QY8B 4I77H 2OJZH 1HKLL 3HUJE 1CR9H 1HIML 1MI5B 3OGOE 2CKBA 3ZDXF 4QRUB 3S34H 5TDPA 1NCUA 4OSUH 1M71B 2CKBB 4XI5C 5D6DC 3OKLA 2MQ0A 3EOTL 1UJ3A 1LWRA 1UM6L 5BW7C 5K9KA 1FYTA 1MCLA 3OKLB 4IDJL 2ZUYA 4NNPL 1RHHB 2BRQA 2E27H 3S5LB 4JGJA 5D7LA 5EBGA 2ITDB 3HE7D 4FQQA 3BPNB 3VGAC 4AQ1B 4FQQB 1OAKH 4Y5VA 3WSQH 4R26H 3D39A 4Y5VB 1DDHA 1KCLA 2ZUXA 3HRZA 4DK3A 3KYKL 4Z7VF 4XNUL 1ACZA 4PG9B 3TT1H 4NWTH 3CGTA 1QFUL 1A3LH 3HNSH 3ULSB 3PHQA 5F3BB 1HZHH 5FB8B 4PGDB 2AGJL 1FLTX 3MRRA 1ZOXA 5H35B 3QDJD 3MRRB 3QPQD 5ICXB 4PRIE 3TYFA 3OPZH 2DQUH 4S1RL 2WWKO 2MQ3A 2NW3B 1Q9KB 3SE8L 1FZOA 4R4FH 2EDFA 4Y19E 1YNLH 2IPKA 5JXAL 1NGQH 2X1OA 1UZ6F 5I8KH 3RY6A 4NQXA 4HCRH 3D69A 1S9WA 3FN3A 4LKXA 5JDSA 2E7HA 2Q6WB 1PKQE 4JHBA 4LKXB 3HMXL 3BRDA 3G9AB 4Z7VE 1RVFH 4LEXL 2FBOJ 5EU7E 4FQLL 1QFWM 3VXRE 4P2RD 1DBMH 4FQXA 5AYQA 5FUCE 1KB9K 5BV7B 5CEYA 12E8H 5I74B 2F5BL 3RKPA 5J6HB 1YYLH 1ZA6A 4QHMB 3OJ2C 3OZ9L 1OTSC 4PRBB 1FIGL 2FX7L 5JHLH 2B2XH 3I84A 3O3AA 3WLWC 2ATPA 4M7KH 2X40A 4QNPF 1KBGL 3IFNL 4GRWE 1F02I 4YJZL 1JF1A 3BGAA 4WWID 5CP7B 2DF3A 4OCXL 1UZ6E 1V7MH 3RIAK 4MMZC 1P5VA 4XPGH 5D72H 3V9FA 5GGRY 4XMKL 3O4LD 5IBTL 2JCCF 2B4CC 2F58L 4QXUL 2IG2H 3QDME 1OCWL 1R3LB 2B4CL 5EH1A 4HEME 3IDJA 1JK8A 3DX9A 1JPFA 2OTUB 3IDJB 1JK8B 4EIZC 2Z0BA 5E56A 4U33A 2VLRE 3S96A 3UJTL 1PY4A 2NY5C 5D2NA 5IB2A 3KPSE 4P46B 3S96B 1TPXB 5IJVA 5D2NB 4YHML 5IB2B 1QBLL 2NY5L 2BC4B 1QLEL 1FN4A 1EA9C 1TJIL 4JZNB 4RIRA 1G9EA 3HI6H 3MRPA 2DQFA 1SVCP 3PWUB 4RIRB 3BE1H 1WZ1H 5JHDE 4YUEL 3N9GL 1F2QA 1HQRB 4QRPA 3BN3B 1JZ5A 1UQSB 2UWEB 4UT6H 2Y06L 4ONHB 4UT7H 2VTFA 4DKEL 1ZTXH 4JFDD 25C8H 4RFEB 1NFIB 2VXTH 4ZFOL 1F3RB 3GGWB 5DF0A 3AS3A 3UBXG 4X7EC 1BFVL 4QRRD 1WEJH 3T09A 3U6RA 1BD2E 2BFVL 3U6RB 3JZ7A 2VLJD 2NCMA 2DQJH 1S78C 4U0RC 3NBNA 3BKJH 4MAUH 1JPTH 2R39A 3PABA 2VIRA 3TNNB 4LLVB 5H2BA 2X70A 3ELAT 1LO5A 1Q0YH 2VIRB 5DD3H 5FDWB 5DJCA 3W9EB 3H9YA 1SJVA 4XXCC 5DJYA 1HHJA 3BUTA 3GJFH 5DJYB 1K4DA 4OLVH 2BNRD 5EZOL 2QHRH 2R0ZL 2X1XR 3D25A 3TZVB 3RUGA 2HG5B 5FHBL 1PX4A 4PIRF 2CKBL 1LO4H 1UJ3C 1YN6A 2XKNB 1JNNL 3EW3B 1X5FA 3BPNC 5FM8A 5LAXB 2YK1L 5GGVH 4BZ1H 3MUZ1 4NM4H 3LKRA 1J1XH 1BX2B 2JTDA 4Y5VC 5CKAA 1HSBB 1CFNA 5HHNA 2VISA 4F37K 3QHFH 3GMQA 2HN7A 4ZS7L 5IVNA 4NC0B 4GO6B 2VISB 5DO2D 4MWFB 1OSPL 5D9SA 1U58B 4GOSA 1MH5A 3RPIA 5D9SB 1MCIA 5IP4A 4AT6B 2IADA 4KRPD 4LKCA 2IBBA 1QFHA 2IADB 4QRSB 5CIPH 5ABDE 5C0AA 5A16B 4NCDA 5L8KB 2DWDA 1TLKA 1EXUA 3F7QA 2YRZA 4GG6B 1JGVH 3LHPL 5IHLB 3BZEB 3EZ8A 3LH2H 2P7TB 1GGIH 4D9QE 4N68A 2MMXA 4MB5A 4JFZL 3K3QA 4RAUB 4K7PL 4HS3A 5E6ID 5I30H 2XWBA 1C8PA 3MLVL 4PRDA 2XWBB 5J6GA 3ULUD 3IFOA 5C86A 4NO2A 1GAFH 1FFOB 5J6GB 3IFOB 3RY6C 2J1KA 3DSFL 3NFNA 1VKXA 4NO2B 4ODUB 2A73B 3NFNB 5C6PB 1NANH 2FJGA 4KPHL 1VKXB 1XF3A 3MROB 4PP2B 4ZUUB 3G08B 4L4TD 4WCYL 2YHGA 3MNWA 1XF3B 1FL5B 5FAAA 3PP4L 3MNWB 4FQXC 1YPZF 4HFWA 7CGTA 4RGNB 2AAVA 1BM3L 3U4EB 3M07A 2ATKB 1H8OA 3RZCD 1UH3A 5GJTH 1BIIB 1NBVH 4ZUSA 1H5BA 2WZPD 2HTLD 3RX5A 4KK5D 1DUYB 1T89C 2UV3A 1ONQA 1G6RB 1WJ3A 5I1HL 1U8PA 3DUSB 1F4YL 4NQDB 1GOGA 3OXSA 4MDJA 3RI5K 3QWOB 4JG1H 1B0WA 4J8RA 4MDJB 1QNZH 3QDGE 4LHUD 2XN9D 4FABL 3QDJA 1HN1A 3V79C 1K2DA 4J8RB 1P84J 1IGJA 5L2KD 3GFUA 1K2DB 4RRPA 1S5IL 2MNUA 5HDQL 1NUNB 5I8OH 1WBYB 1LK2B 3CDFA 2G9HB 3QRGH 4XMLH 5HDBF 3UBXB 1WBXB 1YPZE 2AXJA 2YN5A 4WWKD 3P9MB 2I5YH 4I18A 4CVUA 2A6DA 2EC9T 1K6QL 4G42A 5DVLA 4MA8L 2AJUL 1I1AB 4P46C 1TPXC 4BSJA 2QEJA 1JYVA 2MQCA 5D2NC 1A21A 2ZG3A 3GKWH 4PJXA 5IKCA 4LAQH 5J13B 2XOTA 4P2RA 5IKCB 5FF6A 4HZLA 2ZUQC 1WWWX 3RTQA 4UAOB 4D94A 4Q2ZA 5DD1H 5MEQA 3QI9A 4Q2ZB 5BJTA 5DD5L 3T77A 3VI3E 4M7LH 4PRHE 5JQ6H 1UKQA 1XAUA 4KQ3H 5ADOH 4MAYA 2MPAH 1OF2A 3DUUB 2ZUTA 3QUMA 3MFFB 1OTTD 3H2WA 3L5IA 4MAYB 5D71H 1NLDH 1NGXA 3QUMB 1QLFA 5HDBE 5DJDA 1NGXB 2FR4B 3HB3C 5FYJE 4BKLB 3IAGC 1QLFB 2W9DH 5DJDB 5HI5D 1E4KA 3UBXI 2E6QA 1MREL 1A3RL 4Q0XL 2EDDA 4Z18A 3RWDB 4JY6A 3S88H 1R5IA 4PUBH 5FM4A 2BSTA 4U6VH 5IF0A 4JY6B 4GAGL 1ED3A 1R5IB 2BSTB 5FYLD 3ZYOA 3EGSA 3DXAA 2DAVA 3QIWD 5MP6L 3BH9A 3EGSB 4LRNL 3DXAB 2H1PL 3NPZB 4HH9A 2X4NB 4NZJA 3D87B 3TZVC 4XNMB 1WZMA 5T3ZD 2Y36L 5DMKB 3WNMA 3M8OH 3UTSB 1BOGA 2YRLA 4N90D 2XA8L 3HR6A 2B0SL 2LV4A 2ZWLT 3P0YL 4ALAL 4GXVL 2H32B 4JQXA 1C12B 4J3UA 2ZSVB 5JLZB 3U7YL 3SEPA 5FV2A 1OP3H 2YXFA 1ES0B 4OQTH 2AJ3B 1ETZB 1JN6A 1NUGA 3IFPA 4J6RH 1UJTA 5I1AA 4Q6IA 4YXKH 4HUWA 1ZLUK 2FHBA 1PBYA 4OCMC 4Q6IB 2D9CA 4MJID 1HINL 1WITA 4HUWB 3UCRA 4K9EH 3DYMA 4JFDA 4O2FA 1NSNL 4EBQL 2AXGA 2G60H 4O2FB 3W11D 1AR1D 1YMMB 3TCXA 1MIMH 1DBAH 3GBNL 4J2XA 1CYGA 1G7LB 3ALPA 5C0JA 1PDKA 4JRYA 1M05A 1A9EA 2BNQA 1M05B 5T3XD 2FGWH 3WUWA 4KHTL 3MV9B 2ADGA 2BHZA 4FG6C 4KKLD 3TA3D 3FQTA 3BUYA 4CN1A 4KK9C 5ACZB 4R7NA 2CKNA 4K2UL 4AG4L 3HAEB 3BD5A 2Q8AL 5CJOL 1CGYA 2ADIA 4LPXA 4XNXL 3QEUA 4RGNC 3MLSL 5I76A 3QO0A 3CX5J 2PR4H 2LVEA 2X4TB 3O2DH 2PO6A 2ZPKH 1H5BC 3M1BA 3FKUS 1V3JA 2PO6B 7FABH 5E8EA 1CFVH 1GXEA 3TFKD 4ZO6A 4NRXB 1JTOA 4JRXE 5I19H 5KVEH 5SX4I 1E6OH 2AS5M 2NX5E 5GZOC 2BVYA 4HF5L 3OKDA 2V2XA 4ZO8A 5D4QA 3MLPA 4MZ3A 4RAHA 3BAEH 4KZEL 3OKDB 3BISA 2AXHA 1WZKA 1PEWA 1QKZH 3RWHA 2VLMD 4U1KB 1R3HB 3RWHB 3VXMD 1VA9A 1FDLH 5DI8A 1GZPA 4LASL 5IWLC 1MFAL 3GSQB 3P11L 5DI8B 4OD1L 5DLMH 1J0YA 4K23H 4GRLA 1I1AC 4EQ2A 1KB5H 4YR6A 4GRLB 1MAJA 4M48L 1ZHBB 3U9UA 5I66A 5DQDH 2BZDA 5E70A 2X4SA 2DM2A 3SJVD 5J13C 3VD4A 2E9JA 3T3PF 3REVB 5E94B 3A67H 3MRMB 2ORBH 4NQED 3QUKA 4UAOC 1S9XA 3C09B 1OAYL 4IRZL 4PRNA 2WK2A 4U1HB 5IHUH 1S9XB 2A74A 1DN2A 4X7TA 4OI8A 3QI9C 3K80A 2XG4A 4F9PA 3PGCA 2A74B 1SBSL 4N0YL 4X7TB 3LEVH 1KIUA 3PP3H 2ADJA 5F1NA 3SDDA 5C07E 4MAYC 3RY4A 2VDOH 4ODSL 5E99L 5LCVH 4XNQA 5F93C 3K46A 4M03A 4PJIF 1XGUA 3QUML 1LQSR 2CD0A 4FMFA 4D9RD 5HVHB 3R0MA 1NFKA 1XGUB 1E4KC 1KFAH 3Q48A 4YAQB 4HBCL 1QR1B 1C5BL 4LSPH 1MCNA 5KN5B 3VXNA 2HRPH 4D0BA 3GUTA 3GMOA 3FFCD 4CMMA 5DURB 3MLZL 4RA3A 4D0BB 5DD6B 2K1MA 5T1MB 3C87A 4WTZG 1VGEL 4RISH 4WWKA 4FFVC 5LWYL 4DGVH 4V1DE 3H9SB 4P5MB 4W81A 3VFUA 4UNVA 2IAMD 3OSKA 2ZCKL 3CFEA 2IANE 4CJ0A 3TT3L 3CFEB 4R96B 3O0RH 2XFXA 4XPTH 4JQXC 4X99A 5DRXA 4YEFA 3NTCL 3SQBA 2XFXB 4PJIE 4Y5XA 4OAWA 2OLDA 4X99B 1T6VN 1W8NA 1FFRA 3LRHA 2D2OA 1I8LC 1U8NB 4GW4A 4X7SL 3D2UB 3RVWD 1MHCB 3LQZA 3MX0A 4GW4B 1DCLA 3SDYH 4Q6IC 4MX7B 2J4WL 5HD8D 5H94B 1NLBH 1WAAA 4HJGA 4OQ1A 1U3JA 1T2QH 4MB3A 4KTEH 3SQOH 4YXHH 1IC1A 1I3VA 2HVKB 4HIJA 5E00B 4PJ8D 1CU4H 4TSCL 4HJJL 4LIQL 2JELH 1VESA 3QEHB 1NFDF 4GAJL 2D3VA 1JTTA 4NN7C 1AGBA 4KDVA 5I0ZA 2NY1D 1DLFH 1WFUA 4JDTL 1MRFH 3FOLB 4GXUM 2BY2A 5I17A 3UYRL 3L5XH 2CRZA 5ISZD 4Z7OF 1Q0XH 4QHUA 5I17B 1IGMH 4KDTA 2ZKHH 4YGVA 4I2XB 5HYQB 3OHXA 4GMSH 4ZMAT 1JNLL 1NBZB 2YD5A 2P8MA 4JDZA 2QSTA 3OHXB 4PJEA 2NXZD 3BDBA 3LEYL 4RGOH 3WFBH 4Y16A 1P7KA 1U3HD 1YY9C 4X6DB 3B2UC 3BH8A 1P7KB 3RBGA 1QFPA 3PWPE 3VFOB 1JZ8A 4QXGL 4BELD 5CBAA 2WANA 1S7UB 3FQNB 1EBPA 4PJ9A 3SGJA 2BMKA 2XKSA 1QFOA 1XFPA 5C6WH 4I3RH 4MJIA 4M5ZH 3P0VH 2PO6C 5A2IH 2W91A 4NYLB 2YZ8A 4OLYL 3ARVA 1WFNA 1LMKA 5AAMA 4K8RD 4FFZL 3HC0A 4YWGL 5C0RL 4HBQA 4HMCA 4RX4D 4Z7OE 1HKLH 1X9QA 3DX7A 4PGEB 1HIMH 4RNRB 3ZSTA 4U1MA 2Q7YA 3CFBB 1NCNA 3JV5A 2Y4SA 3NCMA 5CHNA 1IKNC 3AY4A 2Q7NA 5EO1A 1HHIA 4X9BA 3UJIL 5CHNB 3EOTH 1HYSC 2DQCH 5EO1B 1HHIB 1UM6H 4JFEE 1NDGA 1EEYA 4L8DA 4P5TB 1EV2E 1UG9A 1DFBH 2OYPA 4ZNEA 3HZKB 1X5LA 4WDIA 1B3JA 2JJWA 1OAXL 2BK8A 3ARXA 4GRLC 4RQQA 5EN2A 3QQ3A 2VSCA 1KGCD 2BHUA 3IKCB 5TDNA 4X6CB 3SGEH 4QHKJ 1MELA 2L0DA 1XGQA 4XNUH 2YBRB 4FTVB 3UTPD 5F1IB 1INDL 5D6CB 1XGQB 4DKFL 1QFUH 1FP5A 3RWGA 1RZGA 4WFGD 1EFXB 5ANME 3RWGB 1RZGB 2AGJH 5AWNL 2GI7A 4ZO7A 3NAAL 1GOHA 5HBBA 4F9PC 2KUTA 1Q8MA 2AEPL 3CSPA 3ZE2F 5BS0A 3ROOB 1C5CL 1IM9A 4OF3A 5BS0B 3GJEA 3SGDH 3SDDC 3ZKNC 3SE8H 4CVXB 3PHSA 4ISVB 4KDWA 5CJBA 4ZFZA 5HVHC 2WINA 2G75A 5C92A 1LGVA 5JXAH 2VE6B 1MCEA 3LZFL 1DQML 3JWOC 5L6YL 1T21B 2NY3C 5KVDL 5DRWB 5DHVA 4X6EA 2VXQH 4MXQD 2CXKA 1S7SB 3JWOL 5D70L 4S1QH 4GKZA 4TSBL 4MA7L 3LCYA 4P2QA 3TH4T 5DDHA 4GKZB 5L7XL 5JZ7D 3VXMA 4NC1E 5DDHB 5T33L 4PJDF 4WHYG 1NC4D 4FQLH 3U48A 1DANU 3TGXA 3H7BA 3RNQA 3JV0A 1BWWA 2F5BH 4MSWA 3RNQB 5BOPA 1Q94B 4ZXBB 2YPLD 4WY7L 3OZ9H 3ZE2E 3LN5A 2FX7H 5F8RC 4Z95L 1AQDA 3FO9B 3LN5B 4EDXB 1EEUA 3TP4A 4GKSA 3G5ZA 5TGBA 3SDCB 5EPMA 2IBZX 3I6LD 3I2CL 5D2LA 5TGBB 2VERN 5EPMB 4JPKL 3IFNH 3IKKA 4Y5XC 4JJ5A 5B3JF 1KCUH 3VCLB 2D03H 4MA1B 5C0GA 3ARFD 4OCXH 1OL0A 2EDQA 5ICZA 3KS0J 4PR5A 5KVGL 4XMKH 5IBTH 3QIBD 2VQ1B 3K8LA 4LU5L 4NUJB 2F58H 4QXUH 1NDMB 5EUOA 3V5HB 15C8L 2WWKT 1OCWH 3ZMRA 4KI5C 4MQ7B 5EUOB 1EVUA 1BQSA 2B4CH 4WHYH 5C0CB 3NGBB 3CDGA 1CBVL 3D1MC 1UH4A 3GMPA 5FGCB 3I75B 1M7IB 2IQAB 5DEGA 3SCMD 5F21B 1QFWL 1VHPA 3GMPB 4JCMA 5BMFH 2AK4E 5DEGB 2OZ4A 3P73A 2FZ3A 3CFIC 4G7VL 1QBLH 5GGSA 3VA6A 1AD9B 1UXSB 2NY5H 3P73B 2GT9B 4F8TA 5J12C 2FZ3B 1QLEH 1WISA 3D18A 5GGSB 2YPKB 1TJIH 3DPBA 3WIIL 1KJ2A 4CADA 2HVJB 1PQZA 4HAFA 4CADB 1H3PH 2WBJD 4YUEH 5F7YC 3RVUD 4KDTC 2J8UB 3N9GH 3LS4L 3E2HB 3L3HA 3O9WD 1PFCA 3HTLX 2F15A 5MEPA 1JGLL 1QVOA 1RIVL 5T3ZL 2E9BA 2Y06H 3BEWA 4DKEH 1G1CA 2A83A 3QNXA 3GHBL 1QVOB 1SQ2N 3BKYL 4ZUVA 4Y16C 1C1EL 2AQ1A 5GRXG 3CMOL 3EUUA 1BFVH 4YHIB 1AD0A 4LARL 1Z6JT 4L5FH 3WEXA 1T5XA 1AD0B 3SDXA 5I6XB 5EZJA 4PJ9C 3SGJC 1AGFA 1T5XB 4CVZA 3SDXB 2VH5L 2WBWB 1LO3L 5D7SL 5GQBA 2SEBA 3O4OC 1QEWB 4IJ3B 5D1ZB 3PHOA 4MQXC 5GRVK 1DQDL 2W9EL 5F7LB 4PLJC 1SVZA 2XZZA 5C2BL 4ZUTA 5HYJE 5EZOH 3TC9A 4YXLL 2V5YA 2R0ZH 1KEML 5F7DA 1ZANL 4Y19D 5IW1A 5FHBH 3AY4C 3LKOB 4HQQL 1BGXL 5EIIB 3F7RA 2CKBH 2F5AH 2XQYK 1UYWL 4P5TC 4QTHA 1JNNH 1BHGA 3GBLA 3DI2B 2YK1H 5ISZA 1NBYA 3T0DA 3RJQB 5IW6B 2O5XL 5GZNC 5BRZA 4HLZH 4ZS7H 5BRZB 1A4JA 4NO0D 1ZLVH 5E2JA 1A4JB 2H9GA 2DD8L 1OSPH 2I9TA 4NHUA 3RIFK 1BZ7A 1U3HA 2H9GB 4M8QB 5EZLA 1IC4L 3CU1A 2I9TB 4HS6A 2VDRL 2XNAA 3MMEA 1BZ7B 1CD0A 1T83C 4EN3A 3MMEB 3ARWA 2BNUA 3HKFA 4XPHL 4Y1AD 1AY1L 1DUZB 3VD3A 2GY7B 4NC2B 3LHPH 3S98A 4G8EB 5DWUH 1XGTA 2C1PA 3GBMH 1MCWM 4U3CA 3L3JB 3HZVA 5D93B 4F7MA 1U8MB 4K7PH 2YWZA 3JVGC 1J87A 5EFIA 4ETQB 1KIPA 3BDXA 3MLVH 1PD6A 4LLYA 1P84K 1JYXA 4YBLC 3QDMD 3ESUF 4AIXA 4LLYB 4X4XA 5DYOA 3DSFH 5E7BA 2VL4A 4X4XB 3G5XB 4Z76A 1TZIA 4KPHH 2EE2A 5JNYA 5IJKA 4OCYL 4Z76B 5SWZA 4WCYH 2VLRD 2ZSWA 4Z6AT 1OAUL 1S8DA 1UWEL 5KG9A 5E08L 5SWZB 3KPSD 2ZSWB 1BM3H 1QLRA 4Y2DA 4JFOB 4LGSB 4ZXBC 1ZHKA 5ID0B 2C3XA 1QLRB 4Y2DB 4LF3A 4PBXA 4DN3L 1NBQA 1T3FB 3BQUD 5JPNA 1DEEA 3ARGA 4EOWL 3F62A 1D5ZA 1D3CA 3SDCC 3T3MF 5A1AA 5JHDD 1D7FA 1NCCL 2N1KA 1D5ZB 3C5ZD 4UBDD 2W65B 5HGAA 1D5XB 1F4YH 4DN4H 1NAMB 1OSZA 4MA1C 5HGAB 3QUXA 3T65B 5JW4N 2MTPA 4QGTA 4ZSOA 1OSZB 3QUZD 1HILB 3QUXB 4PJ5A 4FABH 3CFCL 4Z0XB 1GCFA 5L0QB 2DM4A 1RJZB 3T0EE 4LGPB 1S5IH 5FA3B 4U1JA 5HDQH 2XTJE 4QKXB 2BX5A 4HXAL 5EU6A 3DTXA 5SX5K 4O4YH 1BD2D 5GS2D 1FZMA 3ARTA 3NGBC 3DTXB 4JJHA 4X8XA 3BXNA 1DVFD 2BVUA 3CUPB 2P5WA 2UUDH 1K6QH 2P5WB 5IOPA 1T1WB 3OR6B 4RZCB 4MA8H 2AJUH 5H8DA 4Z7WF 3REWB 3GNML 2E9WA 5I2IA 1ZHNB 1TTGA 4PPTA 1IBGL 4JZOB 1JF6A 1SHMA 2AJSL 1T4KB 2OZ4L 5GSRB 4XWOD 2HP4A 3FRPG 5E2VH 1KJ2L 4K7FB 4WEUD 1XF2A 3L3KB 1DTUA 4FZEL 4HT1L 4KJYB 1EHXA 5LBSL 4PGZA 3QRFM 3O3UN 4GW1B 4KMQA 3WFCL 2K7QA 4GSDL 2CO6B 4YNYB 5JW5B 4Z7QF 1N6UA 4ZD3H 3QUYB 4PJGF 3RFZC 2VLLB 4G9FE 5I6XC 1LEGA 4HKXA 1X4XA 3AS1A 3OWEA 4YHNA 1DQTA 4JKLA 2F53D 1O5DT 4G6KL 1MREH 4TUOA 1A9BA 1VEOA 4IJ3C 4Q0XH 1ERNA 1NPUA 4Z7WE 5FUOH 3INUL 2NLJB 3VXOB 4NRZB 2PNDA 4O02H 4GAGH 3IF1A 2IJ0C 3ZZ1A 3R0NA 3IF1B 2HMID 1Z5LB 1J12A 4LRNH 1KPUB 4NO3A 2H1PH 4OM0L 2P43B 1U8OA 3EO1A 4D9QD 4YC2C 3IYLW 3NA4A 3QHZH 1U8OB 2Y36H 4DKDC 1E4XI 2RJMA 4QT5B 5DFVC 3VMNA 1MHPL 2XA8H 4BJLA 1QHPA 2B0SH 2IQ9L 3HUJA 2Q86A 3P0YH 4LCWB 5C0FA 4ALAH 1FG2A 5E24E 4GXVH 1ND0A 5DJAA 2XACC 3U7YH 1FG2B 4PJGE 5FCUL 2V7NA 3BZDA 5DJAB 5ITBL 1EERB 3WFHA 2IEPA 2WBJA 3KPOB 1A7BA 4JLRB 3BP7A 4XNYL 2LAGB 1CFTA 2NTFB 5F6IB 1A2YA 1HINH 5JOPE 3UPRB 1ZV5A 5ICYA 1QYGH 4ZYKB 4G43A 3GSRB 2FECL 1A2YB 5IROC 3DHMA 4EBQH 3ZLQC 8CGTA 4ODWA 3P9WB 5HI4C 3JV6B 4ODWB 3GBNH 2J88L 5DQ9A 1RI8A 3MGOA 4OGXL 4EN3C 1BP3B 3MREA 3QJFA 3MGOB 2XG5A 3MREB 3QJFB 4ENED 1UACL 3LRSB 2HLFC 4M00A 1W0WB 4JFHE 1CFQA 3QDGD 3EOBB 3EJJX 3S7GA 4KHTH 1ZMYA 1CFQB 4PRIA 4EJ1C 2C4FU 1AFVL 2C9AA 3RWJA 3CZJA 2DDQL 1MY7A 3RWJB 2ZNWA 4X8JA 3VXQB 2Z35B 3OAZH 4K2UH 1EHLL 3W9DB 4UTAH 4NJAL 2Q8AH 3WDIA 2ADFH 3D6GA 2D0FA 4XNXH 4EDWL 5IJKC 1T7ZA 5KANI 3RVVC 3TIDB 4X80L 3MV8E 1GL4B 3MLSH 4EVNA 2OL3A 1PKQA 3CSYB 1CDUA 4C56A 3PDDA 5F9AC 4Z7VA 4Y2DC 2F8XC 3GK8L 3MRNA 4C56B 5IM7B 3VXRA 4H1LA 1D5BA 1PX3A 5DEFB 2OTWA 2NQCA 4H1LB 3ARGC 2H2PC 4NO0A 5E2UL 1MJUL 3K1DA 2H26B 4OZIF 4U6YA 4PJFF 3HI5L 1CG9A 4PRHD 1J8HD 3RKDC 1U8LA 5E8OB 4NCC1 2R56L 1U8LB 3QUXC 4HF5H 1UKSA 4WUUD 5L0QC 1GGUA 1NQBA 4S2SB 4KZEH 4F2MA 2FHCA 4R2GB 4R6UA 3T2QA 2WMPA 5FYJD 1BFSA 1QD0A 4P57B 4Z5RB 4O00A 3KPMA 3TWCH 4LNRB 3ARDB 3IB4A 4PJCF 3V0VA 1AC0A 2QLVB 4CW1A 2JF1A 3KPMB 3O6FD 2VB5A 3NA9L 3RVXD 3V0VB 4BK4A 1RUML 4LASH 1MFAH 1S7QB 4IIQA 3P11H 3MRGB 4HC1A 4OF0A 5DR5H 2BERA 4OD1H 3R8BB 3WIHA 2P42B 3FB5B 5AG8A 2WLYA 1NJ9A 3BPLB 3MNZA 3VFTB 3W82A 3I3DA 4M48H 1NJ9B 1GVIA 3VE0A 2WQ8A 5ALCL 1A8JH 1U8KA 3VE0B 4M7ZC 4OD2A 4PJFE 1IEHA 5HHOD 1YNTA 1ORSA 5AD0A 4OD2B 4NKIL 1OAYH 4IRZH 4NKQB 3GHEL 1YNTB 1QRNE 3SKMB 3BP6B 5C9JB 3BZFA 4NKOB 1SBSH 4LHJB 4LP4A 3BZFB 3WJLA 2ZUWA 1JGUH 1O0VA 3SKOB 1NMBL 3S6CA 5HTSA 4PJCE 4ODSH 1AE6L 1XGYL 5E99H 4E9LA 4U7SA 3QUYC 4WRLA 3NIGE 4WO4D 5CILL 4PB9L 1LO2L 3QUMH 3WHXA 3LRGA 2FSEA 2JCCA 5F88A 4BQ9A 3AMLA 3QUZA 3WHXB 2QSCH 2P5EE 2FSEB 2JCCB 4HBCH 1C5BH 2ZOKB 5B38A 1CGUA 4XVSL 1ITBB 4HXBH 5B38B 4DGIL 4LDLB 4LLAA 4HUXA 3MLZH 1KPRA 1XF5A 2BSSA 4L9LA 1MJ7L 1KPRB 4IOFD 1VGEH 1K5NB 3VFRA 2VO5A 5LWYH 2R0LL 5DMYA 3DVGA 4WFEE 35C8L 1T22B 2ZCKH 4P9HL 1U91A 2EEBA 2XWJB 4UTBL 3IXTA 3OR7A 3TT3H 3OKEA 3ECBB 1U91B 3TVMA 3ZTNL 3IXTB 3OR7B 2OJEB 4YLQT 3VXPA 3TVMB 4YHPA 1PG7X 1T0PB 2H32H 1J05A 4YHPB 3WUWG 1E27B 1WVZA 3GSXA 4OGYH 4X7SH 4DUVA 1J05B 5CSZA 4YHLL 5T1KD 1X44A 3GSXB 4WI3A 3KLHC 1N2RA 3BO8A 2J4WH 1N2RB 4GKOA 5D1XD 1RULL 3S37X 5IFJA 2R2HA 3ALXA 4RAVB 2BOCA 3EJYC 2VZ3A 2X7LA 1ZWIA 2AJVL 4LFHD 2YC1B 2IPUK 4P2YA 2X7LB 1RJCA 2AEWA 1KYOJ 2D31B 4TSCH 4JRXD 4LIQH 1LE5A 4G8GE 3RGHA 2NX5D 5IMKA 3K4ZA 4GAJH 3RA7L 3KR3H 4OFPA 4HK0A 1B4RA 4I0PD 3OXRB 3T0WA 4JDTH 4XBEL 5CWSA 3VFVA 2D7TL 5BVPL 3HR5A 4PY7A 3UYRH 1EX0A 4X9HA 4CDHA 1QR4A 3X12A 2DL2A 4PY7B 3MJ7A 1C5DB 2DYPD 3ZYJA 2D7NA 1JNLH 2IH3B 4KJWC 4IHOA 3HAEH 3ZKMC 3LEYH 1QQDB 1JTPA 3PDGA 3E8UL 3LQMA 2WQRA 2Y6SC 1ZT1A 1IKFL 4QXGH 2OL3L 1MFEL 3DHJA 4I5BA 5CZKA 3DV4B 5F9OL 3VJ6A 2Z4QB 2DI7A 1SEBB 3MACL 4MD5A 4N8VB 4OLYH 4CNIB 5GS1B 4RFOH 3O4LB 4FFZH 4YWGH 1T5WB 4PJAE 1K3ZA 1UVQA 4XP1H 2Q87A 4BUHA 2GCYA 4NQVA 3GDBA 2NYYD 5CEZL 2GCYB 4KKBD 4R2GC 3GI8H 5TF0A 3MR9B 2V6HA 3TM6A 2DQGL 2XKUA 5IR1A 3UJIH 3ARDC 2YR3A 4LLDA 1IJ9A 2DIBA 4OZGE 1VFUA 3L1OL 1UWXH 2Z31D 1R24A 1TNMA 2WLZA 4HDIA 1F2XK 3VRIA 1OAXH 5F3HB 3QNZB 5BZDA 4HC1L 3VRIB 4KH2A 1J1PH 4LHUG 3TEUA 3WIHL 1YPZA 3D3VE 3NOIA 5IVXE 1FHGA 1K85A 4KKNA 1INDH 4OIAA 4DKFH 1PZ5A 1YEKH 3C5JB 4OZFA 3NIDF 2PXYD 3QXDB 5J7CC 1H9VA 5AWNH 4JB9L 3NAAH 1GJIA 4NOBA 2AEPH 4WEBL 2CLZB 2X1PA 1RMFL 3BP4A 3LKQB 3WJLC 5ACLA 3MRDB 5ERWA 3BN9C 3K74B 1MI5E 3BP4B 3LPGA 2VR5A 4KK6D 4FNLL 1MVUA 2O5YL 1HOCA 4YFDB 4Y4KB 5A2JH 1MVUB 2Y9RT 2JIXD 4JQIL 2EE9A 5C0IA 3HE6A 3LZFH 4BSWB 1DQMH 4HAGA 3ZSSA 5L6YH 5KVDH 1FYTE 3T8XA 1F3DJ 3OKNA 4I13B 5D7LE 3JWOH 2LE9A 5D70H 3T8XB 3HHRB 4MA7H 2X89A 2CPCA 1XMWA 4PREB 2HAZA 2R9HC 5L7XH 5T33H 3SKUD 3ZT5A 4C57C 3KWWB 2EZ0D 2CK2A 3UTZA 3UTZB 3V7AG 1HI6A 1MFNA 2YUWA 1R3IL 5EO9A 5T5NF 1AGEB 1HI6B 4WY7H 2JK5A 3QDHA 5EO9B 5TDOA 4Z95H 3O6LL 1JPSL 1I1YB 2AV7B 3TVMC 3NN8B 1UA6H 1R5WB 3HI1B 3I2CH 5MENB 1TCMA 2A38A 4JPKH 4DOHB 1JNHA 4YE4L 1URLA 5CUSL 4M7JL 1I1FB 4HWBA 4KRPB 3EOYG 1RPQA 3C6SB 3PGDA 4MCYA 3UYOD 2DQHL 5KVGH 5GXBB 2CUMA 3L95A 4LU5H 5C0DA 5EC1A 2XTLA 5TFSL 5C0DB 3AM8A 4WO4A 1JPGB 2EYRA 1S9KC 3RZWA 5I18L 5E6IB 3MRJA 3ZO0A 3LV3A 1FE8L 2I07A 1Y0LA 1CBVH 3TF7C 4Q58C 1HWHB 3MRJB 3B9KD 4IRJD 1QFWH 4HEPG 5DJ2B 3UX9B 3BESR 3CXHJ 4G7VH 1P9MA 2GTWA 5AZ2H 4XP5H 4QCIA 3WIIH 4L4TB 4JY4B 3B5TA 3IETA 4JFED 4UINL 3NIFF 3P30L 3QAZB 4CMHB 3LS4H 3IETB 1BLNB 1QA9B 3EYSL 1JGLH 3GSVB 1RIVH 1XR9B 3H7LA 3V6BR 4AEHL 3PV7A 5K59E 1UZ8A 3GHBH 5ENWB 3BKYH 3CC5B 2UY7A 2UWEF 3CMOH 1J8KA 5LVEA 4LARH 1D5IL 1CL7I 1RQ5A 3CNKA 4XHQA 1DQLL 4OGAC 2EKSA 1LO3H 1NCAL 5D7SH 4BSVA 5FO8B 4P3DB 5GS1C 4MLIA 5L2KB 2EKSB 5EC2B 4KI1A 3VRJA 4GKNA 4IDLA 1ZGLB 1PW3A 5D2NE 3KLAB 3V8CA 3PJSA 3OKMB 1M6OA 1DQDH 1MCHA 2W9EH 5GSVB 3N50A 5GGUB 3MJ9A 3V5KB 5CLWA 3RHWF 3NIFE 2I24N 3W81A 2EYSB 2RCSH 1KEMH 3P4OA 1ZT7B 3I6GB 1NEZG 3GSNA 4RFNC 4HQQH 4Y4HA 1UYWH 4I0PA 1OOAA 4ZS6D 5LXGL 1N8ZA 1JWSA 2UWEE 3GJFK 3D0VB 2LTQB 4AYFA 2HWZL 5FECA 1JWSB 2O26U 3P4NA 3L7FA 3R8QA 1H15A 5FECB 5C9KA 3RWFA 1FNHA 2BRRL 3L7FB 3RWFB 4UU9A 2DYPA 4GW5A 1NKRA 4KQ4L 1LK3L 4X9FA 1HEZA 3HS0A 4GW5B 2DD8H 4M5YL 3MUGB 4PJ7B 3HS0B 2GJZA 1IC4H 4POZC 4S0SD 2VDRH 43CAA 1A6ZB 3E6FA 1EJ6A 4BFBD 5L9DL 5JO5B 4XPHH 3VD9A 4HX1B 1IZKA 2CLRA 1UCTA 2X4OA 4YIQB 3DI3B 1F4WL 4NZUL 5DFWH 1B0RB 4U3XA 1FVCA 1I3UA 2IBZY 3KYMB 2EIDA 4Y4KC 3GMNB 4D0CA 1FVCB 3FZUC 1LP9B 1AXSB 4D0CB 2VN7A 4X5XA 5CZXD 3EYFB 3GIVA 1JGEA 2NY7L 4HPOL 5C07A 3QIWB 3WD5L 4CVWA 5AYUL 4GAYB 4H0IA 4YBQD 2VDPL 3CMGA 4R4NC 1X6LA 5B8CA 3CH8A 4EI5A 5DHVH 2AV1A 2E8YA 2XYCA 2YUZA 1KTLA 1TJHL 3FT3B 3V4PL 4OCYH 5SWQA 4FQ1H 3VD5A 1YEIL 4ODHL 1OAUH 1UWEH 3AREA 5E08H 1BJ1H 2OMNA 1KOAA 1J0ZA 3WN5A 3ZTJG 1MRDL 4WUKL 2Y1VA 3MBEA 4X7DC 3KXFA 3WS3A 4I0CC 5C0ND 4LPYA 4DN3H 4UV4L 3KXFB 3FCTB 1S9YB 5H37G 1HE7A 2JJTC 5IV2A 1MCCA 4EOWH 4M7LT 4B7LA 3TIEA 5LGHL 3QQ4A 4XCEA 2H45A 3JTSB 4WNQB 4V1DA 1NCCH 2DI8A 4K3DL 2O93L 4GG6E 4K55A 4XCEB 4NN5B 4OCNC 1PJ9A 3ULVF 2VZ1A 1OB1A 2IANA 2D4DA 1JMXA 2VXUL 2ZNXA 5E2TL 2X9WA 4EEEA 4X6BB 4OZHF 3CFCH 3V4UL 4APQB 1TVHB 3H0TB 4ZFFA 3N06B 5I1KH 4PJIA 2R2BB 4JPVL 4JO4L 4ZFFB 4G9DA 4HWBL 1BQUA 3Q6FA 4HXAH 4O5LL 2J8HA 4X98B 2G5RA 2VWEC 2Q76A 2FWOB 3LMJL 3V52L 4Y4FD 2Q76B 3FTGA 3HG1A 4F7TA 2OR8A 3MRHA 3TA3B 3S4SG 3HG1B 1LO0L 2OK0L 2DIAA 1VGKA 2YEZA 4RGNE 5F97E 2R29L 1CLOH 1VGKB 4UQ3B 3GNMH 1F8TH 4UV7L 3QZWG 4HIXL 5HYJD 1IBGH 1RU9L 2AJSH 2OZ4H 3QCUL 2C3WA 4N5EC 2ZJSL 5DMIL 5KOMC 4JHZA 4D8PA 1CD8A 3EDKA 1T66C 3QAZC 4CMHC 4D8PB 2IPTL 1KJ2H 1FNEB 2YUVA 2MOVA 4FZEH 5LBSH 1NEZB 3IJYA 1RZ8B 3WFCH 3IFLH 1MFDL 2V7HA 4TNWF 2HLAB 3OV6A 5HGGS 3IGAA 2EDJA 4HIHB 4PJBF 3AFLA 3MJ8B 1BVKA 2WIIA 4WHCA 4G6KH 4M4RA 3MA7A 1BVKB 2WIIB 3PWPA 2J3SA 5IMOA 5I1GL 1OGAD 4X6FA 1JNJA 5IK3A 3QFDA 2CO7B 1EO7A 5DK0B 1NFDA 3QFDB 5IB1B 4K94C 3MV01 2WSKA 4OM0H 1NFDB 4PYHA 1T7WA 4U1LA 1MY5A 1JFQL 2ARJQ 2E7LA 3RJDA 4IRJA 4K94L 3UMTA 4U1LB 5T1LD 4QYOA 3MJ9L 1MCBA 2PW2A 2GW5A 3H9ZA 3JWDC 3GEWB 1MHPH 1XCTB 2IQ9H 4P49A 3JWDL 3GSNL 1IAKB 2LTQC 3SJVB 3DVNA 3VRLE 1J0KA 1PSKL 1YC7A 4NQEB 3ILPA 5ITBH 3ILPB 1JRHI 3DARA 4XNYH 1EHAA 3QXAB 2R23A 5CJXA 1G84A 3D0LA 4OCRL 2CQVA 4P4RA 4NO5B 4BH8B 3AU1A 3D0LB 4N8PA 1OP3K 4UNUA 1S7RA 3CIQA 4MXWH 5I1DB 2CRYA 3AU1B 2R2CA 1KG0B 3U83A 2J88H 4OGXH 3MRKB 3B3IA 3IJSB 3DXAE 2QADB 4DFHA 1UACH 1A6AB 5F1OB 2EH7L 4TNVK 5JR1L 4M1CD 2NY4B 4HMDA 1BZQK 3FFCB 3UTSE 3QIWC 1AFVH 2YMXH 5BZWB 2XTJD 1FL3A 2NNAB 3LPWA 4H5SB 1U95B 2GUOB 4ODTL 4OUUB 1FL3B 1ROWA 3DURA 3EHBD 3T1FA 4O9HL 1ZLSH 5HVWA 3DURB 1U92B 2NXYB 4PRPA 1H3VA 3PWLB 4NJAH 2VRAA 3MLXL 1CGTA 1X5IA 4Y89A 4G3YL 4PRPB 3EBAA 2BCKB 4EDWH 1H8NA 1PZUB 3AREC 4X80H 4OLEA 3O81A 2W0FB 1OAKL 2R1WB 1YMME 3SBWA 3GK8H 3MBEC 3MYJA 4PP1D 5HSFA 3MYJB 3PIQA 3BEVA 1FZJB 1N3NA 5E2UH 4EUPA 3T08A 4NSKA 4F3FA 4NN5C 3LQAC 4JQVA 4KKCD 3HI5H 4EUPB 4HK3J 4BYHA 2R56H 1NAMH 1TETL 2VJXA 4APQC 2Z91B 3MV9E 5KSAB 4L4JA 4GBXA 3KPLA 3BKML 4XCYB 1VENA 2ZUUA 3MJGX 4PYGA 3MYZA 4LSRL 2EXYC 1HSAB 1F13A 1IGFH 2PCPA 3NA9H 3RBSA 1RUMH 4KKLC 3EYQC 1NGYB 1OM3L 3MV7B 4LCCA 5I8KL 4PJDA 2W07A 4P5KA 5D96B 5F89A 1VSCA 3WL9B 4RMVA 2UZIL 4PJDB 5D7JD 2A6KB 2HT3C 3JV4B 5K33A 1RVFL 3ARRA 4AEFA 5FEBA 4LPWA 3EOAB 4FQHA 2AK4A 1LD9A 1Z3GL 2GFBA 1I7RA 4JZJB 3GHEH 12E8L 3CSBA 1F42A 3L3DA 3SN6N 4L4VA 4NQCD 1U8QA 4L4VB 5FCSH 1NMBH 2NY6D 4JG0H 2HFFA 5HGBA 1CD1B 1AE6H 1XGYH 3TPUB 1FLRL 3C60A 5CILH 3IDUA 4PB9H 1LO2H 5JOPD 3C60B 4XC1L 2GK0B 1JHTA 3FFDB 4HS8L 4MJ5A 3PP3K 1V7ML 5IMLA 4Q9CA 4HJ0C 4ZPVA 3LSOB 1XT5A 4XVSH 5IMLB 2MKLC 1X4ZA 3NVQA 3L5JA 1DANT 2D0HA 2F8OA 4DGIH 3P4LA 1F5WA 1OWWA 3PNWA 4HIIA 5FOBA 4WU7A 1MJ7H 3FN0L 2C3HA 1F45A 4HIIB 5F6HJ 5FOBB 5HHXL 5DZLA 3T4YB 5C7XL 4JFHD 3ME0A 3L5HA 4UIKL 1U9KA 2ITCA 4KKAD 4B5EA 5JOEA 1T1XA 35C8H 3IU3B 1DQQA 2ITCB 1AJ7L 4UTBH 3V6FA 3FRUA 1SJHB 1MAML 4LBEA 5E03A 3SDAB 3TN0D 3FRUB 3VD7A 3ESVF 2XQYG 4LBEB 1T20A 2VMFA 3L3OB 1JWMA 4U2ZA 1Y6KR 5GRWA 1JBJA 4YHLH 1TVBA 2RHEA 5CJXC 3MCKB 4F33B 1RULH 3B2VL 4NNYB 4ZOEA 3QXUA 4O2EA 3BD4A 2VAJA 1IM3B 3U46B 1UB6A 4MQTB 2AJVH 3X3FL 1V05A 4LL9A 1MPAL 2OP4L 3CVHB 3ZE1E 1X3DA 1FV1A 2QADC 1CXLA 4OKDA 1HWGB 5JXEA 3C2AL 2DKSA 3BKJL 3BPCA 1RD6A 3RA7H 5HHPB 1A7QL 2NY4C 3W0WB 3H9SE 5IVZA 3BPCB 1HHGA 5IVZB 3LDBB 4XBEH 4M4PA 2HJKA 3C8HA 1HHGB 2D7TH 5BVPH 1NC4B 1TNNA 4F7PB 3DROA 3QQ9D 4ZUWA 2NXYC 1P2CB 4QF1A 1R3KA 2YPLB 3ES6A 4CL7A 1LO4L 3E8UH 4P99A 1T7YA 3OF6D 4AL8L 4DZBA 3IDNB 4BZ1L 2ERJC 1J1XL 5C09A 1MWAB 4DZBB 4X6DF 2OL3H 3SBWC 1MFEH 4KI5E 3L9RB 3FHQA 1AKJA 4TYUA 1TQCB 3ARFB 5F9OH 4MNGB 3TBSA 3BVNB 3MACH 3GSOB 3PL6D 4NM8L 4H1LH 5E8NA 1CFBA 1VERA 4JHAL 3QIBB 1J10A 5GISL 4JQVC 4N0RA 5FA4A 1EK3A 5EOQL 1NC2B 5HYSA 3FOMB 2H2SC 5KSAC 5HYSB 1DQJB 3TJEL 2EIEA 5CEZH 3A6BL 1G7IA 1TJGL 4GBXC 2DQGH 3KPNB 1G7IB 2XXMB 1A7OL 3SCMB 4XI5D 4L3CA 4EXKA 3LH2L 1HQ4A 5JW3H 4OFIA 2P5ED 2NZ9C 4I2XE 3BRFA 3B9EA 3L1OH 3UTTB 4NRYB 1SY6A 5I30L 2HA1A 3T0EA 2RGSA 1MCOH 4PJEE 3OAYH 4PJHF 3T4AB 1KJMB 5D96C 4KVCL 2E3VA 3VDCA 4LCCC 3FQXA 4MVBC 4X6DE 2A9NL 4HC1H 3QA3A 1IGYA 4OFKA 1CDJA 3O9WB 3BGFB 4WFED 4KUZL 4X6CF 5IESL 1NAKL 5HHQA 1OAZL 3U0TB 3HLAA 4JB9H 1DR9A 5KS9F 5HHQB 2CDFB 2R1XB 4WEBH 4UZGA 1RMFH 1T04A 4P0DA 2Z93B 3VXTB 1KULA 1SYVA 4U7MA 4FNLH 2O5YH 1SYVB 3C60C 2VC2L 2R4SL 5BVJA 3DETD 1K8IA 3UTQA 4RCAA 1LNUA 4JQIH 2WNGA 2IC2A 1IRAY 1I9EA 5HGDA 3UTQB 4TTGA 3VXSB 1A6WL 5J1TC 4YHYB 1MCPH 4OF8A 1FYHB 1MCJA 4F80A 4ZNEE 4G9FA 5F71A 2FYYA 1IEAB 4Y19B 3ZHDA 2PTTA 3UJJL 2FYYB 3QEQD 5JORA 2PTTB 1BAFL 2A2QT 4X6CE 3TO2B 4G8GD 4L3EB 1NUFA 4Z7WA 4JFQA 4ZOBA 4FTVE 2CRIA 4JFQB 3DRQA 3HPJB 2AI0L 2J5LB 2FBJH 3DECA 3ZT7A 1OTSD 3WNPA 3G5VA 5D7JA 1WFOA 3SDAC 3WLWD 5DUMH 3O2WL 1F4HA 1VFOA 1S7VA 1MRCL 3JWNC 2Y5TA 5BS0E 1RFDH 1S7VB 3B8SA 4P2CG 1XCQA 1LEKB 4YE4H 2EXWC 3EFDL 4OZ4A 1IC7L 5CUSH 4M7JH 5TH2A 3WLBA 1ZS8B 5IGXL 2HJFA 4PJGA 5TH2B 3U7WL 2DQHH 4Y1AB 1OWRM 5C6TL 3WLBB 3TBVB 2HJFB 2GSIA 2X4RB 3NFSL 1NGPH 2V9QA 1F58L 3OJDA 5TFSH 1XZ0A 1Z9OA 3VFNA 4P2QE 5I18H 2ZOLA 1U8HA 1BQHA 3ARYA 1FE8H 4HUVB 2OQJA 4H26B 3DIFB 5J1AB 2OQJB 1ZT4B 3DYPA 4G5ZL 4P4KA 1ZA3A 4JO3L 5JXEC 4P4KB 4KUCF 4E41A 1ZA3B 2NY0B 3FQRB 2WIMA 3LDBC 4IEFB 4TTDD 4G6AC 2VKWA 1YEDA 2P49B 3DO3A 3DX8A 2BY3A 2F19H 4UINH 3P30H 2NW2A 4PV9A 2YD9A 5MI0B 4J4PA 5DA4A 2NW2B 3G04A 4O58L 1HXYA 4JANA 2VABA 1FBIH 3EYSH 3TN0A 3C5SB 2J8UF 5F1KC 4JANB 4AEHH 2VABB 3RU8L 3V7MA 2APTA 5JHDB 5INCB 4FRWA 3C5ZB 3RRQA 3D3VD 4NDMB 5T5FL 4MJ6A 4YEEA 4J6RL 5EUOE 1D5IH 4YZFF 1E28B 3MOBL 5C0CE 1TQCC 3NCEB 3MV8A 2VQUA 2EC8A 1DQLH 1S78D 2VNCA 1NCAH 2RIKA 4P23A 1PGRB 1DE4B 5FGCE 2BVQB 3CLEH