1R3LB

Potassium channel kcsa-fab complex in cs+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords Antibody Fab fragment light chain
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3lB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3lB02
3AGVA 3IF1B 3P4MA 1P53A 2IADB 1S78D 5CCKH 12E8H 4LLMB 2K9UA 1VEMA 1PX3A 3R1GH 3ARXA 4JRXE 4BFIA 1BJMA 3IDJA 4HCRA 4XGZB 1A4KB 2GKIA 1F4WH 5D1QB 5TPWL 2ICWB 1BREA 1JTTA 4C4KT 1VFOA 2CRMA 3ZKND 5GSVA 4GRWE 1WT5A 5AAWA 3MRKA 2BOCA 4Z5RB 5C0CA 4UV7H 4K23L 1FPTH 2XWBB 2OJZL 1GGIL 3IAPA 4TRPH 1K6QL 3PWJB 4OJFH 3KNBB 3H7LA 3SGEI 4FNLL 1U8OA 2WQRA 5HI4D 1VKXA 4LIQH 3MNZB 3BN9D 1X5FA 3D0VB 4HXAL 2X4TB 4HJGA 1TZHA 1P9MA 3L6FA 2UZIL 5F88B 1HHJB 3AS2A 1I1AA 4N0UB 4JFZL 4YX2H 3MXVH 3H7BB 3MV9B 2K3TA 3BISA 1D9KC 5HGGS 4X98B 4YUEH 3ZKQD 3E6FB 1J0ZA 3NOIA 2P8MA 1I8IA 1RJZA 5EU4A 4P4KB 4DUXA 3A6BL 4JDVA 1EFXA 1WIPA 4QGYA 5ABDE 2RQ8A 1H0DB 3PUCA 3X3GH 5BMFL 1EXUB 2X09A 1KLGB 1BGXL 1BQUA 4NC1C 2FX7L 3AMLA 3MYJA 2DLTA 3RI5F 1JF1A 2OJEA 4IEFB 5HYEA 4FFWC 1MEXH 1EZVY 1U8JB 3FFCB 4PJIF 5I1JH 3MLTA 4U1KA 3GMNA 4QEGA 1R3JB 1G7HB 3PV6B 1FJ1A 4XPBL 2J6EL 4CVWA 1X5LA 4RDQG 2NZ9C 5L7XL 2AEPL 1CGXA 1AQKL 4KGLA 3QEQD 4H8WH 4CDGC 2XYCA 3S36L 3BZDA 1SM3L 1EBAA 4C4KO 5F7MC 1RK1A 2AQ2A 3D6GA 3KPRD 4DTGL 2PCPA 1QBBA 3W0WE 2J8OA 2XV6B 4HC1L 4C54A 5D7LA 4QRQA 5IB2A 2BNQE 2ZCLL 2FIKB 3U30C 5IFHL 3TVMA 3DBXA 3KR3H 3V6OC 5CP3A 5E2WL 2OLDA 4U1NB 1IAIL 4HW6A 5DC4B 1Q1JL 2BXYA 3TBVB 5GS0H 1JMZA 5AWNH 5IB3A 1IMHC 5IMOA 2DQEL 1A7RH 3DYOA 4NZTH 2EZ0D 4ZDHA 1CE1L 2Y23A 3AU1B 3FB5A 4NQDE 5CEXA 3MMEB 4MJIA 4PP2A 4MD4B 4YHZL 2AGJH 2QKIB 2CIIA 3VGEA 3EOBB 2GAZB 1MCSA 1DQLH 4MDIB 1K4DA 4K9EH 4BFBD 1RVFH 2IANB 5EU3B 1T2JA 4QT5A 3QJHA 4P0DA 3SDDB 1SM3H 2UYLB 4Z78A 2GSGB 4OD2A 3RVVD 3TA3B 2CPCA 4K94C 3V6ZA 5F3BA 3MA7A 4YBHA 3MBXL 1IC7H 5BV7L 4M6AA 3LRSB 1CR9L 2R0ZH 2VQ1A 4AYFA 5IEKA 1AP2B 5GGSA 3O2DA 3T3PF 5F89B 4Y5XA 1EGJL 4U0RC 2X4OB 3V4PH 1FG2A 4PJGA 2NY2D 3O6KH 4HF5L 5DJYB 3O4LA 4XAKD 5BCAA 5FGRA 1HSBB 3NA9H 1L0YA 4PV9B 3RGVC 3KPSB 1RZ8A 4GRMB 4X7DC 5E4IA 1MCWW 3FT3B 3SKMA 1SBSL 3KVQA 5E94A 4KK9D 5F9DC 5HHNB 5GS0D 3PHSA 1AXSB 1OAQH 4LSUL 4X4YB 1N6UA 2OTPA 3VXRE 4KQ3L 4I3RL 3GSNL 3WO4B 3RWFB 2GSGA 3TBVA 2OZ4A 4PJFB 1X5IA 2OR7A 4NN7B 1BD2E 1MFAL 1LP9E 1YYLH 3SO3C 5J3HD 2FIKA 1NGQH 3HHRB 4L3EB 4M61A 2A0LC 4W4NA 1VEOA 3S5LA 2B7DT 4GAYA 5E6YA 2BOBB 4X98A 4YH6A 4NN5C 2P42B 3G04B 1G7IA 2MWCA 4KQ4H 1BWMA 4JQIH 4M43H 1A7OL 3L3IB 4CW1A 4WI5A 2VDML 4KKAD 4BZ1H 2DBLL 1E4KC 3P11H 5DRWB 1UJ3C 5F71A 1FYTA 5ANMB 1NC2D 3BRDA 1MREL 5HHOD 1XGPA 3P9WB 3QXAB 2XA3A 3LEXB 4KVCL 3LQZA 3NMEA 4WNQA 12E8L 5GGTA 3X17A 4PYGA 5C71A 2KDGA 3QIWA 2VLJD 5KS9A 1OGAB 1QFWL 3ULUD 5SWZA 5FDWA 4QRRB 3OKMA 1DDHB 1F3RB 3MJ7A 4F2MA 5BOZG 4I48A 5HHQB 2V5YA 4P9ML 5I1IH 4H88L 1WWCA 5EBMB 4QOKB 4YLQT 4NP4H 2VXTH 4ODSL 3B4NA 4QHLB 3BIKA 3VGAB 2GK0A 4I18C 4H5SA 3N85H 4NO5A 3W5MA 2BRRH 4KJYB 1CGUA 4ZAKA 1K9TA 1MFBL 3MLUL 2A38A 1BVLA 2J7LA 3WFDL 3WIHA 1FZOB 5DRNB 5H35A 2VZTA 2AV7A 4HJGB 4I0KA 3G6AA 1MRCH 2EDWA 5ESQB 2DJSA 1NEUA 3UPRA 4MD5A 2BNQB 3FL7A 3WDIA 5EBWB 2VZUA 4TSAL 3BO8B 4WW2A 1IL1B 1DVFD 4EDXA 2HG5A 4H0HB 1PYWA 3MFFB 4NRXB 2DDQL 1D5IL 2EH7H 3VWJB 2X4QB 1ZVSB 1CL7H 3T0EE 1Q9KA 4LFHD 1HILA 3FTGB 5F9OH 5LBSL 4RNRB 2R8SL 4YDKL 4XVSH 3ZDZE 4AK1A 4Z0XA 5DD1H 3ALXA 4ZOEA 4OIBA 1QACA 4A2LA 2FGWH 3G5VB 4HQQH 5MEPA 3W0WA 4LAQL 1D5XA 1Q72L 2XWJB 2KQNA 1MCJA 1VADB 3TNNA 1KNOA 1G7HA 5GRZA 5HVGB 1KJ2H 5FKAB 2HJKB 4LPVA 4MAYB 5F3BB 1KPRB 4IMLB 4OZHA 1KEMH 2R0ZL 1B0GA 1VFMA 3KAAA 3S96A 4JPIB 3OJVC 2HT2C 2YKLH 2FBOJ 1OP5K 4CADA 4K3JH 4L9LA 2X1WL 3RNKA 5L2JB 4KY1H 4S1RH 5D5MB 2Y25A 4H1LH 4E42A 3M8OL 1T5XB 5ECJE 1ZS8A 4JY6A 3F7QA 2DQCL 3SGDH 4FTVB 1KTLA 4XPTL 1NPUA 1S9YA 1WWWX 3WIHL 1NAMB 1RJZB 4NKIH 3BRGC 3VWJA 5HJ3A 4H5SB 4DN3L 2ICEA 4NQCB 3JWDC 4M7ZC 4UU9A 1BQSA 1MIEH 3ARGC 3DYPA 2W0FB 5A2FA 1G6VK 4IRJD 1WZ1H 3MV9D 5D2LF 4HIIA 4UOW0 5DD1L 2IALA 4PIRF 1XF1A 3VGHA 3OAZK 2K1MA 1RUMH 2B39A 1AC0A 1WTLA 2NXZD 2WNGA 4KFZC 1JRHI 1WZKA 1RJLB 4YR6A 1S9XB 3R06A 3T1FB 3X3FL 5MEOA 1UB6B 1X5KA 4R7NA 4IHOA 4NT6A 5FDYA 4HXBH 5LGJB 1N2RA 2LFGA 1IL1A 5CUSL 4WY7L 3KXFD 5ENWA 5AZEL 5CILH 4DEPC 1K2DA 1JYNA 4ZODA 1URLA 3C60A 5LGHH 3OAYK 1KGCE 5B39B 4GMSH 3BFOA 2P24A 3D25B 3MRFB 1NCAL 1E27A 5IV2B 3K4AA 5CIPB 1YMMD 4S1SH 3VDCA 5HVWA 1DLFH 4XPAL 1XF3A 3GMOA 4HH9B 3QDJE 4MHHI 5F97E 4RGOH 4HLJA 2HWZH 4JR9L 3ZT6A 1FYTD 4P49A 1IVLA 1F90H 3PWPB 1P9MC 2X9XA 3MOAH 4XP4H 1A7NH 1ITBB 4PJEA 3S35X 1Q0YL 2ZG3A 4F9PA 3GIVA 1GHFL 3ARUA 5EORL 3UPAA 4KUCD 2HH0H 2HFGH 3D2UB 4QXWA 2BVTA 4X9FA 1H3PH 3CFIC 1P7QA 4OI7A 2X4NB 2XNAB 1S3KH 5D96B 4NQDB 1OAKL 4YXKL 1KXQE 2APWA 1T5WB 2HT3D 1UFUA 5C09E 3WXWH 3PQYD 5CJXA 1TZGL 1MY5A 1UB5A 3LMJH 1DQDL 1V3KA 1BJ1J 3RWFA 4ORGA 1HINH 1NJ9A 3ARED 4AMKL 3BP7B 2VL4A 4W81A 5F7DA 4LHUA 3RWJB 4YFLF 4MA1C 1U3ZA 3LZFH 2W0FA 4RISL 3BKYH 5EUOF 4QHLA 3KPPB 2YWYA 3KYMA 5JDSB 1F2QA 4XBEH 1GGCH 1CXFA 1ZVYA 2DTML 3EYFA 7FABL 1FH5L 1FIEA 4GAGL 1T0NA 4ZS6C 1MSPA 1UKSA 2VN7A 2NW3A 4HK3J 1TVBB 3VMOA 1AP2A 1KIPA 1RIVH 5T3XL 2E8ZA 3HRPA 4O02L 5E7BA 4JVWA 1GIGH 2R39A 2JCCB 4D8PA 2GT9A 2X7LA 4KV5F 3TA3D 3IXAA 1CICC 4RDQF 1WWBX 1JRHL 1UJTA 3U0TA 1T4KB 2WAHA 5D7JA 2EECA 1XIWB 3T3ME 4F2MB 1YEHL 3MLXL 3TVMC 5GRJL 4ZXBB 4ONFH 2GY7B 3W0WD 1MH5A 5BRZE 2DQDL 3VE0B 1II4E 2D0GA 3IDXL 1R6VA 4NZUL 4JRYE 1KBGH 4QTIH 5FYKH 2D3VA 3H0TB 5E8DH 1EHXA 3UJJL 3SQBA 2XTLA 4OZHB 3MRQB 3MV9E 1NFKA 4HGWA 4U2ZA 4RIRB 4LARL 3P77B 3UTQB 4KMLB 4Y4HA 4L4VD 3HI1A 2DAVA 5J12B 2B1HH 1U8HA 3AM8C 3ARFD 3QXDA 1VFBB 3EO1A 2KZ1B 2DMCA 4NQSB 4DAGH 3VFUB 1JGLH 1I8KA 3MLVH 1F4YH 2FB4L 5JOFA 3QIBC 4OCXH 1QRNE 4WHTA 2FLRT 2HMIC 3P0VH 1NAKL 3QHTC 4NKOB 1T6VN 4F9LC 2YD7A 4RGNE 2HLAA 1G7IB 1U3YA 1M4KA 2VR9A 3RVUC 1IGTB 3PJSB 3LQAH 1S7RB 4LSQL 4QLRA 4BSVA 3PWUA 5BV7C 3TJHD 2DQHH 1J8HB 3S5LB 3GSOA 3O0RH 3B8YA 5E2UH 4M8VA 3CFEA 3U2SB 1KLFA 4Y4FB 5IHZB 3O11A 4OGAC 1G7LB 4BA8A 3IFOA 2GJ6A 2EDFA 1T1WB 2CDEA 4MJIE 4C59B 3QWQB 5I74C 1EJOH 4UILL 4DCQB 5DJDA 3HE6A 4EI5B 4JG0L 3QP3A 1NLBL 4JGMA 4QO1A 1UYWL 3H8NA 4I2XA 3KPOB 5FKAA 3CDCA 2WWKO 5IB5A 3V79C 1CE6B 3HNSH 1MI5B 4PJ5D 1EXUA 4O2EA 5D93B 4WW2C 1AGDA 3D85A 1S7WB 4YFDB 3Q6FA 1OPGL 1H5BB 4JPKH 3MROB 4GS7C 1A14L 1OGAD 5DS8B 2A6KB 1E4XI 3UXFA 1E28B 4QCIA 1YMHA 3DI2B 3B2UC 2BP3A 3OR7B 1AR1C 3FCTA 4I18B 1FJ1B 2EYRA 4GQ9H 3GFUA 5DQJB 2E7LC 4WUKH 3ULSB 5C0RL 3QWOB 4WUUA 4MA3A 4ZSOE 4Y19D 5I2IB 2DIJA 1KB5B 3EJJX 4LKCB 1CFQB 1JIBA 1T1WA 3LQMA 4I0PB 2YK1L 5SX4I 3EFFA 5FCUL 2CLRA 5DRXA 3QDMB 4MA1B 4NO0D 3NCEB 3WD5H 3QEGL 4MJ6A 5FXCH 1IT9H 3RZWA 4I2XB 1DN2A 4CVZA 1TJIH 3A67L 1I1FA 1YEGH 1I4FB 1JUFA 2OBGA 1IZJA 2BNQD 2ERJB 3BWAA 4KRPD 3WS3A 4JAMB 2IQ9L 1N3NA 2UYLA 2X4UA 3QXVA 4MNQA 5DS8A 2C3WA 5F7NC 5ITBL 3F7YA 2ZKHH 3UEZA 3V5HB 4HUMB 1LP9A 1J05B 2NTFA 2Z8RA 1DL7L 4KKLD 2EICA 4Z7NE 4AM0A 5BZDA 1FDLH 1U8KA 3PWUB 5TDNB 4Y89A 4Z95H 4DKEL 4YUEL 2YD1A 5CEZD 3BH8B 5I2IA 4DVRH 1CIDA 3UPCA 4UNVA 1EERB 2GJJA 2A9NH 4FQCH 5IG7A 1S7VA 5F1IA 1NDMB 5TDOB 4FQ1L 3VGGA 3UAJD 4MX7A 4WTWA 4P23D 4HS8L 4MAYD 4L8DA 4PRBB 3GJFH 3THMH 3MRPA 2ZSWA 5C07A 5D7JB 3EOAA 1EEQA 1UCTA 1XGTB 5EOCL 1E4WL 2F58L 3QQ3B 5GRUL 3OPZH 5JW5A 1MJUL 4DFHA 1T7XA 1LO5A 4ONHB 3V4UH 2BDNH 3TIDA 5A2JH 4I5BA 1CXKA 1A6ZB 1R3JA 3B6SA 4JANA 2JJSC 5BVPH 1B4RA 4P48A 4PJEF 4M03A 1HWHB 3BESR 4HJJH 5JR1H 5TE7H 4Z7VF 4QYOA 5F96H 4I1NB 2E27L 2WBJC 3OZ9L 4RGMC 2Q3ZA 4M1GH 5I71B 3D0VA 3TLRA 4WEUD 4U0RB 3MACH 3BUYB 3L5WB 4NM4H 4WU7B 1J8HE 1KCRL 5HHVH 3KS0J 4GO6B 1VGKB 4JQXC 5HHPA 4PJIE 3BDXA 1NGYB 3QEQE 3KYMB 1DUZA 5FUCE 5I75C 1INEH 1F13A 2VDNL 4Z8FL 3SOBL 4X6CB 3SDAC 2W65B 4QOKE 3FHQA 3IAQA 5ANME 3KXFB 2OI9C 4OCSH 5A2LH 3VXQB 3QUML 1FDLL 3MRBB 1P5VA 4KJQC 4KROC 5BOPA 4MHHG 3VD5A 3SO3B 3TJHC 3WIFA 2EH8L 5IVOA 3AMKA 3CLFH 3BJLA 5GS1C 5EZOH 5CIPA 1FHGA 5FYKU 2Z91A 3VRJA 3MOBH 2VERN 2F54E 4MZ3A 5C0BD 1RZKH 4RMUA 4FXGA 5IF0B 1BVKA 4JRYB 4JM4H 1SEBA 1P1ZB 5MENB 3EJYD 1INQA 5LQBL 1J1XL 4ERSL 3BP7A 3FO0H 2GTZA 2OQJB 2Z93B 3MRDB 4F80A 3G5ZA 1FVEA 2VNCA 3VI4F 1WAAA 3F7VB 3T77A 1ZVHA 3TZVA 1QRNA 2H32B 3THML 4WI2A 3NZ8B 5IQ9A 5CSZA 2IALB 3DIFB 4GUPA 3SCMA 3WIIL 5IGXH 4WHYH 3JV4A 1B3JA 2G9HB 1KELH 1HEZA 3U36B 3MOQA 5EUOE 2YD9A 4XCYA 4NQEA 2BMKA 1MRDH 1R24A 4XPGL 4PG2A 3P73B 3TYGH 4JY4A 1SVCP 2M8XA 4RAVB 4NWTH 1FNEA 1Q9LA 5DJCB 1RJCA 3X3FH 1IBGH 4UV4L 2NR6D 2IFFL 5EU6D 3S34H 3P4NB 3HC4H 5ITBH 4APQC 1M7DA 1X4ZA 3JTSA 4FQQB 2UWEB 1UXSA 3I3EA 4PUBH 3EYFB 3HNTL 4YHKL 2G60H 1EFXB 3LB6D 1CFSB 4U1HB 4OZ4B 2RFXA 3DPBA 4LHQB 4AEHH 4YHLL 3MGTA 4ZTPL 3ZDXF 1W0VA 5KW9L 2DF3A 2OP4L 1NBYB 4HSQA 5CS7A 4OLWL 2F74A 1K8IA 2WBJB 3P2TA 3NZHL 2EH8H 6FABL 5EIQA 4PG2C 1FG9C 2RHEA 3K0WA 5I9QB 3S88H 2O5ZH 3O2VH 3OAUH 4PJAE 3VG0L 1A6WH 4XCYB 2CD0A 5CLWA 1UVQB 3RA7H 3H42L 4OTXH 4WO4C 5J06A 2DYPB 4NM8L 4WI3A 3MRHA 4IOFD 4OZIB 2FGWL 4YBQC 4M7LH 1OWWA 5ISZA 3NN8A 1PW3A 5IVXA 2ATKB 3WS6C 5TE7L 2ADFL 1HSAB 4UV4H 4GXVH 2V5MA 1ONQA 1IGIL 4PGCB 5I8EA 1NANH 4P5KA 4PV8A 3NH7L 3G6DH 2CLVA 4P4KA 4OZGF 2UV3A 5K9OA 2UVFA 1ZAGA 3IDMA 1I3RA 4WGVB 4EI6B 1GGTA 3CH8A 3OPZL 2ZG1A 2EDTA 4M48L 3HZMA 4OM0L 1JPGA 4NYLB 2YXMA 2Q8AL 3ZDZF 2A6DA 5F9WC 4PD4K 4DGYH 2Q8BL 4OV5A 4N9GA 1CG9B 3WYRA 1J8HD 2ZPKL 2VDOH 2I5YH 3OF6D 2QBWA 4MS8C 5CZVH 3RWIA 1GOGA 2HTKD 4GG6B 1GPOH 1QLRB 4DGVL 3BGAA 4ZFFA 1NFDF 5T3XH 5DJXB 5A43C 4PRIA 2JCCF 3W11D 4PJEB 4EI5D 2ARJA 4AIZB 2AV7B 5EZOL 1NCWL 1YN7A 2H26B 1DN0A 2NNAA 3I3DA 4OD1L 4PJ5B 2JB6B 3FOMB 4D0DB 1CL7I 2ORBL 3BH8A 1RUKL 4LARH 3BPLC 5TDPB 1MFEH 1K8IB 3P4OB 3QCUH 4WW1A 4HKJB 1KYOK 2C4FU 4EDXB 2NY1C 5DMJB 5I1EH 5IKCB 1ZHNA 2FEEL 3ZTJH 5E9DB 3MR9B 3WD5L 1AQDA 1Y0LB 2AJ3A 4DGIH 4PRBA 5H37H 3KJ6H 1J88A 4LQFL 1H3XA 2P45B 5EOQH 3TZVB 1P2CB 5FOBB 4M7JL 3DX8A 4ISVA 3HFML 4NIKB 5I76B 4V2BA 1SYVB 1WBYA 1T0MB 2L7UA 3F65A 1PG7W 4LSSL 3RRQA 3DGGB 5D9SB 1OAKH 3VGBA 3HZVB 1S3KL 4NO0B 1DBJH 2LTQC 4ZUTB 3L5JA 5HYFA 1KTRL 2EYTB 3EYQC 4JGJA 5HVHC 4WFHD 3F6IA 5IVZB 2HFTA 4MWFA 4L29B 3UJTL 3FN3A 1YYLL 4X6BA 1G7MB 1WAAF 3MRBA 4HWZA 3ARDC 4KRPB 4LU5H 4ORZC 1LE5B 1BF8A 4GMTL 3VH8G 5C3LD 3HNSL 1MLCB 3HKFA 2VXSL 2YR3A 4XBGA 3WBDA 3OGOE 2JJTC 1N59B 4FQ1H 4A6YB 5C0IA 3UBXB 3OJDA 5IM7B 2OTWB 1N0XL 3WHE1 3O81A 3GI9H 1PSKH 4OD2B 3QZWG 1A2YB 5J9PB 5F7EH 2NY0D 5L9DH 4XBPB 3LOWA 1OAYL 3O6ML 3NTCL 4UT6L 2YD4A 1RHHA 1AFVH 2Q76B 1IARB 2ICES 3MRLA 4P23B 1O0VA 5C08E 5EC1A 4PJCF 3UYPA 3SGDI 2VUOA 1D9KA 1KCKA 1U36A 2VKWA 1SMOA 2VTFA 1S8DA 4I0CC 3TPUB 3RWHB 3QFJD 5IHBA 4PJ9A 4UIMB 4NZRH 2BFVH 4DN3H 4LCYB 1WICA 1T4KA 3QQNA 4G7YH 4NKIL 1N8ZB 3TFKD 4Y2DB 5GIRA 2VYRE 3QEGH 3QSKB 4Z7VA 3SDDA 4Z18A 4C55A 1T0PB 4YWGL 3RDTC 4LBEB 4Q9CA 5GGQH 2MTPA 1DP0A 1HOCB 2WW8A 3MV7E 4Y0GA 2OK0H 5C0JA 4OZHE 5FB8A 4OLYL 5I16A 4TQEH 5ICXB 2EDEA 4WV1A 1M71A 4U4BA 2BVEA 2W0PA 2WUCH 3LHPL 4X6DE 2D03L 1RZGB 3CFBA 5GGRA 2YA2A 2EDJA 4AENB 4NFCA 1CLZL 1N7ML 1T04A 4LSRH 3C8DA 5K59E 2YRPA 4XP6H 3T09A 3KR3L 3LEVL 1MI5A 3P9MB 4WI6A 4XI5D 3CUPB 1BM3L 3VFRA 3AS1A 3D5OF 3ARFA 3DGCR 5JHLH 3QUYC 1FBIH 2F5BL 2DIAA 4LOUD 1BFOB 5T1KB 4XNMB 1T3FA 1CU4H 3N50A 5A3ID 4RGMB 2NY6B 2ESVD 4HZAA 3MV7D 5GQBA 3DXAE 4PJ8B 1GGYA 5DQ9B 2WINB 2EIDA 3VGAC 2BY2A 3DV4B 3B9EA 5EU6E 3RWEA 5KVEH 2ADGA 4KK9C 2Q87A 4JPVH 1LO2L 1PX4A 5T33L 3RDTB 2C4FT 1BBJB 2JLLA 3FZUD 1M71B 5I6XC 1JWUA 3S4SB 4WUUE 5IQ7L 3VFPA 2QJDA 4NDMB 1MF2H 1CBVL 3QPQC 5BS0B 4FTVA 4WCYH 4OFVA 4ODSH 4R7DB 3TGXA 3VRLF 4IDJL 4JFFE 2DI7A 4JO4H 5GS1B 3SPVB 3ARDD 5MI0B 4JKPL 1GRWA 2P1YA 1W0VB 4UDTA 5E00B 3H9YA 3I85A 5K9OB 1YEFH 4XNMA 3RJQB 4C83A 1YQVH 3VWKC 3W2DH 4FZ8L 3GSWA 4JHBA 1LEIA 1KJVA 4MNQE 4TSAH 4JFZH 1NDGB 3O4OB 2DQDH 4X4XA 4K07A 1KIUA 5E8OB 3QYCA 5J56B 3LKRA 4XX1E 1KC5H 2XRAH 3JXAA 1TFHA 1MHHA 3EJZC 3ARBC 4LIQL 2WBJD 3JSSA 5FGBA 2E5EA 3RTQB 5A16A 3MRFA 1X5HA 3VI3E 4E0RA 1XFPA 4TRPL 4YBLC 1IAKA 1QLRA 3IDIA 2Q6WB 2YS4A 3F12B 1LK3H 4Y1AA 1NAMH 3BMVA 1CTOA 5CWSA 1ONQB 5I8EB 3HC0B 4LHUG 5FYJU 3L3KB 5D7IA 1J5OH 1R3IL 1ETZB 4JO2H 2LTQB 4H1LB 4UQ2B 3FT2A 4XB7A 5D7IE 5HGAA 5E08H 4FQIL 3SBWC 2RCSL 1UWGH 2XNAA 2IANA 5EU3A 5E6ZA 4DQOL 3PGFH 2WBWB 3O41B 3GSNH 3VXTA 4Z7UE 3D69A 5FKPA 1KENL 1ND0B 4LSUH 5IBTL 1RFDL 5E2VL 1MCEA 3R06B 3QUYB 4HGMA 1CCZA 3RWGA 3CLEH 1MHHB 1K8DB 2V17L 1F4XH 3FTGA 2YZ8A 4ELMB 3U79A 3WJLA 1JPTH 2AJVH 4X4ZA 1S7WA 2I9LA 2VISB 4WWKD 4PGJA 2EKSB 4J3OC 3LMJL 4JQIL 4M43L 2AK4E 4KK8D 3MGOA 2FECL 2FJHB 5E1AA 4JVUA 2I9TB 1NSNH 3MREB 5TJWK 5EN2A 3BIBX 4N0FB 3NCCB 1YN6B 5FA4A 2NX5E 3VGFA 3ARGA 4OZFH 1U58B 5E2TH 1EO5A 5LGJA 4ZFZB 3HRZA 4BSJA 8FABB 1V7ML 1A6PA 1F4XL 1A64A 4TNWF 4O4YL 4KMTL 3QPXH 2Z8WC 3DMMB 5IHZA 3IFLH 3T2OA 3L3JB 5MENA 1CL7L 3D3VD 1KCUL 5T1LB 3G6JF 3LKPB 4G5ZH 1CU4L 2ARJB 3AROA 3CX2A 4EDWH 1G0YR 2VB5A 4QNPF 4N8CH 3EHBD 2BSTA 5JNYA 2W0LA 4BKLB 3ES6B 2EDOA 5E2JA 5BW7C 2NY1B 5JORB 3TT1H 1T1YA 2P5EB 1L7IH 5GGVY 1JWMA 3VXPB 3GNML 2YPKA 5J11B 1TCRA 1DBAL 1HHIA 1KB5L 1PQZA 4WY7H 1WBYB 2NW2B 5CGYC 4PLNC 4NBYB 5FYKD 2GJZB 4U6XA 2R4SL 4FFVD 5AWNL 3C08H 1EUUA 5MERB 4NN6B 3V4PL 5E9DD 3VXTB 1EGJH 2DKSA 5F1SA 2VLRD 1SEBB 3QUXB 1FZKA 4XCFH 4YHOH 1NSNL 4F7EB 3V5DB 5EUOA 5I1GL 3OXSA 5FHAH 3ZT7A 2IMNA 3TT1L 4IRZL 3MO1B 5CP3H 5DD3L 4UQ2A 3WNNA 3PDOB 4RGNC 2Y7QB 5D70L 3KPNA 2R0WH 2V5RA 1AXTH 1ADQL 5CSZB 4B0MM 1RUQH 3DTXA 3GMOB 3RL1B 4WRLA 4X5WA 3HLAA 2BX5A 1UXWB 4O2CB 4JY5L 3BT2H 5LXGL 2F9BT 2XFXB 3G08A 4MAYC 1FZJA 2R23A 3P4MB 2MCPH 4UMGA 3DX9A 5I1GH 3QXAA 3BI9X 4PGEB 4UQ3B 4CN6A 2R15A 4R2GC 4UI2A 3VFVA 3K8MA 5D2NE 4LAQH 2FH6A 5SWZB 5JLZA 3CGTA 1VERA 4MD0B 1IGYA 4BQBA 5IR1B 2NZ9D 3S36X 1U8LB 4ZG1A 2DYPA 1T89A 4RX4A 3CMOL 1Q9WA 3VCLA 2O61B 3GNMH 5HD8C 3HRZB 4G80B 4ONGH 3GO1L 4HMDA 5B39G 1YEKL 1WJ3A 4P23A 1ZLSL 3ZTNH 1KENH 5E03A 2NY2C 3PQYA 4HV8A 4Q9BA 3PWVB 4FOMA 4JPWH 3GSXB 3P3YA 4G8IA 5HI5C 3O9WB 2IPTL 4Y7MA 2ZSVB 5EULV 3BZ4A 1CF8L 2AERT 1KACB 4QHMB 3D0LA 5DJ2A 1ZLUK 5IEKB 4HUWA 3WLWD 1WZLA 4M93B 1BBJA 3EGSA 3TA3C 4XCNA 2F5AH 4KI5C 4PRAA 3KPTA 4V1DD 5LVEA 1UJ3A 1BVKB 2CKBB 4M6NH 2OJZH 3TIDB 1P6AB 1MLCA 1C08A 4PBVC 2EE9A 5FGSA 4JRWA 5HHOE 1CVRA 2VXTL 3MJ9A 1UA6L 2AJVL 4PP1D 4BFEA 5JOPE 3ZYIA 4PR5B 1FIGL 1LWRA 2R1XA 1DANU 1JI2A 4FQJH 3G9VA 4C57C 5I8OL 5L2JA 5JW3L 5JIPA 3PDOA 1T1XB 1U8MB 4Y19E 3O3UN 4D3CL 3FRPA 3GB7A 3UC0L 4QNPE 1T04B 4PRPE 4BH8A 1NEZB 3SKOB 3WHE0 1VGKA 1YY8A 2IGFH 4S11A 1X4XA 2Z8VC 5I15H 4JE4B 3QEHB 5E70A 5KSBA 4I77H 1F8TH 1FORL 1H15A 1JGEA 5SWZE 1G6RB 1JNNH 3IKCB 4QRUB 1VENA 3BPNB 1FO0A 3T2NH 1U42A 4EN3B 2R2CA 3RAJL 2BSED 1GZQA 2NY6D 2VXQL 4NN5B 4MCZB 4QXTA 5HYJB 3O4LD 1T89C 1NAML 1U6AH 2XTJC 2YMXH 4PJIB 5GGTH 5GHWH 5AZ2L 2X41A 3LKQA 2CGRH 1PDKA 5CBAB 1AC6A 2XZQL 3L5XL 4HK3N 4P2OC 2DRUA 2YRLA 4XXCC 5DHVB 4IRSC 4JKKA 3JZ7A 1AJ7L 1KC5L 1ZLVH 1IAIH 1A9BA 2XWTA 4HUXA 4TVPH 3I6KA 4ZUUB 5KVGH 3ARBB 4HFWA 2Q8AH 3SHSA 1PSKL 1CFQA 2FGZA 3NVQA 5DF0A 5JUEL 4CUCA 3G6JB 1TNNA 2J5LC 5TH2B 1ZLWK 2ESVA 4LRIC 3ARDB 1N4XH 5CCKL 1Q9OA 3C5ZD 2YPLE 3C6SA 4LU5L 4H8WL 3CIQA 4AEFA 1CFVH 3MJ9L 1WAAE 2CK0H 4IOIB 3CDGB 2PTVA 4UT7L 1U92B 1AQKH 1N7MH 3QIWD 1OTSC 4HKBB 4XXDB 2JF1A 1H5BA 2QL1A 3HI5H 4LMQI 1UZ6F 3SE3C 3HPLA 1RURH 1D9KD 4KHTL 5KS9F 3V6FB 2EO9A 3RIAK 4CJ1A 1DBJL 5DFTA 3V0WH 1M05A 4OT1H 4WDIA 1BZ7A 3V6OA 4G42B 4GRLA 1EX0A 1QBML 5C3TA 5MP6H 3RA7L 2XKSA 3DJ9A 1JWSA 3MA9L 1OAZL 1CWVA 2Q76A 1LO2H 3TO4B 1F3DJ 2ADIB 2CR3A 4YK4C 5F7HA 2AJUL 3CH1B 3VFUA 2V17H 2ARJQ 5C9JA 4X7TB 3SCMC 3FAXA 1J7VR 3A6BH 3CLEL 1FLRL 3EDJA 4ESKA 2BVPA 1EGJA 2HJFB 3BVNB 3FQTA 3WFHA 1KJ2A 1OP3H 3WN5A 5C0IB 1B6UA 1QBAA 2EIZA 2VXSH 1CGYA 3DVNB 3LKQB 3QFDA 1JE6A 5ICXA 1VCAA 1NC4D 3QJFB 5D71L 5CJ5A 3ULUH 4WFHE 1GH7A 1YUHA 2AK4B 4IRJA 4OCWH 5EBMA 25C8H 1GZQB 4Y4FA 2UZIH 3KPNB 2IFFH 2Y6SD 1I8IB 4LVOB 2AJYL 1AXIB 4R96B 5B4MC 1VDGA 1GGBL 3O3DB 2FYYB 1X5XA 1B0RA 5DRZA 3C2SA 1HCVA 4OD3L 1LDSA 2ICCA 2GCYA 2UY6A 2X4RB 4Z7QF 3RZCA 4GRWB 1N5YH 2FZ3A 4WWKB 3U0PA 3IDYB 1SEQH 3EDFA 3IXTB 3MPCA 5I17B 1M7DB 1T83A 2PO6D 4X8JA 4D9QE 1J1OL 3KJ6L 1SJHA 3Q3GB 4PB0L 3IKKA 5CHNA 5EO0A 1MQ8A 3RL1A 1HH6A 4LVOC 1AQDB 2AJ3B 1W0WA 3P0YH 3GGWB 3S36H 3UTQA 4XMPH 5IFAH 1V05A 3PF2A 1EMTL 5F44A 2IG2L 3ZL4L 4KWUA 5BXFA 3H3KA 3RU8L 1FAKT 3RIFK 2DM4A 5C0AA 1JNHB 2Q1EA 3BGMA 4P9HL 2VDPH 4N0YL 2B0SL 2O61A 1IM9B 4QHUA 3QIWC 2DQGL 5DT1L 4N0UA 4PLJD 3FO9B 2MNUA 2HLAB 1QLFA 5HGBA 3FB5B 1GL4B 3HR5B 1BD2A 4U1MB 5KAQG 5FO7B 3LH2L 3OF6A 3WO4C 3ILPB 1FRGL 3BHBA 4MJ6B 1H15B 1VFBA 1ZGLA 2CDFB 3IF1A 5F7EL 3RKDC 3O8XB 5IWLC 3OKYA 4K3HA 5H8DA 3NACL 4Y5YA 5DK2B 5IHUH 4AG4H 4BJLA 3SDYL 2ZUSA 2QADC 2C4XA 4TSBL 1LO3L 1IEAB 2YD6A 3O2VL 4DW2L 1RUKH 3CVHB 3O4LE 4LNVA 2BC4B 3CVIL 5FF6A 3SE8H 3M17A 4U3CA 1U8QA 5KSBF 2R0KL 1R24B 2VAAB 3I2CH 1T22B 1JNJA 3LS4L 2VN4A 1AKJD 1NBYA 5DTFB 3MYZA 5BQ7A 5AAMA 4FNLH 3HB3C 1MQKH 3LKNB 3VFMB 1PY4A 4XC3H 5HYSG 4K7PH 1GGIH 4NNYA 4K55A 1S7UB 3OSKA 5FV2A 4KTEL 2MSPA 3VXOA 1LK2A 1ZSDA 3FAWA 1I7UB 4U31A 2AXFB 1ZT4A 3U9PL 4E41B 2XZCH 2EDYA 2V7HB 4WUUD 1T83C 5L2KA 1YC8A 5DUBA 4Y8AA 2Z35A 5I1LA 1X7QB 3NAAL 5I1CH 2C26A 2PXYA 2R1XB 1KPVB 1NUFA 4Q6IB 1FO0H 1CDYA 5FFLA 5JO5A 2QR0B 2HRPL 4TQEL 3UMTA 1ZTXL 4OCNC 4X5XB 4XAWL 3E6HA 2XKNA 1YPZA 2Q7YA 3OKOB 1Z9MA 1AHWA 4PJIA 2MPAH 1U8QB 3L3HA 5LAXB 2ATPA 4YWGH 4PP2B 3L95B 1YMMA 4RNRA 3LKRB 4OCRL 3Q0HA 4LIQE 4M00A 1BF2A 5KANG 4LRNL 1JGUL 2XT1B 5GGUB 4U7MA 4R0LA 4AEIH 4LLYB 2PTUA 5MENE 2BFVL 1EK3A 1PBYA 4BM7A 2PYFB 4ZTOL 3KPRA 1MIMH 3S9DB 5E9DA 4GH7B 3RVWC 4HEME 2HJKA 3F12A 1V7NL 2R0LH 3BO8A 3QUZB 4MAYA 4WW2B 2G60L 4Y16D 5D1ZD 1ROWA 2AEQH 2VUYA 1GJIA 2J8UF 2VL5A 1U95A 3B9KB 4H25B 4I4WA 1QQDA 5C0EA 3EYOB 2X9WA 2ZOLB 4L4TE 3BPCB 5IBUB 2AQ3A 3WNOA 3FO2A 4OLUH 1UWXK 4H8WC 4HPOH 3ULVF 3CXDL 4C56E 1MJ7L 4M1CD 1MHCA 5GGSY 2YK1H 1QPPA 4C58B 3ULVH 2XA8H 4ODTH 5TGBB 4U1IB 6FABH 3QULB 1BQHG 3PHOB 3KYKH 4GAJH 3RDTA 4X7SH 4EOWL 1T2QL 1XGTA 3ZDYE 1FZMB 2W07A 1IQDA 1KCRH 5HHVL 2XG4A 4JN1H 3ARYA 4G6JL 3IRZA 5MI0C 4K71B 4GMTH 4HX1B 1MCKA 4G6FD 3PABB 3OZ9H 3UO1H 2I9LB 5GS2H 4UINL 5C0BA 4Z77B 4P2RD 1FSKC 1AI1L 1LNUA 1MFNA 5LQBH 4CBPA 2IQAB 2FO1A 2VOTA 4U6VL 2YPKB 2R1YA 4XP9H 4JB9H 1CYGA 3CX5K 3ILQC 3BUYA 4KRMB 4U33A 2FBJL 5F7UA 4HIXL 4LSPH 1MNUL 2AJXH 3WIIH 2NX5D 3BQUB 3R4DA 2LAGB 1NJ9B 4CMHC 3KPOA 3J7HA 4OBRA 2EE3A 4N8VB 2EIZB 4HMCA 3FB7B 2CUMA 2HA1A 1JNLL 5JIHA 3JUZA 4PRPB 1MVUA 4UQ3A 4XVJH 1CDJA 3D3VE 2BY0A 1PKQE 3REVB 4OD1H 2P8LB 4O00A 2OR9L 4Y8DC 5I73B 3C09C 3DO7A 4O2CA 3S5LG 1RJLA 1G7QB 1CG9A 1F4YL 4HZLA 1FNHA 5IW3A 5I0DA 5FCSH 5DD0L 5J7CC 4O2FB 4PJXB 5EWIH 4XNYL 3VWKD 4ZUVB 3SQOL 3KPLB 4MQSB 1OTTC 1JNLH 5C0AB 1NUNB 3HPLB 1J0JA 4JKLA 2IADA 3RIAF 1IFHH 4BFGA 5ID0A 1MCOL 4KK5D 3MNWB 3S8WA 3P0YL 1FE8H 4QHKJ 1KNOB 4IIQA 2A1WL 1YEIL 5C09D 4LF3B 3TN0C 3QNXB 5DUBB 1U41A 2R69H 2XZCL 3CSGA 3TO4D 4PJXF 3FO0L 5FECA 1RZJH 5F9JA 4HJJL 2LE9A 3MRMB 4J2XA 3QNZA 3MRIA 4X6FA 1EBPA 1L6XA 1BOGB 4GQ9L 3SQOH 3GUTA 1MHEA 3UROR 5L88H 1ZE3C 2BXZA 5TF0A 2JIXB 2DWEA 2WP3O 4UUJA 3ROLA 1MY7A 3LPWA 4NQCA 4V2CB 5C0FA 3BZEA 3CFJB 2W92A 4ACPA 4NUJA 4NOBA 4S2SA 5TE6L 4M02A 4FZEH 4H26B 3KXFE 1X6LA 3DYMA 4PRIE 2H32H 2D4DA 5FF6B 1DBMH 1F5WA 4NDMA 4YXLH 4OCSL 5K9JH 4LDEB 3T65B 4AH2B 4NO0A 4IS6B 4FG6D 3LQZB 1S9VB 4K7PX 2YA1A 4OUUB 4OZ4A 2A9ML 5D4QA 1NLDL 3UTZA 1B4JH 4PY8I 3KWWB 3L3GA 5FCUH 2ZSVA 4Z95L 5J89A 1MJ7H 4HCRH 2VSDA 4HPOL 5HHMD 1I3GL 2Z31C 1SJVA 3HMXL 1DL7H 4TNVK 4LNRA 3EOYG 2R2BB 3V5KA 3WXWL 2FX8H 4NHUB 5ID1A 4JFHD 3QDGE 1N3NB 2AEQL 5CJBA 1IGJA 2IBZX 3SGJA 3UDWC 3VFNA 2BY1A 4K3EH 1XF4A 3QIBB 1SQ2N 5DJAA 5EORH 4ODVL 3WE6A 5KS9E 2DQJL 2DKUA 4FQXC 2XACC 4KH2A 4WJ5A 3KPMB 1MJUH 4NKMA 5IW6B 4ETQA 4XP4L 4M7ZB 4J1UA 4R3SA 1JGDB 2RIKA 5HYJE 4OI8A 5HDBE 1XGYH 4NWTL 4G7VH 1RZIA 1C12B 2KQMA 1NCBL 5DMGC 5LWYH 4JFEB 5DHYB 5DR5H 2YBRB 1J8KA 5J1TC 3GUTB 3HC0A 4M5YH 1BP3B 4L3CA 3HE6B 4EI5A 4NKOA 1OP5H 5I1HH 1HOCA 4PJ9B 4UIMA 5ICZB 3G08B 4MDIA 5FYJH 5DQJA 1NCUA 1QEWA 2ZCKL 3STZB 3GJEA 5EA0H 4ZUUA 2PR4L 1FO0L 1CICB 1T22A 2ARWA 1PGRB 2P8PB 1AD0B 2DLEA 4XNZB 5C0DA 3U2SA 2X4PA 1RZGA 4P99A 1PLGH 1OPGH 1E27B 2L4OA 3U1SH 3QNYA 3ZKMC 4AQOA 1Q0XH 2ESVE 1KJVB 3IB4A 1F45A 2H2SD 5EZLB 4ODWA 5ERWA 3INUH 3BKCL 5HI4C 4PJ5A 5EU7C 1RIVL 2NXYD 2X6MA 4WWKC 4X99B 4D9QD 1TJIL 3A67H 32C2A 1AKJB 4PJ5E 1HQRB 2ILLA 4WU7A 5F21B 3DO7B 4HLZH 5GZNC 1CXIA 4NKQB 4JM2F 1X3DA 2P5WD 4PJ7E 4QT5B 3KYOB 1LP9B 4D9RD 2AI0L 3GMQB 1XMWA 3UCRA 4JHAL 4UT9L 3MNVA 5IW1A 1NCDL 1BBDH 1P5UA 2W91A 5ISZD 4QRRD 1AXSA 3RX7A 4O51A 4B7IA 3WEXB 5I8KH 5TDPA 2P4AB 4BZYA 2AXGA 5DA4A 4UIKH 5F7DB 3K81A 1PAMA 3OKEB 1AGEA 1QO3A 3ET9F 4XXCA 2BVPB 3BVNA 3GMRA 3TT3L 4PRDB 4F8QA 3O2DL 3FJTA 2A6IB 4J12A 4F7PA 1TMCB 5DHXB 5HDLA 4P5MB 2IPUK 2V9QA 1LEKB 4RAUB 2JB5L 3N9GL 5L88L 1EVTC 1GHFH 4FFVC 4OZGA 2A77H 3LV3B 2WWKT 3UJJH 1CF8H 5CP7A 2EDNA 3HG1B 5C8JA 1OGTB 1TZIB 5H94B 4PRHD 3FB6A 4YK4B 2HWZL 4XMLH 4U1GC 4HPYH 5C08D 3BQUA 5IVXF 2IAMD 3VXSA 4X6BB 3F7YB 3RWGB 1ORQB 1BEYL 2XZQH 2VWEE 3L5XH 4XB8A 4Z7OE 5DLMH 2ICWI 4UNUA 3GJEB 4F15B 4JEGB 4HJ0D 4X6EB 2FO4B 3QG7L 1GIGL 4XX1G 3PG2A 2E6PA 3MMEA 3T3MF 3HZKB 2VZOA 4OI9A 1LNUB 4AMKH 2VXQH 5FYLH 2ADJB 1A3RH 3TA3A 1G7QA 1TJGL 1UEYA 2HYMA 2CMRL 1ZHKA 3STLA 1OARL 4ZFZA 4QWWD 3F7PC 5D7SH 1UH4A 1Z9LA 3GKWL 1LVEA 2MCPL 5ALCL 1FV1B 2ZCHL 1UC6A 2E9IA 4IRSD 1AO7A 5B38B 3RJDA 2FSEA 4R6UA 3IDXH 3HS0B 4JJHA 2LU3A 5FYLD 4OKVB 5C09A 5I8OH 3B2VL 1C5BL 3EO0A 5F6IC 3LDBB 1FFNA 1YEHH 3TM6A 1JVKA 4OGZA 1UM6L 1QKZL 1A47A 1LHZA 3TNMB 1JTOA 4UDUA 2Z31A 4LOUC 5TQ2H 3AY4A 1N5YL 1HHHA 3HAEH 2NZIA 1MRFL 3REVA 3SN6N 1ODAA 1XIWC 1H8SA 2M2DA 3MRHB 4GBXC 2X4SA 2X89A 3AAZA 1P1ZA 5BJTB 4JO3H 1OSPL 4PS4H 3ZYOA 1S78C 5EIVA 4EZMA 4I9WE 1HXYA 5C7XH 1Q0YH 3HB3D 3VW3L 1MCQA 3IDYC 4ZNCD 5KSBE 4H20H 4Z0XB 3NABL 4JR9H 1HQ4A 2HTLD 4ZYKA 3MX0A 4RGOL 4S1QH 2IPTH 3RP1A 5D71H 3LKNA 4LVHB 2D9QB 2DB8A 4JN1L 3TC9A 1HH9B 2Y4SA 1JHTA 3P30L 3EZ8A 4P4KC 4FRWA 1OAQL 1JZ4A 2ICEB 3QDJD 5TQ0H 3GO1H 3QHFL 2H9GA 2OTUB 3PWJA 3WFEH 4HIJA 4L4TA 3EOAB 3O3AB 4JRXA 5IIEA 3K74B 2VH5H 5FECB 3LPGA 1R0AL 3OG4B 1K4CB 5C0AD 3ZHKA 3FB8A 3MGAA 3P4NA 2WBKA 1WITA 4POUB 2GITB 4JZOA 2WWMC 3MJ8A 4G8GD 4HD9A 4Q6IC 4IIQB 3O2WH 2F19H 4NQDD 4WHDA 5J1AB 3MV8D 3FN0H 5HDQH 5LAXA 4U1HA 2YMXL 5GHWL 1B0RB 3C5ZC 3NCJH 2COQA 4UAOB 3R0MA 2B8OT 1TTFA 3CFKB 5C1MB 5ANMA 1MLBB 2QSVA 3BT2L 4JY5H 1OCWH 4XRCA 5EOTB 5LXGH 3VCLB 4LCWD 1JNNL 1IKFH 2J8HA 3GK8L 2JIXD 4XPTH 2NY0C 2EIBA 4UOJA 2ZJSL 5EO0B 4NT6B 3V9FA 2VLLB 5IBTH 5EU7E 4P57A 4K3JL 1C08B 43CAA 4KVCH 2VITB 4NZUH 4QTIL 3R8QA 5FYJE 4DQOH 3B9DA 4L1HA 1UWGL 2RCSH 5DJ0B 3QRFM 3QQ4B 4HUNB 5JW3H 3DX9B 5TQ0L 3ZE1E 3S98A 2OSLB 5M7QA 5DO2D 2XZZA 3HAEG 2BNQA 4S1DD 2OR8A 4ZFOA 3VFSB 4PY7A 3C2AL 4G6ML 4Q7DA 3O8XC 5D72L 5T3ZD 5IMLB 4QTHA 5EZIL 1S7VB 5CWSB 2PTTA 4Y5VB 1OQOA 2I60L 5FUOL 3ZE1F 3CFDB 4K2UL 1FGVL 2W9EL 4KJWC 5SWSE 4F9LA 5EOTA 5JZ7C 1HXYB 3ES6A 5JORA 4G8GA 1FSKB 4PTUB 3UJIL 4M4RA 1SY6H 3MV01 5I66A 1CDHA 1JZ7A 3VFTB 1I7RA 5GRVK 3JWOL 4X7CC 2OMNA 3DIFA 1Y18B 5E6IC 4ZNEA 1KCUH 4I8DA 1A6VH 4Z0BH 5HGDB 4XHJD 1AH1A 2XWJA 1WSST 4GW1B 3WSQH 5D1XC 3CVHA 2QHRL 3GJFB 4PB9L 4H1LA 4WHCA 5HDBF 1ZA3A 4PGDA 1OGAA 1NMCC 1LEGB 3O4OC 3EYSL 4JPIA 3BUTA 5IIEB 1C16A 4G6AD 4IBLT 4WO4B 1SBSH 1I7ZA 1KEML 2QADD 4ZUSA 3D2UA 2X1OA 2EDDA 4HIHB 4NZDA 5TFSH 3O6FA 3BEVA 1HHGB 3OB0K 4EVNB 1BD2B 1TZGH 1A1OA 4AT6B 4B5EA 1VPOL 4R26L 3C87A 2V5SA 3AXLA 5F8QC 4M62L 4BUGA 4ZSOB 4TSCH 3HI6L 4NKDB 3BWAB 3WS3B 3G6AB 2F74B 2WBJA 1CFTB 3DGGA 3KLAB 1F6LL 4OZGB 5D9SA 2WUBL 4TUOB 4F37F 4XXDA 4GQPH 4X6EA 2JTDA 3JVGA 1ZA3B 1P4BH 3DSFL 3K4ZA 1X44A 1J0HA 1FG2B 3OHXA 1N2RB 1QFPA 1JFQL 3QDGD 1U8KB 3MZGB 4OLZH 4O5LL 4FABL 1NC2A 3ELAT 1FFPA 5D2NB 2NXYB 4KQ3H 4JO2L 4WU5A 2AKRB 5D70H 3M17B 3UTTE 4PLOB 4K9EL 4L9DA 4KDVA 1MFBH 1A6ZA 1WCBA 2BRRL 2ZP0T 5HGHB 1Y6KR 2VZSA 1I85A 5D7KD 5HYQB 3PL6A 2Q7NA 4Y5VA 1BQHB 1FGNH 1NL0H 4HZLB 2XTJD 4H88H 3IT8D 4IIQC 4NHCL 4NWUL 3EYQD 3GSQB 3QH3A 4IMKC 3L5WA 4OCYL 3MRNA 1LO0H 5JHDB 2Z35B 2AS5M 4KUCF 4D8PB 3B83A 4M9PA 4KPHH 2ADIA 3HG1A 4YDIL 3DETD 1A5FH 4LLUA 5IBLD 4OM1L 4OLVH 3UBXA 3TWCH 4I0PD 4MNGA 4FMFA 3C9NA 4E5XB 4TULH 2ZOKA 4Z76B 2IAMA 1NC2B 1CDIA 3P40A 4ZXBA 2JJWA 3GIZL 2XQYG 2N7BA 5A16B 3RTQA 2FH8A 4NCDA 1PY9A 3QUKB 1JF5A 1MCLA 1VB9A 4QRTA 3SKNA 1OSZB 4IDJH 2GIYA 4YBLB 5JDSA 1JV5A 3MA9H 2H45A 4KV5E 3V0VA 1QBMH 4Q0XL 3TPUA 4GXUN 3V0WL 1NGWA 3C08L 1YN7B 3EHBC 1J0KA 4PJFF 4QHNA 4ZO7A 4R97C 4P2QE 3V5KB 4CNIB 3TN0A 3NTCH 1U92A 3S35L 4UDTB 4P2OB 4YDKH 1CFVL 1PG7H 4I3GA 1CDGA 3DRTB 2HFFB 3ZZ1A 4ZFFB 1DBAH 2VLKB 4GAFB 2FJFB 2JCCA 3TV3L 4YHML 4XWGH 3TVMB 3VD4A 4F37K 4FP8L 4NKMB 1VFUA 1NMAH 1QLFB 4A6YA 1INDH 1XH3A 3TWCL 4EDWL 4ONOA 4KJYA 3CUPA 4K9EC 3STZA 2NW3B 3PIQB 1N6VA 5BO1L 3WXVL 1RU9H 3MV9A 3GEWB 3H7BA 3DUSA 2IH1A 3QQ9C 1LO0L 5KSAD 2NLJB 5DHVA 1ZHLA 3GSXA 4G8IB 5D1QA 5GGRB 1Z3GL 1CD8A 5ETUB 2P7TB 5J8OA 2P8MB 2CXKA 4NBZB 4KDTA 2XPGA 1EA9C 5C0ND 3T0AA 1RZFL 3VWJD 1G0DA 5I8CB 5HPOA 5J13C 4RFNB 1Q1JH 1HCFX 1LD9B 5DZNA 4CNIA 4LLWB 1BJ1H 1S5HB 1C16B 2XWBA 4MMZC 3HE7D 4EIZC 4GKNB 2FX7H 4JM2D 4KKCD 3ULSA 1XGPB 1WIUA 3OB8A 4JLRB 5I1IL 4FN0A 1VKXB 1YDPB 1VSCA 2YD3A 1CLYH 5C0GB 1UM4H 4HH9A 1IEBB 3BPOC 4AT6A 3K2UH 3MV11 1JZ5A 3L9RB 5IB4A 1T1YB 2P5EA 4HCRL 1F00I 3CPLB 4NJAH 2AEWA 4OIAA 4GG8A 3DUSB 4DEPB 2WUBH 3AM8A 3O9WC 3ZDXE 2ZCHH 4WFFE 2B1AL 1YEFL 5D6CB 2LABA 5EO9B 5L0QC 1OARH 1MFCL 3GDBA 3Q6GL 4WTXA 5JO5B 3D39B 1XF3B 4R0LC 2FRGP 5IMLA 4YXHH 3S37H 3QDJB 5FM5M 3RBGA 4PJ7A 1T1ZB 4JRYD 1OAYH 1RUAL 5MEND 1CLOL 2OXHA 4OB5H 1YNTA 4ZUWB 3PDDA 4PD4J 2LU4A 4QHNB 3QXWA 5CEZE 4N90E 4WI7A 5FM4A 5KANI 2EDHA 4D0CB 1P4IH 1KSRA 4W4OC 1GSMA 4FTVE 3QCTH 5HGHA 1PKQA 3OKLB 4X6DA 4KI1A 4NQXB 2DTSA 3CZJA 2PXYC 4JFFA 4YEEA 4GKZA 1T7ZA 5B3JF 4KTYA 1WUNT 3D9AH 1U8NA 5EDXA 2IMMA 3WSQL 5J4MA 3VXQA 3ETBF 3QT2A 5ADPH 1HKLL 1BIIA 5IVZA 5E24E 5D2LA 4F58H 2CKNA 1F02I 1OW0C 2Z4QB 1JPST 4OQTA 5F89A 2J8UE 5JIKA 1XR9A 2RGSA 4OSUL 1FVDA 3OWEA 4GW5B 1QSED 1CGTA 1FCCA 4XP6L 3PWPD 3UTSE 5JMOC 3E2HC 5HD8D 1EFQA 4P46D 3O2DH 4UV7L 1MCNA 5KSVA 1ZV5A 1BOYA 4U1IA 3B43A 1T0NB 3L3DA 2Z93A 3JTTB 3VXSE 3LHPH 4RMTA 2JB6A 3I9GL 1FNGA 1JPFA 4MA8H 4QY8B 2R2HB 1KN2L 3B6SB 1FZMA 1I7RB 3HN3A 5J6GA 3PQYB 4FXGB 1K85A 2OR9H 4HKJA 2WM0A 3AREB 4AZ8A 4BELD 1YA5A 3E6HB 1TVHB 3PV6A 4DFIA 3IU3B 2EXWD 4PB9H 2QHRH 5H2BA 3SDXA 3ZKXC 3A6CL 4LCUA 2R4RL 4JZNB 2PXYB 4NGHH 1TLKA 2KH2B 4NRZA 1TVDA 2H32A 3KXFA 5D6DA 5HVHB 4WU5B 3DX8B 5ACZB 4YHPA 5DVLA 1RPQA 1RVFL 1JYWA 5IG7B 2DYPD 1IQWL 5A40E 4OIIH 4PJEE 1A6TB 1ZHNB 4XZUA 5ALBH 1JZ2A 3IDIB 3B2UD 4BKLA 3M1BB 3MCKB 1PZUB 1EHAA 4OGXH 2QQLL 2HTLC 1IBGL 1J1PH 4DKDC 1ETZA 4D9LH 1UACL 3C2AH 4R0LB 3VDBA 1IRAY 3PP3H 1Z3GH 3DARA 3U82B 1K8DA 4TTDC 3CMGA 1LDPH 5BS0A 4PTTB 4YQXL 3NIGE 3H9SB 4ELKB 4YHNB 1ERNA 2CSPA 3AVEA 5GGVL 5IFHH 2EXYD 3ZYZA 3V7AG 1BD2D 4I4WB 1XIWD 3MNVB 4BSWA 3E3QC 4LCIH 4P2QA 3VFGL 4ZXBD 5DFWH 3H3PH 1P4LA 3CFCH 4OGAD 4S1QL 1LE9B 2AJZA 4Y4FC 3WUWA 1PG7X 3WFCH 3MODL 4CMMB 1Z0NA 3DX7B 2A2QT 4XCEA 4YZFE 5M95B 2J4WL 4Z7UA 4H0GA 4PS4L 4U6HB 1CFNA 4NM8H 1DVFC 3IGAA 2XN9A 3OKOA 5C0NC 3HPJA 4QRSA 4N1HB 4LSSH 4PPTA 5DD5H 3MO1A 1XF2B 2FX8L 4JJ5A 4LASL 1CDUA 4YHNA 2R2HA 2B4CC 3Q6FB 3RFZC 1J12A 5EBWA 1IQWH 5JPNA 1IZKA 1SHMA 1NLDH 5DMKB 3BHBB 4Z8FH 4R4NC 4U6XB 3PGCA 2VQTA 1Q9OB 2D31A 4KI5F 3H9HB 3OB0H 2XTJB 5DMGD 1DQTA 2GYSA 2SEBB 3DUUA 4OLWH 3QCUL 4Y4FD 3ARQA 5BRZA 3SE4C 3P30H 5H2BB 3AS3A 2VC2L 2KUTA 2C1PA 3F5WA 5CLTA 2EDLA 3TZVD 5KSAA 2VDQL 4HS6A 2OX5A 2ZZUT 1QSFB 4M1GL 3EOTL 2CMRH 4LPUA 2EXYC 1RMFL 2DQUL 2GHWB 3K8KA 2ITDB 4IRJC 3RNQB 4ELKA 2EYSB 3I9GH 2C1OA 3ARGD 1NGZA 3DV6B 3W39B 3BDBA 3MV8A 4AQ1B 1GPOL 4X6CA 2CIIB 4OZHF 1MLBA 4GAYB 3BP6B 3O6LH 1CD0A 3SDAA 3RPKA 5TQ2L 2N56A 4LNRB 1C5DB 5IGXL 3FFCD 3QO0B 4HBCL 4CDHA 4J8RB 4I13B 2Q20A 3TBWA 3I75B 4FG6C 1MCFA 5DJZB 1XZ0B 3WLBA 3X12B 2V7HA 5B38G 4LVEA 4R8WH 5C9KA 4N8VG 1L0QA 5IK3B 3GRWL 3L3KA 5GISH 5IBLC 5DI8A 3TH2T 4X80H 4IOSD 2FL5A 4WJ5B 4RBPH 3CX5J 1MFEL 4XNUL 1BAFH 1HN1A 1J1XH 2MOVA 4W6XB 1ZGLM 4D9RE 2JJSA 4NRXA 1Z0MA 1MAMH 4Z7OF 1RZIB 4Y4KA 2WK2A 2BRQA 3O41A 2DJUA 3SPVA 2F54B 5ILTL 3SCMB 3L7FA 3T8XA 3OJ2C 3P9LB 3MSPA 4J4PC 1U8NB 1WWAX 4M8QA 4PGBA 4U1NA 3VFPB 1FL3B 1O7SA 3DRQA 4OQTH 1MVUB 1FAIH 4PJHE 2JK5B 3EGSB 1RK0B 3MYJB 1XR9B 4O9HH 2AI0H 4YHYB 4XNUH 3OR6B 1KLUB 3MLRL 4J6RH 2D7PA 2UWEA 4NM4L 4X0KB 2HFEB 2BNRE 3MR9A 3HE7B 4LSPL 2DI9A 2OYPA 2J6EA 3VD7A 4U1SB 4Z7QE 1YYMH 4WTZG 5GPRA 1NFDE 4AEHL 3QHZL 3OAZH 2HJLB 1BM3H 4HIEB 1P4IL 2IPKA 1IILE 4HUUB 4UZGA 1ZK9A 3HZVA 1MWAH 5F1IB 1YMHB 5CGTA 5F9WB 4GXVL 1A14H 1HSBA 3V6ZB 3NFSH 5IMKA 3RBSA 1AGBB 1TZHB 3FQUA 5IJVA 2ENYA 4M7LL 1CLOH 2XKUA 4LCCB 3RWDB 2AJZB 2B2XL 4JFYA 4POYA 5KSBB 1QRNB 4Y5XB 4PRNA 4N68A 1V3JA 1GGUA 4ENEC 2QQKL 2O5XH 2DM3A 4K8RL 2ED9A 4X6FB 1ZHLB 2X5PA 4OCLC 5HVFB 2ESVB 3OL2A 2NY2B 1TJHH 4YE4L 4YDVA 4LPYA 3W9DB 4ZS6D 2ITCB 3HMWL 4HS3A 2O5ZL 1T80A 1QLEH 1RZ8B 1YNLH 5D1XB 3MRNB 4J7RA 4RMWA 5E6ID 1MCRA 3BD3A 1I1AB 4G3YH 3EAKA 4ELME 5CMAA 3OQ3B 1QNZH 1DQJB 3E1F1 3ME0A 1YECH 2NY7H 4XPFH 3T4AB 5IROC 4OZFG 4PJFA 1HE7A 1IAIM 5I1DB 1JK8A 3JWOC 3QDGA 4RCAA 4ODXA 2X70B 5TH2A 2P5WE 5AYQA 1DFBL 5AG9A 4L3ED 2HTKC 4X7EC 3S34L 2DI8A 3HE6C 1J87A 1ZLWH 1KT2A 3WFZA 3BAEH 4ZAKD 2VZVA 3AB0B 1T5WA 5C9JB 1LE9A 5I30L 3NGBC 2UZXB 5HGDA 4U1SA 2V2XA 4XT1C 4P46B 2D7QA 4NYLA 1UCBH 2VO5A 2H8PB 2BOCB 4O2EB 4F57H 1XT5A 3FO1A 4ZUVA 3RZCC 2QQNL 4WDIB 1MVFA 4G9FD 4LCIL 3QEQA 3UYRL 3T0ED 3QUXC 1MCPH 5ESVB 3QNZB 3DMMA 3MACL 4NQEE 1ACZA 3GSRA 5DXWA 3MRGB 4Y4KD 4QRTB 4HKBA 3BPLB 3KYOA 1GC1C 3AS0A 1PD6A 1IC4L 4WFFD 5DHYA 5C7XL 1LDPL 2VLJB 5F3HB 1UADC 5EBGA 3KYAA 4KJPD 3M1BA 2GI7A 3QPQD 4XP5L 3T0EC 1U95B 3B9KA 3HI1B 5F1NA 2DBJA 1BZ9B 2GFBA 3GMLA 3O9WA 5J11C 2QQLH 1S7TA 4LLDB 2MMXA 5CJQH 1NGWB 1QD0A 4JG0H 1FFQA 4ALAL 1YEJH 2CRYA 4PTUA 3D0LB 5DJ2B 3T65A 3CLFL 3I6GA 3WDJA 1P2CA 3QRGH 2R29H 2QSCL 4HFWB 4YPJA 5D8JH 3SDCB 2BSRB 1A7QH 2I25N 1HI6B 4FFYL 1H0DA 3V0AC 4FQPA 2A74B 3DMMC 3L7FB 1G0XA 5FIEA 3LN5B 4H26A 4LPCA 1GC1H 4DZ8B 4GS7B 4BSWB 2C5DC 1INEL 2VDNH 3MLYL 1Z5LB 2DIBA 4XTRD 1FAIL 4LEXL 4KZEH 2YEZA 4XNQB 3SE4A 5GGSB 3F5WB 3RPIB 5A2IH 3RWIB 4TTGA 3B5GA 1TTGA 3SDAB 3MRJA 3G6JA 2I07A 1GZPB 2BERA 4OCXL 1S9XA 3OXRB 4OCYH 3MNZA 4OF7A 3PP4L 3GHBH 4CJ0A 1I1AC 4Y88A 5HYIA 2D7OA 4APQD 1XR8A 3MLSH 4L4TB 2VDPL 3GI8H 3O3EB 4N0YH 3V4UL 5D96C 5GGRY 1DQQB 1IM3B 4LEXH 4KZEL 4L8SC 1A7NL 4W70A 5JW4Q 3OX8B 1XF4B 3BSZL 3T2PA 4EBQL 3DMMD 3JV4B 3DX6B 3QISA 2MQCA 2XICA 5LCVH 2YD5A 1ORSA 5T1LD 1GC1L 2FD6L 3VJ6A 1NBQA 4ODUB 5K93A 3EO0B 2SEBA 3DUUB 1Q8MA 1EO7A 5DDHA 3SGEH 3QIUA 5JPMA 3UTSB 4CVXA 3U6RB 3H9ZA 2P5ED 4XVTL 1A6VL 1P4BL 3DSFH 4Z0BL 2BVYA 2DWDB 4ZS7H 4Y5YC 1I3RB 3AC0A 5I73C 4F8TA 2MQ3A 1DEEA 4POZD 1CDCA 3SJVD 1CZ8H 1EO8H 3QDJA 4K71C 4E41A 4NQCD 4JPKL 5CJXC 3TNMA 4UINH 4OB5L 5EO1B 3TT3H 4OV5B 4L8SB 5ISZE 1AGFB 1UH3A 2X42A 4CU6A 5DUML 1I9IL 1ADQA 4RWHA 4HJ0C 4IRJB 2DKMA 4YBQD 2WZPD 1DANT 4F15C 3FHAA 5IV2A 3O6FB 4JFPA 1I9JH 2NXZB 3KPPA 3QCVL 1JHTB 1X5ZA 3QI9C 5JA8B 3ARGB 1QPXA 2QHLA 1G9NH 2IAMC 1IT9L 2VLJE 1MCHA 3VG0H 3SGKC 3MRPB 2GTWB 1A6AA 1FNGB 4HK0B 3BPOB 2VITA 1HNFA 3QA3B 4KK6C 4JFDD 1HIML 1ZT4B 3FB8B 4NNXB 3CK0L 1QSEA 4JQVC 5TDOA 1U2CA 3D18B 3EYVB 4G9DB 4AL8H 4RX4D 2EC9T 2XXCB 3ZHLA 3CXHK 4U2YA 1TQCC 2R0LL 1LD9A 3SEPA 3ZE0E 4DN4H 4EXKA 3O45A 3PHOA 4JGUA 3LN4B 4WGWB 3NCJL 2CLZA 3DWTA 4BK4A 4K2UH 3IDMB 2R1WB 5CJ8A 3MODH 1A3LL 3NFPA 4LHUB 3D2UD 1MHCB 2EDXA 1MHPH 1C1EH 3FO9A 2F53D 2B1HL 5MERA 1OF2B 4MCYB 2R4SH 3D39E 3VFGH 3GSUA 4JFXA 4QF1A 4X7SL 1A9EB 1N4XL 1NDMA 4F57L 1OP9A 3OTTA 4MQXC 5FYJL 2XN9E 3CPLA 4HK0A 4YE4H 4GJTB 1S7TB 3QDAA 2EEAA 4PYHA 5C0CB 1UXSB 1RJYA 1MRCL 1PKOA 4R4FL 3C6LD 1V5JA 1RD6A 4ZOCA 3GK8H 3I50L 4XCCH 1YNKL 3FQRA 2E3VA 1INQB 5CIPH 5TF1H 2OL3H 3I6LE 3U7YL 4ONHA 2RBLA 3MCKA 3RVTD 3H6JA 3LDBC 4L8CA 1E4JA 3U4EB 4TVPD 4E9LA 3FFCE 3T2NL 4R4ND 4FQ2L 4ZDHB 4OZFA 1KTLB 2XQBH 3FONA 4P9HC 2EIEA 4Q0XH 3WIHH 2A6JB 4LRNH 3SE8L 2OXGA 4JN2B 2DTMH 1U93A 5JIIA 2GITA 3QO1A 4JZOB 5KSAC 1YNLL 4JDZA 3B3IA 1ZSDB 2DJ4A 4J3TA 2OQJA 2VH5L 3NA4A 3HR5A 5INCB 3ORJA 3C8KA 3TO2B 1A6AB 3L95A 3P73A 5EBLB 1N64H 1MREH 3V4VL 3MZTA 2WV3A 2LQRA 1DZBA 3MLXH 3T0EA 4HAGA 2FJHA 4OM1H 2X1PA 4P5TD 2BSSB 2GK2A 5FHBL 5HYJD 1M1SA 2KBGA 4PJ8C 2CDGB 2NY3B 3LH2H 1HHGA 3MJGX 5DUMH 3GSVA 3LAFA 1UT9A 1DSFH 3U0WH 1GAFH 1M7IB 5D1ZA 5JXAH 2FEEI 2B4CH 1KLUA 5E6IB 3CC5B 3FRUA 4TNVF 1CZ8L 8FABA 1NL0L 5FYLL 1J5OL 2B0SH 32C2B 1UGNA 2NY4B 2FZ3B 4WWKA 3U0PB 2W0KA 5SWSA 1BMGA 1FNSH 2V2WA 4LCCC 3JWNC 3LEXA 2K7QA 4PJCA 1QP1A 3KPQB 1HKLH 4XMPL 5IFAL 3QNXA 3MGOB 5E1AB 5DRXB 4XPAH 2G75A 1YEIH 2A1WH 2ZOKB 4I3RH 4Z76A 1ZXQA 3Q5YA 1LO3H 3X14A 2UWEF 1H3VA 4O9HL 1EEUA 4ODHL 4OZIE 1MCOH 3C5ZB 5FA3A 3ZE2F 5IHUL 5ESVA 5LCVL 4EUPA 3VFRB 3REWB 4PJ8D 4PJHA 4RGNB 1LEIB 2VXVH 3QIWB 3VXRD 4MXVF 4R90H 1NCCL 4U1LA 3PXHA 1DN0B 3PXJA 5F7WC 5ALCH 4OZIF 1C5CL 1BQHA 4KI5D 4P4RB 3RVUD 1FFPB 5D2NA 2B4CL 4MSWA 1G6RL 2WINA 5JXAL 3FFDA 4G9FB 2CDFA 1WLHA 4YXKH 1YEEH 2VXUH 2CKBA 4XHQA 3HCVA 5KSUA 1JI1A 1BAFL 5L0QB 5DA0B 5IT2L 5CFHA 5INDB 4P57B 1L6ZA 5FOBA 3D48R 4XWOC 5D6DC 1KTDB 4MXWH 5ACMA 1BWWA 1XH3B 3CDYA 3GSQA 3QH3B 2YPVL 1MPAH 1N8ZA 3TPKA 2R2BA 2AJXL 3QUKA 5A1AA 3QI9B 4DZBA 3PHQB 3SKOA 5KBNC 1BFVL 5C2BL 2AK4D 4RBPK 4JFFB 4GBXA 4OD3H 1IEAA 2E7CA 5K9QG 1A6UL 2C3XA 3C8HA 5IFJA 1DE4A 3IS1X 1NH6A 3GMNB 2XG5A 1MELA 1SY6L 4HDIA 1U8LA 2JB5H 1Z2KA 3U7YH 3RTQD 15C8L 1IC1A 2UWEE 4P3DB 3FT3A 1QHOA 2BNRA 2XN9D 4GKOA 1RUML 3PDGA 1QSEE 4Q6YA 3MJ9H 4XCCL 5E56A 2AV1A 3WXVH 4L5FL 1UJ3B 3NCYS 1Y18A 5C92A 1LILA 1UZ8A 1I85C 2PO6B 1S9VA 1VACA 2K7PA 3H9HA 3GIVB 1KTDA 3U30B 3ZKNC 3VA6A 4YHMH 1UXWA 3TV3H 3RUGF 5EZJB 2HRLA 3NPZB 35C8H 3QPXL 4L4TD 4PRHA 1S9WA 3KLDA 1ZKAA 3MRLB 4J4PA 1WK0A 2DLGA 4ZO6A 5F7FA 4K3GA 3RL2B 4WHTB 3VRLE 2A0LD 3LEYH 4HF5H 2ZJSH 4J23A 2WIIA 3IYLW 1IM9D 2DQHL 4MJID 1TQBC 3PJSA 5GZND 3LQAL 2HT3C 3C9NB 4E5XA 5L8JB 1NGXB 1U8PA 2R2EA 3BKCH 4HQQL 3UTSD 1DBKH 1ZT7B 3G5XA 4Y1AE 5E8PA 2CRIA 2JELL 4JG1L 5T1DH 5TF1L 5HY9B 1YECL 4ELMA 2ERJC 4URTB 1OHQA 5I9QC 1G1CA 1H8NA 3AU1A 3SJVB 1FN4A 4GRWH 5D7LD 4V1DE 5E2VH 1A4KA 1I3GH 1OLLA 2HLFD 2VE6A 2DDQH 2H9GB 2OTUA 3KLHD 3HS0A 4MNQB 2IANE 1QLEL 3K46A 2G9HA 2XFXA 35C8L 4X4MA 4P59H 5T3ZH 1A5FL 1CE6A 2A83A 2A9MH 4XAWH 2HKHL 3RVTC 2AGJL 2N7AA 4QXTB 1JN6A 5HYJA 1UZ6E 1YC7A 4ZO9A 3K8LA 4ISVB 1HXMB 4C56A 3L1OL 2DQEH 4NO3A 5JA9A 2HFFA 1NCBH 5GS0L 3DOSA 1C1EL 4OGXL 4DUWA 4YJZL 2CGRL 1LK3L 3HMXA 2XY2A 1A3LH 4H20L 3IU4H 4ZQKB 3IU3A 4N5ED 1U6AL 4R4BB 1U3HB 4E41D 1TQBB 4WUUB 1SYSA 3AFLA 4GLRI 4FXLA 2ZWLT 4KDTC 4ZUTA 2F8OA 4RZCB 1IGJB 2BCKA 2YC1B 2VLLA 3GRWA 3VFWB 4RMVA 4MQXD 4ZS7L 5GRYA 3V6FA 2FLBT 1E28A 2IQAA 4YDLB 1FFOB 1W72B 5DK3A 2X05A 5DK0B 5IJKC 4ZNEE 3B3IB 5DZOA 1ZVSA 1BLNA 4MB5A 3T04D 4KDWA 5EOQL 5C0FB 3BZEB 3S3JA 1ZLSH 3O3BA 1J0IA 3SDYH 1XEDA 1F6AA 1F4HA 5J9PA 3NFNB 1YPZF 4NCC2 1G9NL 4GG6A 2F53B 3IDGA 3CZFA 4XCNB 3IJSA 2ZUYA 3OJDB 4OFDA 3CSYA 3DROA 4M62H 1CVSC 3GI8L 1MFDH 2E9BA 5FO9B 4PRDA 2NYYC 4QGTA 3O6KL 3VXOB 3NIGF 2LVCA 4U1MA 1S5IH 2VXUL 3DHJA 4XMKH 1RZKC 1M7IA 5D1ZB 1G9EA 3P9LA 3B9KD 4JY4B 1JZ3A 3P0GB 5TE6H 4KK6D 3BKJH 3MBXH 3LD8B 4OKDA 4Z7WF 3C6LB 3HUJE 3D3VA 3GM0A 4PLKC 5DEFB 1PJ9A 3WKNA 1Z6JT 5FGBC 4Q2ZA 5E8NB 2JJTA 5DK0A 4B7LA 5EPMA 4Q9QL 1FN4B 3RWEB 3TZVC 4P5TC 4JFDE 4LSVH 4JREC 4Z5RA 3OKMB 4LKXB 3DVGA 1FL5A 5IVNA 4HUVB 3JWOH 4TNWK 5I71C 3VMNA 1AKJA 4KAQH 3FOLA 2NW2A 2YPLB 5DD3H 3CSYB 3DROB 3VWKA 5J6HB 3WUZA 1KXTB 5DURD 3MNWA 2R29L 4EBQH 4EQ2A 2DD8L 4NSKA 4OQ1A 5I1DA 2GK0B 4YAQA 2IH3B 1FPTL 3TP4A 4LSRL 2FYYA 5HGAB 2WMPA 4QF1B 5FYLE 3U6RA 3UTSA 2BVOB 4W6YB 3NH7H 3UDWA 4ZD3L 3RVVC 4YXHL 1U8IB 1FZOA 5DRNA 4PV8B 1P7HL 5HHQA 1T03H 4Y5VC 5HHOA 1FFNB 1MFCH 2CJUL 2DS4A 1N0LA 4JQVA 1IM9A 4OLYH 4QHUB 3BMWA 3EOTH 4P5TB 1ZLVK 3VI4E 1PVHA 3BIKB 4Y2OA 3HUJF 1MIEL 3WL9B 5D1QD 1R3KB 3R1GL 1I1FB 1G1YA 3ARVA 3UYRH 4EKXA 1FZKB 4LLWA 4OTXL 1S9YB 3BXNA 4HBQA 4YPGB 4WTZA 4I9WD 3CJJA 3FOLB 1IGFL 1LEGA 3M45A 3L3DB 1RIUH 2OZ4H 3EYUH 3UBXG 1CIUA 2D0HA 3QIUB 5JPMB 3I02B 1HZHH 1ULVA 2Z31D 3D39A 3DTXB 2HT4C 1DBKL 2X4RA 1W72L 4ZYKB 3UTTD 4S10A 2A6DB 3E8UL 3FQWB 4Y1AB 2QSCH 4HIXH 3MXWL 2Y5TB 2XQBL 3BGFB 1S8DB 2QV2A 3ZYJA 1YEJL 1TVHA 3PNWB 1KJMA 2Y6SC 1SJXA 1M7XA 3INUL 3KDMA 2VQUA 1NGPL 1CDBA 3EUUA 5T1LA 3HI5L 5ENWB 1CT8A 1AO7D 3MC0A 1HQ4B 1TITA 2AV1B 4XCEB 3A6OA 5JTWA 5GSRA 5F9OL 2CR6A 3VXRB 3UO1L 4QXGH 4NQXA 5HPMB 4MD0A 2MKWA 4PJ7B 5BO1H 5INDA 5BS0E 1FYTE 4OV6F 3BPCA 4NC0B 1SVZA 3LSOA 4PJFE 5TE4L 4YNYB 1X5GA 4HC1H 4MLSA 1KJ2B 1NMAL 2ZCKH 4HIJB 1YPZE 2BVQB 3ARBD 4MXQD 3ECBB 4PRNB 4F33B 1EDQA 3TESA 4LGSB 4L8BB 2EKSA 5ESQA 4X5XA 4LQ1A 1V7MH 2E7HA 2O5XL 4JREB 4QYOB 3MRGA 1TPXB 4PTTA 1W72A 4NOFA 5DYOA 3ROOB 5C70A 4AEEA 4S1DC 1X4YA 1J0YA 5EB9A 1K4DB 4D9LL 1MCIA 3MLUH 4N1EA 5D1XA 2BMKB 4X4ME 1XF5B 3NFSL 2ZUVA 4N5UA 2DL2A 5BVJA 4K7PL 3C60B 2GCYB 1SYVA 4M7JH 5E4EB 3O8XA 2X4SB 2FJFA 4FHBD 5J0BA 3KPRB 3IJHB 4XPFL 4PJ8A 5DQ9A 1T7YA 3C5JA 5CBEB 2RB8A 5KS9B 4G8EB 4ZPTB 1CD1A 4RIRA 3LRSA 5I1EL 3A6CH 2IGFL 1RFDH 4LCUB 3AUVA 3BN9C 3QUMH 1QFUH 4NNYB 4RQQA 4DW2H 2Z92A 4QRPD 1QBLL 1DEDA 2DQFA 4JCMA 5DC9B 2GQHA 2RR3A 1NFIA 3BP5A 1RK1B 4D0DA 1GVIA 2WIIB 3W82A 5I8CA 2FR4B 1ZTXH 1VPOH 2CQVA 3P11L 3BZFA 3CFBB 3F58H 3FQXA 1PZ5A 1A3RL 4G9FE 4S2SB 4NQVB 4Y4HC 5E8OA 1XCQB 1KIQA 4L3AA 3TIEA 1MF2L 3X13A 4KTEH 4M6NL 1V3MA 5E8PB 2C3VA 3ARRA 2KL6A 1WGOA 1TIUA 2F5AL 1QO3B 3HC3H 4OSUH 4Q97A 5IESL 3SDDD 4NJ9H 3TH3T 1TNMA 2BJMH 5J57B 2VLKA 2XRAL 4NQTA 4CAGA 4XHJC 5HPMA 4F58L 4Z78B 5TDNA 3T4AA 4BZ2L 2VRAA 3ZL4H 4MJ4A 3UTZB 1JFQH 5F72S 3QFJB 4HWEL 3FN9A 2R69L 4PJ9D 2HT2D 2XQYK 5HYSA 2Y36H 2EDKA 5MEQA 1KN4H 3W2DL 1IGMH 5EG6C 5JZ7D 4IS6A 3X11B 3CCHB 3SDCA 3FB6B 1NMBH 4EI5C 2AVGA 1BPVA 2B5IC 3WFBH 2A73B 4QXUH 5SWQA 2A9NL 1IKNC 3U4AA 2W9EH 5DSCA 1FGVH 3BRFA 3ARDA 4WI8A 4PR5A 1VFAB 5DYOB 2PTTB 5E5RB 4KUZL 5B3NA 3QUMB 4P46A 3KPSD 2VLRE 4AIZA 3HAEB 2X4TA 5D72H 1XZ0A 3WLBB 2ID5A 4FQLH 3UYOD 5FGCE 2VLRA 3HZYB 2FDBP 4HKZB 3WCYA 3DURB 3NIFF 3U4BH 1KB5A 1U91B 1IQDB 3CFEB 5T5FH 4P2RA 4RA3A 5SWSB 4UBDC 1R3HB 3SGJC 4MXVE 3L5HA 3HUJB 4ZFGL 3ALPA 2P5WB 3DVIA 4XP1L 5F8RC 4CVUA 3BZ4B 5D7JC 5EUKA 5EC1B 4NQVA 1XIWA 4M61B 4MDJB 2OMBA 3WJJA 1IGCL 3KHQA 3VFTA 3F8UB 3RZCD 1AD0A 2DQIH 1GOHA 5J12C 1WFOA 2OP4H 3DRTA 4HBCH 4FFYH 3TBSA 3WDHA 1X5JA 1QVOA 3UTPE 3NIDF 3MV7B 3I6GB 2AJSH 3T1WA 4MNGE 4NSKB 2CLVB 5C0AE 4K3DH 2EC9U 3MRQA 1ZLUH 1P7KB 4ODXB 1YNKH 3O2WL 3MRKB 5DJAB 3IETA 4N0UE 2FATL 3DURA 4TPRL 2WUCL 1KG0A 1LE5A 1R0AH 1WC7B 5MEQB 3O11B 2OSLA 2P7TA 2G2RB 5FGCB 3RQ3A 3SKNB 4MA3B 3DO3A 1LO4L 5E8NA 1HHKB 3HG1D 5IW6A 3IDJB 4TTDD 3QHFH 1AGCB 1KF9B 3D87B 2E9WA 1A9EA 4KGJA 2IPKB 4LL9A 3WUWG 2QTEA 1UEMA 2IAMB 1H3GA 3F62A 5E99L 3WMSA 2YSSA 3Q48A 1EHLL 4JZJA 4O2FA 4G7VL 1KCSL 2MHAA 2Y07L 2BNUB 4PREB 4G6KL 1FLRH 4KI5E 3U0TB 1IKFL 5IB3B 3ULVL 1I75A 2XZAL 5FOJA 1AGDB 3C5JB 5CBEA 4NZRL 3I75A 2IH3A 5L7XH 1J18A 1JPSH 3QWRD 4TUKH 1BFTA 1OAZH 3TO4A 2I27N 2MQ0A 4P5KB 3Q1SH 3OKKA 3H0TA 1T7WA 4HWUA 2YD2A 1JF1B 1KGCD 3LVEA 4ODWB 1A1MB 3PABA 1WQVT 5DURB 3QNYB 4LCWE 4Y16B 4U1JB 3RGVA 4PJDF 1H3WM 3FQXB 5AYUL 5ACLA 2CIKB 1CQKA 2FECI 3CAFA 3DX6A 1BQLH 4ORGB 3GIZH 2CLZB 4MYWB 5E8EA 5I15L 1KOAA 3C6SB 3V6BR 3KG5A 3CSPA 5GS2D 5EBLA 3ZKMD 3UC0H 1WEJH 4FQIH 3WL9A 3VI3F 3VXMD 1FNAA 1CFTA 1BZQK 4JFXB 3NABH 2HLFC 4J3SA 2OM5A 2Y06L 2YD8A 2GJZA 5L6YH 5JR1L 2I07B 5DJ8B 4Z9KB 2HVJA 5DHVH 1S7UA 1G7MA 1OTUC 5FA4B 1FVCA 3FQUB 4OLXL 4M7LT 1BX2A 1MJJA 2GSIA 2PYED 3I3BA 4ZOBA 3KYNA 2Z4QA 4LPTA 5J13B 1J9CT 4GG8B 5B38A 2DD8H 4KMQA 3BYTA 4L3EE 4FTVD 3KPSE 3L3JA 2G2RA 3MLTB 4U1KB 3ULVC 4LQFH 4GFTB 4L9LC 4LSTL 1AD9B 5D5MF 4AIXA 4DGIL 4G6AC 2FD6H 4ZPTA 5E0QA 4FABH 5C6TL 5L2KB 5CAYB 4I77L 1EEZA 3BSZH 4MAUH 5CP7B 3KWWA 1JF6A 4F33A 4FQXB 3KJ4C 1AO7B 2A77L 3MLRH 4J6RL 2PF6A 3IJSB 1NCTA 3BQUD 1FVDB 3V2AR 1YEKH 4WI9A 5CINH 5BW7A 4BH8B 4P2QD 4R2GB 2P44B 4ONGL 5AG8A 4NQED 2F8XC 1KEGH 3U4BL 4OQTL 1DVFA 4FQJL 3MV8B 1VEPA 4K8RD 4JZNA 4JO4L 1B2WH 2NY1D 1CXHA 1AGFA 1YUHB 2DM7A 4U3HA 2AXGB 3QZWA 1F58H 4YHIA 2P24B 3D25A 5DEFA 5CEZH 3LB6C 4MLIA 1EV2E 3EJZD 3U48A 1CD9B 2R9HC 1BBDL 4C56D 4N9OB 4XH2B 2BY3A 1T21A 3MLYH 5CINL 3BDYL 3K4DA 1OM3H 4GUPB 1FFRA 2CIKA 3FQWA 1OT2A 5F7YC 3W11C 2NR6C 4LRIA 1QBLH 2CXGA 2I9TA 3MJ7B 1JL8A 2D31B 2Y36L 3RNKB 1KT2B 3R8BB 4G6KH 1K4CA 3FT4A 3W9EB 1OOAA 2VMFA 1VESA 4NNPH 1UM4L 5KVFL 3BEWA 1CLYL 4TYUA 4U7KA 2Y9RT 3FQNB 4KKLC 4WUKL 1CT8B 5EPMB 5C09B 1PEZA 4XGZA 2YN5A 4NO5B 5HI5D 1AR2A 4YC2C 5IESH 3UJIH 2NY5C 5BV7B 4UU9B 1UM5L 2HVKB 5FHAL 3AREA 3O6LL 3IS0X 2N4IA 1D5BA 2WIMA 4JFDA 3OKNA 4MJ5B 3HC4L 5DFVC 2MHAB 3GSRB 4HXBL