1R3LB

Potassium channel kcsa-fab complex in cs+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords Antibody Fab fragment light chain
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3lB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3lB02
3ZYJA 1RUQH 5EBGA 5JQ6L 2D7PA 4NQCB 1N3NA 4PG2A 3OKEB 5EO9B 5SV3A 3NZHH 4X4XB 4JFXB 4Y8DC 2OZ4A 3QHZL 5AAMA 1I9JH 4NQSA 3VXTA 2YPVL 1I7UB 2YUXA 3QWRA 5JW3L 3TBTB 4HV8B 2M1KA 4YHPA 1VFOA 4ODUA 1R3JA 1AD0B 3G04A 2DQJH 1IGCL 3CVHH 2WBJD 4ZOEA 4G80B 1Y18A 1YNLL 5KSAB 5IW6B 5EFIA 5JW4M 5E24E 5BO1H 3KLAB 5I1KH 2HN7A 2XZAH 3T0XA 2AEIT 4I3SL 2NW2B 5K9JL 3MA7B 1KLUA 3V5KA 1FZMB 2F19L 1KPRA 1XZ0A 4GBXA 3QFJD 4OCXL 3EYFB 4HUVB 3RWIB 3V5KB 4NC0B 4JDZA 5T1DH 4QHKI 2VIRA 5MI0B 1A7PH 5J3HD 4GH7B 2RCSL 4MJID 4PRHB 3GMQB 5DUPH 5C0AB 1I8LA 3BZFA 2J8HA 4I18B 2AKRB 4WFFD 1DEEA 1FL3B 4X6DB 3BESR 1V7NL 1XF5B 1A5FL 1B4JH 5CLWA 5FB8B 4OIAA 5C6WH 1OGTA 4AMKH 1KUMA 1UEYA 2I07B 2CKNA 3TA3B 2D0GA 5JOFA 3D85A 4HC1A 3MV8D 3DI3B 1ROWA 4PJ8A 1GGUA 4LSSL 5FYJL 1OAZH 3CLEL 4GRLD 1FVDA 5I1DA 5IQ7H 1WCQA 1AO7A 5E2WH 1KTKE 1Z9MA 1JGDB 3LAFA 3WNLA 4HIXL 1NGXA 5D7IE 4ODTL 5T3ZH 5B3JE 4QTIL 4MCYA 1D5BB 3TH2T 1QNZL 4P57A 2COQA 4LVOB 4M4PA 1VESA 2CGRH 5J6HA 4MMZC 3U0PA 3DSFH 3OX8B 2I9LA 2OMNA 1A6VH 2FATL 3VWJC 4PJ5B 1FZOA 1E6JL 1U8MB 1MOEA 3LH2H 1W2KT 3Q6GH 3BP6A 2WBJA 1T1ZB 3HZVA 4NJ9L 4OFYA 2AEQL 4YHKH 5GS1A 4UIKH 4YK4C 3MV11 3WNPA 2FJHB 4LSSH 3RL1B 4XP4L 1AGFA 1INQA 1N4XL 1P2CA 1A7BA 1JNLH 5HI3D 3SDDA 4J3UA 5I30L 1ZHKA 1MJJA 3OAUL 4OCYL 2MKWA 3TESA 1S9WB 3ARBB 5TGBB 3IGAA 3MFFB 2H8PB 3LKSB 1U8IB 2JJUA 1AGEB 1NMAH 2VDML 3DVNB 4HHAB 4HQQL 2FBJH 5DRZA 1II4E 1U8IA 3O4LE 3VGHA 3RGVA 4PRAA 5E1AA 1JJUA 4UMGA 3QT2A 3VXPA 3FB7B 1WBXA 5IMOA 3HNSH 2EH7H 3ARGC 1TZIB 3LCYA 3RWDB 3HR6A 4GG6A 2NXZD 4F33B 1NC2B 1OCWL 1FVCA 5KSBF 5EOCJ 2V7HA 5FEBA 4IIQA 4ODHL 4EQ2A 3B5HA 5DJ6A 2NY1D 2Q3ZA 1BEYH 1CI5A 3HG1E 1URLA 4EEEA 1XMWA 1CR9L 5T3XL 5IFAL 3DX9B 2CJUL 2ZJSL 5GGVL 2MPAH 5E8EB 5I2IA 2BVQB 4GW4A 3O9WD 3QDME 4OLUL 3X11B 4GKZA 5C3TA 5KSBE 1YYMH 1S7UA 2BRRH 1UB6A 4X9GA 1C16A 5LQBL 4MXQD 4YDJB 1HKLL 1EEQA 3IDXL 4F15B 3EZJB 1X5LA 5I17A 4GAGH 4KI5D 4OBRA 3KYOA 2YC1B 4BQ8A 4HJGA 4QLRA 1CQKA 2IFFL 5GRUH 1OPGL 1ZGLB 4BJLA 5J6GB 1BJ8A 1RIHH 5FKPB 3MLVL 2V5TA 4OFDA 3N1FC 1F90H 4Q2ZB 4PJFA 1CE1L 1WGOA 4JANA 2DQTH 3GM0A 4UT6L 1J12A 5AWNH 3ULUD 4DN3H 2H3NB 4FP8L 5H2BB 1JRHI 3SPVA 2VLRB 5ALBL 5LJYH 2VDMH 5T1MB 4WHYH 1KEGL 3TNNB 4I4WB 1LO3L 4JM2A 1WVZA 5E8NB 3HE7A 5MP6L 4Z7OF 5HHME 4OZFH 1JGUH 5EOCL 5K9KA 4QXUL 4XHQA 1FZKA 3H9SE 4NRZB 3P4MA 1XF1A 1KJVB 3Q5OA 1F58H 4POZC 1XGQA 4ZO9A 3X13A 1CYGA 2VO5A 3IDGB 4U1MA 4P2QE 2IG2L 3B9AA 3BOVA 4XPHL 3Q6FB 4UOJA 3T0WA 3MRGA 3BEVA 1F3DH 3B5TA 2EYRB 5JO5B 5FECB 1UKTA 4PUBH 1OW0A 4L4TE 2WP3T 1EAJA 4XMKL 4YBHA 4IOFC 1I1AD 2AK1H 2BNUA 4IMLA 3SKMB 1G9EA 4PBVC 3GMNA 2IFGA 2YK1H 4QRTA 4X9BA 5CSGA 3DROB 5IOPB 3MJ8B 3VMOA 4N8VG 4PJ7A 2O61B 3CDYA 3PDOA 1VFUA 1J8HB 3D48R 2R1XA 2B39A 4PB9H 1Z2KA 4JRYA 4OFVA 3HFML 3MJ7B 4QRRD 5CSZA 2DRUA 1QFWH 3HRPA 5CEZL 1QRND 5GGQH 4IEFB 3VXRD 2DQFA 2A9NL 4IDLA 4OQTL 5DFWH 4WFGD 4X8JB 5DWUH 5AUMB 1XGTB 3AXLB 1AGBA 3MROB 1I7RA 3RPKA 1KLUB 3U82B 2BNQA 1RK1B 2KZ1B 1RURH 1NMBH 4ZOAA 1MHCA 1G6VK 4BZYA 4X5XA 5ITFA 3SGDH 1DCLA 1NCUA 4PJCE 3U4AA 3KPNA 1JGUL 1VACA 5EOCH 4XPGH 1LEIA 3QDAA 5MP6H 3BN3B 3JWDH 4XP1L 4FXLA 4MX7A 4FQCH 3KPSA 4QYOA 5LGKA 1WJ3A 3QXUA 1FAKT 2VABB 4TNVF 1TENA 5D1ZA 1ES0B 1WC7A 4ZUUB 2R2EA 4PJCF 3BPCB 4FQ2L 3U0WL 4C4KO 4LL9A 4X0KB 3SE3C 1ORSA 4JFYB 1I7TA 1T0MB 4TVPL 5JW4Q 4BA8A 5F21B 2MHAA 3CH1A 5ACZA 32C2B 5IEKB 1NQBA 1QFOA 5ADPL 4JO1H 4GQPH 3V9FA 2ADGA 4QO1A 4F7EB 2R0KH 3NCCB 4UDUB 5DQJA 4M1CC 4U6XA 4LQFH 3PGFL 1F8TL 4U6VH 2R0WH 5DQJB 1FQ9C 1R5VA 2VQ1B 4N0UB 1DN2A 5CP7B 3WFHB 4Q9QL 3KPSE 4KZDL 5FO9A 4PJAB 2Y5EA 4X4YB 4LPCA 1F4AA 4JGMA 5J9PB 5B3NA 4JQIL 5DJCB 2ATPA 2D03L 3MLWH 3CDFA 4AEHH 4OQTH 5C92A 1JRHL 3K80A 4JGUA 3TBVA 4YQXL 1P9MA 3QP3A 5D1ZD 1YQVH 1RURL 4MA8H 3LOWA 5I1AA 3K0WA 1HZHH 3VGFA 3QUYC 5JIHA 3MSPA 3WO3B 3FQXB 3QG7L 1B88A 4Q0XH 4J3WA 1HIMH 4BFIB 4FQLL 4M5ZL 1NEZA 2JJSA 5BJTB 1P4BH 3ECBA 1RSFA 1UWEL 2G60L 1EMTL 4H1LG 4XNYL 4PJGE 3CXHJ 1MQKL 2I5YH 1KFAH 2G2RB 4XPHH 1OB1B 3WJLC 4PP1C 4RBPH 3NIFE 3DYOA 4Z7VE 4LSRL 2OR8A 3DX9A 1QBAA 1AC0A 3HTLX 5C2BH 4G8FA 1KB5L 1HHGB 15C8H 4O51A 4NN5C 3QXDA 5I18L 2BVEA 5MEND 1U8JA 1CWVA 3T2NL 5HY9B 1DQDH 2V17H 3BN9C 1NCBH 1RV6X 4E0RB 1I1FB 3DTXA 4Z7UF 1UEMA 3RDTD 4QY8B 2VDKL 1RHHB 4HH9A 5J6GA 3CZFA 1NEZG 3KR3H 3CLEH 3AAZB 1PG7H 5IB5A 4QRTB 4H0GA 5CD5D 3BKCL 4XCFL 4OCXH 3NCYP 1N7MH 1S3KL 2CDGA 3QHFH 1MCBA 3O3EA 1JE6A 5DRWB 3QNYB 4OD2A 5C0FA 5I8EB 3MCG1 1VADB 4TOYL 1S5IL 4NGHH 3MMEA 3TNNA 4P2OA 1T20B 4XMPL 4WI2A 1P6AB 5HGBB 3PWPB 4EUPB 3LKQB 2DJ4A 2O26U 4G42B 1KG0A 1TQBC 5GGTA 5SWQA 5DJ0B 3DARA 5FF6B 3MV9E 1XR9B 2X4NB 3FAWA 2A74B 3HE7D 1FVEB 4PJDE 2OQJA 1KB5B 2OL3A 1MF2H 4ONGH 4JN1H 3K2UL 3U7YL 4TUJA 4Z8FL 1A6UH 4R96A 4Q6IA 3STZB 4HPYH 3STZA 4LBEB 4P4KA 1TPXC 3MJ8A 4L4VD 4OLZH 1OSZB 4UINH 5D2NA 4DWHA 3VFPB 5FB8A 4IRSD 4KXZH 4RDQG 1HEZA 4MX7B 4ODHH 3MRQA 5JOFB 4RFEB 2AJ3B 2IAMB 3L3OA 4ETQA 2WBJC 5C09D 4H0HB 1K5NB 2CLVA 2BK8A 2CK2A 3MREA 4N8VA 5GRVK 1FBIL 1YN6B 3F12A 5HYFA 3OR6A 3QR2A 4ELMF 1O5DT 4MS8C 4LPVA 3HC3L 3LKRB 3KDMA 5AUMA 2XQBL 4GBXC 2XFXA 4YR6A 3BRDA 1GGIH 5DVOA 2QBWA 4WCYH 4BQ6A 4JANB 2WV3A 3T08A 2VLJE 2BJML 3VRLE 2N1KA 3P0VL 4PV8B 1UM6H 1DZBA 2X9WA 3U30C 3D2UA 5E5MA 4RGNB 4R3SA 1TVBB 4M6NH 2YSSB 5JIKA 5D2NE 4GT7A 4YHNB 1MVUA 5C08B 3N9GH 4BSJA 3GMMA 4DCQB 1EAPB 1WEJH 3T0BA 2FO1A 1CF8H 4ZXBC 3SDCD 2WINB 2FWOA 3U0TB 1CZ8L 1PBYA 4MDIA 4XC3H 4LPXA 1KPVB 4LMQE 4LLWA 1F4WH 2BCKA 5JHDD 2XTJB 4JREB 3U9PL 5I8OH 2B1AH 4JO2H 3L5IA 1RAMA 3C8KB 1WV7T 5DJ2A 3PDGA 2FECL 4Y4KD 4ZAKC 5IF0B 1CFVH 4XH2A 4MXVE 1Z3GL 5IGXL 1LO2L 2IPKA 1KIRB 4KK9D 3AS1A 3RU8L 3UYRH 1A7RH 3IDJB 1I1RA 2DQTL 1AXTL 5C0CD 2I9TB 3U1SL 4KXZI 1KJ3H 4MS8D 2HKFL 2EKSA 4JM2B 5CHNB 1IVLA 4IHOA 4PGCB 3PGDB 1JPFB 3WHXA 3AGVA 4J4PA 4LCUA 3EOTL 4HUXB 3IKCB 1QLRA 4RMRA 4NUGH 4KZDH 4X7TB 5DJCA 5BMFL 1JTOA 5DGQA 5E7BA 1C5CH 1MAJA 5HI4D 4OV5A 4UAOC 2ADIA 4NBYB 3IXAB 1CQYA 3DBXA 5HBBA 3EDKA 3AB0C 3OKNA 4DEPC 4C83B 4N9OB 3ETBF 4WNQB 3BYYA 3NACH 1DEEB 4YXKL 2IQAA 5IG7B 5L6YH 3SCMD 4TSBH 3UPAA 3O11A 3AREB 3BFOA 2WIIB 4WUUA 5D70L 5E6ID 3RWFA 4EVNA 1JTPA 4BFIA 3NA9H 1BBJA 3AAZA 4U6YA 5E1HB 4WI3A 1XH3B 1F4HA 4YHLL 3HMWH 4YWGH 4EOWH 1RZKC 2OJZL 3KPRD 5KW9L 3JUYA 4YX2L 2F5AL 1U92A 4L4JA 2VZTA 3RGHA 3EUUA 1RIVL 2CH8A 4RFOL 5FYKL 2E7HA 3VW3H 2IALA 3VFRB 4HWZA 3RI5K 4Z76A 4JO4L 1FLTX 3OAUH 5E6ZA 4U1SB 2W9DH 3MYJA 4XXDB 3BRGC 3OL2A 5CCKH 1VA9A 3S9DB 1RUMH 1YDPA 3LPWA 1XFPA 4ODVH 4YGAB 1PW3A 1Q1JH 1NMBL 2B4CL 2ZZUT 5FM4A 1EPFA 5D6DC 3HI1B 1VACB 3UYRL 5FECA 1BZ7B 1OAKH 2RBLA 3X14B 4BKLA 5LGJB 3CX2A 3BP6B 4YFLF 5E7FA 1MCOL 1VFAB 3WXVH 5KZCB 5IMKB 1FFPB 4ODWA 3VGAB 1X5XA 2YR3A 1WISA 4OT1H 4P2RE 3T0ED 3G9VA 2YEZB 43CAB 3S36X 3SO3C 1UT9A 3GZKA 3FFCD 2OR9L 4APQA 3RKDD 2FHCA 1BZQK 2DS4A 5EZJA 3HNTH 4YFLI 2YUWA 3QDGB 1MFBH 3O3DB 4J12A 4AIOA 3D9AL 5FHAL 3UZEA 1C1EH 4PRPB 1U3HA 3RIFK 5L7XL 4OZGE 2V9QA 4KJQD 2E7MA 1F97A 4PUBL 3UBXG 1MREL 3A67H 1MCOH 3CGTA 5GGSB 1BFOB 4XPTH 1PLGH 4I3RL 4F7PA 1GZQB 1H3PH 5CJ8A 5EOQL 4IBLT 4P9HL 5L2KA 1IM9D 2XZZA 4YQXH 5C0RH 4GW4B 1KEGH 3H9YA 1UQSB 1XGRA 1TPXB 4YIQB 1S7UB 1YYLL 1R5IA 3I2CH 1F00I 2FLBT 2Y6SD 1TTGA 4ZOCA 3MBEA 4PTTA 4NQXB 2A2QT 5HHXL 1NGPL 2YRZA 4R7NB 4HZLA 3HI5H 2VWEE 1U95B 4NQXA 3C9NB 5F7NC 3ZMRA 4R7NA 5DVKA 1F2QA 1GGYA 1IEBA 3GIVA 2DWEA 2DQEH 4Z7VA 5A2KH 5JLZA 3C8KA 5HHPA 1CD9B 3G6JF 3OKYA 3H7BB 4K7PL 5FGBC 2W9LA 3JSSA 1TLKA 3B6SB 4FXKB 2P42B 3QUZB 1IQDA 1IT9H 3EYUH 3UTTD 5LAXA 3HPLA 5DTFA 3VFOA 3P30H 4XGZB 2VR9A 4I3GA 3QI9A 3VXRB 5I1HL 5FYKE 3ZZ1A 5F7LB 1MVUB 3EJYC 2P1YA 4XTRC 4Z7UB 1W72L 4M7LL 4DTGH 2EXYC 1R3KB 4KY1H 1KJVA 2J6EA 4NKIH 4NN6B 2E9WA 1T0NB 2AJZB 3GO1L 4ZPVB 2CKBH 4S1QL 3HHRB 1DUZB 1YMME 12E8L 3AMKA 3CUPB 1BD2D 2Q8BL 1WTLA 2F8XC 3UEZA 2PW1A 1FNFA 3VH8G 2ZCLH 4JPKH 1N7ML 1S3KH 3FOMA 2YPKB 3DVFA 5JIPA 3ULVD 3JV6A 3WEXA 1EEZB 4P5TD 4HUVA 1OD7A 2R0ZH 5F88A 1KPUB 4AIZB 4I3RH 1PLGL 3TH3T 3VI4F 1IKFH 3U7WH 1YEIL 2GTZB 1DQJA 1H3UA 3C5ZA 1OF2B 1QEWB 4TN9A 4YNYA 2FGZA 5A2IH 3QDJD 5EO9A 3PE9A 3CDCA 4IS6B 4M8QB 4Z5RA 4DGVH 1NBVL 2IBBA 2OZ4L 4LLUA 5IB1A 3VA2C 1UKQA 4YHOH 3MRKA 1YC8A 4IS6A 4M8QA 3CXHK 4DKFL 4Z5RB 2ILLA 4JFQB 2AGJL 3FRUA 3K1DA 4OZIA 5C0EA 4XPBH 3QUXB 4P3DA 3BWAB 2YA0A 3ZDYF 4JFED 3I6KA 1RHFA 2ZPKL 3VCLB 5T5NG 2CDEA 3FHQA 3ARGA 2X4PB 2XA8L 4LP5A 5CGYD 4I5BB 2W0PA 2FH6A 2KQNA 2D2OA 1ZHNA 2P47B 4HUNB 3E6FA 5GSRB 1GAFH 3LD8B 2J1KA 4PJXF 2VL4A 4FABH 1SEQH 2ICWA 2PCPA 1WITA 1A22B 4JPWL 3F8UB 4IOFD 4XCNB 1T2JA 1RIUL 3BZFB 3BDYL 4ONFL 5T3ZL 2VDRH 3B3IB 4HKZA 3LB6D 2DM3A 3RWFB 2YD4A 1OAZL 3QIBA 5ITBL 4KROD 3MRQB 1IMHC 5GS0L 1J05A 1ES0A 4L3EE 4KJWD 3NBNA 1P4BL 4M02A 5I73B 1BLNB 4Y16D 4JQIH 3W9EA 3LQZB 3RZCB 4ODXA 2B0SH 5DJAA 5MHSD 4GAJH 1RU9H 1AO7B 2VDLH 2ZKHL 3BHBB 2EE6A 5E5RB 3VFRA 5EU7C 4J3VA 3TBYB 2AJSH 3DVNA 3ZKMD 3I3EA 1FNSH 4CADA 3QDGA 1YY9D 4R2GD 2D31A 2RFXA 3MRLB 3VWKB 4LSPH 5JZ7C 4NDMB 4NQCA 4OZHA 1XF4B 1VERA 2J8UA 1D3CA 4PD4J 2HVKA 1DBKH 3H3PH 1S5HA 3GMOB 4JFFA 3GSVA 4EN3C 1A3RL 3PP4H 5GHWH 4WTWA 4L1HA 2FL5B 1J0YA 3JTSB 1RJYB 1XR8B 4H8WH 4NSKB 3GSVB 1CBVH 5DI8B 3O2DL 5E2VH 4MAYA 3JVGC 3BJLA 1FE8L 3K74B 4R0LA 3ZKNC 5HVWA 2HYMA 3CFDB 2DBLL 1IAIM 3N1GC 1JMXA 1S78C 1CGTA 3MO1B 3Q5YA 4IOIA 2ZG3A 4ENEC 4WI6A 3D39D 5ADPH 5T3ZE 4KHTH 4YEFA 2BC4B 5KVEL 2YN5A 1IAKA 5EPMA 4PYGA 3RGVB 2V5MA 1DBKL 2WQ8A 1UWGH 2ZUXA 5C3LD 5F44A 4JRXA 4GRMB 5FCUL 5HYSG 3RY5A 4LSUL 2GT9A 4LOUC 3B2UD 3QUZA 4U3XA 3IB4A 4BZ2H 4H20L 5B38B 5D2NC 5IVXB 5IGXH 3HPLB 3L5JA 3HC4H 1JGVL 2W59A 2DB8A 4JG0L 1ZKAA 3WXWH 3HNVH 1JF1A 1FFQA 3BKMH 4XBGA 3U4EA 3QDMD 3LKNB 3DXAA 5IKCA 5HJ3A 2HG5B 1QLEH 2ENSA 3TIEB 1JYXA 3LKNA 1F2XK 4YIQA 3VXUD 3U1SH 3W39A 2Y25A 4HWUA 2AS5M 5CGTA 1WCBB 1GGBL 2EXWD 2GK2A 4K7PX 5IVZB 7FABL 1A3QA 4J7RA 3RBSA 1K8DA 3QNXA 3W0WE 4HJ0D 2QADC 1FIEA 3JV0A 3HRZA 5IMKA 4NCC2 1X4ZA 3KYMB 3ULUE 2XKNB 5IHUH 3K4ZA 4ONHA 1C5DB 1QRNB 4OF6A 1DL7L 1I3GH 3S5LB 4ZFFB 4HIXH 5IBUB 2YS4A 3DXAD 1KJ2B 3KLHC 3NCMA 5DMJB 7CGTA 3BGMA 4J6RH 5FYJH 1QVOA 4UT9H 4X4ME 4AY0A 1V7ML 2ZUQB 4LCUB 1BQHB 4M93C 3LN5A 1BIIB 2GSIA 2J8UE 4P49A 5KJRH 1J1PH 3QPQC 3QPXL 5F8RC 4J3OC 4K8RD 1XIWC 5MENE 2GJ6B 3O8XC 2HA1A 2OXGA 4WGVB 25C8H 3NVQA 3BH8A 4PJ7F 1GGIL 1M7IB 3I50L 4F15C 3RWEA 1MCFA 2XZQH 3O4OC 5F7WC 4PG2C 3U46B 4JPVL 2NZIA 1GYAA 2HMID 3P9MA 4LHQB 3CZJA 3MJ9A 2VJXA 2R4SH 2VSDA 1NSNH 1LMKA 3GMRB 1NPUA 4F57H 1H0DB 4YBQC 3BSZH 3UDWC 3ARDA 1J8HA 2Q3AA 3DRQB 3KWWA 4HIIA 1ONQA 1U58B 2VDPH 5DMKB 2YPLD 1LP9F 1ONQB 1E28A 1KF9B 5C0GA 4LFHG 2WZPD 4NGHL 3WHE0 1S7QA 2WK2A 4NO3A 4BUGA 4KVCH 5GJSL 3HUJE 1G0DA 2ARJB 2K7QA 5DZNA 4OTXL 1NCWL 1IKNA 4XNQA 4PV8A 5GJTH 3QG6B 3KPMB 4N0YL 2PF6A 5CP3H 1YMHA 3CSYB 3FB8A 4XXCC 4JHZA 2MPAL 4HK0A 1V8HA 1YC7A 1PG7W 3RY6A 3TM6A 2YXFA 5FA3B 1TETL 1DVFC 4RGOL 4D3CH 3BSZL 5MENB 4KKLD 3QWRD 3E1F1 2CO6B 3UTQB 3D5OF 3C87A 5KJRL 4M48L 3GMPB 4JJ5A 4NN7B 5GZOC 2P45B 1LK2A 3CFBA 3QIBD 1OTTD 4JPVH 3T4YB 3QULB 4E41E 2AEPL 2HJLB 3T09A 4QRPA 5DHYA 1RZFL 1JNNH 1MHHA 1A2YA 4U1LB 5TFSL 4PP2A 3S6CA 2OYPA 4I9WD 3IDNA 3S37H 3ULUL 2WANA 4ZAKD 4WUUD 3DI2B 2A1WL 1ZOXA 1JPSL 4Z0BH 8FABB 3GMLB 1QPPA 1U36A 3MOBH 3N85L 4ZTPH 3EDDA 4ZDHB 5IOPA 3FMGH 1QBLH 4WO4A 4TUOB 4Y2DA 4RMTA 3C09B 2DJUA 2J5LC 1NDGB 3RNKB 5I18H 4UV7H 4PJBA 3SDXE 5IB2B 1ORQB 1TZHA 4JFEE 5E03A 3H2WA 4XC3L 1DBAL 1JPST 2ENYA 3UTSE 3AC0A 2CR6A 4JCLA 4M6OL 5IW6A 2R15A 1DUZA 1JNNL 2P5WE 1A6PA 3WL9A 1JRHH 2ERJB 3VCLA 2PETA 3SE9H 1U2HA 2FGWL 3HAEG 2EIZA 4M5YH 1HCFX 1MY7A 1U8QB 4OGYH 3WJJA 4JZJB 1ZA3B 1B90A 3QUXC 5EA0H 3ZE2F 5K9QI 4M00A 4ENED 5I1AB 1KNOB 1U6AL 3AU1B 2DWEB 1F58L 3LEVL 3ARUA 1NGZB 5JNYB 5EU5A 1J5OH 2B4CH 5J12B 4KK8D 3FTGA 5BRZA 3C08L 3NZ8B 4M93B 1UB5A 4JB9H 5DFVC 1KOAA 1HH6A 3VFWB 3PWPD 2CDGB 4F8TA 3MC0A 3QQ4A 3KPRE 1MFAL 4XB7A 4HPOH 1VADA 4AEIL 1T5XA 3QIWD 1A7NH 3F5WB 1NC4B 4XBPB 4XWOC 5LXGH 2ZSVA 4NNPH 4RWHA 1A7PL 2C1PB 3H9SB 2Z4QA 4O2FB 4OGZA 1MCLA 5A16B 3VFSB 5T3XH 5IFAH 3KNBA 3RGVD 4MA1C 1BZ7A 3SCMA 4K8RH 1MPAH 1CTNA 5E99H 4KKBC 5CJXA 4ELME 1SEBB 5DMIL 4L5FH 5F9WC 3IETB 3C60C 1OAXL 4G8GE 5DUMH 3UTSA 3ILQC 3GSQB 4FQ2H 2QL1A 3KYMA 4PJAA 3U0WH 4CKVX 2FB4H 3GSOA 5JHDB 2F15A 3DJ9A 3GSQA 3RVWC 1MWAA 2R2CA 5TPWL 3TVMA 5FYLH 1HE7A 4P5KA 2EDTA 1R3IH 3EGSB 5J0BA 2FO4B 1QR1A 1X4YA 3MO1A 5FYJD 3C08H 5C08D 3I3DA 2PW2B 4PLKD 5HI5D 2H32B 3EJZC 3MNVB 4HK3N 5ERWA 2VXTL 4U1JB 4K9EC 4MJ2A 4PY7B 4H5SA 4HT1L 1HKFA 3FB5B 3I02A 1BAFL 4M4RA 3ZKSD 3IU4H 4G42A 3ZDZE 3TBSA 4Y2DC 3NTCL 4H5SB 1VSCA 4X6CE 3TO4B 3GRWL 5B38G 2VISB 3JTTB 2HT4D 1U6AH 3P0GB 1FNAA 4ZS6C 1PQZA 3IDYC 1S5HB 4JFFB 4WHTA 1T1XB 1DFBL 4K3JH 1G7PB 4Y4KB 5BXFB 1BJ1H 4FNLH 4AENA 2Y07L 2ADJA 5C0AE 2Q6WA 3ZDZF 3B9EA 4KDTC 5SWSB 3EYVB 1KCUL 1SM3L 1TVBA 4LPTA 3OXRA 1KTDB 2HWZL 1JHKL 4E42A 1AD9B 1JZ6A 3D87B 1T6VN 4XVTH 4ELMA 3BPLC 3MRIA 1UB6B 4O4YL 4JRYD 1K6QH 5I16A 1OAUL 4LCWD 1Z0NA 4PJDF 5I75C 1IQWL 5EBLA 1CL7I 3FT2B 2C3HA 4HGWA 3PWVA 3KDMB 3A6BH 3MUHL 2BFVL 4RGNC 2BJMH 5A3IC 1KC5L 5HHVL 1FL6A 2K1MA 4LK4A 4L9LB 4LNRA 4HC1H 3VXSB 5JDSA 4D0DA 1HWHB 2Z91B 3WSQL 1YECL 4BQCA 4X5LA 3TEUA 3UJIH 3IS1X 3MBED 4NOBA 4X5WA 2VL5A 3KPQA 4YHZL 1CFNB 4FQIL 3W81A 3G6JB 4YE4H 5MEQB 4NHUB 4OBSA 1HKLH 4MWFB 3N1QC 4PJXA 3UBXA 3RP1A 1SQ2N 2GJZB 3LMJH 4X98A 3O9WB 1MNUH 5HY9A 4YH6A 3MRNB 4GRWH 4W4NA 1FCGA 2GJZA 4JJ5B 3T4YA 1KB5A 2OL3B 3MRGB 1DE4B 4OKDA 1HH9A 5E00B 1MIEH 2VH5H 5ISZB 3P40A 3IKKA 1BF2A 2DIJA 3B5GA 5SWSE 4IMLB 3OKKA 1KBGH 4H88H 4XBEH 4CDHA 1DDHA 5EPMB 2VR4A 5KVMC 4HIEA 5I6XB 3VXOB 3UTTA 3GRWA 4C54A 3OV6A 4X9IA 3JBG7 5ICZA 1IFHL 3GMQA 5C0AA 1J0ZA 1S9VA 3MV9A 5MEOB 1QG3A 3VWKC 3WIHA 2NYYC 4LHUA 1KCKA 3T3PE 4TRPH 1OGAE 3SGEH 4WV1A 5MEOA 4OLYL 4Y16B 2QADD 2ESVD 4AL8H 1W8OA 5TE6H 1G9NC 3IF1A 2H9GB 1BOYA 1AO7D 5IB2A 1E28B 5T1LA 5L2JB 1U93A 2GQHA 1I1CA 1Q94A 3LN5B 5KSVA 4DK3A 3W0WA 1RUQL 4ZS6D 2CDEB 4GRWB 4POZD 3ULSB 2CRMA 3PP4L 5GHWL 4E5XA 4JB9L 1SYSB 3DETD 3BT2L 3QHFL 3NFSH 3ULVF 4Z76B 4R97B 2P46B 2FZ3B 4LLAA 3WSQH 5C0IA 2P8LB 5E9DD 2I60H 4HS3B 4TSAH 5HHVH 3AROA 1F45A 3BPNB 2BNRB 5H94A 5FYLE 4XNUH 2X89D 3LMJL 1OHQA 3PP3H 3WS6C 4Y19E 4Y4FC 5SWZB 2A77H 4KKCD 1AQDB 3QSKB 3OKDA 5K59F 4GLRI 5FO7A 2P44B 4WUKL 4LAJH 3H8NA 4HX1A 2VKWA 3CMGA 3MGOB 2DTSA 4HS8H 3REWA 3TC9A 3V79C 4IRJD 4OD2B 4DZBB 3QRGL 3BAEL 4UV4H 3SQOH 3IJSA 1ORSB 4JFYA 4G6FD 1I7TB 4PJ7E 1RUAH 3RVVC 3KPSD 5JXEC 3I6GA 3IDNB 3KGRA 3L3JA 5F7EH 4DFHA 2YD3A 1SEQL 4OLXL 1TDQA 5CAYB 1TXKA 1E0OB 2PXYA 4MCYB 4PGBA 3GGWA 3F58L 3VXPB 3OGCA 1BX2B 2AQ2A 3LS5H 4YC2C 3IFPA 5B8CC 5IMOB 5FIEA 4NC1C 3OKEA 1S8DB 3QFDA 1ZT4B 3BEWB 3RWDA 4RMUA 5FA3A 5EO0B 4JY5H 3REVA 3EDFA 4OZFA 1I7UA 5INCA 4L4TB 4TSAL 1QFWI 1W0WA 4XNMB 5HGDA 1JK8B 3RRQA 4OD1H 1PZ5B 2AGJH 5HD8D 3L5XH 4NFCA 1RUML 3DURB 5IB4B 1J88A 3CFKB 1DBJL 3KAAA 3RL1A 3HNVL 5EZIH 3BZDA 3RWCA 3P4NB 4WJ5B 1ZANH 1RZKH 5AG9A 1YJDL 1KCVL 3QFJE 1R3IL 3WCYA 3CH8A 2JCCA 4LHJB 1QO3A 2NPLX 2X4TA 2I60L 2IBGA 2HRLA 2JCCB 3HZKA 3ALPA 5GGVY 1MSPA 5I1HH 1XCQB 4WEBL 5D7JA 1OSPL 4MJIA 3Q2CA 1QLFA 2PYEB 1KCSH 5FGCE 2VB5A 4KVNL 5CWSB 2XTJD 1BREA 5EO1A 2Z9TA 5E08H 1IC4H 1I8IA 5DUBA 3IFLH 12E8H 1J9CT 2VDNL 3OKOA 2JJTA 4RIRA 1FV1A 4HFUL 1NKRA 2DQEL 5E0QA 2JJTC 4QRSA 5C0BA 2YN3A 2Q76A 3ARDC 2G75B 3QEQA 1U3HC 1T7YA 1D5XA 2HFGL 3HI5L 4C4KT 2IALB 1DN0A 3BP4B 3W39B 2QLVB 1S5IH 1VKXB 3QHZH 1KLFA 2A73A 4L4VE 1OTSC 2BVQA 4G9FD 4POUB 3T1FB 1ZE3C 5FA4A 3QXVA 3P4MB 2Y06H 3OXSB 2AI0H 5HYJE 2N4IA 2CIIB 2F8OA 1OSPH 4WFGE 4GRWF 4U1MB 5DJDA 2HRPH 3EJJX 4TVPE 3DLQR 1C12B 1NCAL 2DF3A 2DD8L 2DQIH 4LCWA 4QOKD 3UTSB 4LCWB 3SGJC 1FFPA 3H9HA 1KENL 4GAJL 1UG9A 4NOFA 3CC5B 4OSUL 1LO0L 5SX5H 4P5MB 4Q97A 1YJDH 3Q48A 5CEXA 3U2SB 4YHZH 1UXWA 4R6UA 4G7VL 3VXRA 3CLFL 3TBTA 4QHUA 4LPUA 3LKSA 4NNYA 4WEMB 4U1SA 4XXDA 5E6IB 4NNYB 1NFIB 1NL0H 4U1NB 3SDCA 1FO0H 3BDYH 4HUUB 3G6DL 1P84K 3X13B 4XTRD 3RWEB 1YA5A 3LIZH 4M5ZH 3Q6FA 4U1KA 4RA3A 2KBGA 3BISA 3KPPA 1PJ9A 2WWMC 4NO5A 5IBTH 2VIRB 3SDXF 5MERB 4L3CA 5HDBE 3O45A 2OTWB 3GBNL 4GFTB 2X7LB 3FO2A 3CU7A 1EJOL 2IPUK 3HNTL 3R06B 4O58L 1AP2B 5I1CH 4A6YA 2OTWA 3LQAL 4YBQD 2VE6A 5TDNA 2X7LA 3HI6L 3LPFA 2ZP0T 4TTDC 4M8VA 3PDOB 1XGRB 3NCFB 3TPKA 4Y4KC 3UTPE 5CD3A 3KPSB 5ICXB 2BP3A 5EWIL 1YQ2A 3WIIH 2ED7A 5EUOF 2P8MB 3PABB 3PQYD 4PTUA 2H32H 2V6HA 1E4WH 5I17B 4OZIB 3P77B 4ZUSB 2GYSA 4EUPG 1A6WH 3QUXA 1J0IA 4HJGB 3C6LD 4PJHE 3ZTJH 1U3HB 5FOJA 3GI8L 3FN3A 3H6JA 1B6DA 2XRAL 4WFED 2W9EH 3NPSB 4U6HA 3RY4A 2AV1A 2EDXA 4LLYB 1EUTA 2IF7A 3KXFB 3VFTB 3VFSA 4CAGA 5A16A 1N2RB 5L88L 5T1DL 3C6SA 4HT1H 4NZDA 3QCUH 5DRNB 1RMFH 4UT7L 3PIQA 2FJFB 4OB5L 4L3EA 2ZOLA 5F9AC 1HHHB 4G8GA 5FKAB 1FO0A 1G7LB 4YHIA 2PCPB 1H3VA 1NBZA 3QIUA 4LSTL 3BKJL 4LAQL 1A14H 1QP1A 5IBLD 5JW4N 2UVEA 3QIUC 3O4OB 5D6CA 3RZWA 5EU3A 5CJXC 3JTSA 4G80A 4LKCB 1KLGA 1NCTA 2R2HA 5FO7B 4DUXA 5KW9H 2F9BT 3V6FB 3E6HB 3VDBA 3LKOA 4FN0A 1BM3L 5AYUL 3AUVA 2NW2A 2EDJA 4MD4A 4S2SA 3MLRH 2QSCH 1JMZA 4O02L 3NGBB 5F1NB 1XZ0B 2X1QA 4GBXB 4ZUUA 4KUZL 2ZCHH 1VDGA 3N50A 4FFVD 2C1OB 5JW5A 5AZ2L 1J8HE 3MV9D 4WI5A 1E6OH 2UZIL 4Y7MA 5E9DB 3AY4A 2PTUA 1G7IB 2GTWB 2ZOKB 3RVWD 4J1UA 1U8LB 1SY6H 3GSXA 1J0KA 1UWXH 5DTFB 3VFOB 5GQBA 4K23H 4NWTH 3MR9A 1S8DA 5H37G 3QFJA 1A21A 1KIQA 2ITDB 3JWOC 5B8CB 1MCWW 5JXEA 1N5YH 4U1HA 3WHXB 2FX8L 3UZQA 3SDCC 4LRIC 1W0VA 4X6EA 3BJ91 4NM8H 4KZEH 4JY4A 3TYGH 1SMOA 4YLQT 4OD1L 3CUPA 3QEQD 5F96L 2P49B 3P4NA 4KPHL 1FZMA 4NFDA 4RNRA 1DSFL 5T3ZD 1D5BA 1CDIA 4XP4H 2QR0B 1TVHB 1BHGA 1UKSA 5I73C 4KMTH 4E41D 4A2MA 4M9PA 1RVFH 4C83A 2IADB 1EEZA 3EOYG 4I2XA 1WAAE 2BOCB 3ET9F 3SDXA 1WIPA 1S9VB 5I19L 4HWBA 4KRLB 5F7DB 3DSFL 5HYSA 4DUWA 4DK6A 5EN2B 3O2VH 4HG4K 3TT3H 4OCNC 3O0RL 4PLOB 4FXKA 3CFEA 4LVHB 2XZCH 1DBBL 3QWOB 2WW8A 3JV5A 5ICYB 4XGZA 4OQ1A 1G9ML 3OKOB 1PKOA 4ODTH 1UWEH 4EN3D 3C09C 2X1OA 3L3HA 2OLDA 5C0DB 4Y4FB 4G9DB 4NQVA 3QYCA 5CJ5A 2HP4A 5ABDE 5DHVH 3AM8A 1J11A 3MNWA 1G1CA 5MEPB 4EUPA 1IAII 4DGVL 1PGRB 4XNUL 2WWKO 5C09E 1T89C 4WW1B 1EK3A 1I8KA 4GMTL 4JGJA 5DZLA 5GSRA 2IBZY 2ADFL 2H2SD 3OXSA 4OZHB 3SKOB 1KIUA 2CMRL 4U1GB 3T0VA 1M71A 2BNQD 3MJ9L 5FM5O 4QRPD 4KJYA 1QLEL 5FYKU 1MI5A 5SWZA 2FIKA 3BT2H 4NO5B 2MCPL 3TYGL 1YY8B 1CLCA 4EI5B 1X44A 4ZXBA 5LG1A 2HLFC 3GJFA 3IJHA 4TTDD 4Z7OE 3NCYS 1MHPL 3WD5H 5D93B 4KVCL 3OG6B 4WRLA 2X9XA 3DPBA 4YDVB 3CD4A 3MFFA 4HH8A 4M7LH 1TJGH 5CD3B 1XIWB 2DTML 3GM8A 2CD0A 4LQFL 4MZ2A 2CJUH 5DD1L 2DWDB 2ID5A 4PJ8D 2BSED 1I9JL 1UACL 4OAWB 2YD1A 3U48A 2IFFH 5DD5H 5I74B 1XCQA 3M07A 3TWCL 3RDTC 4ZXBD 5D1XB 3BP5A 4W4OC 3WDJA 4H88L 1HDMB 3GSNL 4GXUN 1T89A 5F9JB 1EBAA 4UT7H 1EEYA 5C9KA 1PX4A 3KPPB 4N8CL 3V2AR 4G7YL 4ALAL 3LQAC 3O45B 3ARRA 4QRSB 2SEBB 2CXGA 2NX5E 5FO8A 2E6JA 1UQSA 4QF1A 2BERA 3O6KH 4ZQKB 1I1YA 3MRIB 1IAOB 4NKMB 4OZGF 2X4RA 4GBXD 4X6FA 4HBCH 4KHXL 4MJ6A 2Y36H 1MFDL 4MJ6B 3LHPL 4PTUB 1CGSH 2HJLA 1CXIA 1NFKA 4WW2F 5E94A 1G7QA 4QY8A 4LARH 1XF2A 1TQCB 1FGVL 3UYPA 4Y4HC 4MJIB 5KG9B 2X42A 1HINL 5DRXA 5EC1A 2XFXB 3CAFA 3VXSA 2EYTA 4JG1L 3GSNB 4AG4H 4XH2B 5JZ7D 3EJYD 3C6LB 3U9PH 3ORJA 1PSKH 5E8DH 3J7HA 4X80H 1G7LA 2VRAA 5BZDA 2J4WH 1MCRA 1NBZB 1I8MA 2Q7YB 3SGEI 4ZFOL 3QFJB 4LKXB 1I9EA 1H8NA 4WDIA 1KACB 3PGCA 2FIRT 1JPTL 3CFKA 3U79A 1PZUB 1WK0A 2AEPH 2RGSA 3RJQB 3SDCB 3RVTD 3QUKA 1PKQE 4XWGL 4MA7L 3HG1D 1RK0A 3LV3B 4NM8L 3WFBH 4KZEL 3G6AA 1LO0H 4GS7B 5IW1A 1U2CA 4PP2B 4MXQC 4Q6IB 4M7LT 1HINH 3O2WL 4MQ7B 4LSQL 1F4XH 1RULL 4HCRA 4Q9RL 2GTZA 2Y6SC 3TBWB 1LD9A 1CVSC 3U83A 4U6VL 3P9WB 2IGFH 3FJTA 3TGXA 2EDRA 2DLEA 1SY6L 4QYOB 2I9TA 1I1AA 3P0YL 1F6LL 3V6OA 1NCCL 3B43A 3PQYA 1P7HL 4OGXL 2Q87A 2UZXB 2XZAL 1OLZA 4J8RB 3ALWA 4CVUA 1RJZB 4HS6A 2IEPA 2G9HA 1K4DB 1IZKA 3ARBD 3FONA 5CILH 4OLZL 3MREB 4UINL 4LQ1A 4K71C 1OP9A 2EE3A 5M94B 4OKVA 4YDIL 2E8ZA 3LKRA 4RWYL 1TFHA 2ZJSH 3NN8B 5TDOB 2GITA 3EO1A 5FOBA 2H2PC 2N7AA 2Z31C 1EFXD 1S9XA 5KVEH 5T1KB 5C0CB 5DURB 3RJDA 2BVUA 2V2TA 1OL0A 1LEKA 4GW1B 3F7YB 4PJ9B 3JWDL 2G5BB 2VZSA 1YDPB 2QJDA 3GB7A 4JR9H 4WEBH 4JQVC 3UP1A 4KJWC 2CLZB 4MNGE 1G6RL 1QSEB 3ZT6A 2F54D 2FIKB 4JQXC 1S7VB 1MIEL 1QSFA 4GAYB 2NY5H 1HI6A 1J05B 1YEHH 3F6IA 4UU9A 4XT1C 4ZO6A 1PEWA 2EC9T 4HFUH 4KRPC 5ICXA 5BW7A 1H3XA 4RRPA 2UWEB 3E2HC 1EDQA 1HOCA 4JVUA 1NCCH 4GKNB 3QUYA 3KYNB 3GUTB 1U8NA 1V3MA 2ZUSA 3ARDD 1JFQL 1NAMB 3E8UH 3IT8D 3F7PC 2CIKA 2IGFL 1XGYL 3F5WA 3MLYL 2V2WB 4XRCB 3GI9H 3VFTA 2XRAH 2IPTH 5TF1H 4M1GH 5DEZA 3RL2A 1DR9A 4XRCA 5JORB 4NDMA 1ZEAH 4C56D 1F4XL 5IMLA 2XTJC 4Q7DA 1H8OA 1FH5L 4Z7NE 3W5NA 5D1XA 2AEQH 3CVIH 1R3LB 1A7OL 5T3XE 4YHMH 5CZVH 5DDHA 1FP5A 1GC1L 2NY4B 4X99A 1CL7L 2DQUH 4HMCA 1DQQB 3DECA 4KTDL 2A9NH 2EYSA 4P46B 1BFOA 5GGRY 5TJWK 4P4KB 1EO8H 1U8HA 1IQWH 4PGCA 2A38A 4MNHB 3QCTH 3QUMH 2APBA 5T5FL 1HHGA 1KFAL 1YEKH 5EOTA 4HEME 2GJJA 5C0BD 1MRDL 4CJ1A 3PG2A 2MFNA 2X4QA 4X6FB 4XC1H 5DR5L 5DA4A 4QHMB 3HZKB 4RMQA 4JDTL 3SJVA 3QWQB 3QEGL 3D3VB 3FCTB 3QISA 4XVUD 1MLCA 1QBLL 1JWSA 5I9QB 2X89A 3X12A 4YDKH 5IQ9B 3RWJB 1F13A 3RWHA 3LEXB 4PFEA 3T04D 2C9AA 5ISZD 1R24B 1MJ7L 3RWHB 4EVNB 1N26A 3ECBB 4NWTL 4F3FB 5I74C 1ZEAL 1D7FA 5DC0A 2PYEE 1CLZL 1T5WB 4F58L 5BV7H 3NFNB 4N0RA 3NZ8A 4Y4HB 3VWJD 4UTAH 2R23A 1T4KB 3IU4L 5A1AA 4D9LL 2Q20A 5HYQB 2Q1EA 3MJ6A 2Q7NA 2PR4H 2Q6WB 2NW3B 5C08A 2QKIA 5F9OL 1FC1A 5J56B 3ZDXE 4ZNEE 1JGDA 1AD0A 3G04B 2FWOB 1L7IL 3U0TA 4JZNA 4X4MA 2DQHL 2X4NA 3I6LD 2J6EH 2X40A 4PRNB 1A0QL 2BNRD 4OD3H 3MRNA 1FLRH 1EJ6A 1F8TH 5DJ8B 4LRIA 4TRPL 2DM4A 1K8DB 2VLLB 4XP6H 1RIHL 4LLVB 1DQLL 3G6AB 4K94H 3W2DL 2A83B 4LLMA 4HGWB 1OPGH 4JY6A 1N0LA 1ZVYA 3A6OA 2CXKA 3MRMA 2R29H 3C8HA 3IFLL 5L6YL 2HT3D 5I1KL 1DANU 4K2UH 5IMMB 3ALXA 2B2XL 3K2UH 3PV6B 3NPSC 4AQOA 3TP4A 3WYRA 1T1WB 4XPFL 4TUOA 2WIMA 3QAZB 3PV6A 1P2CB 4NPYA 4I0PB 3VFWA 4LHUB 5CLTA 1BMGA 1NDGA 5DGRA 2VOTA 3MPCA 4QTHB 1Q9KB 2Q7YA 4LCCC 4OCLC 4TTGA 3NZHL 1MCPH 1Y6KR 1ZAGA 2CUHA 4NO0A 1KCRH 3QIWC 2GSIB 1NFIA 2QHRL 5ENWA 1WFUA 4NJAH 1DLHA 5KAQF 4G8IB 3IAQA 2X2YA 1NAMH 2BVTA 4Y5YB 3UBXB 4YXLH 3HPJB 4P0DA 4L29B 3FB6A 4LGSB 4E5XB 3LKPB 5BRZE 3P3YA 4R96B 3NPZB 1OP5K 3TJEL 5F8QC 1UCBL 2ZUWA 4OD3L 2Z35A 3EJZD 3FO1A 3RX8A 3Q3GB 3G9AB 4GW1A 3I9GL 2DQCH 3O41B 5E5MB 1MHCB 1NGQL 3M17B 3HG1B 1FIGH 3ZKXB 4IRSC 4S11A 3BPLB 4M1DH 3VXUB 4GRLC 5EUKB 4ZQKA 2C3VA 3O6FA 4IRJB 1PFCA 4HKZB 4Y16A 4RFEA 1IM9A 3WE6B 2JTDA 1WZMA 2PTVA 3WNMA 2GY7B 3UTPD 4JKPH 3L6FA 2R0LL 4UIKL 2ESVA 4KJPD 1CXKA 4FG6C 2C4FU 3BP7A 3FFDA 4JHAL 3RBGA 1FRGH 3BD3A 5DK2B 3Q6GL 3BQUC 4R4ND 3V0WL 2G60H 2CIKB 3O9WC 3M1BB 5MEPA 5FHAH 3ARYA 1OD9A 5DRXB 5ISZE 2Y07H 2OZ4H 4GSDH 4PV9B 5JIIA 1JPGB 1NCDL 6CGTA 3CK0H 2B1AL 4PJFB 3DV4A 4FZ8H 4JFZH 4JVPA 4P4KC 1JPGA 3FOLA 3O3AB 3S34H 3OGCB 4QNPE 1S7SA 4O4YH 4XAWL 1OWRM 1FGVH 1NUNB 4XVTL 2ZPKH 1NL0L 3OKLA 4NO0D 3VI3E 4FS0A 2A9ML 1KIPA 3DX7B 1EFXB 3S35L 1CFNA 4WUKH 1UENA 1KN2H 3V4UL 4LDEB 4P46A 3ROOB 1IEAB 1LK3H 2DLTA 5E6IC 2VLJD 4GMSL 4N5ED 3L1OL 4PRIA 5IHZB 2BDNH 4BH7B 2GCYA 4AM0B 2NXYB 3DXAE 3ZSTA 4KTEH 5E8OA 3EAKA 1TTUA 3P73B 4P9ML 4WJ5A 5EBLB 2IWGA 2FEEI 2H32A 2HH0H 3EOBA 1U8NB 5CKGA 5DJ2B 2X4UA 3VXUE 1C08B 3E2HB 3O4LA 3EHBD 1AFVL 1N6UA 4L8SC 1D9KC 3WUWB 5EU7E 5DURD 2P24A 3NIDE 1EGJH 4QHNB 1WBXB 3PGFH 2YUZA 4KV5E 2R56L 1JL8A 3BVNB 3DO7B 2YD9A 4NO2B 5IR1A 1IC7L 4GG6B 1BBDL 3HA0A 3KPQB 1ZHBB 4QHLB 5CWSA 2A6DB 3SGKC 5BO1L 3BD4A 1TITA 2OBGA 5CIPB 4FMKA 2DQJL 3CVHL 4DFIA 4MNHA 3W0WB 2VH5L 3TO4C 1IAOA 1U8PB 5C71A 2NTSP 3IU3B 1FJ1B 2DLIA 2QTEA 4P59L 1XGTA 4MJIE 1VGKA 5C0ND 3FT4B 1VPOH 5BRZD 5E08L 3D25A 4XP5L 2BNQB 3L1OH 4HIHB 5T1KA 3BMWA 4CU8A 3L3GA 4OZHE 4ZPTB 3WN5A 3U0PB 3L5XL 5DJYA 5ITFB 4NQCD 1RD6A 3HB3C 3TCLB 2NZ9C 3PV7A 4Q58C 4PJ5A 2AEWA 3VJ6B 1D5MB 2ZUUA 1LO4H 2MQ0A 5E8PB 2AJUL 2DJSA 1OP3K 2EYTB 3TN0B 4GAYA 3MV7D 1JZ2A 4GRMA 3DROA 1WZ1L 4N9GB 4K55A 3S36H 2PR4L 3TIDA 3FN0H 1CTOA 2VABA 1QFWM 2BSTB 2VLME 5GPRA 4LIQH 1ZLVK 3ROLB 3MODL 3TVMD 3D2UD 1B0WA 1JGLH 3MZGB 1HCVA 1B4RA 3EFFA 3KG5A 1F4WL 4OGAC 4MCZB 3IDMA 3SOBH 3MLTB 2ZUTA 3GHEH 5E2UL 3GBNH 1S7RA 3QUZD 5JORA 5E2TL 4U4BA 1DJSA 2HWZH 2W60B 1I3RA 1NCBL 4XAKD 2GFBB 3DYPA 3TT3L 1QYGH 3GSUA 4P2OC 2FRGP 4DUVA 5IJVA 3MOBL 3N85H 3MA9H 1I85C 4ODBD 4WUUE 3WO4C 1G6RB 5HVHB 3K4AA 1OVZA 2D4FA 3FHAA 1NGQH 1SJHA 5ICZB 1AGCB 3D39A 1FNHA 4L3CB 1FRGL 1H8SA 1GPOH 1RFDL 4F37F 4PJCA 5F7YC 5I8KH 2EECA 4PRDA 4MQSB 3DUSB 3ZKXC 5BV7C 2AJVH 3U30B 1CDCA 4LVHC 4MAYD 1N6QH 2XWTB 1R6VA 1KJ2A 1ZV5A 2DYPA 4KHXH 4QEGA 1NAML 5DMKA 3PXJA 4MA1B 5BCAA 4YHML 4MNQA 4JFQA 1IGIH 3TA3D 2FJGB 3AY4C 3BWAA 3L5WB 3VD5A 1JI2A 3I6KB 4S1DC 4DN4L 2IPTL 5TF1L 5ILTL 5TDOA 1BGXH 2IANE 2GJ6D 2EZ0D 1D6EB 4XNXH 1LEKB 3VDCA 1JFQH 3WNNA 4Y4HA 4F7EA 5I9QC 4PJ9C 3T65A 1FNGA 3KPMA 5K9OB 1AE6L 2OP4H 4P5TB 3MCKB 3MRRB 1ADQL 1ODAA 4HW6A 5MHSE 3IDXH 4LVEA 3TO4D 1BPVA 3MFGB 4FFWD 3PHSA 4ONGL 5I2IB 1CFBA 5IKCB 4OZGB 5T3XD 1U3YA 5GZOD 5I8CB 4HPYL 3WJJC 2PW1B 1A7NL 1WQVT 5J1AB 3MJGX 5DJ8A 2EKJA 4XAKE 1G7QB 1NCWH 4JFDD 3TO2B 4KJPC 2MTPA 3VFVA 4QXWA 4TSBL 3MLSH 3KXFE 3KYKL 4OGXH 5FKPA 4HKXB 3GMNB 1JYVA 3FQRB 1IEHA 1D9KD 4NC2B 3S5LG 1JZ7A 3N1MC 2YZ8A 2YWZA 4KQ4L 3VXMB 3ARED 2RFXB 5EO1B 2ZOKA 4DEPB 1T83A 3O3AA 3MV01 2E7LC 2ZUVA 1KTRL 2HJFB 3DVGB 2VDKH 4UTBH 4U7SA 1JHLH 4PB0L 4MDJA 4J3TA 4WDIB 4Y19A 1J1XL 2ERJC 3MMEB 5FYLD 4MNQE 2YD8A 3L9RA 4HLJA 5LGHH 5D1QB 5DJZA 4LKCA 3V6FA 5C70A 1PAMA 4CBPA 2GAZB 1RZJC 4KROB 2X4PA 4FQXB 1NBQA 5KBNC 1KGCD 3VG9B 5HGGS 3P73A 4Z7NF 2ORBH 1JI1A 3NABL 3D25B 1A2YB 1Z3GH 3TBWA 2VXSH 1ZA3A 1TCMA 4W70A 4G8EB 4X80L 3HG1A 2XI9A 1YEEL 1SHMA 5GRYA 4X6CB 5HHNA 3LIZL 4J6RL 1A1NB 1A7OH 5EN2A 3B4NA 4FG6D 1WBYA 2VXVH 4KK6D 5SV4A 5CGYC 1A1NA 2W07A 3QRGH 4PB9L 3ME0A 3QWOA 2R23B 1JYWA 5GRZA 3DHMA 4KPHH 1ORQA 1TZHB 5A43C 1KJ2H 1J8HD 1JUFB 4MD5A 2G2RA 3QCTL 3ROLA 1ETZA 2W65B 5C7XL 3FMGL 5D7IB 4OM0L 3C5SA 4Y1AB 5HJ3B 5H35B 4XCEA 1A9BB 3VXSD 4RNRB 4L4VB 3MXWH 4LEOB 1KG0B 2VDQH 2O93L 1GCFA 5EZLB 3T8XB 2V7NB 2EEDA 2ICWB 1ZTXL 1Q9LB 1I8KB 4KRMB 4HAFA 2J8UB 2VLLA 4QRPE 3V6OC 2AJUH 5JMRA 2HVKB 4F7CA 1IBGL 1JZ8A 1FAIL 4W81A 4G5ZH 4HJ0C 2R4RH 4LSDA 5HXMA 4JO4H 2JCCF 1RPQA 1FGNH 3GSWB 4YFDB 2B1HL 2R0KL 3IETA 4ZAKB 1A6UL 4KQ3H 3SBWA 4ZAKA 1E27A 1JGVH 5ANMA 2Q8BH 3IJHB 5L0QB 2X1PA 2EICA 4PJAE 4TVPH 1DTUA 1JHTB 4ZFOA 2CLRB 1CICA 3R4DA 4DTGL 5KANG 3HUJB 4KWUA 4IRSA 4DVRH 2NYYD 5D71H 3B83A 2YPVH 5JW3H 1A6TB 5FAAA 2E5EA 1YNKH 5DMGC 3GGWB 1ADQH 1GHFL 5ESQB 5I1IH 3UBXI 1A3RH 4H1LA 3H9ZA 3PWJB 1Q8MA 3BVNA 4O5LL 1TNMA 3DUUA 1MCWM 4KUZH 4HIJB 3ARVA 2NQCA 1HHHA 3MRJA 2VZ3A 3PWJA 3SKOA 3V7MA 5I1JL 1ZLSH 3KPLB 2MCPH 5J1SC 4JO3L 3QIUB 1CU4H 5F9JA 3BE1L 5IVXA 1MI5E 3SBWC 5MERA 3KPLA 3N0PB 1NDMB 4NC1E 4R26L 4EN3A 4P5TA 5IFHL 1R3JB 5HHOB 2XN9A 3BGAA 2J8UF 3ZL4H 2VDQL 3QAZC 4NCC1 4L8BA 4RQQB 4M43H 1MLBB 3MLUH 1QRKA 4DAGH 2X4RB 4ZUWB 1U58A 4ZNEA 4G5ZL 1B0GB 2AJVL 3SE8H 4NT6A 3ZE0E 4AH2B 2MJWA 3IXAA 5EC2A 4PJDB 4UI2A 5F7MC 3IVKB 5IVZA 3HNSL 1CDUA 1ZTXH 3RIFF 2YKLH 5EB9A 5EOQH 4AH2A 2NY2B 1ED3A 4KFZC 3GHBH 3LN9A 3VXMD 3LH2L 5HHMD 4U3HA 3BQUB 4PGDA 1DBAH 3VFVB 1NJ9A 4M62H 6FABH 4I18A 3A67L 3V7AG 1A64A 4G6KH 2NY0C 3RHWK 5I8OL 4TUKL 4LNRB 4L3EB 2CO7B 15C8L 2D7TH 5IESH 4M6ML 1P53A 4X6EB 1X5HA 2QSQA 5C0DA 2VLRA 5DYOB 5D6CB 1FJ1A 1JHKH 4Y19B 3T0EE 2VDRL 2Y1VA 1NBYA 3ROOA 5HGBA 3W5MA 3LHPH 1IGTA 4RFNC 2NY1B 4O9HH 1UADC 1T66C 4AM0A 4BFEA 5KSAA 1REIA 1Q72L 4NZJA 3KS0H 2CDFB 2V5RA 1AIFB 3F7VB 4OIBA 3MLZL 3CVIL 1N59B 4G43B 2RAMA 4OZ4A 1RK0B 4Z0XB 4BELD 1WBZB 2DLFL 5J11B 2VC2L 3UTSD 5E2UH 4E41A 2EYRA 5JO5A 2O5XL 1YZZA 1FYHB 4QXUH 2F5BL 1JGLL 3VE0B 4UBDD 4P5MA 4JFDB 4CMMB 3DO7A 1D9KA 4JPKL 4FFYH 3SE4C 4M43L 2Q86B 4BK4A 1ZLWH 1U42A 5HYJA 4Y1AD 5EU6D 4HXBH 1WWBX 2W1NA 4JKMA 4KC3B 3IAPA 3U9UB 4PY7A 3SGKA 5SWQB 1AXSA 1ND0A 4YX2H 4MD5B 3KHQA 5J11C 4APQD 1U8PA 2LVCA 3MLVH 1T66D 2JJSC 2BMKB 2NTFB 3VDAA 2W60A 3GBML 3NIFF 3IFOA 3OBAA 4YHLH 2VUOA 4L5FL 2GFBA 1G84A 1CDGA 1G9MC 3RZCC 1OY3B 1U91B 4I0KA 3WD5L 3VWKD 2H2SC 1QQDB 1NSNL 1A4JB 1RZ7L 4LSTH 5GGSA 2H2PD 3ZTNH 4JN2A 1YYML 5C6PB 2QSCL 2CKBB 2NY7L 3GO1H 2AXHA 1QR4A 1MCIA 3ULUC 3GK8L 2ARJQ 1FDLH 3CFCL 1DLFL 3DOSA 2X4SB 2AXJA 4LASL 4YGVA 5D93C 1SMAA 3M8OH 4PRDB 1UH4A 3TN0A 4G9FB 4RGNE 4EDXB 5ID1A 4ODSL 4CL7A 2GJ6E 4RAUB 4XCCL 5ILTH 1OLLA 2V9TA 2B4CC 4OFYD 2ESVB 4EI6A 2N56A 2QEJA 1BBDH 1BJ1J 3QEUA 3VFNA 5F6IB 2UYLA 1L9MA 5HDBF 2C5DC 5GSVB 2F5BH 4KGJA 5TE7H 1MRCH 4B7IA 3FT3A 5GRXG 3V52H 3MBEC 4NN6C 5FM5M 1T2XA 2B5IC 1I3RB 4O58H 5I1CL 3C6LA 5DFTA 3WIFB 3DGCR 4PJFE 5K9OA 1G9NL 3IFPB 2JK5B 4N0UE 3T1WA 2EIDA 1EFXA 1C1EL 4KKAC 5H2BA 4I48B 1CGVA 4XP9H 3I85A 4HV8A 5HGHB 3OKMA 4JLRB 1EERB 1T7VA 2BHUA 3C60A 4GW5A 5JHDA 3ARGD 3P4OB 4FFZL 3CFJB 3QI9C 3X3FL 1KPVA 3UZVB 4OQTA 3O9WA 3PF2A 4DW2H 4F80A 4ZFZA 2JB5L 5J1AA 4GRLB 2EIZB 5DQDH 3RTQB 1F6FB 3HB3D 2IMMA 3QH3A 5B39B 4M3JA 3FOMB 1WZKA 2XY1A 2Y7QB 3MODH 4G9FE 1UZ8A 3D6GA 4WWKA 2IPKB 3MBXL 1UH2A 3C9NA 1MHEA 4QXTA 4BH8A 2OCFD 3ZKQD 5CZVL 3MX0A 1MFEH 4XI5C 5IB3A 1BQLH 4X7SH 4TVPD 5DZOA 3BZEA 3DGGA 2HJFA 4GXVL 1BBJB 4ZO7A 4AK1A 1R24A 1I85A 1EEYB 4KJQC 3LVEA 5KVGL 3VU2A 3UAJC 3VGGA 4MXWL 5BJTA 3OR7B 1JWMA 3CSGA 1CGWA 1XEDA 4ODUB 2D03H 3MLWL 5JA8B 5INCB 3L3IB 5GRUL 2A6IA 1MUJA 5DXWA 5C9JA 5J89A 2VXUH 5FYKH 3EYVA 3ZHLA 5D7LD 5C0EB 3NA4A 3NIGE 2C4FT 3V4PH 1AD9A 1DVFD 1DBML 4PREA 2BNRE 4RQQA 4OV5B 1C5BH 5MI0C 4WWID 5CMAA 1YPZF 4O51B 3ULVH 2EIBA 5C0IB 3QDJB 4LRNL 2V2TB 1U41A 1QHOA 5C6TL 4GKSB 4Y5YC 3ILQD 1MCEA 4NZUH 1D5MA 1AJ7H 5I1LA 3QNZA 5I0ZA 1ACYH 3NIGF 4YBLC 4ZMAT 3W11D 4XX1G 3KHOA 3LEXA 4KDWA 4G6AC 4WI7A 1J10A 2EEBA 2LU3A 1KCSL 3I84A 4L9LA 2ESVE 1GOGA 3ES6A 5J13B 2JIXD 3L95A 1MCSA 2GHWB 3FAXA 4QRRA 5TE6L 1OW0C 4C56A 1BM3H 1LQSR 5AYUH 4CVXB 3MCLL 4KKAD 1C5BL 4YPGA 3SKJH 3ZYZA 4HPOL 3BPCA 3X3GL 3FN9A 3D85D 1Q0YH 3NFPB 3GEWB 2PTTB 1A1OA 2AK4B 1H3WM 5E8NA 2YHGA 4AIXA 1OARL 2HFFB 1T0MA 3OZ9L 2PO6D 4GO6B 5DC9B 5I30H 3SDYH 1YUHB 1F11B 4OB5H 2PYED 1KT2A 1MI5D 3QDGE 3SCMB 4NQTA 1FVEA 1KN4H 5ITBH 4I0CC 5GGUB 5SWZE 3ULVL 5DDHB 4KUCD 2BVOA 1LGVA 1CIDA 1DQML 1E4XH 3TCXA 4X7SL 4Y4KA 5BXFA 2F8VA 4AENB 2AJSL 1MQ8A 3LQMA 4AQ1B 2R2BB 3H3KA 2J2ZA 4QXGL 1WIUA 2YBRB 3HS0A 1INQB 1VEOA 3FO2B 1H5BB 2WQRA 4S1SL 3SY0B 4TQEH 5JOEA 2PKDA 4L9LC 1WT5C 5F89B 4PIRF 4R0LB 4IRZH 4FQHB 4O2EB 1HXMB 4X6DE 1IGFL 5HDQH 5F89A 2OJEB 4UNVA 4JM2C 1OOAA 4U1JA 2F53E 4HS6B 1RJZA 2YPLB 2RJMA 1V05A 1NLDH 3ELAT 2P8PA 5I71B 2WAHA 3GJEB 1G7MB 4QOKB 1YNTB 3AS2A 2EC8A 3FL7A 3UAJD 1A6AA 4ZYKB 2UV3A 3WKML 1Z5LA 1R3HA 3VG9C 3HE6A 4MJ4A 1WT5A 1TVDA 4JVWA 1AHWC 2ORBL 4IJ3B 4EDWH 4NRYB 5F3HA 4C55A 1BOGA 1NUDA 1VHPA 2B5IB 4R4FH 1JZ3A 3S97C 1QSEE 4TNWF 1YPZB 2NXYD 4JLRA 2WUBH 3PL6A 1UM5H 5I8CA 5L9DL 3VD7A 3V6OE 5EU3B 4I0PC 2F19H 4D0BB 2APXA 4GUPA 3QA3A 1IM9B 3ULVE 1GC1H 3HC4L 1IAIH 1C16B 1OARH 2UWEE 4H25B 4PRIB 3TLRA 1RIVH 5IHZA 2NY4D 4LOUD 1FL5A 5FUCE 3DIFB 2LE9A 5IFHH 1W72H 4Q9QH 1CE1H 4D3CL 3OKKB 4LLMB 4EI5D 4MB4A 1CE6A 3O6FC 4LLQB 3NGBC 2QQQA 3P9LB 5FYJE 4U6HB 5FK9B 4N0YH 2OI9B 4FTVD 3V8CA 4FHBD 5DK0B 5M7QA 3EHBC 1AQKL 4CJ0A 4OCSH 1I3UA 1ZK9A 2AI0L 5D8JH 3B9KA 5E4EB 4PJ7B 2O61A 4B5EA 4OZHF 2FX7L 1SY6A 5TQ2H 3TF7C 1JZ5A 2F5AH 2R1XB 3BEWA 2YUVA 2CKBL 3MRBA 5KTEH 3NH7L 2WWMD 5B38A 2IAMC 1U93B 4P2OD 1T1YB 1Q94B 3MRBB 5KSVB 1SJEA 4PJXB 2ICEB 2ATKA 5ENWB 1UC6A 1OT1A 4HD9A 4NIKB 4YZFE 3VRJA 4H8WC 3U4BL 1T7ZA 4OZFG 2BDNL 1MHPH 4JJHA 1U91A 2P5EB 5FYJU 3FT4A 5AZEL 2QR0A 1M7IA 3HLAA 4WFHD 2Y7QA 3UTTB 1MY5A 4PJIF 4NZRH 5EBMA 3L3GB 4ZPTA 1A4KB 1H3PL 5D5ME 2NY2C 4W4OA 3M17A 3MV9B 4QNPF 4NP4H 3LRHA 2DQHH 2WUCL 3FQXA 3S98A 2H26A 1RY7B 25C8L 1I1AB 4RMSA 1MJ8L 1NEZB 2ICWI 3O8XD 4OGYL 2R69L 4K8RC 4Z7WB 3EFDL 2DM7A 5FM8A 1INEL 1G7JA 5HYQA 3F7RA 4MXWH 5ESVA 2UUDH 2A0LD 1MUJB 2J7LA 1MFBL 3DX6A 4WVRA 5DQ9B 4YPGB 5F97E 1RUAL 2VAAB 1OGAD 1Q9OB 1TJIH 3FB6B 2OL3L 4MHHG 3OF6A 4J23A 1FVDB 3C8DA 1EZVX 4ONFH 5C07E 4OCRL 3I3BA 2YRLA 3QJFA 4LSQH 1S9XB 3LKQA 1MRFL 4JAMA 5BVJB 4HGMA 4LHUD 5FHBH 4FABL 3QUML 3IXTA 4N5UA 2VLKD 5F7HA 3O0RH 3E3QC 2BY2A 2YXMA 2V17L 5DJDB 4HLZH 1SJVA 5HPMB 5ESAB 5FUOH 1LEIB 3F62A 3QNZB 1HYSC 3FQWB 3RWGB 3LZFH 3S96B 2HT2D 2M2DA 2VQ1A 3MRMB 4N0UA 2J88H 2VXSL 1M7XA 1TZGL 3OKDB 1UZ6E 4KRPD 4F7TB 4HG4J 3O2DA 3P4LA 1P7QB 1U8KB 4MAYB 4GG6F 3L95B 5EUOB 3TJEH 4XI5D 5B39G 2EH8L 1EO8L 1QFUL 5GIRB 1M6OA 1DVFA 3GI9L 3VXRE 1LE5A 1WC7B 3W9DA 2W92A 2FECI 2RIKA 3OZ9H 1QKZL 1MHHB 1AGDB 3CIQA 4R0LC 1CIUA 5CEZE 3X3GH 2APFA 4G8IA 1MCDA 2HFFA 4JDVA 4NQDE 4RFNB 3VMNA 2D31B 2H41A 3R1GL 4FQQB 3MV7E 2GY5A 3L5WA 3T0AA 4P3CL 4TPRH 3QI9D 1Z0MA 4LSUH 3ZDYE 2R0WL 5F7FA 3ULVC 4R4BB 4HFWA 4D0CB 4PRPA 1NGYA 5DSCB 1BIHA 1KYOK 1MH5A 2PO6B 4U05A 4OTXH 4DQOL 3MZTA 4JN2B 4U0RB 2P48B 4P2QB 1CXEA 1MI5B 4P2YA 3FB8B 4KHTL 5TPWH 2ZCHL 4P23B 3R06A 3ISWA 4L9DA 4PJCB 2NLJB 2P5WB 2W38A 5D2NB 4DVRL 4UBDC 4GRLA 3HCVB 1P69B 3H42L 4YDIH 3HC0A 3NCBB 5JQHC 3SDAC 5A2LH 5JOPE 1IE5A 4OLYH 3MRHA 4EI6B 3RUGF 3WJLA 3NA9L 1L7IH 4XPFH 2ZCKH 2FX7H 3K46A 4K07A 1IFHH 4QRPB 1P5VA 4U1LA 1S7QB 5IK3A 1MCCA 4YAQA 4DQOH 5DVNA 2X9YA 1DQLH 5HYSB 1YNTA 4I77L 4JRXB 3HZYB 4J2XA 4OCWH 5JA9A 2NXZC 2BX5A 1N2RA 1UJ3B 3HZYA 3CXDH 3QO0B 5CFHA 3SE4A 3L7FB 1C5DA 1NGPH 1WWCA 3LD8C 3RU8H 4S10A 3TT1L 1VFMA 5EU6A 4K71B 3ZSSA 1X9QA 1T80A 1JWUA 5FUZH 1HSBB 1LP9B 1NBYB 2B0SL 4F9LA 2UZYB 2WSKA 3WFEH 5MENA 2DIBA 3BKCH 4XCFH 4PJHF 1NKOA 4JO2L 2HKFH 4OCYH 3QEGH 1BQHG 3T2NH 1FHGA 1OAUH 2PYFA 1CLYH 5D1QA 2BHYA 3BH9B 1MCKA 4Y4HD 3L7EB 5DJYB 4KI5C 3RTQC 1CXFA 1J7VR 4TNVK 4Q6YA 1FYTB 3JXAA 2WM0A 3SN6N 2BFVH 2CUMA 1HHIA 4RGMC 3CK0L 2QQLL 1J1PL 3CZFB 35C8L 3PWLB 5D2LE 1UA6H 3VE0A 4IDJH 4MQ7A 1MAMH 5CBEA 5EC1B 1BVLA 2V2XA 4PGZA 4JM2F 3GMRA 5BVPH 4ZTPL 1H0DA 4ZFFA 4UILH 1G7HA 3MLPA 4X4XA 1WBYB 1MVFA 2BVYA 4GQ9H 4KI5F 4TYUA 3X3FH 2R1YA 2PTTA 2ED9A 3D0LA 3MLYH 3VFMB 3QO1A 3UTZB 2J3SA 2NY5C 1MCJA 3CSPA 4L8CA 3FONB 1Z9SA 5J4MA 4MD0A 3RVTC 2DQFB 4M62L 3TNMA 5C86A 4UTBL 4WTZA 1T6WA 2MQ3A 1BVKA 4RX4D 1HDMA 4UT6H 5DEGA 1AGBB 4WGWB 4WCYL 4RISH 4DKAA 3CXDL 3WN5B 4GKSA 4P57B 4P4RB 1U0QA 5DEGB 4UB0H 1KNOA 3NTCH 3E6FB 4X6BA 4BKLB 1KV3A 5E99L 4LCYA 5T33L 1EUUA 1OTUD 2ZCLL 3RTQD 1I1YB 4AEFA 2VERN 3KWWB 4HIIB 4JG0H 4ORZC 2OSLB 5ICYA 1GHFH 3SQBA 4Z7WA 5DFVD 5AWNL 4HWNA 2W91A 4Y1AE 2X4OB 1ZHKB 5I1JH 1G7MA 3OPZH 1ZSDA 5GJTL 3IGAB 2E9IA 2DMCA 4PV9A 5DJAB 4K2UL 1Y6MR 3QJHB 4L3ED 2R29L 3QUZC 3H7BA 4LEOA 3QG6A 1P7KB 3LY6A 5KVDL 5JQ6H 1RUKH 4K94L 3W2DH 4WW1A 4OGAD 4P2RA 4H1LB 4LPWA 1SBBA 4HGKC 4V2BA 4P23C 5T1KD 5C6TH 1MCQA 1EH9A 1FZJB 5JDSB 1Q9LA 1A9EA 3AMLA 1CXLA 4LRNH 3RNKA 3FRPG 3H3BC 3KR3L 2EEAA 1FZJA 2LAGB 5BZDB 4F33A 3FQWA 3HAEA 3LEYL 3D3VE 4G6ML 4M7JH 1YPZA 5D7SH 3GMOA 5KN5A 1VFAA 4IIQC 2OI9C 3JWOL 2VR5A 4YHYC 1SJEB 4KK6C 2BSSA 2GW5A 4GOSA 3KPRB 2OR7A 4NN5B 1Q9WA 5HGDB 2NY4C 3S37X 1A1MB 2DI7A 3V6BR 5I1EL 2DKUA 3SE9L 3PL6D 3ARZA 1DE4A 5E00A 1ZS8A 1YEFH 5TGBA 4I2XB 5SX4I 3VI3F 2FR4B 2BSRA 1WWWX 2NY1C 4MAUL 3IVKA 4PRHA 5HVHC 2BSRB 1U8LA 5EORL 1V3KA 1YMMB 4XAWH 4HWBH 2AJXL 1CG9B 4MQXC 1T0PB 3DV6B 5FGRA 5IMLB 1N3NB 3NCEB 3RY6C 3LS5L 4CNIB 4JFOA 1XH3A 3GKZA 4CNIA 4WFFE 4MXVF 1X5YA 4Y88A 5E2TH 4Y19D 3W0WD 4O2CB 1H15B 1Z9OA 4NYLB 4JY4B 3WFCL 1RZJL 3K1KC 1YEKL 2UVFA 4G9DA 4K9EH 3CU1A 1H15A 2R9HC 1QBMH 5ALCH 2HN7B 2NLJA 3C5SB 1EHAA 3QBTB 4JKPL 3FFCB 1NLBH 3MACH 2Q76B 4ZOBA 4RGMB 4X8XA 1INEH 3MRPA 1JGEB 1MIML 3NAAH 4NT6B 1ZLVH 4OUOA 4PJDA 4PRHE 1QNZH 2QADB 4G6KL 3HI1A 4PRPD 4HUWA 4NZTL 2IG2H 5F7DA 3UPRA 3JWOH 4Z7UE 1UVQA 4MYWB 1TETH 3AM8C 4OZ4B 4X6CA 5HHNB 3EO0B 1FORL 5JLZB 1HHIB 1FL3A 1E4XI 1KEMH 1TQCC 1XF5A 1R0AH 5IFJB 5CBAB 1YEGH 1Q1JL 3VXMA 4ZXBB 4KRNA 3SDDC 3QQ9C 2I07A 2F74A 1LO3H 4C56B 4CU7A 5FUZL 3S4SG 4DVBB 1QACA 1T83C 5I66A 1JV5A 3EFDH 3BZ4A 3REWB 5A2JH 4LFHD 1HNFA 1ETZB 2W65A 4DGIL 4APQB 4LIQE 3B2VH 3EIFA 5EULV 5H35A 3ZE0F 4EUPH 1FCCA 4Z7UA 4QT5B 1UWGL 1ZVSA 3C60D 2GAZA 3IXTB 4L8CB 2HRPL 5GS1C 4MNGB 3T77A 1PD6A 4ZUTB 3A6CL 3TNMB 2BY3A 5ESAA 5D7JD 2B2XH 3DMMC 4UDTB 4ZNCD 3QFDB 4TSCH 2R56H 4L8DB 4MNQD 4O02H 3REVB 4EI5A 4JFFE 4MVBD 1JBJA 4NZUL 1SVZA 2SEBA 1OWWA 5SWSA 4UNUA 4NRXB 5HHOA 1N8ZB 2DTMH 4X6DA 1CR9H 4NKMA 1T2QL 1AP2A 3B2VL 5TH2A 1X4XA 3SDDB 1ZGLM 2XWTA 2MWCA 4P9MH 4DGIH 3MV8A 5BOPA 2H9GA 1YYLH 4U33A 5TQ2L 1A6ZA 4POYA 1OCWH 2X41A 4GLRH 4NBXB 3TPUB 5HHQB 1FGNL 1HILA 4OAWA 1EGJL 2Z8RA 2E7CA 4LHUG 3G5ZB 1NMCC 1A7QL 3ARSA 4CN4A 2EDWA 5K93A 1BFVL 2M8XA 1FNSL 1GZPA 2P4AB 1NGYB 4GKOA 5DVLA 3VRLF 3CJJA 3QIUD 4OUUB 1CLOL 3C6SB 4F7PB 3O2VL 1X5AA 1CFSA 1DQDL 3B8YA 4JPWH 4LF3A 1FSKC 4HJJL 5H94B 4BK5A 2K9UA 1JWUB 5EIIA 2XN9D 2DKMA 5C0BE 1KIPB 5EIIB 2DLHA 1EAPA 1MFCL 1Q9WB 3GHEL 1GL4B 1FNEA 5EDXA 5IESL 4KK5C 2DOCA 2CRYA 4I0PD 1Q38A 4F2MB 3TA3C 1WFOA 2XZCL 2X09A 3OMZA 3R8BB 3GIVB 1FYTA 4ONOA 3WKMH 1BECA 1S7TA 3JV6B 4GSDL 1YEEH 5IF0A 5GSVA 3TN0C 2FHFA 5FHBL 3ARQA 1X5KA 1WTGT 2VZVA 3WXVL 5D5MB 5DK0A 2E27L 5HYIA 1MRFH 4W6WB 4ZSOA 1LEGB 5HTSA 3B9KC 1X5FA 3K8LA 4JE4B 1BWWA 1EBPA 5IQ7L 4LU5H 4I0PA 4HKJB 4I9WE 4LVOC 4JFEB 2DQIL 1AI1L 2HFEA 5E4EC 4AEHL 1MAKA 4M48H 1E6OL 2UZIH 3CX5J 2VXTH 3FRUB 5LBSL 3WFEL 3VRJB 5A40E 4HMDA 1KULA 3IRPX 5IM7B 5IROA 4ZFGL 1WFNA 4Q9BA 1WLHA 3CVHA 2VLJB 4ELKA 1YEIH 2VTFA 1QLRB 2CDFA 4BZ2L 4OFIA 2R0ZL 4X7TA 2OTUA 1UWXK 3MRHB 1GJIA 4N8CH 4CU6A 2NX5D 4ZS7H 2DDQH 4DGYH 3UJTL 4PJ5D 4IOIB 4XVUC 1JNHA 3GSRA 5IT2H 1KPUA 5KS9F 2JF1A 2A6KB 2HKHH 1P1ZB 3KPNB 1J1OL 3WUWA 4NM4H 1OAYL 1C12A 4HDIB 3VJ6A 1Q0YL 2VE6B 5TDNB 3U7AA 4U7MA 1IGJB 2F53A 2C3VB 3O6FB 2WIIA 4WUUB 5FYKD 3RZCD 3DRTA 3STBA 1B0RA 1TJGL 3GBMH 1BGXL 3RUGE 4CVZB 3FKUS 4U0RC 1F5WA 2PO6C 5EU6B 1FV1B 1XGPB 5F3BA 2X4OA 1RU9L 2VDLL 4P4KD 3V7AE 4ZUSA 2VXUL 2Z93A 3O3UN 1AY1L 3WKNA 3MYJB 5KSAC 3O6LH 2AJYH 1F3DJ 1T7XA 3HMXL 5D72L 1X5IA 4P3CH 1TQBB 1ZT4A 4G6AD 4WFHE 3KNBB 5HHXH 1A47A 4TUJB 4XPTL 3HAEB 5GS1B 4NZTH 1P4LB 5CGMA 5CP7A 3WFHA 4W68A 4CW1B 5IBTL 5LBSH 4PRID 4D9RE 3I75A 1LDSA 3O6MH 1QZ1A 5C0RL 1E4KA 4S1RH 4UT9L 5JPNA 1KLGB 1W72A 3MGOA 5CJOH 4M5YL 4PR5A 2YOCA 3C2AH 2FX9H 4U0QB 2X44D 4PS4H 3SKUD 3SY0A 1JCKA 5F7EL 5IJKC 3IJSB 1HXYB 1ZWIB 4IMKC 1QFPA 4OCRH 1K8IB 1ZSDB 1AXTH 5C0FB 4O2EA 4HC1L 2R1YB 2FO4A 3OAYK 3WIHH 4MMXC 3VFMA 4JHAH 1Y0LA 3CFIC 2PW2A 3X12B 8CGTA 3UTTE 3F58H 4JHBA 3ARPA 4OLXH 3MA9L 5D7KE 1X7QB 1LILA 3MV7B 5DSCA 1NMCB 1J87A 5HVGB 3TFKC 2Z0BA 2GT9B 1PYWB 2IQ9L 5KS9B 4HAGA 1EHLH 5EORH 4OCMC 2CKBA 2OL3H 2VSCA 1NAKL 4X4YA 1H3TA 2A6IB 3UX9B 3D2UB 5DUPL 3KPRA 3X17A 4X4ZA 4XPBL 2NW3A 5CJOL 3SKNB 2APTA 5C8JA 5TQ0H 3HCVA 2D7OA 2XOTA 4Z9KB 1R5IB 3NFSL 4GKZB 4UQ2B 5C0JA 5I1EH 3BGFB 3DSNA 1UM6L 4MLIA 4AMKL 1NGWB 4HZLB 4RFOH 3QA3B 3VW3L 4ZG1A 5ELIA 1A5FH 1B4JL 1L7TH 2EDYA 3RVVD 1PKQA 1AKJD 5IEHA 4XCYA 4ETQB 4H25A 2HFGH 5I16B 1HQRA 5FCUH 1BVZA 4LLVA 1MCPL 5J06A 1IKFL 3RWJA 1NJ9B 3U7WL 3BIKA 1ZVHA 5DUML 3UO1H 2WNGA 5J13C 1NCAH 3SEPA 4HH9B 2APWA 2JIXA 2KL6A 1UJ3A 2DQGL 4TULL 5EU5B 3KJ6L 3QO0A 3EKCA 3KXFA 4YO0A 5KG9A 5IB5B 2YZ1A 3GSNH 3MRFB 1I8IB 5DUBB 3JVGA 3A0OA 5CSBA 3U2SA 4J4PD 2VITA 4PJGB 4NUJA 4NNXA 4URTB 3LS4L 1AXIB 4QGYA 2YSSA 5D2LA 3OKMB 5D71L 5D7IF 3V5DA 1UFUA 2VL5B 3FFCA 1NUGA 2DAVA 5TDPA 2L4OA 3QXWA 3EYQD 2PXYC 3PWPA 1W8NA 1DLFH 2KKQA 3P4OA 5BS0E 3QXDB 4XBPA 4HXBL 1HWGB 4NHUA 4OZIE 4RGND 5A3ID 4LEXH 1DQTA 5IM7A 2Z4QB 1YN7B 2E6PA 4JN1L 4OCSL 4PG9B 3GSUB 4JY6B 3L3DB 4TULH 2DLGA 1Y6NR 4OLWH 4KMQA 5F72S 4QXTB 1DDHB 4F9LC 1MNUL 1GGCL 4QWWD 3HS0B 4RISL 3MOQA 3GSOB 2FBJL 2ADFH 3KPTA 2H6PA 1OSZA 4BUHA 4YUEH 1JV5B 3B9DA 2VQUA 1IILE 5DRWA 3MV8B 5L7XH 4QHLA 1F3RB 1KIQB 3ARFC 1F3JA 2OX5A 1RZGB 1DBJH 2IBZX 2XPGA 3MOAL 3QCVH 5CHNA 1EX0A 3WMSA 2ICEA 1J5OL 5DJ0A 1CD8A 5FF6A 3HPJA 2C26A 4XPAL 4Y4FD 4P46D 1XF3A 3RIAK 1YUHA 2AXFB 2E8YA 3VXNB 1CVRA 2LVEA 2J88L 3TO4A 1NC4A 3BRFA 2J4WL 1EHNA 4YDKL 1Z5LB 5DS8A 1EVTC 2C1PA 4TUKH 3CMOH 4TQEL 1BWMA 2C3XA 1BFTA 1NCDH 5EIVA 1WF5A 3HLAB 5HVFB 5KVFH 5F1KC 4LF3B 1K6QL 4RAVB 4HK0B 4X9HA 4HWBL 5HPMA 1IKNC 2X05A 1VFBA 2NX5B 1HZHL 1H9VA 1OAKL 3S96A 5AYQA 4HWEH 4XCNA 3GHBL 3PL6B 4YDLC 3WHE1 2ZG2A 5BRZB 3DHJA 1M1SA 1S7VA 1PY9A 4MDIB 5D1ZB 5B21A 2ZNWA 2FX9L 2HTLD 1A7QH 2Z92B 2UYLB 1MWAB 4LMQI 2EO9A 2CPCA 4OIIL 2KUTA 1LO5A 1JUFA 4M9OA 5CEZD 1CLOH 5IHBA 1NEUA 1MJ8H 3RGVC 4P3WA 2AK4A 4MGXA 1KENH 2XIDA 2Z31D 5ALBH 2AV1B 1AGEA 1GGCH 3C5ZD 3S37L 3ULUH 1M4KA 1BFVH 2GTWA 4MAUH 3DV4B 1LDPH 1M05A 4LCIL 1GSMA 5F1SA 4K23L 3HE6B 2AP2A 3G5YA 3IDJA 1X7QA 2DQDL 4D0DB 5ID0A 1YEDA 3KPOB 4I48A 3OAZH 2Y06L 4P2CG 3OJMB 2W0LA 4V1DB 4L8DA 5DHVB 2AABH 1PX3A 1MPAL 3WFDH 1YNKL 2P7TA 2R2BA 3D3VD 5CUSL 1KBGL 5DD3H 3R8QA 2AQ1A 4YXHL 3CFDA 5E8OB 1L6XA 4ALAH