1R3LC

Potassium channel kcsa-fab complex in cs+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords Antibody Fab fragment light chain
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r3lC00
2WLHA 3E83A 4PA7A 4XDKA 5BZBA 4PA4A 4R50A 3UM7A 4MS2A 2ATKC 3ZJZA 5EBWC 4UUJC 3TCUA 2BOCC 3LDCA 3LDEA 3SYAA 3JYCA 4R6ZA 3RVYA 2OCCC 3LUTB 3SYQA 2DWEC 3WG7C 3FB7C 3SPGA 2Y69C 2A79B 2H8PC 3AG1C 1S5HC 4R7CA 5B3SC 5CBHA 3K06A 3E8FA 1LNQA 1P7BA 3FB6C 3SPHA 4QE7A 2HJFC 5J9PC 2X6CA 3OR7C 2ZD9A 3OGCC 2JK5C 3E8GA 3E8BA 4MTOA 4CBCA 3T4ZA 2HVJC 5EC2C 5B1AC 3STZC 2WLJA 3X2QC 3LNMB 1OCZC 2ITCC 3OR6C 3IGAC 1KKDA 2KB1A 2EILC 4XDLA 2EIKC 1R3KC 4X88A 2IH1C 3AG2C 4PA3A 1K4CC 2WLLB 3HPLC 3LDDA 2WLIA 2YEVA 1R3JC 2QTOA 2DYRC 3OUSA 4GX2A 4I9WA 4GX5A 2AHYA 1M57C 4MVQA 3SYOA 4X89A 3FB5C 4PDVA 1V54C 4PDRA 1ORQC 2DYSC 4P30A 3T4DA 4MVSA 1G4YB 4MTFA 4MW8A 4PA9A 2Q6AA 3T1CA 4MTGA 2Q67A 5KUKA 4R8CA 2A9HA 4JTDB 2WLIB 4H33A 3SJQC 1XL4A 1QLEC 2QKSA 1JVMA 3ABLC 1OCCC 3E86A 2DWDC 3IFXA 4RO2A 4WFEA 5EC1C 3RBZA 2HVKC 2K1EA 1OCRC 1R3LC 3SPJA 4KFMA 4P9OA 2AHZA 4QNHB 3F7YC 5IY5C 4MW3A 4LP8A 3AG3C 3STLC 4DXWA 2IH3C 3AG4C 4OXSA 4WFGA 2A0LA 3K0GA 2ITDC 4G28B 4RAIA 5CBGA 2X6BA 4PA6A 4RUFA 4RUEA 4X8AA 1K4DC 4J9ZB 4P9PA 2HG5C 1ZWIC 2WLNA 4LCUC 4JTAB 5EBLC 4EKWA 3F5WC 1BL8A 2P7TC 2WLMA 4GX1A 4F4LA 4WFFA 4J9YB 1J95A 3E8HA 3SPIA 4TWKA 3TETA 2EIMC 3SYCA 2EIJC 3ABKC 3RVZA 3ASOC 3KG2A 3RW0A 4XDJA 3VOUA 3FB8C 4MVMA 2WLLA 4MSWC 4BW5A 3EFFK 3K04A 4JTCB 4MVUA 5B1BC 4QE9A 4MVOA 4P2ZA 1V55C 2R9RB 4WFHA 3UKMA 1R3IC 2HFEC 2NLJC 2ZXWC 4PDLA 3ZRSA 5KUMA 3K0DA 2Q69A 5EBMC 2BOBC 4MVRA 3ABMC 3PJSK 3ASNC 3BEHA 4H37A 3OUFA 3R65A 5EK0A 3SYPA 3F7VC 2EINC 2X6AA 4MVZA 2W0FC 5E1AC 1M56C 4HYOA 3K03A 4GX0A 3K08A 3SPCA 5CBFA 1OCOC 3GB7C 4G27B 4PDMA 4ZBMA 3T2MA 2Q68A 2WLKA 4LBEC 3E89A 4HZ3A 1XL6A
chains in the Genus database with same CATH superfamily
4J7JA 2YIAA 3CCQV 4CH4A 2D3OW 1SERA 1Q8IA 5IJ9B 5EBWC 1VP7A 3LDEA 5DM6V 3RVYA 4PELA 1H8HG 4LH7A 1HR0O 2A79B 3CE2A 1I94B 2AGAA 1VQNV 4DYLA 5B3SC 4NXNO 1VF6C 4FMTA 4D7TA 1VF6A 3OR7C 2UUCO 4MTOA 2IJHA 2R70A 5KA6A 2Q4PA 1S5JA 4GZRB 1TUBB 2DYRC 3C3TA 1XMOB 5JJEB 1GTOA 1HWYA 5CB4B 4LWSA 2Y69B 1W0KG 4GKKB 3R66A 5KUKA 5BY1A 1N34O 4GCZA 1AJNA 4LWSB 3MHSC 1S76D 3UO3A 1SETA 4LNUA 4DV2B 3AG2B 5IJ0B 4IHJB 3VQWA 2FKXA 1R6TA 4RUEA 1IX9A 1FKAO 1GH6A 1PD3A 2JIZG 4B3TO 3IJ4A 3F5WC 1B6QA 1W2BU 4LF7O 4IL6Z 2EIJC 5LOVB 4DUZB 1RPRA 3HKEA 1K33A 2AZ2A 1GRJA 1RFYA 3N27A 1BHAA 4KXRA 1KU9A 2NNUA 2X0LA 4JV5B 4K3AA 3CSXA 2CTWA 5EIBC 2RN9A 1OCOC 4FLUA 1K73W 1VQ8V 2Q7EA 2PTMA 5DEDA 5GTHZ 3TGUH 1SQXH 4CC5A 5A2QN 1RP3B 4FM0A 2B1GA 4I0XB 1NVPD 1M1KW 2ZR3A 3K58A 3AK2A 1FFTB 2B1IA 3WG7C 3SYQA 3DTUB 5BMVA 1EN4A 3FAVA 2FTKA 1IZ3A 5KHKA 3E8FA 3FB6C 1SZTA 5BMVB 4JI1O 2YIBD 1NI8A 1P4RA 3BRCA 3OR6C 4LC1A 4XDLA 2ZKOA 4UVBA 3W7UA 1K7DA 5KHHA 2WLIA 2XAHA 3OUSA 3W7WA 4AQYB 4JYAB 1PL0A 4YJ2A 1AJPA 4X65B 2LFSA 4MW8A 1F4NA 2YS8A 3B8NA 5GONB 1LUVA 5IE9A 5KX5B 3JCUZ 5KHIA 5EC1C 3RBZA 1QVFU 3HKCA 1YF2A 3SPJA 1R6KA 2JJ1G 4FLZA 1JFFA 2L6LA 4LP8A 3ZHTA 4DR3O 5KX5A 2EJ7A 4H44B 4OXSA 4DR4O 4DR7O 4KUMA 1D5NA 4UCSA 3HKCB 1HNXB 4LFCB 1IBKB 1GK9A 1AROP 3ZRWA 1P84F 2WLMA 3E22A 2EX3A 3SYCA 5B1OA 1YXBA 3OTFA 2EJRA 1THZA 1AI6A 1NR7A 4OX9O 2OCCB 1Y76A 3CEIA 1YDXA 2QKCA 5F2VO 3ZRSA 2BOBC 4Z1MG 3BEHA 1VF5B 1VQPV 5GTIZ 3P32A 1OHHG 1FXVA 2QR4A 3E83A 2YXHA 1TA8A 1AR5A 4MS2A 3L72H 4TT3G 2ZM6O 3MD0A 2E74B 3FB7C 4JI3O 5ITZA 1I5YA 2YI9A 1WAZA 2RNBA 4TV9A 3B8MA 4Z2WA 1HP8A 2JK5C 2AXTZ 4DR2O 1OCZC 1QHTA 1JPXA 4GLXA 3CRRA 4JF3A 1CEZA 2Q7HA 2HLDG 4NR1A 1BMFG 5CA1A 3T4DA 4I55B 3B4SA 4MTGA 3VBBA 2KG7B 2ILMA 2A06H 2RMKB 1S0VA 2EIJB 1HNWB 2HJDA 2K1EA 1XHXA 4E4EA 1R3LC 3RN4A 4CH5A 4LF6O 4WFBV 2Y4UA 4JI0B 1DTOA 1KQSU 1GN3A 2HG5C 3ZHUA 3RT3C 4NXMO 2XAQA 1BL8A 2K9PA 4FFKA 1K97A 4UCOA 1I5XA 2ZQMA 3JD0A 3P30A 5H6QA 1VQ6V 2ZE6A 1GKFA 4LF5B 2QTSA 4JV5O 3WB2A 1OV9A 3RYHA 3GVMA 4DR6B 4K0KO 1H2SB 3JARB 1HNZB 2NN4A 4LH6A 3SPCA 5CBFA 4PDMA 4ZBMA 2LGQA 1M90W 1NQTA 1L1FA 4XDKA 5LOVA 3THOA 3ABKB 2VQFB 4JI7O 1YZBA 3TCUA 4ZI7A 1K9MW 1SQFA 1BE3H 1WB8A 2H8PC 2GDSA 2QGNA 2XT9A 2EZOA 4QPJA 4GKJO 5E79Z 5J9PC 4GUNA 2X6CA 3MDSA 4YY3B 1YJNV 2OYQA 1IBLO 4UCVA 4O4IA 2ZT9B 3RYCB 3IGAC 1FD9A 4FK5C 1P49A 4F6RB 2QM4A 2H94A 1GN6A 3N2KA 5J2TB 4I9WA 3RYCA 2IW5A 1G4YB 4WBNB 2DQ3A 4L8JA 4HNAA 4R8CA 4U3JB 4LF4O 2JRIA 1NVPB 4TUYA 3ETDA 4ABMA 2QKSA 1XDCA 1OCCC 1G1XB 4UB6Z 4FLTA 1NR1A 1YHQV 4KFMA 1Z5VA 3W7SA 2OWOA 4I9QA 3K0GA 1TVKA 1Q6HA 2WAMA 1MSDA 4DV0B 3H1HH 2BCCH 2P7TC 5IYDO 4YJ3B 1A32A 4DR3B 2BTOA 1XEQA 2ODMA 2UXNA 3N2GB 1XBLA 3JARA 1K5QA 3Q4HA 1E79G 3ZIAG 3CXHF 3WG7B 1QNMA 2HR3A 5LMNO 2CTQA 3PJSK 2YICA 4DV6B 4LF9B 4ZKIA 4ZI7B 1XREA 3QO5A 4FJCC 3M7MX 3SR2C 1N0JA 2CUGA 4UCUA 1KUQA 2LW7A 2C2AA 4A5UB 4PA7A 1KP3A 4PA4A 2JVDA 4R6ZA 3LUTB 2XAFA 2Q0AA 2VWJA 1LNQA 3APOA 4X9QA 5C8YB 3UQ8A 1K8AW 4LFAO 3JAWB 3K57A 2N05A 2H3OA 2ZNIA 2HVJC 3STZC 3X2QC 3VQVA 4JI4O 2ITCC 5KLVH 3ZMZA 2KB1A 2JGUA 2VQEO 2UXDB 4JI5B 5FNVB 1M57C 4ZHQB 1JA8A 4PDRA 2F93B 1JJOA 2CH7A 3HKBA 1K5SA 3FYIB 1MNGA 1WPBA 1KECA 2OIGA 4X1YB 1QLEC 1UFIA 3RYIA 3E86A 1UJWB 2XAGA 2RDCA 4DR6O 3K5LA 3HKEB 2ZE8A 3CC4V 4LF5O 3EHBB 1N0NA 4WFGA 4FPPA 1V54B 4UXNA 1K4DC 4H13B 1SC5B 4NVPA 2QA4V 4JTAB 3FD9A 3K5MA 1JCHA 5AG2A 4EB6A 4DV2O 4I50A 2PI4A 4J80A 1J95A 3SPIA 4TWKA 2LQTA 1IBMO 4B7KA 3KKYA 4JI0O 3ABTA 2JEUA 2QWNB 4W4LA 2ZDIA 3L70H 1UPGA 1ROPA 3OUFA 1TAEA 2CE4A 4QGPA 1XNRB 3U0ZA 1NTZH 5D5QA 4G27B 2E76B 1SQBH 3O9OA 1F7YA 3QNEA 4DV6O 2Q5ZA 3CC2V 2ATKC 4JI2B 2IM9A 2DYRB 1K92A 3JASB 2E75B 1VMGA 2WA4A 2A7WA 4DK0A 3OMAB 5LYJB 1BT8A 3J80N 4LF8O 1RM1C 2EBOA 2GBOA 4CBCA 1H2KA 3BABA 3CRMA 5B1AC 4BIUA 4BIOA 3APQA 2ADPA 3SJCC 1KP2A 1XMQO 3IC9A 5IT9N 4XBFA 3S3XA 1R3KC 5FPOA 3TXSA 2RCVA 5LP6B 2YSUB 3FX7A 3HPLC 1YIJV 1CPYA 1FJGO 4B3SO 4GX5A 4MVQA 4LFBB 1V54C 1EM1A 1P7GA 3LSUA 3ZRVA 4LF9O 5BR8B 4JYCA 2A9HA 1RM1B 4PI0A 4DV4B 1X59A 1SRYA 3ZMVA 1Q7YW 3JALA 4K0KB 3BHPA 1WLEA 3AG3C 3AG4C 4JASA 1Q3EA 3JALB 3H1LH 1BHBA 3H01A 4EFEA 3DSQA 2FB5A 1AI5A 4KP4A 1GM8A 3J81N 3DC5A 2GV9A 1QLEB 2R9AA 3QO7A 1JMKC 2Q0OC 4X66B 3CCSV 3RVZA 2GTAA 4N23A 4LFCO 2E5LB 4U7OA 4QE9A 1GAXA 1K3EA 3ZS8C 2VQFO 1TVKB 4JI7B 4EFBA 2YXYA 1N33B 2Q8VA 5LHIA 4F6EA 3K03A 1V9PA 3OTOO 3JASA 2UXXA 4DV4O 2HHHO 2IU3A 3HKDA 2QDOA 3CX5F 4U7NA 3U11A 3K9AA 4OPHA 1JFFB 2BOCC 3JYCA 2GSMB 1ENVA 5EZYB 4DV7O 1MZFA 2ZXWB 1NT2B 4DO2A 5IYBO 4DR2B 2RQ6A 3ZRWB 2IJJA 3OGCC 3CWBH 4DR4B 3P3NA 5JCOC 2BSKA 4CS4A 5J2UB 3OM3B 3JD4A 3LNNA 5L3BA 2EIKC 1QVGU 4E2LA 2ZDIC 4B3RB 2QWQB 3K59A 2JGDB 4D7SA 5LGTA 1BQ0A 1GN2A 4PDVA 4JI2O 1ORQC 2YXLA 1PNLA 3AG7A 4MVSA 3JD3A 5IWAO 3T1CA 3AG1B 1VQ7V 1GN4A 1HNWO 4DW0A 4JYAO 2BE3A 1O9GA 5JWPA 3SJQC 3QVNA 4LNUB 3ABLC 3IFXA 4RO2A 2VWKA 3X2QB 5JH7A 3B40A 1XILA 3DC6A 1AP6A 5B1BB 1IXMA 4J11A 4B3RO 1AI4A 4CS3A 2CGNA 1NH2B 4Z1VA 4TSFG 2XUMA 3ZRXA 1QQCA 4LF7B 4LCUC 3C3SA 3G80A 1PPJH 5LXTB 3AEIA 3RYIB 5HFMA 2DMXA 3AK1A 3ABKC 4NTXA 1EN6A 2QM7A 1IBKO 3IAYA 4BW5A 1R1BA 2Z0AA 2P22C 4MVRA 3ABMC 1ZTEA 4J7ZA 2D2CB 3SYPA 1Q81W 4X1IA 1M56C 4H0LB 5IJ9A 2CTRA 2LO1A 4RQEA 2IJKA 1FXKA 4O4JB 1HNZO 3BAAA 2P4KA 1KYOF 5LP6C 4GKKO 1N33O 1PV0A 1FPOA 2P06A 4FIPC 2EULA 4DUYO 2UXDO 4O4JA 1HDJA 2MK3A 1YJWV 4OX9B 2JJ2G 3OAAG 2PYLA 4X66O 1DGSA 2ZE7A 1EBOA 1F23A 2ZD9A 4YHHB 5JQGB 1XI1A 4G2KA 1MMMA 2DQ0A 2PI5A 4DK1A 3L75H 4LF8B 3PN1A 4PJ0Z 1I94O 3AG2C 1CP9A 3FFQA 1Y76B 2UUAB 1WA8A 5KAIZ 1BCCH 3OD4A 5KA5A 2QWPB 1XMOO 3CCMV 3T1YB 4QJFB 3BY6A 3CCUV 1H2NA 4CH6A 2HEPA 5EYPB 5BR8O 2P90A 2EILB 3JAKB 4UV8A 4U3FH 3A0BZ 4JI8B 3HR0A 3CCRV 3BPZA 3VQYA 1SQVH 4O4IB 1IVSA 3IC7A 4XDJA 4MVUA 3M99B 4FLWA 1R3IC 1Z5WA 5EBMC 3R65A 1Q5OA 4I55A 2X6AA 4MVZA 5LMUO 2DE0X 3K5NA 4B08A 3T2MA 1T5EA 1OCZB 2P67A 4BR6A 1W0JG 3KCYA 3ZMTA 1TUEB 5K1PA 1VQKV 3ZHSA 2OT5A 2KKWA 1ZLZA 4JI6B 5L3FA 4JI1B 3A2FA 1SQGA 2ADQB 3WFVA 2Q9LA 2XAJA 4LFBO 2HKOA 3EVKA 5IDJA 1NJIW 4TV8A 3T4ZA 5EC2C 4KHPB 3L9DA 2JS3A 1OJHA 2YI8A 3HKDB 1ZSPA 2QM8A 4X88A 1HNXO 1YEWA 1VF7A 2AW9A 2XASA 2Q7GA 3K5OA 4IT5A 1MABG 1N8RW 1K34A 1YTFD 1R6NA 5LBQA 4I50B 4K8XA 3BVOA 4WFEA 2WWWA 1VQLV 3CRQA 3CRCA 4X65O 1D5AA 4QNHB 2LFRA 1BGYH 1AR1B 3W7XA 2OCHA 3STLC 5LMNB 1OZ0A 4NTWA 4B3TB 4LF4B 1FJGB 2JGDA 4FLVA 2VS0A 1XMQB 1F4MA 4X64B 1MG1A 2GHYA 2WLNA 2IBZH 1WNSA 1MOFA 1WN7A 2P4VA 1G8MA 5LGNA 2R72A 4J42A 4MSWC 2CDYA 3K04A 3ETQA 4JZGA 4JAUA 3AG4B 5FNVA 4PD4F 3NR7A 3HKBB 1JX9A 2LP7A 5JJNB 4TUYB 4X20A 4FFBB 2E3CA 3CP1A 3ZX6A 1XNRO 2Y0IA 3QO8A 4EEQA 3JSNA 3E35A 4R50A 1H2MA 3UM7A 3ZN1A 1RSOA 1PL4A 1Y74A 4Q20A 1FXKC 3OE7G 4B3MB 1KD1W 5B66Z 4R7CA 2MW2B 1EZJA 5CBHA 1D2DA 4GYCB 1YJ9V 1NS1A 4QE7A 4WFAV 1PNMA 2F23A 2F4VO 3N2KB 4EB6B 1QU7A 1SA0A 5CA1B 1M5IA 3OFNG 1VQ5V 4X1KA 4HNAB 1K4CC 3RFRA 3ZEDA 4NXMB 2ZM6B 2YIBA 3UT5B 3SYOA 5H6RA 4BAYA 1US6A 4PA9A 4ICGA 2IU0A 1JR9A 2YEVB 3CS5A 5FPRA 4JI6O 2DWDC 5DN6G 1M4UA 4J7KA 1S77D 1ZUQA 1KBHA 5JVDA 2DOSA 4DXWA 3CCJV 3CJHA 4RWUA 2DW4A 1VQMV 2Z3YA 3ABMB 5L3CA 2YDEA 5LMUB 2EINB 2KSDA 4FVMA 3N2GA 5JVDB 3JD1A 4DRXB 4JAAA 5L3GA 2YIDA 5EBLC 4YY3O 2UUCB 1IDSA 4WFFA 1JOYA 4NXNB 4GKJB 4DV5O 2PZSA 2GUZA 2M7WA 1Q6IA 5L3EA 2UXBO 2F66C 5LA6B 4ZIBA 2Y48A 5EZYA 2HFEC 3H1JH 5KUMA 3LSSA 3D36A 1Q6UA 3BFRA 3JCZA 1U96A 2GUZB 3F7VC 4NKGB 1LR1A 1Y74B 4LBEC 4HZ3A 3CMEV 3CB2A 2PY5A 1H2GA 5BZBA 4DV5B 1Y6XA 3ASOB 1GM9A 1M57B 2HHHB 2DWEC 2QKAA 3OMNB 3T1HB 3CCEV 1DF5A 5FLXN 1L0NH 3OMIB 4I0XA 4F6RA 2UUAO 1G6UA 2PUSA 2F95B 2ZR2A 5J2TA 1NH2D 1HW7A 2QEXV 4WBNA 2JEXA 1QBZA 1IBLB 4JI3B 1NU1H 3LDDA 1YITV 3SDLA 2YEVA 4I4TB 2AHYA 4WCEV 3TK1A 3DXRB 1COWG 3JATB 4IIJA 3H9VA 2WLIB 1H38A 4H33A 3OT7A 1XL4A 4CS2A 4DUYB 2KQXA 1H2LA 2EIMB 4YJ2B 5B1AB 3L74H 2NR5A 1I0HA 4JYBA 3B2EE 5GONA 5IYZB 4JPRA 1KB9F 4OGQB 1YCIA 2F4VB 3ABUA 1SQPH 4DV3B 1XOUA 1YVWA 4NTYA 4X1IB 4P9PA 5IYZA 1ZWIC 3Q4HB 1PP9H 4L87A 5IJ0A 3D8CA 2WSSG 2B9ZA 4AHCA 2UUBB 1RPOA 1PM9A 4O2BB 1JQ0A 3CPWU 4K8ZA 2HP8A 3P3PA 2W0XA 2OTLV 2Y4TA 2WLLA 3CRAA 2QJ1A 2FL4A 2WA3A 3SGIA 4O2BA 1TUBA 1V55C 1YTFB 2V4DA 2ZXWC 4YIPA 1BSMA 5EK0A 1J5EB 1FYJA 2Y0PA 5HFLA 1S5LZ 2ARHA 4AILC 3CCLV 2PYJA 3ZJZA 3JD2A 5B1NA 3ZHRA 2UXCB 4D6TH 4PHZA 1Q82W 3D36C 3OEHG 4FM1A 3OGIB 1OCOB 4X20B 4NB5A 2B5UA 1IBMB 4X89A 3FB5C 4P30A 1IURA 4DV7B 4UCTA 2QWRB 3ICXA 1XHZA 3QTCA 2UU9O 4O4HB 1OCRC 4MTXA 4FZ0A 2OTJV 3D3QA 4MW3A 4AQYO 2ZIOA 1Q90D 3OTOB 2KG7A 4CC6A 3VQXA 4O4HA 3FAVB 4LR3A 3ASNB 3G71V 4X62O 1YSCA 1XNQO 4PA6A 2DYSB 3QG5A 3ETGA 4OPAA 4EKWA 1MA1A 2LJ2A 3L71H 3SJBC 2E5LO 4BWAA 3DGEA 3KCXA 3MAQA 1S72V 3ASOC 3KG2A 4B7EA 4PV1B 3D3IA 1JJ2U 3EFFK 3A8TA 4MVOA 3CJHB 1MZEA 1BQZA 4WFHA 1BZKA 4C7UA 3RYFA 1H8EG 4RQFA 3S3WA 3I56V 2W0FC 2ZINA 3L73H 1AP5A 3B77A 3K08A 4WF9V 3GB7C 1N34B 1KC8W 3ZMUA 2WLHA 5KMGB 4JZ2A 4IYHA 1QR8A 4UUJC 2O57A 3W7TA 5KMGA 4QIWF 4KL1A 1DLBA 2BSKB 4DUZO 1P7BA 4UCRA 2W6JG 4B3SB 3E8GA 3E8BA 4ZOLB 5LXTA 2V7QG 2WLJA 5ITZB 4FM2A 1SKVA 2L35A 5IY5B 3HB3B 2IH1C 4PA3A 3MHHC 4DR7B 4GX2A 4W4KA 1N36O 1B04A 2UXCO 2DN9A 1BS3A 5B3SB 2AZ0A 1FXHA 4JTDB 2CK3G 3EXAA 4FZ1A 3BCCH 3OEEG 3U10A 2WPDG 2ITDC 4O2AB 4UVCA 3FYEB 1XQ8A 4I4TA 1GM7A 2CGOA 2JDIG 5LL6Y 1Z2GA 4FFBA 4O2AA 3B09A 4O4LA 3RYFB 3E8HA 1L8DA 4NYKA 1VQOV 4MVMA 1Y67A 3H1IH 1N32B 1E1RG 5H5NA 2PF4E 3WB1A 3GWOA 3K0DA 3LSQA 3CD6V 1SQQH 2ETNA 2G38A 3O65A 5KHGA 4DR5O 2VRZA 4FLYA 1PKXA 5CA3A 1XL6A 3RYHB 2YC0A 5EYPA 3C90A 3I55V 4DV1O 3JAKA 3LDCA 3UT5A 3SYAA 2OCCC 4ZOLA 1N32O 1I7FA 1V55B 3RGBA 5CMUA 5J2UA 1S5HC 3G4SV 3K06A 3SPHA 1AILA 4JI5O 1M56B 1M93A 2BTQB 5GW7A 1S3JA 2V1DA 3E22B 2VQEB 4DW1A 3WU2Z 3AK3A 1ZX3A 3ZHVA 5B5EZ 1WA8B 2EILC 5TISZ 4X62B 1XNQB 3G67A 1KKCA 1Y66A 2M6YA 2QTOA 3ZN0A 1XUQA 2OIEA 2ZNJA 1U97A 4CZZA 5JH7B 4DR1B 2Q67A 4LF6B 4UV9A 5KAFZ 3UCSC 2HVKC 1J5EO 1SESA 4P9OA 3TXQA 5IY5C 1FFXA 2EIKB 4X1YA 4RAIA 5CBGA 2CTPA 1E1QG 4CH3A 1FFXB 2LW1A 4JI8O 1WB7A 2R9IA 5DECA 1URFA 3OW2U 1SZXA 3TETA 4UVAA 1YI2V 2EIMC 1N4CA 3FB8C 1NTMH 4X1KB 4JTCB 4P2ZA 5K1XA 2R9RB 1FXKB 3UKMA 3T1YO 4DV0O 2Q69A 4UFZA 4PI2A 4H37A 1X4TA 1NTKH 4U3JA 1Q86W 3K3WA 1DK1A 3A0HZ 5IYCO 3GWKC 4IGGA 2P5OA 3CYOA 4HAMA 1AR4A 1LUWA 2BTQA 4YHHO 5JQGA 4TV8B 3SPGA 1O9HA 1WP7A 3JAMN 1NZ6A 2F43G 3AG1C 3DXRA 3JATA 1Q43A 5BXZA 4BW9A 4DRXA 2EZPA 2HJFC 2P6JA 3ML0A 1EZVH 2UUBO 1OCCB 2W6IG 4JAVA 2PGGA 5LYJA 1KKDA 1B3QA 2XNDG 1B06A 3FKSG 2QWOB 1QR9A 4IHJA 2Q73A 1R3JC 5LA6A 1GMGA 5C93A 1SF9A 4DV1B 3H1KH 5LP6A 5H9CA 5LHHA 2UU9B 3F5TA 1AI7A 1AVMA 3UO2A 1JVMA 4IYIA 3J7AU 1AB3A 4JYYA 5A9GA 2QE7G 1VIBA 1IXBA 2CH7B 1EN5A 2JS5A 2AHZA 3F7YC 2IH3C 3G6BA 4G28B 1R73A 2XHBA 5CA0B 4X8AA 3ETEA 4J9ZB 3RWRD 3SJAC 3K9SA 5C8YA 1AJQA 1WP8A 4Q6GA 4F4LA 4J9YB 5CA0A 4FLXA 5CN0A 4N21A 1DF4A 1VQ9V 4I7ZB 5FL7G 3T1HO 1FAFA 4ASUG 1M9NA 1NKDA 4PDLA 2N04A 4ZHQA 4AI8A 2N74A 1WJZA 5IWAB 2EINC 5D5PA 5KHJA 1TGOA 5E1AC 3TJTA 4GX0A 3K79A 1RSOB 3QF7A 1VEWA 1KMIZ 4O4LB 4DR1O 2YUAA 1SS3A 4QPKA 5JJJB 4GT1A 3BA9A 1FS0G 2ZE5A 1PNKA 1N36B 2F1MA 4DR5B 3WB0A 4TOIA 4JGSA 1ZL8B 2UXBB 2Y69C 1QCEA 2XOKG 4HBNA 5LHGA 3CCVV 1VQ4V 5LGUA 1SA0B 4UB8Z 3JSLA 3ZCCA 1EFRG 3ZHQA 4K35A 4KHPO 3CMAV 3ABLB 1ZL8A 5JCOA 4I5SA 4MT8A 5L3DA 4YJ3A 2Z5UA 1MSWD 3LNMB 1QLNA 2ZIMA 1F51A 3AG3B 3CHXA 2CAZC 1NBMG 2FMLA 2WLLB 3M8AA 4DV3O 2DJVA 3G6EV 2XTAA 1CXZB 2DYSC 3ZMSA 4BIZA 4YIOA 4MTFA 2Q6AA 2A3QA 2FYUH 3BA8A 1I08A 4YXWG 4TQFA 5CB4A 3NXSA 3ZBHA 1L0LH 4JI4B 1ZAUA 2RJZA 2ZCEA 2LGWA 2A0LA 4LFAB 4J41A 2X6BA 4RUFA 3I5DA 2X7RB 3JAWA 3A0RA 1W59A 4J10A 4GX1A 4X64O 1OCRB 5H2FZ 3RW0A 3VOUA 3CXCU 4B3MO 3KZIZ 3E2EA 5EIBD 5B1BC 1WPXA 1Y4MA 2NLJC 1GO3F 2QSAA 3CC7V 4TQDA 3ASNC 4TV9B 1VARA 4HYOA 1HR0B 4IIJB 2IJIA 2GTSA 2Q68A 2WLKA 3E89A
chains in the Genus database with same CATH topology
3ZMTA 3ZMUA 2C2AA 1TUEB 2WLHA 1VQKV 4PA7A 1KP3A 2OT5A 3CCQV 4PA4A 2D3OW 1SERA 5EBWC 1QR8A 4UUJC 5L3FA 3LDEA 5DM6V 4R6ZA 4PELA 1H8HG 3LUTB 3RVYA 3W7TA 2A79B 4QIWF 2XAFA 1VQNV 1DLBA 3WFVA 5B3SC 2XAJA 1LNQA 1P7BA 4FMTA 2W6JG 1K8AW 2HKOA 3OR7C 5IDJA 1NJIW 3E8GA 3E8BA 4MTOA 2IJHA 3T4ZA 2HVJC 5EC2C 2V7QG 2WLJA 3STZC 3X2QC 2ITCC 2QM8A 5IY5B 3ZMZA 2KB1A 5KA6A 3HB3B 4X88A 2IH1C 4PA3A 2XASA 3MHHC 2DYRC 4GX2A 1M57C 1GTOA 1HWYA 4PDRA 2Y69B 1W0KG 1MABG 1K5SA 3FYIB 5KUKA 5B3SB 1FXHA 4JTDB 2CK3G 1N8RW 1K34A 1KECA 1YTFD 1R6NA 5LBQA 4GCZA 1QLEC 1AJNA 3E86A 4WFEA 2WWWA 1UJWB 1VQLV 2XAGA 3MHSC 3OEEG 4QNHB 1S76D 2LFRA 3CC4V 1AR1B 1SETA 3STLC 3W7XA 3AG2B 1OZ0A 3EHBB 4WFGA 2WPDG 2ITDC 4UVCA 3FYEB 1GM7A 4FPPA 1V54B 4RUEA 4UXNA 1F4MA 1K4DC 2JDIG 1MG1A 2GHYA 2WLNA 1PD3A 2JIZG 4JTAB 2QA4V 1JCHA 3F5WC 1B6QA 1MOFA 1W2BU 2PI4A 1J95A 3E8HA 3SPIA 4TWKA 1G8MA 5LGNA 2EIJC 1VQOV 4MVMA 4MSWC 3ABTA 1RPRA 3K04A 1K33A 2JEUA 4JAUA 1E1RG 3AG4B 2ZDIA 3GWOA 1BHAA 3K0DA 1ROPA 3OUFA 2NNUA 3LSQA 2X0LA 1JX9A 3CD6V 2LP7A 1OCOC 4G27B 1K73W 1VQ8V 1PKXA 5CA3A 3CP1A 1XL6A 3QO8A 3QNEA 3E35A 4R50A 3UM7A 3ZN1A 3I55V 2ATKC 3CC2V 2B1GA 1M1KW 1NVPD 2ZR3A 2DYRB 1K92A 1FFTB 3LDCA 3SYAA 2B1IA 2OCCC 3WG7C 3SYQA 3DTUB 4Q20A 1V55B 1FXKC 2FTKA 3OE7G 5CMUA 3OMAB 1KD1W 1S5HC 4R7CA 5CBHA 1EZJA 3G4SV 3K06A 3E8FA 1RM1C 1YJ9V 3FB6C 3SPHA 4QE7A 4WFAV 2EBOA 1SZTA 1M56B 1PNMA 5GW7A 4CBCA 1S3JA 2V1DA 5B1AC 4BIUA 1P4RA 1KP2A 3OR6C 4LC1A 4XBFA 2EILC 4XDLA 4UVBA 1R3KC 3W7UA 3OFNG 1VQ5V 2YSUB 1K4CC 1Y66A 1K7DA 3HPLC 1CPYA 1YIJV 2WLIA 2XAHA 2QTOA 3OUSA 3W7WA 3ZN0A 4GX5A 4MVQA 3SYOA 1V54C 1PL0A 4CZZA 5H6RA 4BAYA 1AJPA 3ZRVA 2LFSA 4MW8A 4PA9A 2IU0A 2Q67A 4JYCA 1F4NA 3B8NA 2A9HA 1RM1B 2YEVB 4UV9A 1SRYA 2DWDC 5EC1C 3RBZA 1QVFU 2HVKC 3ZMVA 5DN6G 1Q7YW 1SESA 3SPJA 1R6KA 4P9OA 1S77D 2JJ1G 1WLEA 5IY5C 4LP8A 3AG3C 2EIKB 4DXWA 3CCJV 3AG4C 4OXSA 4JASA 4KUMA 2DW4A 1VQMV 2Z3YA 3ABMB 5L3CA 1BHBA 4RAIA 5CBGA 3H01A 1E1QG 1GK9A 2EINB 3JD1A 1AROP 1AI5A 3ZRWA 5L3GA 4KP4A 5EBLC 1GM8A 2R9IA 2WLMA 4WFFA 1JOYA 3OW2U 3TETA 1QLEB 3QO7A 4UVAA 1YI2V 2EIMC 3SYCA 5B1OA 3CCSV 3RVZA 4N23A 2EJRA 3FB8C 1THZA 2M7WA 1AI6A 1NR7A 5L3EA 2OCCB 4JTCB 4U7OA 4QE9A 4P2ZA 2R9RB 1FXKB 1K3EA 2Y48A 3UKMA 2HFEC 3ZRSA 5KUMA 2Q69A 2BOBC 3LSSA 4Z1MG 3D36A 3BEHA 4H37A 3JCZA 5LHIA 3F7VC 1VQPV 3K03A 1Q86W 3K3WA 2UXXA 3P32A 2IU3A 5IYCO 4LBEC 1OHHG 4HZ3A 3CMEV 1FXVA 4U7NA 3CYOA 1H2GA 3E83A 4HAMA 5BZBA 3K9AA 4MS2A 3ASOB 1GM9A 2BOCC 4TT3G 1M57B 3JYCA 2GSMB 3MD0A 2DWEC 1ENVA 3FB7C 3OMNB 3SPGA 3CCEV 1DF5A 1I5YA 2F43G 2ZXWB 3AG1C 3OMIB 4DO2A 5IYBO 3B8MA 2EZPA 2HJFC 2P6JA 3ZRWB 2IJJA 3ML0A 3OGCC 2JK5C 1OCCB 2ZR2A 2W6IG 4JAVA 1NH2D 2QEXV 1OCZC 3OM3B 1JPXA 1KKDA 3JD4A 2JEXA 5L3BA 1QBZA 2EIKC 2XNDG 1QVGU 4E2LA 3FKSG 3LDDA 4JF3A 1QR9A 2ZDIC 1YITV 2YEVA 1CEZA 1R3JC 2HLDG 1GMGA 5C93A 2AHYA 5LGTA 4WCEV 4PDVA 3TK1A 1BMFG 1ORQC 1PNLA 3T4DA 4MVSA 3JD3A 3T1CA 3AG1B 4MTGA 1COWG 5H9CA 5LHHA 1VQ7V 2WLIB 1H38A 4H33A 3SJQC 1AI7A 1XL4A 3VBBA 1S0VA 1JVMA 3ABLC 3IFXA 2EIMB 4RO2A 2QE7G 2EIJB 5B1AB 2K1EA 3X2QB 4JYBA 1R3LC 2AHZA 3F7YC 5B1BB 4JPRA 2IH3C 1IXMA 3ABUA 4G28B 1R73A 4WFBV 1AI4A 1NH2B 1DTOA 1KQSU 4TSFG 4X8AA 3ETEA 4P9PA 4J9ZB 3ZRXA 2HG5C 1ZWIC 4L87A 4LCUC 1AJQA 2XAQA 1BL8A 2WSSG 1RPOA 1K97A 4F4LA 1I5XA 3AEIA 2ZQMA 4J9YB 5HFMA 1JQ0A 3JD0A 3CPWU 5CN0A 3P30A 4N21A 1DF4A 5H6QA 1VQ6V 3ABKC 2QM7A 2OTLV 1VQ9V 2WLLA 4BW5A 5FL7G 1GKFA 4ASUG 1M9NA 1YTFB 1V55C 1NKDA 4PDLA 2ZXWC 4MVRA 3ABMC 5EK0A 3SYPA 2EINC 1Q81W 5E1AC 1M56C 4GX0A 3K79A 3SPCA 5CBFA 4RQEA 4PDMA 2IJKA 4ZBMA 5HFLA 1FXKA 1M90W 1NQTA 1L1FA 4QPKA 4XDKA 3CCLV 4GT1A 3ZJZA 3JD2A 3ABKB 5B1NA 1FS0G 4FIPC 1PNKA 3TCUA 1K9MW 1Q82W 4JGSA 2MK3A 1YJWV 3OEHG 2Y69C 2JJ2G 1QCEA 2H8PC 2XOKG 3OAAG 5LHGA 3CCVV 1VQ4V 5LGUA 2EZOA 3ZCCA 1EBOA 1EFRG 4QPJA 1F23A 5J9PC 2X6CA 2ZD9A 3CMAV 3ABLB 4I5SA 1OCOB 4G2KA 4MT8A 2DQ0A 5L3DA 1YJNV 2PI5A 2Z5UA 1MSWD 3LNMB 1QLNA 2B5UA 3IGAC 1F51A 4FK5C 3AG3B 1NBMG 2H94A 3AG2C 1CP9A 2WLLB 3G6EV 4I9WA 4X89A 3FB5C 2IW5A 2DYSC 4P30A 3ZMSA 4BIZA 1G4YB 4MTFA 2DQ3A 2Q6AA 4R8CA 5KA5A 1NVPB 3CCMV 4QJFB 3ETDA 3BY6A 2QKSA 4YXWG 3CCUV 1OCCC 1NR1A 3NXSA 1YHQV 1OCRC 4MTXA 4KFMA 2OTJV 2P90A 4MW3A 2EILB 4UV8A 3W7SA 2A0LA 3K0GA 3ASNB 3G71V 1YSCA 2X6BA 4PA6A 4RUFA 2DYSB 2WAMA 2X7RB 3CCRV 3ETGA 3A0RA 4EKWA 2P7TC 4GX1A 5IYDO 3DGEA 2UXNA 3IC7A 1S72V 3ASOC 1OCRB 3KG2A 3RW0A 4XDJA 3VOUA 1K5QA 3D3IA 1E79G 3ZIAG 3CXCU 1JJ2U 3E2EA 3EFFK 4MVUA 3WG7B 5B1BC 1WPXA 1Y4MA 3M99B 4MVOA 2HR3A 4WFHA 1R3IC 2NLJC 1GO3F 5EBMC 3CC7V 1H8EG 3PJSK 3ASNC 4RQFA 3R65A 3I56V 2X6AA 4MVZA 2W0FC 4HYOA 3B77A 2IJIA 3K08A 4WF9V 4ZKIA 3GB7C 1KC8W 3QO5A 4FJCC 3T2MA 2Q68A 2WLKA 1OCZB 3E89A 2P67A 1W0JG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLH A;  3E83 A;  4PA7 A;  4XDK A;  5BZB A;  4PA4 A;  4R50 A;  3UM7 A;  4MS2 A;  2ATK C;  3ZJZ A;  5EBW C;  4UUJ C;  3TCU A;  2BOC C;  3LDC A;  3LDE A;  3SYA A;  3JYC A;  4R6Z A;  3RVY A;  2OCC C;  3LUT B;  3SYQ A;  2DWE C;  3WG7 C;  3FB7 C;  3SPG A;  2Y69 C;  2A79 B;  2H8P C;  3AG1 C;  1S5H C;  4R7C A;  5B3S C;  5CBH A;  3K06 A;  3E8F A;  1LNQ A;  1P7B A;  3FB6 C;  3SPH A;  4QE7 A;  2HJF C;  5J9P C;  2X6C A;  3OR7 C;  2ZD9 A;  3OGC C;  2JK5 C;  3E8G A;  3E8B A;  4MTO A;  4CBC A;  3T4Z A;  2HVJ C;  5EC2 C;  5B1A C;  3STZ C;  2WLJ A;  3X2Q C;  3LNM B;  1OCZ C;  2ITC C;  3OR6 C;  3IGA C;  1KKD A;  2KB1 A;  2EIL C;  4XDL A;  2EIK C;  1R3K C;  4X88 A;  2IH1 C;  3AG2 C;  4PA3 A;  1K4C C;  2WLL B;  3HPL C;  3LDD A;  2WLI A;  2YEV A;  1R3J C;  2QTO A;  2DYR C;  3OUS A;  4GX2 A;  4I9W A;  4GX5 A;  2AHY A;  1M57 C;  4MVQ A;  3SYO A;  4X89 A;  3FB5 C;  4PDV A;  1V54 C;  4PDR A;  1ORQ C;  2DYS C;  4P30 A;  3T4D A;  4MVS A;  1G4Y B;  4MTF A;  4MW8 A;  4PA9 A;  2Q6A A;  3T1C A;  4MTG A;  2Q67 A;  5KUK A;  4R8C A;  2A9H A;  4JTD B;  2WLI B;  4H33 A;  3SJQ C;  1XL4 A;  1QLE C;  2QKS A;  1JVM A;  3ABL C;  1OCC C;  3E86 A;  2DWD C;  3IFX A;  4RO2 A;  4WFE A;  5EC1 C;  3RBZ A;  2HVK C;  2K1E A;  1OCR C;  1R3L C;  3SPJ A;  4KFM A;  4P9O A;  2AHZ A;  4QNH B;  3F7Y C;  5IY5 C;  4MW3 A;  4LP8 A;  3AG3 C;  3STL C;  4DXW A;  2IH3 C;  3AG4 C;  4OXS A;  4WFG A;  2A0L A;  3K0G A;  2ITD C;  4G28 B;  4RAI A;  5CBG A;  2X6B A;  4PA6 A;  4RUF A;  4RUE A;  4X8A A;  1K4D C;  4J9Z B;  4P9P A;  2HG5 C;  1ZWI C;  2WLN A;  4LCU C;  4JTA B;  5EBL C;  4EKW A;  3F5W C;  1BL8 A;  2P7T C;  2WLM A;  4GX1 A;  4F4L A;  4WFF A;  4J9Y B;  1J95 A;  3E8H A;  3SPI A;  4TWK A;  3TET A;  2EIM C;  3SYC A;  2EIJ C;  3ABK C;  3RVZ A;  3ASO C;  3KG2 A;  3RW0 A;  4XDJ A;  3VOU A;  3FB8 C;  4MVM A;  2WLL A;  4MSW C;  4BW5 A;  3EFF K;  3K04 A;  4JTC B;  4MVU A;  5B1B C;  4QE9 A;  4MVO A;  4P2Z A;  1V55 C;  2R9R B;  4WFH A;  3UKM A;  1R3I C;  2HFE C;  2NLJ C;  2ZXW C;  4PDL A;  3ZRS A;  5KUM A;  3K0D A;  2Q69 A;  5EBM C;  2BOB C;  4MVR A;  3ABM C;  3PJS K;  3ASN C;  3BEH A;  4H37 A;  3OUF A;  3R65 A;  5EK0 A;  3SYP A;  3F7V C;  2EIN C;  2X6A A;  4MVZ A;  2W0F C;  5E1A C;  1M56 C;  4HYO A;  3K03 A;  4GX0 A;  3K08 A;  3SPC A;  5CBF A;  1OCO C;  3GB7 C;  4G27 B;  4PDM A;  4ZBM A;  3T2M A;  2Q68 A;  2WLK A;  4LBE C;  3E89 A;  4HZ3 A;  1XL6 A; 
#chains in the Genus database with same CATH topology
 4J7J A;  2YIA A;  3CCQ V;  4CH4 A;  2D3O W;  1SER A;  1Q8I A;  5IJ9 B;  5EBW C;  1VP7 A;  3LDE A;  5DM6 V;  3RVY A;  4PEL A;  1H8H G;  4LH7 A;  1HR0 O;  2A79 B;  3CE2 A;  1I94 B;  2AGA A;  1VQN V;  4DYL A;  5B3S C;  4NXN O;  1VF6 C;  4FMT A;  4D7T A;  1VF6 A;  3OR7 C;  2UUC O;  4MTO A;  2IJH A;  2R70 A;  5KA6 A;  2Q4P A;  1S5J A;  4GZR B;  1TUB B;  2DYR C;  3C3T A;  1XMO B;  5JJE B;  1GTO A;  1HWY A;  5CB4 B;  4LWS A;  2Y69 B;  1W0K G;  4GKK B;  3R66 A;  5KUK A;  5BY1 A;  1N34 O;  4GCZ A;  1AJN A;  4LWS B;  3MHS C;  1S76 D;  3UO3 A;  1SET A;  4LNU A;  4DV2 B;  3AG2 B;  5IJ0 B;  4IHJ B;  3VQW A;  2FKX A;  1R6T A;  4RUE A;  1IX9 A;  1FKA O;  1GH6 A;  1PD3 A;  2JIZ G;  4B3T O;  3IJ4 A;  3F5W C;  1B6Q A;  1W2B U;  4LF7 O;  4IL6 Z;  2EIJ C;  5LOV B;  4DUZ B;  1RPR A;  3HKE A;  1K33 A;  2AZ2 A;  1GRJ A;  1RFY A;  3N27 A;  1BHA A;  4KXR A;  1KU9 A;  2NNU A;  2X0L A;  4JV5 B;  4K3A A;  3CSX A;  2CTW A;  5EIB C;  2RN9 A;  1OCO C;  4FLU A;  1K73 W;  1VQ8 V;  2Q7E A;  2PTM A;  5DED A;  5GTH Z;  3TGU H;  1SQX H;  4CC5 A;  5A2Q N;  1RP3 B;  4FM0 A;  2B1G A;  4I0X B;  1NVP D;  1M1K W;  2ZR3 A;  3K58 A;  3AK2 A;  1FFT B;  2B1I A;  3WG7 C;  3SYQ A;  3DTU B;  5BMV A;  1EN4 A;  3FAV A;  2FTK A;  1IZ3 A;  5KHK A;  3E8F A;  3FB6 C;  1SZT A;  5BMV B;  4JI1 O;  2YIB D;  1NI8 A;  1P4R A;  3BRC A;  3OR6 C;  4LC1 A;  4XDL A;  2ZKO A;  4UVB A;  3W7U A;  1K7D A;  5KHH A;  2WLI A;  2XAH A;  3OUS A;  3W7W A;  4AQY B;  4JYA B;  1PL0 A;  4YJ2 A;  1AJP A;  4X65 B;  2LFS A;  4MW8 A;  1F4N A;  2YS8 A;  3B8N A;  5GON B;  1LUV A;  5IE9 A;  5KX5 B;  3JCU Z;  5KHI A;  5EC1 C;  3RBZ A;  1QVF U;  3HKC A;  1YF2 A;  3SPJ A;  1R6K A;  2JJ1 G;  4FLZ A;  1JFF A;  2L6L A;  4LP8 A;  3ZHT A;  4DR3 O;  5KX5 A;  2EJ7 A;  4H44 B;  4OXS A;  4DR4 O;  4DR7 O;  4KUM A;  1D5N A;  4UCS A;  3HKC B;  1HNX B;  4LFC B;  1IBK B;  1GK9 A;  1ARO P;  3ZRW A;  1P84 F;  2WLM A;  3E22 A;  2EX3 A;  3SYC A;  5B1O A;  1YXB A;  3OTF A;  2EJR A;  1THZ A;  1AI6 A;  1NR7 A;  4OX9 O;  2OCC B;  1Y76 A;  3CEI A;  1YDX A;  2QKC A;  5F2V O;  3ZRS A;  2BOB C;  4Z1M G;  3BEH A;  1VF5 B;  1VQP V;  5GTI Z;  3P32 A;  1OHH G;  1FXV A;  2QR4 A;  3E83 A;  2YXH A;  1TA8 A;  1AR5 A;  4MS2 A;  3L72 H;  4TT3 G;  2ZM6 O;  3MD0 A;  2E74 B;  3FB7 C;  4JI3 O;  5ITZ A;  1I5Y A;  2YI9 A;  1WAZ A;  2RNB A;  4TV9 A;  3B8M A;  4Z2W A;  1HP8 A;  2JK5 C;  2AXT Z;  4DR2 O;  1OCZ C;  1QHT A;  1JPX A;  4GLX A;  3CRR A;  4JF3 A;  1CEZ A;  2Q7H A;  2HLD G;  4NR1 A;  1BMF G;  5CA1 A;  3T4D A;  4I55 B;  3B4S A;  4MTG A;  3VBB A;  2KG7 B;  2ILM A;  2A06 H;  2RMK B;  1S0V A;  2EIJ B;  1HNW B;  2HJD A;  2K1E A;  1XHX A;  4E4E A;  1R3L C;  3RN4 A;  4CH5 A;  4LF6 O;  4WFB V;  2Y4U A;  4JI0 B;  1DTO A;  1KQS U;  1GN3 A;  2HG5 C;  3ZHU A;  3RT3 C;  4NXM O;  2XAQ A;  1BL8 A;  2K9P A;  4FFK A;  1K97 A;  4UCO A;  1I5X A;  2ZQM A;  3JD0 A;  3P30 A;  5H6Q A;  1VQ6 V;  2ZE6 A;  1GKF A;  4LF5 B;  2QTS A;  4JV5 O;  3WB2 A;  1OV9 A;  3RYH A;  3GVM A;  4DR6 B;  4K0K O;  1H2S B;  3JAR B;  1HNZ B;  2NN4 A;  4LH6 A;  3SPC A;  5CBF A;  4PDM A;  4ZBM A;  2LGQ A;  1M90 W;  1NQT A;  1L1F A;  4XDK A;  5LOV A;  3THO A;  3ABK B;  2VQF B;  4JI7 O;  1YZB A;  3TCU A;  4ZI7 A;  1K9M W;  1SQF A;  1BE3 H;  1WB8 A;  2H8P C;  2GDS A;  2QGN A;  2XT9 A;  2EZO A;  4QPJ A;  4GKJ O;  5E79 Z;  5J9P C;  4GUN A;  2X6C A;  3MDS A;  4YY3 B;  1YJN V;  2OYQ A;  1IBL O;  4UCV A;  4O4I A;  2ZT9 B;  3RYC B;  3IGA C;  1FD9 A;  4FK5 C;  1P49 A;  4F6R B;  2QM4 A;  2H94 A;  1GN6 A;  3N2K A;  5J2T B;  4I9W A;  3RYC A;  2IW5 A;  1G4Y B;  4WBN B;  2DQ3 A;  4L8J A;  4HNA A;  4R8C A;  4U3J B;  4LF4 O;  2JRI A;  1NVP B;  4TUY A;  3ETD A;  4ABM A;  2QKS A;  1XDC A;  1OCC C;  1G1X B;  4UB6 Z;  4FLT A;  1NR1 A;  1YHQ V;  4KFM A;  1Z5V A;  3W7S A;  2OWO A;  4I9Q A;  3K0G A;  1TVK A;  1Q6H A;  2WAM A;  1MSD A;  4DV0 B;  3H1H H;  2BCC H;  2P7T C;  5IYD O;  4YJ3 B;  1A32 A;  4DR3 B;  2BTO A;  1XEQ A;  2ODM A;  2UXN A;  3N2G B;  1XBL A;  3JAR A;  1K5Q A;  3Q4H A;  1E79 G;  3ZIA G;  3CXH F;  3WG7 B;  1QNM A;  2HR3 A;  5LMN O;  2CTQ A;  3PJS K;  2YIC A;  4DV6 B;  4LF9 B;  4ZKI A;  4ZI7 B;  1XRE A;  3QO5 A;  4FJC C;  3M7M X;  3SR2 C;  1N0J A;  2CUG A;  4UCU A;  1KUQ A;  2LW7 A;  2C2A A;  4A5U B;  4PA7 A;  1KP3 A;  4PA4 A;  2JVD A;  4R6Z A;  3LUT B;  2XAF A;  2Q0A A;  2VWJ A;  1LNQ A;  3APO A;  4X9Q A;  5C8Y B;  3UQ8 A;  1K8A W;  4LFA O;  3JAW B;  3K57 A;  2N05 A;  2H3O A;  2ZNI A;  2HVJ C;  3STZ C;  3X2Q C;  3VQV A;  4JI4 O;  2ITC C;  5KLV H;  3ZMZ A;  2KB1 A;  2JGU A;  2VQE O;  2UXD B;  4JI5 B;  5FNV B;  1M57 C;  4ZHQ B;  1JA8 A;  4PDR A;  2F93 B;  1JJO A;  2CH7 A;  3HKB A;  1K5S A;  3FYI B;  1MNG A;  1WPB A;  1KEC A;  2OIG A;  4X1Y B;  1QLE C;  1UFI A;  3RYI A;  3E86 A;  1UJW B;  2XAG A;  2RDC A;  4DR6 O;  3K5L A;  3HKE B;  2ZE8 A;  3CC4 V;  4LF5 O;  3EHB B;  1N0N A;  4WFG A;  4FPP A;  1V54 B;  4UXN A;  1K4D C;  4H13 B;  1SC5 B;  4NVP A;  2QA4 V;  4JTA B;  3FD9 A;  3K5M A;  1JCH A;  5AG2 A;  4EB6 A;  4DV2 O;  4I50 A;  2PI4 A;  4J80 A;  1J95 A;  3SPI A;  4TWK A;  2LQT A;  1IBM O;  4B7K A;  3KKY A;  4JI0 O;  3ABT A;  2JEU A;  2QWN B;  4W4L A;  2ZDI A;  3L70 H;  1UPG A;  1ROP A;  3OUF A;  1TAE A;  2CE4 A;  4QGP A;  1XNR B;  3U0Z A;  1NTZ H;  5D5Q A;  4G27 B;  2E76 B;  1SQB H;  3O9O A;  1F7Y A;  3QNE A;  4DV6 O;  2Q5Z A;  3CC2 V;  2ATK C;  4JI2 B;  2IM9 A;  2DYR B;  1K92 A;  3JAS B;  2E75 B;  1VMG A;  2WA4 A;  2A7W A;  4DK0 A;  3OMA B;  5LYJ B;  1BT8 A;  3J80 N;  4LF8 O;  1RM1 C;  2EBO A;  2GBO A;  4CBC A;  1H2K A;  3BAB A;  3CRM A;  5B1A C;  4BIU A;  4BIO A;  3APQ A;  2ADP A;  3SJC C;  1KP2 A;  1XMQ O;  3IC9 A;  5IT9 N;  4XBF A;  3S3X A;  1R3K C;  5FPO A;  3TXS A;  2RCV A;  5LP6 B;  2YSU B;  3FX7 A;  3HPL C;  1YIJ V;  1CPY A;  1FJG O;  4B3S O;  4GX5 A;  4MVQ A;  4LFB B;  1V54 C;  1EM1 A;  1P7G A;  3LSU A;  3ZRV A;  4LF9 O;  5BR8 B;  4JYC A;  2A9H A;  1RM1 B;  4PI0 A;  4DV4 B;  1X59 A;  1SRY A;  3ZMV A;  1Q7Y W;  3JAL A;  4K0K B;  3BHP A;  1WLE A;  3AG3 C;  3AG4 C;  4JAS A;  1Q3E A;  3JAL B;  3H1L H;  1BHB A;  3H01 A;  4EFE A;  3DSQ A;  2FB5 A;  1AI5 A;  4KP4 A;  1GM8 A;  3J81 N;  3DC5 A;  2GV9 A;  1QLE B;  2R9A A;  3QO7 A;  1JMK C;  2Q0O C;  4X66 B;  3CCS V;  3RVZ A;  2GTA A;  4N23 A;  4LFC O;  2E5L B;  4U7O A;  4QE9 A;  1GAX A;  1K3E A;  3ZS8 C;  2VQF O;  1TVK B;  4JI7 B;  4EFB A;  2YXY A;  1N33 B;  2Q8V A;  5LHI A;  4F6E A;  3K03 A;  1V9P A;  3OTO O;  3JAS A;  2UXX A;  4DV4 O;  2HHH O;  2IU3 A;  3HKD A;  2QDO A;  3CX5 F;  4U7N A;  3U11 A;  3K9A A;  4OPH A;  1JFF B;  2BOC C;  3JYC A;  2GSM B;  1ENV A;  5EZY B;  4DV7 O;  1MZF A;  2ZXW B;  1NT2 B;  4DO2 A;  5IYB O;  4DR2 B;  2RQ6 A;  3ZRW B;  2IJJ A;  3OGC C;  3CWB H;  4DR4 B;  3P3N A;  5JCO C;  2BSK A;  4CS4 A;  5J2U B;  3OM3 B;  3JD4 A;  3LNN A;  5L3B A;  2EIK C;  1QVG U;  4E2L A;  2ZDI C;  4B3R B;  2QWQ B;  3K59 A;  2JGD B;  4D7S A;  5LGT A;  1BQ0 A;  1GN2 A;  4PDV A;  4JI2 O;  1ORQ C;  2YXL A;  1PNL A;  3AG7 A;  4MVS A;  3JD3 A;  5IWA O;  3T1C A;  3AG1 B;  1VQ7 V;  1GN4 A;  1HNW O;  4DW0 A;  4JYA O;  2BE3 A;  1O9G A;  5JWP A;  3SJQ C;  3QVN A;  4LNU B;  3ABL C;  3IFX A;  4RO2 A;  2VWK A;  3X2Q B;  5JH7 A;  3B40 A;  1XIL A;  3DC6 A;  1AP6 A;  5B1B B;  1IXM A;  4J11 A;  4B3R O;  1AI4 A;  4CS3 A;  2CGN A;  1NH2 B;  4Z1V A;  4TSF G;  2XUM A;  3ZRX A;  1QQC A;  4LF7 B;  4LCU C;  3C3S A;  3G80 A;  1PPJ H;  5LXT B;  3AEI A;  3RYI B;  5HFM A;  2DMX A;  3AK1 A;  3ABK C;  4NTX A;  1EN6 A;  2QM7 A;  1IBK O;  3IAY A;  4BW5 A;  1R1B A;  2Z0A A;  2P22 C;  4MVR A;  3ABM C;  1ZTE A;  4J7Z A;  2D2C B;  3SYP A;  1Q81 W;  4X1I A;  1M56 C;  4H0L B;  5IJ9 A;  2CTR A;  2LO1 A;  4RQE A;  2IJK A;  1FXK A;  4O4J B;  1HNZ O;  3BAA A;  2P4K A;  1KYO F;  5LP6 C;  4GKK O;  1N33 O;  1PV0 A;  1FPO A;  2P06 A;  4FIP C;  2EUL A;  4DUY O;  2UXD O;  4O4J A;  1HDJ A;  2MK3 A;  1YJW V;  4OX9 B;  2JJ2 G;  3OAA G;  2PYL A;  4X66 O;  1DGS A;  2ZE7 A;  1EBO A;  1F23 A;  2ZD9 A;  4YHH B;  5JQG B;  1XI1 A;  4G2K A;  1MMM A;  2DQ0 A;  2PI5 A;  4DK1 A;  3L75 H;  4LF8 B;  3PN1 A;  4PJ0 Z;  1I94 O;  3AG2 C;  1CP9 A;  3FFQ A;  1Y76 B;  2UUA B;  1WA8 A;  5KAI Z;  1BCC H;  3OD4 A;  5KA5 A;  2QWP B;  1XMO O;  3CCM V;  3T1Y B;  4QJF B;  3BY6 A;  3CCU V;  1H2N A;  4CH6 A;  2HEP A;  5EYP B;  5BR8 O;  2P90 A;  2EIL B;  3JAK B;  4UV8 A;  4U3F H;  3A0B Z;  4JI8 B;  3HR0 A;  3CCR V;  3BPZ A;  3VQY A;  1SQV H;  4O4I B;  1IVS A;  3IC7 A;  4XDJ A;  4MVU A;  3M99 B;  4FLW A;  1R3I C;  1Z5W A;  5EBM C;  3R65 A;  1Q5O A;  4I55 A;  2X6A A;  4MVZ A;  5LMU O;  2DE0 X;  3K5N A;  4B08 A;  3T2M A;  1T5E A;  1OCZ B;  2P67 A;  4BR6 A;  1W0J G;  3KCY A;  3ZMT A;  1TUE B;  5K1P A;  1VQK V;  3ZHS A;  2OT5 A;  2KKW A;  1ZLZ A;  4JI6 B;  5L3F A;  4JI1 B;  3A2F A;  1SQG A;  2ADQ B;  3WFV A;  2Q9L A;  2XAJ A;  4LFB O;  2HKO A;  3EVK A;  5IDJ A;  1NJI W;  4TV8 A;  3T4Z A;  5EC2 C;  4KHP B;  3L9D A;  2JS3 A;  1OJH A;  2YI8 A;  3HKD B;  1ZSP A;  2QM8 A;  4X88 A;  1HNX O;  1YEW A;  1VF7 A;  2AW9 A;  2XAS A;  2Q7G A;  3K5O A;  4IT5 A;  1MAB G;  1N8R W;  1K34 A;  1YTF D;  1R6N A;  5LBQ A;  4I50 B;  4K8X A;  3BVO A;  4WFE A;  2WWW A;  1VQL V;  3CRQ A;  3CRC A;  4X65 O;  1D5A A;  4QNH B;  2LFR A;  1BGY H;  1AR1 B;  3W7X A;  2OCH A;  3STL C;  5LMN B;  1OZ0 A;  4NTW A;  4B3T B;  4LF4 B;  1FJG B;  2JGD A;  4FLV A;  2VS0 A;  1XMQ B;  1F4M A;  4X64 B;  1MG1 A;  2GHY A;  2WLN A;  2IBZ H;  1WNS A;  1MOF A;  1WN7 A;  2P4V A;  1G8M A;  5LGN A;  2R72 A;  4J42 A;  4MSW C;  2CDY A;  3K04 A;  3ETQ A;  4JZG A;  4JAU A;  3AG4 B;  5FNV A;  4PD4 F;  3NR7 A;  3HKB B;  1JX9 A;  2LP7 A;  5JJN B;  4TUY B;  4X20 A;  4FFB B;  2E3C A;  3CP1 A;  3ZX6 A;  1XNR O;  2Y0I A;  3QO8 A;  4EEQ A;  3JSN A;  3E35 A;  4R50 A;  1H2M A;  3UM7 A;  3ZN1 A;  1RSO A;  1PL4 A;  1Y74 A;  4Q20 A;  1FXK C;  3OE7 G;  4B3M B;  1KD1 W;  5B66 Z;  4R7C A;  2MW2 B;  1EZJ A;  5CBH A;  1D2D A;  4GYC B;  1YJ9 V;  1NS1 A;  4QE7 A;  4WFA V;  1PNM A;  2F23 A;  2F4V O;  3N2K B;  4EB6 B;  1QU7 A;  1SA0 A;  5CA1 B;  1M5I A;  3OFN G;  1VQ5 V;  4X1K A;  4HNA B;  1K4C C;  3RFR A;  3ZED A;  4NXM B;  2ZM6 B;  2YIB A;  3UT5 B;  3SYO A;  5H6R A;  4BAY A;  1US6 A;  4PA9 A;  4ICG A;  2IU0 A;  1JR9 A;  2YEV B;  3CS5 A;  5FPR A;  4JI6 O;  2DWD C;  5DN6 G;  1M4U A;  4J7K A;  1S77 D;  1ZUQ A;  1KBH A;  5JVD A;  2DOS A;  4DXW A;  3CCJ V;  3CJH A;  4RWU A;  2DW4 A;  1VQM V;  2Z3Y A;  3ABM B;  5L3C A;  2YDE A;  5LMU B;  2EIN B;  2KSD A;  4FVM A;  3N2G A;  5JVD B;  3JD1 A;  4DRX B;  4JAA A;  5L3G A;  2YID A;  5EBL C;  4YY3 O;  2UUC B;  1IDS A;  4WFF A;  1JOY A;  4NXN B;  4GKJ B;  4DV5 O;  2PZS A;  2GUZ A;  2M7W A;  1Q6I A;  5L3E A;  2UXB O;  2F66 C;  5LA6 B;  4ZIB A;  2Y48 A;  5EZY A;  2HFE C;  3H1J H;  5KUM A;  3LSS A;  3D36 A;  1Q6U A;  3BFR A;  3JCZ A;  1U96 A;  2GUZ B;  3F7V C;  4NKG B;  1LR1 A;  1Y74 B;  4LBE C;  4HZ3 A;  3CME V;  3CB2 A;  2PY5 A;  1H2G A;  5BZB A;  4DV5 B;  1Y6X A;  3ASO B;  1GM9 A;  1M57 B;  2HHH B;  2DWE C;  2QKA A;  3OMN B;  3T1H B;  3CCE V;  1DF5 A;  5FLX N;  1L0N H;  3OMI B;  4I0X A;  4F6R A;  2UUA O;  1G6U A;  2PUS A;  2F95 B;  2ZR2 A;  5J2T A;  1NH2 D;  1HW7 A;  2QEX V;  4WBN A;  2JEX A;  1QBZ A;  1IBL B;  4JI3 B;  1NU1 H;  3LDD A;  1YIT V;  3SDL A;  2YEV A;  4I4T B;  2AHY A;  4WCE V;  3TK1 A;  3DXR B;  1COW G;  3JAT B;  4IIJ A;  3H9V A;  2WLI B;  1H38 A;  4H33 A;  3OT7 A;  1XL4 A;  4CS2 A;  4DUY B;  2KQX A;  1H2L A;  2EIM B;  4YJ2 B;  5B1A B;  3L74 H;  2NR5 A;  1I0H A;  4JYB A;  3B2E E;  5GON A;  5IYZ B;  4JPR A;  1KB9 F;  4OGQ B;  1YCI A;  2F4V B;  3ABU A;  1SQP H;  4DV3 B;  1XOU A;  1YVW A;  4NTY A;  4X1I B;  4P9P A;  5IYZ A;  1ZWI C;  3Q4H B;  1PP9 H;  4L87 A;  5IJ0 A;  3D8C A;  2WSS G;  2B9Z A;  4AHC A;  2UUB B;  1RPO A;  1PM9 A;  4O2B B;  1JQ0 A;  3CPW U;  4K8Z A;  2HP8 A;  3P3P A;  2W0X A;  2OTL V;  2Y4T A;  2WLL A;  3CRA A;  2QJ1 A;  2FL4 A;  2WA3 A;  3SGI A;  4O2B A;  1TUB A;  1V55 C;  1YTF B;  2V4D A;  2ZXW C;  4YIP A;  1BSM A;  5EK0 A;  1J5E B;  1FYJ A;  2Y0P A;  5HFL A;  1S5L Z;  2ARH A;  4AIL C;  3CCL V;  2PYJ A;  3ZJZ A;  3JD2 A;  5B1N A;  3ZHR A;  2UXC B;  4D6T H;  4PHZ A;  1Q82 W;  3D36 C;  3OEH G;  4FM1 A;  3OGI B;  1OCO B;  4X20 B;  4NB5 A;  2B5U A;  1IBM B;  4X89 A;  3FB5 C;  4P30 A;  1IUR A;  4DV7 B;  4UCT A;  2QWR B;  3ICX A;  1XHZ A;  3QTC A;  2UU9 O;  4O4H B;  1OCR C;  4MTX A;  4FZ0 A;  2OTJ V;  3D3Q A;  4MW3 A;  4AQY O;  2ZIO A;  1Q90 D;  3OTO B;  2KG7 A;  4CC6 A;  3VQX A;  4O4H A;  3FAV B;  4LR3 A;  3ASN B;  3G71 V;  4X62 O;  1YSC A;  1XNQ O;  4PA6 A;  2DYS B;  3QG5 A;  3ETG A;  4OPA A;  4EKW A;  1MA1 A;  2LJ2 A;  3L71 H;  3SJB C;  2E5L O;  4BWA A;  3DGE A;  3KCX A;  3MAQ A;  1S72 V;  3ASO C;  3KG2 A;  4B7E A;  4PV1 B;  3D3I A;  1JJ2 U;  3EFF K;  3A8T A;  4MVO A;  3CJH B;  1MZE A;  1BQZ A;  4WFH A;  1BZK A;  4C7U A;  3RYF A;  1H8E G;  4RQF A;  3S3W A;  3I56 V;  2W0F C;  2ZIN A;  3L73 H;  1AP5 A;  3B77 A;  3K08 A;  4WF9 V;  3GB7 C;  1N34 B;  1KC8 W;  3ZMU A;  2WLH A;  5KMG B;  4JZ2 A;  4IYH A;  1QR8 A;  4UUJ C;  2O57 A;  3W7T A;  5KMG A;  4QIW F;  4KL1 A;  1DLB A;  2BSK B;  4DUZ O;  1P7B A;  4UCR A;  2W6J G;  4B3S B;  3E8G A;  3E8B A;  4ZOL B;  5LXT A;  2V7Q G;  2WLJ A;  5ITZ B;  4FM2 A;  1SKV A;  2L35 A;  5IY5 B;  3HB3 B;  2IH1 C;  4PA3 A;  3MHH C;  4DR7 B;  4GX2 A;  4W4K A;  1N36 O;  1B04 A;  2UXC O;  2DN9 A;  1BS3 A;  5B3S B;  2AZ0 A;  1FXH A;  4JTD B;  2CK3 G;  3EXA A;  4FZ1 A;  3BCC H;  3OEE G;  3U10 A;  2WPD G;  2ITD C;  4O2A B;  4UVC A;  3FYE B;  1XQ8 A;  4I4T A;  1GM7 A;  2CGO A;  2JDI G;  5LL6 Y;  1Z2G A;  4FFB A;  4O2A A;  3B09 A;  4O4L A;  3RYF B;  3E8H A;  1L8D A;  4NYK A;  1VQO V;  4MVM A;  1Y67 A;  3H1I H;  1N32 B;  1E1R G;  5H5N A;  2PF4 E;  3WB1 A;  3GWO A;  3K0D A;  3LSQ A;  3CD6 V;  1SQQ H;  2ETN A;  2G38 A;  3O65 A;  5KHG A;  4DR5 O;  2VRZ A;  4FLY A;  1PKX A;  5CA3 A;  1XL6 A;  3RYH B;  2YC0 A;  5EYP A;  3C90 A;  3I55 V;  4DV1 O;  3JAK A;  3LDC A;  3UT5 A;  3SYA A;  2OCC C;  4ZOL A;  1N32 O;  1I7F A;  1V55 B;  3RGB A;  5CMU A;  5J2U A;  1S5H C;  3G4S V;  3K06 A;  3SPH A;  1AIL A;  4JI5 O;  1M56 B;  1M93 A;  2BTQ B;  5GW7 A;  1S3J A;  2V1D A;  3E22 B;  2VQE B;  4DW1 A;  3WU2 Z;  3AK3 A;  1ZX3 A;  3ZHV A;  5B5E Z;  1WA8 B;  2EIL C;  5TIS Z;  4X62 B;  1XNQ B;  3G67 A;  1KKC A;  1Y66 A;  2M6Y A;  2QTO A;  3ZN0 A;  1XUQ A;  2OIE A;  2ZNJ A;  1U97 A;  4CZZ A;  5JH7 B;  4DR1 B;  2Q67 A;  4LF6 B;  4UV9 A;  5KAF Z;  3UCS C;  2HVK C;  1J5E O;  1SES A;  4P9O A;  3TXQ A;  5IY5 C;  1FFX A;  2EIK B;  4X1Y A;  4RAI A;  5CBG A;  2CTP A;  1E1Q G;  4CH3 A;  1FFX B;  2LW1 A;  4JI8 O;  1WB7 A;  2R9I A;  5DEC A;  1URF A;  3OW2 U;  1SZX A;  3TET A;  4UVA A;  1YI2 V;  2EIM C;  1N4C A;  3FB8 C;  1NTM H;  4X1K B;  4JTC B;  4P2Z A;  5K1X A;  2R9R B;  1FXK B;  3UKM A;  3T1Y O;  4DV0 O;  2Q69 A;  4UFZ A;  4PI2 A;  4H37 A;  1X4T A;  1NTK H;  4U3J A;  1Q86 W;  3K3W A;  1DK1 A;  3A0H Z;  5IYC O;  3GWK C;  4IGG A;  2P5O A;  3CYO A;  4HAM A;  1AR4 A;  1LUW A;  2BTQ A;  4YHH O;  5JQG A;  4TV8 B;  3SPG A;  1O9H A;  1WP7 A;  3JAM N;  1NZ6 A;  2F43 G;  3AG1 C;  3DXR A;  3JAT A;  1Q43 A;  5BXZ A;  4BW9 A;  4DRX A;  2EZP A;  2HJF C;  2P6J A;  3ML0 A;  1EZV H;  2UUB O;  1OCC B;  2W6I G;  4JAV A;  2PGG A;  5LYJ A;  1KKD A;  1B3Q A;  2XND G;  1B06 A;  3FKS G;  2QWO B;  1QR9 A;  4IHJ A;  2Q73 A;  1R3J C;  5LA6 A;  1GMG A;  5C93 A;  1SF9 A;  4DV1 B;  3H1K H;  5LP6 A;  5H9C A;  5LHH A;  2UU9 B;  3F5T A;  1AI7 A;  1AVM A;  3UO2 A;  1JVM A;  4IYI A;  3J7A U;  1AB3 A;  4JYY A;  5A9G A;  2QE7 G;  1VIB A;  1IXB A;  2CH7 B;  1EN5 A;  2JS5 A;  2AHZ A;  3F7Y C;  2IH3 C;  3G6B A;  4G28 B;  1R73 A;  2XHB A;  5CA0 B;  4X8A A;  3ETE A;  4J9Z B;  3RWR D;  3SJA C;  3K9S A;  5C8Y A;  1AJQ A;  1WP8 A;  4Q6G A;  4F4L A;  4J9Y B;  5CA0 A;  4FLX A;  5CN0 A;  4N21 A;  1DF4 A;  1VQ9 V;  4I7Z B;  5FL7 G;  3T1H O;  1FAF A;  4ASU G;  1M9N A;  1NKD A;  4PDL A;  2N04 A;  4ZHQ A;  4AI8 A;  2N74 A;  1WJZ A;  5IWA B;  2EIN C;  5D5P A;  5KHJ A;  1TGO A;  5E1A C;  3TJT A;  4GX0 A;  3K79 A;  1RSO B;  3QF7 A;  1VEW A;  1KMI Z;  4O4L B;  4DR1 O;  2YUA A;  1SS3 A;  4QPK A;  5JJJ B;  4GT1 A;  3BA9 A;  1FS0 G;  2ZE5 A;  1PNK A;  1N36 B;  2F1M A;  4DR5 B;  3WB0 A;  4TOI A;  4JGS A;  1ZL8 B;  2UXB B;  2Y69 C;  1QCE A;  2XOK G;  4HBN A;  5LHG A;  3CCV V;  1VQ4 V;  5LGU A;  1SA0 B;  4UB8 Z;  3JSL A;  3ZCC A;  1EFR G;  3ZHQ A;  4K35 A;  4KHP O;  3CMA V;  3ABL B;  1ZL8 A;  5JCO A;  4I5S A;  4MT8 A;  5L3D A;  4YJ3 A;  2Z5U A;  1MSW D;  3LNM B;  1QLN A;  2ZIM A;  1F51 A;  3AG3 B;  3CHX A;  2CAZ C;  1NBM G;  2FML A;  2WLL B;  3M8A A;  4DV3 O;  2DJV A;  3G6E V;  2XTA A;  1CXZ B;  2DYS C;  3ZMS A;  4BIZ A;  4YIO A;  4MTF A;  2Q6A A;  2A3Q A;  2FYU H;  3BA8 A;  1I08 A;  4YXW G;  4TQF A;  5CB4 A;  3NXS A;  3ZBH A;  1L0L H;  4JI4 B;  1ZAU A;  2RJZ A;  2ZCE A;  2LGW A;  2A0L A;  4LFA B;  4J41 A;  2X6B A;  4RUF A;  3I5D A;  2X7R B;  3JAW A;  3A0R A;  1W59 A;  4J10 A;  4GX1 A;  4X64 O;  1OCR B;  5H2F Z;  3RW0 A;  3VOU A;  3CXC U;  4B3M O;  3KZI Z;  3E2E A;  5EIB D;  5B1B C;  1WPX A;  1Y4M A;  2NLJ C;  1GO3 F;  2QSA A;  3CC7 V;  4TQD A;  3ASN C;  4TV9 B;  1VAR A;  4HYO A;  1HR0 B;  4IIJ B;  2IJI A;  2GTS A;  2Q68 A;  2WLK A;  3E89 A; 
#chains in the Genus database with same CATH homology
 3ZMT A;  3ZMU A;  2C2A A;  1TUE B;  2WLH A;  1VQK V;  4PA7 A;  1KP3 A;  2OT5 A;  3CCQ V;  4PA4 A;  2D3O W;  1SER A;  5EBW C;  1QR8 A;  4UUJ C;  5L3F A;  3LDE A;  5DM6 V;  4R6Z A;  4PEL A;  1H8H G;  3LUT B;  3RVY A;  3W7T A;  2A79 B;  4QIW F;  2XAF A;  1VQN V;  1DLB A;  3WFV A;  5B3S C;  2XAJ A;  1LNQ A;  1P7B A;  4FMT A;  2W6J G;  1K8A W;  2HKO A;  3OR7 C;  5IDJ A;  1NJI W;  3E8G A;  3E8B A;  4MTO A;  2IJH A;  3T4Z A;  2HVJ C;  5EC2 C;  2V7Q G;  2WLJ A;  3STZ C;  3X2Q C;  2ITC C;  2QM8 A;  5IY5 B;  3ZMZ A;  2KB1 A;  5KA6 A;  3HB3 B;  4X88 A;  2IH1 C;  4PA3 A;  2XAS A;  3MHH C;  2DYR C;  4GX2 A;  1M57 C;  1GTO A;  1HWY A;  4PDR A;  2Y69 B;  1W0K G;  1MAB G;  1K5S A;  3FYI B;  5KUK A;  5B3S B;  1FXH A;  4JTD B;  2CK3 G;  1N8R W;  1K34 A;  1KEC A;  1YTF D;  1R6N A;  5LBQ A;  4GCZ A;  1QLE C;  1AJN A;  3E86 A;  4WFE A;  2WWW A;  1UJW B;  1VQL V;  2XAG A;  3MHS C;  3OEE G;  4QNH B;  1S76 D;  2LFR A;  3CC4 V;  1AR1 B;  1SET A;  3STL C;  3W7X A;  3AG2 B;  1OZ0 A;  3EHB B;  4WFG A;  2WPD G;  2ITD C;  4UVC A;  3FYE B;  1GM7 A;  4FPP A;  1V54 B;  4RUE A;  4UXN A;  1F4M A;  1K4D C;  2JDI G;  1MG1 A;  2GHY A;  2WLN A;  1PD3 A;  2JIZ G;  4JTA B;  2QA4 V;  1JCH A;  3F5W C;  1B6Q A;  1MOF A;  1W2B U;  2PI4 A;  1J95 A;  3E8H A;  3SPI A;  4TWK A;  1G8M A;  5LGN A;  2EIJ C;  1VQO V;  4MVM A;  4MSW C;  3ABT A;  1RPR A;  3K04 A;  1K33 A;  2JEU A;  4JAU A;  1E1R G;  3AG4 B;  2ZDI A;  3GWO A;  1BHA A;  3K0D A;  1ROP A;  3OUF A;  2NNU A;  3LSQ A;  2X0L A;  1JX9 A;  3CD6 V;  2LP7 A;  1OCO C;  4G27 B;  1K73 W;  1VQ8 V;  1PKX A;  5CA3 A;  3CP1 A;  1XL6 A;  3QO8 A;  3QNE A;  3E35 A;  4R50 A;  3UM7 A;  3ZN1 A;  3I55 V;  2ATK C;  3CC2 V;  2B1G A;  1M1K W;  1NVP D;  2ZR3 A;  2DYR B;  1K92 A;  1FFT B;  3LDC A;  3SYA A;  2B1I A;  2OCC C;  3WG7 C;  3SYQ A;  3DTU B;  4Q20 A;  1V55 B;  1FXK C;  2FTK A;  3OE7 G;  5CMU A;  3OMA B;  1KD1 W;  1S5H C;  4R7C A;  5CBH A;  1EZJ A;  3G4S V;  3K06 A;  3E8F A;  1RM1 C;  1YJ9 V;  3FB6 C;  3SPH A;  4QE7 A;  4WFA V;  2EBO A;  1SZT A;  1M56 B;  1PNM A;  5GW7 A;  4CBC A;  1S3J A;  2V1D A;  5B1A C;  4BIU A;  1P4R A;  1KP2 A;  3OR6 C;  4LC1 A;  4XBF A;  2EIL C;  4XDL A;  4UVB A;  1R3K C;  3W7U A;  3OFN G;  1VQ5 V;  2YSU B;  1K4C C;  1Y66 A;  1K7D A;  3HPL C;  1CPY A;  1YIJ V;  2WLI A;  2XAH A;  2QTO A;  3OUS A;  3W7W A;  3ZN0 A;  4GX5 A;  4MVQ A;  3SYO A;  1V54 C;  1PL0 A;  4CZZ A;  5H6R A;  4BAY A;  1AJP A;  3ZRV A;  2LFS A;  4MW8 A;  4PA9 A;  2IU0 A;  2Q67 A;  4JYC A;  1F4N A;  3B8N A;  2A9H A;  1RM1 B;  2YEV B;  4UV9 A;  1SRY A;  2DWD C;  5EC1 C;  3RBZ A;  1QVF U;  2HVK C;  3ZMV A;  5DN6 G;  1Q7Y W;  1SES A;  3SPJ A;  1R6K A;  4P9O A;  1S77 D;  2JJ1 G;  1WLE A;  5IY5 C;  4LP8 A;  3AG3 C;  2EIK B;  4DXW A;  3CCJ V;  3AG4 C;  4OXS A;  4JAS A;  4KUM A;  2DW4 A;  1VQM V;  2Z3Y A;  3ABM B;  5L3C A;  1BHB A;  4RAI A;  5CBG A;  3H01 A;  1E1Q G;  1GK9 A;  2EIN B;  3JD1 A;  1ARO P;  1AI5 A;  3ZRW A;  5L3G A;  4KP4 A;  5EBL C;  1GM8 A;  2R9I A;  2WLM A;  4WFF A;  1JOY A;  3OW2 U;  3TET A;  1QLE B;  3QO7 A;  4UVA A;  1YI2 V;  2EIM C;  3SYC A;  5B1O A;  3CCS V;  3RVZ A;  4N23 A;  2EJR A;  3FB8 C;  1THZ A;  2M7W A;  1AI6 A;  1NR7 A;  5L3E A;  2OCC B;  4JTC B;  4U7O A;  4QE9 A;  4P2Z A;  2R9R B;  1FXK B;  1K3E A;  2Y48 A;  3UKM A;  2HFE C;  3ZRS A;  5KUM A;  2Q69 A;  2BOB C;  3LSS A;  4Z1M G;  3D36 A;  3BEH A;  4H37 A;  3JCZ A;  5LHI A;  3F7V C;  1VQP V;  3K03 A;  1Q86 W;  3K3W A;  2UXX A;  3P32 A;  2IU3 A;  5IYC O;  4LBE C;  1OHH G;  4HZ3 A;  3CME V;  1FXV A;  4U7N A;  3CYO A;  1H2G A;  3E83 A;  4HAM A;  5BZB A;  3K9A A;  4MS2 A;  3ASO B;  1GM9 A;  2BOC C;  4TT3 G;  1M57 B;  3JYC A;  2GSM B;  3MD0 A;  2DWE C;  1ENV A;  3FB7 C;  3OMN B;  3SPG A;  3CCE V;  1DF5 A;  1I5Y A;  2F43 G;  2ZXW B;  3AG1 C;  3OMI B;  4DO2 A;  5IYB O;  3B8M A;  2EZP A;  2HJF C;  2P6J A;  3ZRW B;  2IJJ A;  3ML0 A;  3OGC C;  2JK5 C;  1OCC B;  2ZR2 A;  2W6I G;  4JAV A;  1NH2 D;  2QEX V;  1OCZ C;  3OM3 B;  1JPX A;  1KKD A;  3JD4 A;  2JEX A;  5L3B A;  1QBZ A;  2EIK C;  2XND G;  1QVG U;  4E2L A;  3FKS G;  3LDD A;  4JF3 A;  1QR9 A;  2ZDI C;  1YIT V;  2YEV A;  1CEZ A;  1R3J C;  2HLD G;  1GMG A;  5C93 A;  2AHY A;  5LGT A;  4WCE V;  4PDV A;  3TK1 A;  1BMF G;  1ORQ C;  1PNL A;  3T4D A;  4MVS A;  3JD3 A;  3T1C A;  3AG1 B;  4MTG A;  1COW G;  5H9C A;  5LHH A;  1VQ7 V;  2WLI B;  1H38 A;  4H33 A;  3SJQ C;  1AI7 A;  1XL4 A;  3VBB A;  1S0V A;  1JVM A;  3ABL C;  3IFX A;  2EIM B;  4RO2 A;  2QE7 G;  2EIJ B;  5B1A B;  2K1E A;  3X2Q B;  4JYB A;  1R3L C;  2AHZ A;  3F7Y C;  5B1B B;  4JPR A;  2IH3 C;  1IXM A;  3ABU A;  4G28 B;  1R73 A;  4WFB V;  1AI4 A;  1NH2 B;  1DTO A;  1KQS U;  4TSF G;  4X8A A;  3ETE A;  4P9P A;  4J9Z B;  3ZRX A;  2HG5 C;  1ZWI C;  4L87 A;  4LCU C;  1AJQ A;  2XAQ A;  1BL8 A;  2WSS G;  1RPO A;  1K97 A;  4F4L A;  1I5X A;  3AEI A;  2ZQM A;  4J9Y B;  5HFM A;  1JQ0 A;  3JD0 A;  3CPW U;  5CN0 A;  3P30 A;  4N21 A;  1DF4 A;  5H6Q A;  1VQ6 V;  3ABK C;  2QM7 A;  2OTL V;  1VQ9 V;  2WLL A;  4BW5 A;  5FL7 G;  1GKF A;  4ASU G;  1M9N A;  1YTF B;  1V55 C;  1NKD A;  4PDL A;  2ZXW C;  4MVR A;  3ABM C;  5EK0 A;  3SYP A;  2EIN C;  1Q81 W;  5E1A C;  1M56 C;  4GX0 A;  3K79 A;  3SPC A;  5CBF A;  4RQE A;  4PDM A;  2IJK A;  4ZBM A;  5HFL A;  1FXK A;  1M90 W;  1NQT A;  1L1F A;  4QPK A;  4XDK A;  3CCL V;  4GT1 A;  3ZJZ A;  3JD2 A;  3ABK B;  5B1N A;  1FS0 G;  4FIP C;  1PNK A;  3TCU A;  1K9M W;  1Q82 W;  4JGS A;  2MK3 A;  1YJW V;  3OEH G;  2Y69 C;  2JJ2 G;  1QCE A;  2H8P C;  2XOK G;  3OAA G;  5LHG A;  3CCV V;  1VQ4 V;  5LGU A;  2EZO A;  3ZCC A;  1EBO A;  1EFR G;  4QPJ A;  1F23 A;  5J9P C;  2X6C A;  2ZD9 A;  3CMA V;  3ABL B;  4I5S A;  1OCO B;  4G2K A;  4MT8 A;  2DQ0 A;  5L3D A;  1YJN V;  2PI5 A;  2Z5U A;  1MSW D;  3LNM B;  1QLN A;  2B5U A;  3IGA C;  1F51 A;  4FK5 C;  3AG3 B;  1NBM G;  2H94 A;  3AG2 C;  1CP9 A;  2WLL B;  3G6E V;  4I9W A;  4X89 A;  3FB5 C;  2IW5 A;  2DYS C;  4P30 A;  3ZMS A;  4BIZ A;  1G4Y B;  4MTF A;  2DQ3 A;  2Q6A A;  4R8C A;  5KA5 A;  1NVP B;  3CCM V;  4QJF B;  3ETD A;  3BY6 A;  2QKS A;  4YXW G;  3CCU V;  1OCC C;  1NR1 A;  3NXS A;  1YHQ V;  1OCR C;  4MTX A;  4KFM A;  2OTJ V;  2P90 A;  4MW3 A;  2EIL B;  4UV8 A;  3W7S A;  2A0L A;  3K0G A;  3ASN B;  3G71 V;  1YSC A;  2X6B A;  4PA6 A;  4RUF A;  2DYS B;  2WAM A;  2X7R B;  3CCR V;  3ETG A;  3A0R A;  4EKW A;  2P7T C;  4GX1 A;  5IYD O;  3DGE A;  2UXN A;  3IC7 A;  1S72 V;  3ASO C;  1OCR B;  3KG2 A;  3RW0 A;  4XDJ A;  3VOU A;  1K5Q A;  3D3I A;  1E79 G;  3ZIA G;  3CXC U;  1JJ2 U;  3E2E A;  3EFF K;  4MVU A;  3WG7 B;  5B1B C;  1WPX A;  1Y4M A;  3M99 B;  4MVO A;  2HR3 A;  4WFH A;  1R3I C;  2NLJ C;  1GO3 F;  5EBM C;  3CC7 V;  1H8E G;  3PJS K;  3ASN C;  4RQF A;  3R65 A;  3I56 V;  2X6A A;  4MVZ A;  2W0F C;  4HYO A;  3B77 A;  2IJI A;  3K08 A;  4WF9 V;  4ZKI A;  3GB7 C;  1KC8 W;  3QO5 A;  4FJC C;  3T2M A;  2Q68 A;  2WLK A;  1OCZ B;  3E89 A;  2P67 A;  1W0J G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...