1R3LC

Potassium channel kcsa-fab complex in cs+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords Antibody Fab fragment light chain
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r3lC00
3T1CA 3T4DA 1OCCC 4ZBMA 5E1AC 1XL4A 2A0LA 3JYCA 4LBEC 5B1BC 3E89A 4QNHB 3KG2A 4MVQA 5EC1C 2ITCC 2NLJC 3K0DA 3OR7C 3RBZA 4GX5A 3E83A 4P2ZA 4XDKA 4EKWA 4G28B 3RVYA 3SPGA 2Q68A 2ZD9A 4R8CA 4MW8A 2DYRC 4XDJA 2EILC 1R3KC 2ZXWC 2A9HA 3R65A 5EBWC 3WG7C 1LNQA 2WLLA 2WLIB 4MTOA 4PA9A 2X6CA 2OCCC 3OUSA 3ASNC 5IY5C 4F4LA 2WLLB 4MVZA 2EINC 3SPCA 3ZJZA 3EFFK 1ORQC 2BOCC 3ASOC 3STLC 4JTAB 3PJSK 4X88A 4WFEA 4P9PA 1ZWIC 3F7VC 3RW0A 3SPJA 3FB8C 3AG1C 4XDLA 4BW5A 4GX0A 2WLMA 4WFGA 3SPHA 1R3JC 1R3LC 3FB6C 4R7CA 4WFHA 3STZC 3SYPA 4HZ3A 4MTGA 3SPIA 3K04A 2WLIA 3SJQC 1QLEC 2A79B 3IFXA 4H37A 4OXSA 3LNMB 3E8HA 2AHYA 2BOBC 3ABMC 4CBCA 2P7TC 3TCUA 2R9RB 4PDMA 2KB1A 3UKMA 4PA7A 4MS2A 2WLNA 3LDCA 4MVRA 4WFFA 4I9WA 4RAIA 1OCOC 2ITDC 2Y69C 3AG2C 3E8GA 5CBFA 1J95A 4KFMA 4QE9A 3SYQA 1XL6A 1S5HC 2HG5C 3ABLC 4X89A 5B1AC 3SYCA 5CBHA 2ATKC 4P9OA 2X6BA 4G27B 4LCUC 2HVKC 3K0GA 2QTOA 4MVMA 2AHZA 2Q6AA 2IH3C 4MSWC 5EC2C 4R50A 2WLKA 2EIMC 4MVSA 4MVUA 2DYSC 2EIKC 4QE7A 4RUFA 4PDRA 4TWKA 3UM7A 2Q67A 3LUTB 3LDEA 5EBMC 4PDVA 1OCZC 3AG4C 3OGCC 3K06A 5EK0A 1K4CC 3X2QC 4PA6A 5KUKA 3OR6C 2HJFC 4GX1A 2IH1C 3OUFA 4J9YB 2WLHA 3SYOA 4X8AA 4P30A 5KUMA 3K03A 3GB7C 4PDLA 3VOUA 5CBGA 1BL8A 3FB7C 1K4DC 2JK5C 4R6ZA 2DWDC 3IGAC 3HPLC 1KKDA 2HFEC 3T2MA 2QKSA 3E8FA 2DWEC 2W0FC 4DXWA 4MTFA 1M57C 1P7BA 3AG3C 5EBLC 3SYAA 2K1EA 4LP8A 3RVZA 3LDDA 1R3IC 1V55C 3ABKC 3TETA 4PA3A 4JTDB 5B3SC 4H33A 4MW3A 2WLJA 2X6AA 4HYOA 3F7YC 5J9PC 2YEVA 4GX2A 3E86A 2Q69A 4J9ZB 3E8BA 4PA4A 2H8PC 3T4ZA 3ZRSA 3F5WC 4RUEA 2EIJC 3FB5C 2HVJC 1JVMA 1M56C 4JTCB 4MVOA 4RO2A 1V54C 1OCRC 1G4YB 5BZBA 4UUJC 3BEHA 3K08A
chains in the Genus database with same CATH superfamily
4DUZO 1OCCC 1M57B 2JVDA 3PN1A 2A3QA 5H9CA 1XNRB 4MTXA 1NI8A 1J5EO 4FIPC 4IIJA 2HLDG 3BHPA 3R65A 4I4TA 4UCRA 1VQ9V 1K34A 4FM2A 5L3GA 1P84F 4UCUA 5GONA 3VQWA 1SRYA 4ABMA 3OTOB 3CCLV 1F7YA 2Z3YA 2A06H 3BFRA 5JCOC 1XI1A 5A2QN 2V1DA 4JI5O 2KKWA 3LNMB 4MT8A 3W7UA 3CRRA 3MDSA 3E2EA 3ZBHA 1S77D 1FXKB 1G1XB 2RMKB 1IBMB 5J2UA 5H6RA 1W0JG 5KAFZ 2FB5A 4DRXB 3APQA 3CB2A 1PNMA 3SJAC 1E1QG 4JI0B 2ZE5A 4FFBB 2Q8VA 2QDOA 4DYLA 5JJJB 2UXNA 1S72V 3W7XA 4JI3B 3HKBA 5IWAO 4WF9V 4YY3O 4DV3O 4CS4A 1DF4A 1KU9A 4DR4B 4QPKA 2JK5C 1Q5OA 1OJHA 4K8XA 4DXWA 1GK9A 4JZ2A 2ZCEA 2QTSA 1WP7A 3OAAG 2OIEA 1D5AA 3JALB 2Y48A 4DR2B 5L3DA 3KZIZ 3ABKB 4AQYB 2W6IG 3FAVB 3JASA 2ZXWB 2PTMA 2UXBO 3T4DA 5E1AC 5B1BC 4J42A 1N36O 4MVQA 3OM3B 1K3EA 1VQ7V 3APOA 3BAAA 1H2SB 1I0HA 3T1YB 4P2ZA 1WB8A 4J7JA 3S3XA 3M99B 1LUVA 2XT9A 1TVKA 1SA0A 2A9HA 1WPXA 5L3CA 4IL6Z 3L71H 3J81N 5IY5C 1H38A 1ORQC 4X1IB 3H9VA 2M7WA 4X20A 4CH3A 4O2BB 3I55V 2A79B 3IAYA 2GUZB 4CS2A 2RNBA 3E8HA 2RJZA 4JYYA 2P7TC 2OTJV 2E5LO 1N34O 3THOA 3LDCA 4UCTA 3E8GA 2YIBA 1SC5B 4X62B 1AI6A 2QWOB 3OEEG 1GM7A 4X89A 4B3TB 4LCUC 3OMAB 3ASNB 5HFMA 4LR3A 3ZN0A 1ZTEA 2D2CB 2YS8A 2FTKA 5B1BB 1OCZC 1S0VA 1MG1A 1CXZB 1IDSA 5EK0A 5FPRA 4AHCA 3CPWU 4A5UB 1S5LZ 4I7ZB 3ZIAG 3SYOA 2QWRB 4TV9A 5KMGB 2XOKG 2QM7A 4DW1A 4LWSA 1M9NA 1KKDA 3E8FA 4NR1A 4YJ3A 4JYAO 2BSKB 1N0NA 5GW7A 4DV7B 4ZOLB 3RN4A 4KUMA 2IU3A 5LGNA 4PJ0Z 3MAQA 1Y76B 4RO2A 4KXRA 4X1KB 4IIJB 2JGUA 1U97A 1G8MA 5IWAB 4LBEC 2PZSA 4JI3O 4J7ZA 2NLJC 4O4IA 2P90A 4YJ3B 4XDKA 4E4EA 1OCCB 5IJ9A 4QGPA 4KHPB 2EZPA 4R8CA 1SESA 4JZGA 3DTUB 3JARA 5EBWC 1IBMO 1BHAA 1RM1B 2JDIG 1OZ0A 2OCCC 4F4LA 2DOSA 3SPCA 4W4LA 1N33O 1PD3A 3AG2B 4K8ZA 1QLNA 2DYSB 4HZ3A 4O4IB 3A2FA 2LQTA 4PDMA 5E79Z 1KD1W 2IU0A 1OCOC 2Y69C 5LGTA 1IBLB 3ML0A 2XASA 5B1AC 2FL4A 2HVKC 1JJ2U 3CCVV 3CC2V 2DYSC 1R6NA 1Z2GA 4LF7B 4LFCB 2VWJA 4UCVA 1L0NH 5L3EA 5KUMA 2QEXV 1H2LA 3J80N 2DWDC 1QLEB 3L75H 3OTFA 3EHBB 5EBLC 2AZ0A 2CAZC 3H1IH 1OHHG 3TK1A 1KYOF 2XAJA 3F5WC 5DEDA 2R72A 2KG7B 4AI8A 1QNMA 3OMIB 1H2MA 4N23A 1SQFA 2CH7B 5GONB 1F51A 4O2AB 5EIBD 2BE3A 1XEQA 4JI4B 4L87A 4GT1A 2OIGA 1JX9A 2P4KA 3AK2A 3L70H 2E76B 5AG2A 2OCHA 2QKAA 2VQEB 1MSDA 2GV9A 4EB6B 2WA4A 3K59A 5LYJA 1BHBA 4EEQA 1NJIW 3F7VC 1NKDA 4NKGB 2AXTZ 3FB6C 1D5NA 3SYPA 1UPGA 1QLEC 4H37A 4JI0O 1M4UA 2UUAO 1SZTA 2YEVB 5K1PA 1XNQO 4MVRA 2ZIMA 1IURA 1GH6A 5CBHA 2ATKC 2X6BA 3ZMUA 1MZFA 1Q6IA 4NXNO 4F6RA 1ZX3A 2DQ0A 4R50A 3JCUZ 2EIMC 3UM7A 3QNEA 3LUTB 2B1IA 3E35A 1ZAUA 1FXVA 1DK1A 1SETA 1QBZA 5L3BA 1GN6A 3EVKA 4DR7O 1GMGA 3FB7C 3OD4A 3G67A 1NTKH 3JASB 3WB1A 1YZBA 4RQFA 2F23A 1WP8A 3AG3C 5GTIZ 1V55C 1FJGB 3ETDA 3LSSA 3IC7A 4MW3A 3F7YC 1L1FA 5LHIA 1X4TA 3ETEA 2KSDA 5JQGA 3CCJV 4FFBA 1PM9A 2P6JA 1ZSPA 1FYJA 1EN6A 1Q43A 4TQDA 2ZQMA 3JARB 1GTOA 1VARA 1JMKC 3HR0A 5FPOA 4GYCB 1Q7YW 3CD6V 3O9OA 4EKWA 3OE7G 4G28B 2ILMA 3UT5A 2NR5A 3FX7A 4I55B 4FLXA 1M93A 1Q6HA 2BTOA 1O9HA 3ASOC 1XMQB 1UFIA 1Y6XA 5LXTB 2EIMB 3P30A 3AG1C 1SS3A 3CYOA 4XDLA 4LF8O 1R3JC 1Q90D 2G38A 3IFXA 4ZKIA 2ETNA 5KHJA 2Q4PA 1EBOA 1K5QA 3UT5B 4LF7O 2RQ6A 1F4MA 5IYZA 3ABTA 2HHHO 1IVSA 1R73A 2ZR2A 4QE9A 1TVKB 1S3JA 3OEHG 1SA0B 2YXHA 1N0JA 2B9ZA 2AHZA 1BZKA 4X1YB 4WBNB 1HNZB 5B1AB 4TOIA 1KUQA 2IJJA 2Y0PA 5IJ0B 4FM1A 3EXAA 3OGCC 4TT3G 5D5PA 1M56B 1YJ9V 1B06A 4O2BA 3HB3B 3RYFB 5LMNO 2YC0A 3F5TA 5LMUB 4BR6A 2Z5UA 5CBGA 3D36C 3JATB 2KG7A 4UFZA 4W4KA 1CPYA 3FKSG 4LP8A 3A0BZ 5LOVA 1R6KA 4GX2A 3VBBA 2WWWA 5IYDO 4DR1O 3BABA 2CK3G 2UUCB 3G71V 2EIJC 2JGDA 4H13B 1M56C 1AI4A 3E22A 3I5DA 4K3AA 1TUBA 4FLTA 5IDJA 2GDSA 1VQPV 4DR3B 2YIBD 5KHIA 4EB6A 2YI8A 4B3SO 3ZMSA 4UVAA 4CH4A 4GKJB 1ZUQA 2F1MA 1GN3A 1H2GA 4OPHA 3HKCB 4LF5B 1RPRA 2WLLA 2XAHA 5JJEB 2JGDB 4DV1B 5LP6B 1VF6C 1PL4A 4HAMA 4NTWA 3VQVA 4O4LA 1W0KG 2ZINA 3ZCCA 4WFEA 4I50A 2P4VA 1K8AW 3SPHA 3CCUV 4Z1VA 4R7CA 3STZC 2XUMA 3BA9A 2M6YA 4CC5A 2E75B 4F6RB 3TCUA 4X9QA 3ZMTA 1SZXA 4RWUA 4LC1A 3U11A 2ITDC 1BGYH 3HKEB 4LF5O 1S5HC 2HG5C 2LP7A 3JCZA 2Q7EA 3CXHF 4TWKA 3CEIA 4TQFA 2EIJB 1GRJA 2DW4A 4Q6GA 4ZHQB 4GKJO 4YY3B 5EYPA 1YXBA 1AJNA 4U7NA 4GX1A 2HJFC 1IXMA 2ZE7A 5KHGA 4NTXA 2QSAA 4LNUB 5LHHA 3RYCA 5JQGB 1Y74A 4FVMA 1WN7A 4JAAA 3H1HH 1PPJH 2X0LA 1N32B 1FFXA 3KCXA 2ZE8A 2W0XA 4J9ZB 3E8BA 4PA4A 3ZRSA 4JV5B 1US6A 2WAMA 1JVMA 4MVOA 4NB5A 4UV8A 3JSLA 1BT8A 3T1YO 4O4JA 5BZBA 4O4HA 5ITZA 3ICXA 4FLYA 1XL4A 1PV0A 3CMAV 4F6EA 5KX5B 2WSSG 2QM8A 2D3OW 2FYUH 1Y74B 1GKFA 4X62O 2EULA 2HKOA 1FFXB 1I5XA 3BA8A 1VIBA 2ZXWC 3ABMB 4MTOA 3N2GA 1B6QA 1EN4A 3B8MA 2QE7G 1Y66A 3ZJZA 3STLC 3PJSK 5JH7B 4O4HB 5ITZB 1QVGU 3FD9A 3N27A 4DR4O 4MTGA 4ZI7A 1VMGA 3B8NA 5CA1A 3WB2A 1NH2D 3CS5A 5J2TB 4D7TA 4JASA 3TJTA 5LBQA 4GLXA 4LFBO 2Q7GA 5EZYA 3ZX6A 1MOFA 5CBFA 1E1RG 1Y4MA 2ADPA 1K92A 1NS1A 1X59A 2VWKA 5LHGA 5DN6G 4JI7B 2HR3A 1K97A 1GAXA 1AR4A 3GVMA 1K4CC 3HKDA 4NXMO 2JS3A 3OUFA 1KKCA 3JD0A 3MHHC 3BVOA 1XREA 3CCEV 3E22B 3CCRV 3QO7A 4LF9B 2AZ2A 5B3SC 2V7QG 2WLJA 1AR1B 1URFA 1J5EB 3HKCA 1IBLO 2ZE6A 1AJPA 1XHZA 2QJ1A 3ZS8C 3DSQA 4O4LB 3GWKC 3RYHA 1VQ5V 1HR0O 1FPOA 4KL1A 1FFTB 4FPPA 2VQFB 2WPDG 4DW0A 3ZN1A 4I50B 1OCRB 1R1BA 4PI0A 4B3RB 2OTLV 2MK3A 2ZIOA 3ETGA 1BQ0A 3NXSA 1XBLA 2N04A 3SPJA 1GM8A 5LP6C 1XUQA 3P32A 3G6EV 3OMNB 3BCCH 1S5JA 3CJHB 3K04A 3C3SA 2WLIA 5CN0A 1A32A 3B2EE 4NTYA 2UUBO 4IYHA 2AHYA 2BOBC 1I08A 4X1YA 3JSNA 1KBHA 4DUYB 4O2AA 4LF6O 2F93B 4PHZA 4ZHQA 1QVFU 1NQTA 4GUNA 3K0GA 3ZHUA 2QTOA 4MVMA 4MSWC 4DUZB 1YF2A 4FZ0A 2EIKC 3CC7V 2QM4A 3ZRXA 1Y67A 4LF8B 3DC5A 2UUBB 2MW2B 3OR6C 5LOVB 5EIBC 3LSQA 4B08A 1N8RW 5CB4B 5B1NA 1HNXB 1AR5A 1NVPB 4X1IA 4O4JB 1Q82W 4JI2B 1XOUA 3HPLC 1P7GA 2QKSA 3A0HZ 1FD9A 2EINB 3DC6A 2K1EA 3RVZA 4PA3A 3SJCC 1THZA 2X6AA 1NR1A 2Y4UA 4B3RO 3CP1A 1EZVH 3AG4B 3ZRWB 1AROP 1EZJA 4HNAB 1FXHA 1HP8A 1G4YB 3N2GB 4DO2A 2RCVA 4I0XB 3LSUA 3DXRA 4GX5A 1SQQH 2CTQA 2DQ3A 4ASUG 4WCEV 5CA1B 1YVWA 1BSMA 2Y69B 3AG1B 4FZ1A 3CSXA 1VQ4V 2P06A 3IC9A 4JTAB 1JA8A 2BSKA 4GX0A 2WLMA 3W7SA 4WFGA 2CGOA 3SJQC 1XQ8A 3MHSC 1I94B 3D36A 1N36B 2KB1A 1DLBA 1FXKA 4DR6B 1AP6A 4WFFA 1EN5A 4I9WA 2ZKOA 3H1LH 1XMOO 1J95A 1H2NA 5DECA 3SDLA 2VQFO 4I55A 5BY1A 3HKDB 2UU9B 2CDYA 1H8HG 3IJ4A 2IH3C 3ASOB 4YHHB 1L0LH 4TV8B 2DJVA 4DV4B 4JF3A 4PA6A 1IBKB 3CRQA 2OYQA 1KQSU 5FLXN 4J9YB 2OT5A 1PP9H 1T5EA 1BL8A 4JI8B 1IBKO 1PNKA 3JD4A 1H2KA 1AP5A 1KP2A 3TXQA 2UXXA 1HW7A 2ZR3A 4JTDB 5LA6A 2PUSA 1KP3A 3CCSV 1RM1C 4JTCB 1KB9F 2JEXA 3T1CA 2JRIA 1JFFA 3JYCA 1Q81W 2F4VB 3CCQV 3SGIA 5LMUO 4JI5B 1YITV 4OPAA 4DV0O 1AILA 5LMNB 2ZD9A 2DYRC 4JV5O 4HBNA 1R3KC 3KCYA 3VQYA 3WG7C 1LNQA 4ZI7B 2WLIB 3QO8A 1N32O 2Z0AA 1VF7A 2HJDA 4X20B 4PD4F 2VS0A 2BOCC 1HNZO 5BXZA 2GTSA 4TUYB 3FB8C 5H5NA 4B3SB 1H8EG 2ARHA 2XAGA 3K79A 3ZRVA 2IBZH 5KX5A 5BMVB 3UKMA 2L35A 3FYEB 3JAWB 1WJZA 2N74A 3AG2C 2RN9A 4KFMA 3SYQA 3CC4V 3SYCA 4CZZA 1Q6UA 4RQEA 1K9MW 5D5QA 4DV0B 4MVSA 5FNVA 5H2FZ 4ZIBA 2F4VO 5KLVH 2CE4A 4U3JA 2PYLA 5KHKA 2QKCA 3H1KH 3P3NA 4TV9B 1JCHA 2PGGA 4LF4O 4HNAA 1G6UA 3CMEV 5LYJB 2DYRB 1EFRG 3GB7C 2XAQA 1F23A 2EBOA 3HKEA 1IZ3A 2Y4TA 2VRZA 3M7MX 1QR8A 4X65B 3DXRB 2YEVA 5BR8O 1RP3B 4BIUA 1VF5B 1WNSA 4B3MB 1MZEA 1BE3H 3CHXA 4UV9A 2EILB 1V54C 1OCRC 1JJOA 1EM1A 5EYPB 1Z5WA 2XAFA 4X1KA 2ODMA 1HNWO 4FJCC 1NTZH 3E89A 1OV9A 4B3MO 3OR7C 3RBZA 1NH2B 1IX9A 3SPGA 2Q7HA 2YXLA 4XDJA 3CJHA 1E79G 2EZOA 4PA9A 2BCCH 2H94A 2DE0X 3ZMVA 1KMIZ 1VQ8V 4LF4B 1VQLV 4WFBV 3B77A 4Z1MG 2CTWA 4DR6O 1RSOA 1R3LC 3SPIA 3K3WA 4BW9A 5JVDB 3W7TA 3L9DA 5DM6V 1NT2B 1B3QA 1FAFA 4DV6O 2EJRA 2XNDG 1O9GA 4FLVA 3ABLC 4CH5A 2UXDO 3T1HO 3AG3B 4G27B 4J11A 2E5LB 2X7RB 3K58A 3K5LA 4MVUA 4K0KO 5JH7A 1DGSA 1YSCA 1K73W 4PDVA 1R6TA 4FM0A 3LNNA 1WPBA 3ZHQA 1V9PA 1YIJV 1GM9A 5KAIZ 3IGAC 1BQZA 2HFEC 2UXCB 4IHJA 3A0RA 2P22C 2IJHA 3SYAA 4IGGA 2R9IA 2JIZG 5J9PC 4OX9O 2AGAA 3E86A 3UO3A 3QTCA 2HVJC 5CA0A 4D7SA 3QG5A 3B4SA 4ZBMA 2JJ2G 3K9SA 2ITCC 4X66O 4MW8A 2HHHB 1JQ0A 1ZLZA 2B5UA 3ETQA 4BIZA 3JATA 4DV3B 1TAEA 4MVZA 4P9PA 1WA8A 3JAWA 4DV4O 3ZHTA 2QWPB 4E2LA 4JPRA 3RT3C 4TSFG 3RYHB 3ABMC 3JAKA 5C93A 2CGNA 1N4CA 2ZT9B 3BY6A 1TUBB 5HFLA 2R9AA 1COWG 2GHYA 4UXNA 1L8DA 1XMOB 3C3TA 2FMLA 2C2AA 4I9QA 3UQ8A 4YJ2B 1VQKV 1U96A 2Q6AA 1NZ6A 4K35A 1HR0B 3L74H 4QJFB 3X2QC 3N2KB 5LA6B 4DV2O 2IH1C 3ZHVA 4JI6B 2E3CA 4CS3A 2YIDA 5CA3A 4UB8Z 4B7KA 3T2MA 2W0FC 1M1KW 1M57C 1P7BA 4IYIA 2YICA 2LW7A 3KKYA 1JFFB 1RFYA 3UO2A 4RUEA 1OCZB 2IJIA 4UB6Z 3L72H 4WFAV 3BEHA 3ZMZA 3RWRD 2HP8A 3CRAA 3KG2A 4NXMB 4BIOA 2LFRA 1DTOA 1BMFG 3E83A 3B09A 2LO1A 4JI1O 4YXWG 5JVDA 4UVBA 1M90W 4OX9B 4X64B 1FS0G 3OUSA 3RYCB 1LUWA 4J80A 1MA1A 5LXTA 1UJWB 3QF7A 3EFFK 4DK0A 1XDCA 2UXCO 1BS3A 4WFHA 1HNWB 1TUEB 4I0XA 4LFCO 1ZL8A 2GBOA 2AW9A 2R9RB 4PA7A 4JI4O 5IYZB 1QR9A 1K5SA 4PV1B 4Q20A 4FFKA 4DV7O 1VQ6V 4JAVA 2UXDB 5EC2C 5IYBO 1XILA 2B1GA 2W6JG 4GCZA 2IJKA 1YHQV 3LDEA 3OW2U 3BRCA 1VEWA 2L6LA 5KUKA 4Z2WA 5JWPA 2O57A 4FLZA 2WLHA 5CA0B 1JPXA 3AK3A 1S76D 3ZHSA 5BMVA 1YEWA 3VOUA 2YUAA 2ADQB 3MD0A 4DV5O 4B7EA 4C7UA 4N21A 1N33B 1R3IC 3O65A 4OGQB 1WLEA 3J7AU 5KHHA 2PI5A 3T4ZA 5IY5B 3ZEDA 1AI7A 1QU7A 3H01A 4TV8A 4BWAA 5LL6Y 5B1OA 3K9AA 1KC8W 3M8AA 1OCOB 1W59A 1SERA 3K0DA 3T1HB 1KECA 2QA4V 4LF9O 1WA8B 1ROPA 2YSUB 5IT9N 2NN4A 1NR7A 2QR4A 5B66Z 4UCOA 5J2UB 3AG7A 4J41A 2ZDIA 4H44B 3Q4HA 3K57A 1XMQO 1AJQA 2X6CA 1NVPD 3G4SV 3ASNC 2GSMB 2Q73A 2WLLB 3AK1A 2EINC 4PI2A 3CRCA 1PNLA 1QQCA 4X64O 4KP4A 4LFAB 2F43G 3RW0A 2UU9O 3CX5F 2EIKB 4U7OA 3CWBH 2GTAA 4I4TB 2JJ1G 4CBCA 5KMGA 4LFAO 1M5IA 4FK5C 1MABG 2WLNA 3K5NA 1YJWV 4KHPO 4PELA 2Q9LA 3Q4HB 1Z5VA 4CH6A 3JD1A 1VQMV 2QGNA 1YI2V 4LFBB 1YTFD 1GO3F 4P9OA 1AVMA 3CE2A 1AI5A 4ZOLA 2PY5A 3OTOO 3TGUH 4QE7A 4NYKA 3FAVA 5KA5A 1Y76A 1SQGA 4JI8O 1WB7A 3RYIB 3AG4C 1N34B 4IHJB 1VP7A 3CRMA 4DR3O 3C90A 5C8YA 4DRXA 5BR8B 2P67A 1I5YA 2V4DA 2KQXA 4X8AA 3JD2A 3ZHRA 4P30A 4X65O 3BPZA 3W7WA 1VF6A 4UCSA 2UUCO 2DN9A 1SQBH 5L3FA 3LDDA 3HKBB 2LGQA 3JAMN 4XBFA 2YDEA 1SQPH 2OCCB 3AEIA 3RYIA 1YCIA 4J10A 3S3WA 3FB5C 5FNVB 4DR5O 5C8YB 1I94O 5JCOA 1Q86W 2DMXA 1FKAO 4U3JB 4DR5B 1QHTA 4QNHB 5EC1C 5CMUA 4EFEA 2BTQB 3WFVA 4B3TO 2Y0IA 2RDCA 2EJ7A 3D3IA 2UXBB 3D8CA 1TGOA 4WBNA 1XHXA 4AQYO 2CUGA 2IM9A 5IJ0A 2EILC 5CB4A 2CTRA 2LGWA 4FLUA 1GN2A 3FYIB 1NBMG 3U0ZA 3CCMV 3RYFA 2P5OA 3JAKB 1ZL8B 4NVPA 4X88A 2Q0OC 4IT5A 3TXSA 1D2DA 2K9PA 4BW5A 3B40A 2Q5ZA 4X66B 1IXBA 3CXCU 1SF9A 2BTQA 4G2KA 1YJNV 1YDXA 4LH7A 1P4RA 5J2TA 4YJ2A 1PKXA 3ZRWA 3K5MA 4LF6B 3U10A 2F95B 2A7WA 4FLWA 5EZYB 1P49A 3ABUA 4JYCA 4MS2A 3OT7A 4YHHO 4BAYA 3SR2C 4FMTA 5IYCO 4YIOA 4L8JA 3R66A 1CEZA 2PI4A 4PDRA 4D6TH 2Q67A 5EBMC 5H6QA 5K1XA 3UCSC 3NR7A 3K06A 3A8TA 1RSOB 1HNXO 1YTFB 3D3QA 4DR2O 4GZRB 2CH7A 3RGBA 4EFBA 4QPJA 3I56V 5LP6A 4DV1O 4R6ZA 5IJ9B 3DGEA 2DWEC 2WA3A 1QCEA 4MTFA 1MSWD 1F4NA 3ABLB 3ABKC 3TETA 1MMMA 4K0KB 4H33A 4LH6A 5IE9A 1CP9A 2QWQB 2Q69A 1FJGO 2H8PC 1ENVA 1SKVA 5FL7G 4ICGA 4DUYO 3K5OA 2HEPA 1DF5A 4JI6O 1LR1A 1NTMH 4DV2B 4DR7B 4QIWF 4DV6B 3K08A 1VQNV 2A0LA 3G80A 1W2BU 5A9GA 3QO5A 2OWOA 2LFSA 2JS5A 4DR1B 3OFNG 3JALA 2QWNB 1K33A 2H3OA 4JGSA 3RVYA 4U3FH 4GKKB 4NXNB 2ZM6B 5B5EZ 2Q68A 5GTHZ 2CTPA 4J7KA 2ZNJA 4YIPA 1Q3EA 1HDJA 1SQXH 2YXYA 4DV5B 3L73H 2NNUA 1JR9A 2ZM6O 2ZNIA 4GKKO 4LNUA 1VQOV 1ZWIC 2YIAA 3P3PA 3VQXA 4JI7O 1XNQB 1BCCH 2YI9A 5TISZ 2UUAB 1WAZA 2PF4E 2E74B 3G6BA 1V54B 5KA6A 4OXSA 2XTAA 1I7FA 2IW5A 1Q8IA 3GWOA 2VQEO 2N05A 4RAIA 2LW1A 2JEUA 1XL6A 4CC6A 2FKXA 4UVCA 3RFRA 1V55B 2Q0AA 1XNRO 5F2VO 4JAUA 2ZDIC 1JOYA 2WLKA 1RPOA 4RUFA 2GUZA 2F66C 4JYBA 3JD3A 4JYAB 1MNGA 3WB0A 5B3SB 2PYJA 2LJ2A 4TUYA 3K03A 4DK1A 4PDLA 1TA8A 1K4DC 2XHBA 1PL0A 3WU2Z 1NU1H 1B04A 3OGIB 4JI2O 4JI1B 2EX3A 3H1JH 3X2QB 4AILC 4HYOA 1GN4A 3WG7B 1FXKC 1K7DA 4H0LB 1SQVH 4I5SA 2R70A 1AB3A 5JJNB 3FFQA 1HWYA 3SJBC 3QVNA 4LWSB 3N2KA 5LGUA 4UUJC
chains in the Genus database with same CATH topology
2ZQMA 1OCCC 1M57B 4DO2A 5H9CA 1GTOA 3KG2A 2LFRA 4MTXA 1Q7YW 1DTOA 1BMFG 3CD6V 4GX5A 3E83A 4EKWA 3OE7G 4G28B 4FIPC 2DQ3A 4ASUG 4YXWG 4WCEV 2HLDG 4UVBA 1M90W 3R65A 2Y69B 1VQ9V 1K34A 5L3GA 1FS0G 3OUSA 3AG1B 1UJWB 3EFFK 1SRYA 1VQ4V 3ASOC 4JTAB 3CCLV 2EIMB 3P30A 3AG1C 3CYOA 4XDLA 4GX0A 2WLMA 2Z3YA 4WFGA 3W7SA 1R3JC 4WFHA 2V1DA 3SJQC 3IFXA 4ZKIA 3LNMB 4MT8A 1TUEB 1EBOA 1K5QA 3MHSC 3W7UA 3D36A 1F4MA 2R9RB 2KB1A 1DLBA 1FXKA 3ABTA 4PA7A 4WFFA 4I9WA 3E2EA 1QR9A 1S77D 1FXKB 1R73A 2ZR2A 1J95A 1K5SA 4QE9A 1S3JA 3OEHG 4Q20A 5H6RA 1W0JG 1VQ6V 1H8HG 1PNMA 4JAVA 2AHZA 2IH3C 5EC2C 5IYBO 1E1QG 2B1GA 3ASOB 5B1AB 2W6JG 4GCZA 2UXNA 2IJJA 2IJKA 1YHQV 3LDEA 3OW2U 1S72V 3OGCC 4TT3G 3W7XA 1M56B 1YJ9V 4JF3A 4PA6A 5KUKA 3HB3B 1KQSU 4WF9V 4J9YB 2OT5A 2WLHA 1JPXA 1S76D 1DF4A 3VOUA 2Z5UA 5CBGA 1BL8A 4QPKA 3MD0A 2JK5C 4DXWA 1GK9A 4N21A 1PNKA 1CPYA 3FKSG 3JD4A 4LP8A 3OAAG 1R3IC 1KP2A 2UXXA 2ZR3A 1WLEA 4JTDB 1R6KA 2PI5A 4GX2A 2Y48A 1KP3A 3VBBA 2WWWA 5IYDO 3T4ZA 3CCSV 1RM1C 2CK3G 5L3DA 5IY5B 3G71V 1AI7A 2EIJC 3ABKB 1M56C 3H01A 4JTCB 1AI4A 2W6IG 2ZXWB 5B1OA 2JEXA 5IDJA 1VQPV 3K9AA 3T1CA 3T4DA 1KC8W 5E1AC 3JYCA 5B1BC 1OCOB 4MVQA 3OM3B 1SERA 1Q81W 3ZMSA 1K3EA 1VQ7V 4UVAA 3K0DA 3CCQV 1KECA 2QA4V 1YITV 4P2ZA 3M99B 2YSUB 1ROPA 2ZD9A 2DYRC 1H2GA 1NR7A 1R3KC 2A9HA 1WPXA 2ZDIA 3WG7C 1LNQA 1RPRA 2WLIB 2WLLA 2XAHA 5L3CA 1AJQA 2X6CA 3QO8A 1NVPD 3G4SV 3CC4V 3ASNC 5IY5C 1H38A 2GSMB 2WLLB 2EINC 4HAMA 1PNLA 1ORQC 2BOCC 4KP4A 1W0KG 2M7WA 3ZCCA 4WFEA 2F43G 3RW0A 3FB8C 2EIKB 1K8AW 3I55V 4U7OA 3SPHA 3CCUV 1H8EG 4R7CA 3STZC 2A79B 2JJ1G 2XAGA 3K79A 3ZRVA 4CBCA 3E8HA 2P7TC 3TCUA 3ZMTA 2OTJV 3UKMA 4FK5C 3FYEB 1MABG 2WLNA 3LDCA 1YJWV 4LC1A 4PELA 2ITDC 3AG2C 3E8GA 3JD1A 4KFMA 1VQMV 1AI6A 1S5HC 2HG5C 3OEEG 3SYQA 1GM7A 4X89A 3SYCA 2LP7A 1YI2V 1YTFD 1GO3F 3JCZA 4P9OA 4LCUC 4CZZA 1AI5A 3OMAB 3ASNB 5HFMA 4RQEA 1K9MW 4MVSA 4QE7A 3ZN0A 5KA5A 4TWKA 2FTKA 2EIJB 5B1BB 1OCZC 3AG4C 1S0VA 1MG1A 2DW4A 5EK0A 3CPWU 1AJNA 4U7NA 4GX1A 2HJFC 1IXMA 1JCHA 2P67A 1I5YA 3SYOA 4X8AA 3JD2A 3ZIAG 3CMEV 2DYRB 4P30A 1EFRG 2XOKG 3GB7C 2QM7A 5LHHA 2XAQA 3W7WA 1M9NA 1KKDA 1F23A 2EBOA 3E8FA 5L3FA 3LDDA 5GW7A 2X0LA 1QR8A 4XBFA 2YEVA 4J9ZB 2OCCB 3AEIA 3E8BA 4PA4A 3ZRSA 4BIUA 4KUMA 2IU3A 5LGNA 3FB5C 2WAMA 1JVMA 4UV9A 4MVOA 4RO2A 4UV8A 2EILB 1V54C 1OCRC 1Q86W 5BZBA 1G8MA 4LBEC 2XAFA 1XL4A 4FJCC 3CMAV 4QNHB 3E89A 2WSSG 5EC1C 2QM8A 5CMUA 2D3OW 2NLJC 3OR7C 3WFVA 2P90A 3D3IA 1GKFA 3RBZA 1NH2B 4XDKA 1OCCB 2HKOA 3SPGA 1I5XA 2EZPA 4R8CA 4XDJA 1SESA 2EILC 2ZXWC 3DTUB 5EBWC 1E79G 3ABMB 1BHAA 1RM1B 2EZOA 3FYIB 4MTOA 1NBMG 2H94A 1OZ0A 2JDIG 2OCCC 4PA9A 3CCMV 3ZMVA 4F4LA 1B6QA 3B8MA 2QE7G 1Y66A 3SPCA 3ZJZA 1VQ8V 3STLC 3PJSK 1VQLV 4WFBV 4X88A 3B77A 1QVGU 1PD3A 3AG2B 4Z1MG 4BW5A 2DYSB 1QLNA 1R3LC 3CXCU 4HZ3A 4MTGA 3SPIA 4G2KA 1YJNV 3K3WA 1P4RA 1PKXA 3B8NA 3ZRWA 3W7TA 1NH2D 5DM6V 4JASA 4PDMA 3ABUA 5LBQA 4JYCA 4MS2A 1KD1W 2EJRA 2IU0A 1MOFA 1OCOC 2Y69C 1E1RG 1Y4MA 2XNDG 3ML0A 4BAYA 5CBFA 5LGTA 1K92A 2XASA 5B1AC 3ABLC 3AG3B 5LHGA 4FMTA 4G27B 5DN6G 2HVKC 5IYCO 2X7RB 2HR3A 1K97A 1CEZA 1JJ2U 3CCVV 2PI4A 3CC2V 4MVUA 2DYSC 4PDRA 2Q67A 1YSCA 5EBMC 1R6NA 4PDVA 5H6QA 1K73W 3K06A 1K4CC 1YTFB 3OUFA 5L3EA 3I56V 1YIJV 4QPJA 3JD0A 1GM9A 3MHHC 5KUMA 2QEXV 4R6ZA 2DWDC 3IGAC 3DGEA 1QLEB 2HFEC 3CCEV 2DWEC 3A0RA 1QCEA 4MTFA 3EHBB 3CCRV 3QO7A 2IJHA 5EBLC 3SYAA 1MSWD 1F4NA 3ABLB 3ABKC 3TETA 2R9IA 5B3SC 2V7QG 4H33A 2JIZG 2WLJA 5J9PC 1AR1B 1CP9A 1OHHG 3E86A 2Q69A 3TK1A 2H8PC 1ENVA 2XAJA 3F5WC 5FL7G 2HVJC 1DF5A 1AJPA 4QIWF 3K08A 1VQNV 4ZBMA 3OMIB 2A0LA 2JJ2G 4N23A 1W2BU 1VQ5V 3QO5A 2LFSA 2ITCC 3OFNG 1F51A 1FFTB 4FPPA 2WPDG 1K33A 4JGSA 3RVYA 3ZN1A 2Q68A 1OCRB 4MW8A 4L87A 4GT1A 1JQ0A 1JX9A 2B5UA 2OTLV 4BIZA 2MK3A 2NNUA 3ETGA 4MVZA 1BHBA 3NXSA 1VQOV 4P9PA 1NJIW 1ZWIC 3F7VC 3SPJA 1NKDA 1GM8A 3P32A 3G6EV 3OMNB 3FB6C 4WFAV 3SYPA 3K04A 2WLIA 5CN0A 1QLEC 4JPRA 4E2LA 4H37A 1V54B 4TSFG 5KA6A 4OXSA 2AHYA 2BOBC 3ABMC 1SZTA 2YEVB 2IW5A 5C93A 3BY6A 3GWOA 4MVRA 5HFLA 4RAIA 1COWG 2GHYA 4UXNA 2JEUA 1QVFU 1NQTA 1XL6A 5CBHA 4UVCA 1V55B 2ATKC 2C2AA 2X6BA 4JAUA 3K0GA 3ZMUA 1VQKV 2ZDIC 2QTOA 1JOYA 4MVMA 2DQ0A 2Q6AA 4MSWC 4R50A 2WLKA 1RPOA 2EIMC 4RUFA 3QNEA 2EIKC 3UM7A 4JYBA 3CC7V 3LUTB 3JD3A 2B1IA 3E35A 3ZRXA 4QJFB 1FXVA 3X2QC 5B3SB 1SETA 3OR6C 1QBZA 5L3BA 3LSQA 2IH1C 1N8RW 5B1NA 1NVPB 3K03A 4PDLA 1GMGA 3FB7C 5CA3A 1K4DC 1Q82W 3HPLC 3T2MA 2QKSA 2W0FC 1PL0A 4RQFA 1M1KW 1M57C 1P7BA 3AG3C 2EINB 2K1EA 3RVZA 1V55C 3ETDA 3LSSA 3IC7A 4PA3A 4MW3A 3X2QB 1THZA 2X6AA 1NR1A 3F7YC 4HYOA 1L1FA 3CP1A 3WG7B 1FXKC 1K7DA 5LHIA 3ETEA 4RUEA 3ZRWB 1OCZB 3AG4B 3CCJV 4I5SA 1AROP 1EZJA 2IJIA 1FXHA 2P6JA 1HWYA 1G4YB 5LGUA 4UUJC 3BEHA 3ZMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1C A;  3T4D A;  1OCC C;  4ZBM A;  5E1A C;  1XL4 A;  2A0L A;  3JYC A;  4LBE C;  5B1B C;  3E89 A;  4QNH B;  3KG2 A;  4MVQ A;  5EC1 C;  2ITC C;  2NLJ C;  3K0D A;  3OR7 C;  3RBZ A;  4GX5 A;  3E83 A;  4P2Z A;  4XDK A;  4EKW A;  4G28 B;  3RVY A;  3SPG A;  2Q68 A;  2ZD9 A;  4R8C A;  4MW8 A;  2DYR C;  4XDJ A;  2EIL C;  1R3K C;  2ZXW C;  2A9H A;  3R65 A;  5EBW C;  3WG7 C;  1LNQ A;  2WLL A;  2WLI B;  4MTO A;  4PA9 A;  2X6C A;  2OCC C;  3OUS A;  3ASN C;  5IY5 C;  4F4L A;  2WLL B;  4MVZ A;  2EIN C;  3SPC A;  3ZJZ A;  3EFF K;  1ORQ C;  2BOC C;  3ASO C;  3STL C;  4JTA B;  3PJS K;  4X88 A;  4WFE A;  4P9P A;  1ZWI C;  3F7V C;  3RW0 A;  3SPJ A;  3FB8 C;  3AG1 C;  4XDL A;  4BW5 A;  4GX0 A;  2WLM A;  4WFG A;  3SPH A;  1R3J C;  1R3L C;  3FB6 C;  4R7C A;  4WFH A;  3STZ C;  3SYP A;  4HZ3 A;  4MTG A;  3SPI A;  3K04 A;  2WLI A;  3SJQ C;  1QLE C;  2A79 B;  3IFX A;  4H37 A;  4OXS A;  3LNM B;  3E8H A;  2AHY A;  2BOB C;  3ABM C;  4CBC A;  2P7T C;  3TCU A;  2R9R B;  4PDM A;  2KB1 A;  3UKM A;  4PA7 A;  4MS2 A;  2WLN A;  3LDC A;  4MVR A;  4WFF A;  4I9W A;  4RAI A;  1OCO C;  2ITD C;  2Y69 C;  3AG2 C;  3E8G A;  5CBF A;  1J95 A;  4KFM A;  4QE9 A;  3SYQ A;  1XL6 A;  1S5H C;  2HG5 C;  3ABL C;  4X89 A;  5B1A C;  3SYC A;  5CBH A;  2ATK C;  4P9O A;  2X6B A;  4G27 B;  4LCU C;  2HVK C;  3K0G A;  2QTO A;  4MVM A;  2AHZ A;  2Q6A A;  2IH3 C;  4MSW C;  5EC2 C;  4R50 A;  2WLK A;  2EIM C;  4MVS A;  4MVU A;  2DYS C;  2EIK C;  4QE7 A;  4RUF A;  4PDR A;  4TWK A;  3UM7 A;  2Q67 A;  3LUT B;  3LDE A;  5EBM C;  4PDV A;  1OCZ C;  3AG4 C;  3OGC C;  3K06 A;  5EK0 A;  1K4C C;  3X2Q C;  4PA6 A;  5KUK A;  3OR6 C;  2HJF C;  4GX1 A;  2IH1 C;  3OUF A;  4J9Y B;  2WLH A;  3SYO A;  4X8A A;  4P30 A;  5KUM A;  3K03 A;  3GB7 C;  4PDL A;  3VOU A;  5CBG A;  1BL8 A;  3FB7 C;  1K4D C;  2JK5 C;  4R6Z A;  2DWD C;  3IGA C;  3HPL C;  1KKD A;  2HFE C;  3T2M A;  2QKS A;  3E8F A;  2DWE C;  2W0F C;  4DXW A;  4MTF A;  1M57 C;  1P7B A;  3AG3 C;  5EBL C;  3SYA A;  2K1E A;  4LP8 A;  3RVZ A;  3LDD A;  1R3I C;  1V55 C;  3ABK C;  3TET A;  4PA3 A;  4JTD B;  5B3S C;  4H33 A;  4MW3 A;  2WLJ A;  2X6A A;  4HYO A;  3F7Y C;  5J9P C;  2YEV A;  4GX2 A;  3E86 A;  2Q69 A;  4J9Z B;  3E8B A;  4PA4 A;  2H8P C;  3T4Z A;  3ZRS A;  3F5W C;  4RUE A;  2EIJ C;  3FB5 C;  2HVJ C;  1JVM A;  1M56 C;  4JTC B;  4MVO A;  4RO2 A;  1V54 C;  1OCR C;  1G4Y B;  5BZB A;  4UUJ C;  3BEH A;  3K08 A; 
#chains in the Genus database with same CATH topology
 4DUZ O;  1OCC C;  1M57 B;  2JVD A;  3PN1 A;  2A3Q A;  5H9C A;  1XNR B;  4MTX A;  1NI8 A;  1J5E O;  4FIP C;  4IIJ A;  2HLD G;  3BHP A;  3R65 A;  4I4T A;  4UCR A;  1VQ9 V;  1K34 A;  4FM2 A;  5L3G A;  1P84 F;  4UCU A;  5GON A;  3VQW A;  1SRY A;  4ABM A;  3OTO B;  3CCL V;  1F7Y A;  2Z3Y A;  2A06 H;  3BFR A;  5JCO C;  1XI1 A;  5A2Q N;  2V1D A;  4JI5 O;  2KKW A;  3LNM B;  4MT8 A;  3W7U A;  3CRR A;  3MDS A;  3E2E A;  3ZBH A;  1S77 D;  1FXK B;  1G1X B;  2RMK B;  1IBM B;  5J2U A;  5H6R A;  1W0J G;  5KAF Z;  2FB5 A;  4DRX B;  3APQ A;  3CB2 A;  1PNM A;  3SJA C;  1E1Q G;  4JI0 B;  2ZE5 A;  4FFB B;  2Q8V A;  2QDO A;  4DYL A;  5JJJ B;  2UXN A;  1S72 V;  3W7X A;  4JI3 B;  3HKB A;  5IWA O;  4WF9 V;  4YY3 O;  4DV3 O;  4CS4 A;  1DF4 A;  1KU9 A;  4DR4 B;  4QPK A;  2JK5 C;  1Q5O A;  1OJH A;  4K8X A;  4DXW A;  1GK9 A;  4JZ2 A;  2ZCE A;  2QTS A;  1WP7 A;  3OAA G;  2OIE A;  1D5A A;  3JAL B;  2Y48 A;  4DR2 B;  5L3D A;  3KZI Z;  3ABK B;  4AQY B;  2W6I G;  3FAV B;  3JAS A;  2ZXW B;  2PTM A;  2UXB O;  3T4D A;  5E1A C;  5B1B C;  4J42 A;  1N36 O;  4MVQ A;  3OM3 B;  1K3E A;  1VQ7 V;  3APO A;  3BAA A;  1H2S B;  1I0H A;  3T1Y B;  4P2Z A;  1WB8 A;  4J7J A;  3S3X A;  3M99 B;  1LUV A;  2XT9 A;  1TVK A;  1SA0 A;  2A9H A;  1WPX A;  5L3C A;  4IL6 Z;  3L71 H;  3J81 N;  5IY5 C;  1H38 A;  1ORQ C;  4X1I B;  3H9V A;  2M7W A;  4X20 A;  4CH3 A;  4O2B B;  3I55 V;  2A79 B;  3IAY A;  2GUZ B;  4CS2 A;  2RNB A;  3E8H A;  2RJZ A;  4JYY A;  2P7T C;  2OTJ V;  2E5L O;  1N34 O;  3THO A;  3LDC A;  4UCT A;  3E8G A;  2YIB A;  1SC5 B;  4X62 B;  1AI6 A;  2QWO B;  3OEE G;  1GM7 A;  4X89 A;  4B3T B;  4LCU C;  3OMA B;  3ASN B;  5HFM A;  4LR3 A;  3ZN0 A;  1ZTE A;  2D2C B;  2YS8 A;  2FTK A;  5B1B B;  1OCZ C;  1S0V A;  1MG1 A;  1CXZ B;  1IDS A;  5EK0 A;  5FPR A;  4AHC A;  3CPW U;  4A5U B;  1S5L Z;  4I7Z B;  3ZIA G;  3SYO A;  2QWR B;  4TV9 A;  5KMG B;  2XOK G;  2QM7 A;  4DW1 A;  4LWS A;  1M9N A;  1KKD A;  3E8F A;  4NR1 A;  4YJ3 A;  4JYA O;  2BSK B;  1N0N A;  5GW7 A;  4DV7 B;  4ZOL B;  3RN4 A;  4KUM A;  2IU3 A;  5LGN A;  4PJ0 Z;  3MAQ A;  1Y76 B;  4RO2 A;  4KXR A;  4X1K B;  4IIJ B;  2JGU A;  1U97 A;  1G8M A;  5IWA B;  4LBE C;  2PZS A;  4JI3 O;  4J7Z A;  2NLJ C;  4O4I A;  2P90 A;  4YJ3 B;  4XDK A;  4E4E A;  1OCC B;  5IJ9 A;  4QGP A;  4KHP B;  2EZP A;  4R8C A;  1SES A;  4JZG A;  3DTU B;  3JAR A;  5EBW C;  1IBM O;  1BHA A;  1RM1 B;  2JDI G;  1OZ0 A;  2OCC C;  4F4L A;  2DOS A;  3SPC A;  4W4L A;  1N33 O;  1PD3 A;  3AG2 B;  4K8Z A;  1QLN A;  2DYS B;  4HZ3 A;  4O4I B;  3A2F A;  2LQT A;  4PDM A;  5E79 Z;  1KD1 W;  2IU0 A;  1OCO C;  2Y69 C;  5LGT A;  1IBL B;  3ML0 A;  2XAS A;  5B1A C;  2FL4 A;  2HVK C;  1JJ2 U;  3CCV V;  3CC2 V;  2DYS C;  1R6N A;  1Z2G A;  4LF7 B;  4LFC B;  2VWJ A;  4UCV A;  1L0N H;  5L3E A;  5KUM A;  2QEX V;  1H2L A;  3J80 N;  2DWD C;  1QLE B;  3L75 H;  3OTF A;  3EHB B;  5EBL C;  2AZ0 A;  2CAZ C;  3H1I H;  1OHH G;  3TK1 A;  1KYO F;  2XAJ A;  3F5W C;  5DED A;  2R72 A;  2KG7 B;  4AI8 A;  1QNM A;  3OMI B;  1H2M A;  4N23 A;  1SQF A;  2CH7 B;  5GON B;  1F51 A;  4O2A B;  5EIB D;  2BE3 A;  1XEQ A;  4JI4 B;  4L87 A;  4GT1 A;  2OIG A;  1JX9 A;  2P4K A;  3AK2 A;  3L70 H;  2E76 B;  5AG2 A;  2OCH A;  2QKA A;  2VQE B;  1MSD A;  2GV9 A;  4EB6 B;  2WA4 A;  3K59 A;  5LYJ A;  1BHB A;  4EEQ A;  1NJI W;  3F7V C;  1NKD A;  4NKG B;  2AXT Z;  3FB6 C;  1D5N A;  3SYP A;  1UPG A;  1QLE C;  4H37 A;  4JI0 O;  1M4U A;  2UUA O;  1SZT A;  2YEV B;  5K1P A;  1XNQ O;  4MVR A;  2ZIM A;  1IUR A;  1GH6 A;  5CBH A;  2ATK C;  2X6B A;  3ZMU A;  1MZF A;  1Q6I A;  4NXN O;  4F6R A;  1ZX3 A;  2DQ0 A;  4R50 A;  3JCU Z;  2EIM C;  3UM7 A;  3QNE A;  3LUT B;  2B1I A;  3E35 A;  1ZAU A;  1FXV A;  1DK1 A;  1SET A;  1QBZ A;  5L3B A;  1GN6 A;  3EVK A;  4DR7 O;  1GMG A;  3FB7 C;  3OD4 A;  3G67 A;  1NTK H;  3JAS B;  3WB1 A;  1YZB A;  4RQF A;  2F23 A;  1WP8 A;  3AG3 C;  5GTI Z;  1V55 C;  1FJG B;  3ETD A;  3LSS A;  3IC7 A;  4MW3 A;  3F7Y C;  1L1F A;  5LHI A;  1X4T A;  3ETE A;  2KSD A;  5JQG A;  3CCJ V;  4FFB A;  1PM9 A;  2P6J A;  1ZSP A;  1FYJ A;  1EN6 A;  1Q43 A;  4TQD A;  2ZQM A;  3JAR B;  1GTO A;  1VAR A;  1JMK C;  3HR0 A;  5FPO A;  4GYC B;  1Q7Y W;  3CD6 V;  3O9O A;  4EKW A;  3OE7 G;  4G28 B;  2ILM A;  3UT5 A;  2NR5 A;  3FX7 A;  4I55 B;  4FLX A;  1M93 A;  1Q6H A;  2BTO A;  1O9H A;  3ASO C;  1XMQ B;  1UFI A;  1Y6X A;  5LXT B;  2EIM B;  3P30 A;  3AG1 C;  1SS3 A;  3CYO A;  4XDL A;  4LF8 O;  1R3J C;  1Q90 D;  2G38 A;  3IFX A;  4ZKI A;  2ETN A;  5KHJ A;  2Q4P A;  1EBO A;  1K5Q A;  3UT5 B;  4LF7 O;  2RQ6 A;  1F4M A;  5IYZ A;  3ABT A;  2HHH O;  1IVS A;  1R73 A;  2ZR2 A;  4QE9 A;  1TVK B;  1S3J A;  3OEH G;  1SA0 B;  2YXH A;  1N0J A;  2B9Z A;  2AHZ A;  1BZK A;  4X1Y B;  4WBN B;  1HNZ B;  5B1A B;  4TOI A;  1KUQ A;  2IJJ A;  2Y0P A;  5IJ0 B;  4FM1 A;  3EXA A;  3OGC C;  4TT3 G;  5D5P A;  1M56 B;  1YJ9 V;  1B06 A;  4O2B A;  3HB3 B;  3RYF B;  5LMN O;  2YC0 A;  3F5T A;  5LMU B;  4BR6 A;  2Z5U A;  5CBG A;  3D36 C;  3JAT B;  2KG7 A;  4UFZ A;  4W4K A;  1CPY A;  3FKS G;  4LP8 A;  3A0B Z;  5LOV A;  1R6K A;  4GX2 A;  3VBB A;  2WWW A;  5IYD O;  4DR1 O;  3BAB A;  2CK3 G;  2UUC B;  3G71 V;  2EIJ C;  2JGD A;  4H13 B;  1M56 C;  1AI4 A;  3E22 A;  3I5D A;  4K3A A;  1TUB A;  4FLT A;  5IDJ A;  2GDS A;  1VQP V;  4DR3 B;  2YIB D;  5KHI A;  4EB6 A;  2YI8 A;  4B3S O;  3ZMS A;  4UVA A;  4CH4 A;  4GKJ B;  1ZUQ A;  2F1M A;  1GN3 A;  1H2G A;  4OPH A;  3HKC B;  4LF5 B;  1RPR A;  2WLL A;  2XAH A;  5JJE B;  2JGD B;  4DV1 B;  5LP6 B;  1VF6 C;  1PL4 A;  4HAM A;  4NTW A;  3VQV A;  4O4L A;  1W0K G;  2ZIN A;  3ZCC A;  4WFE A;  4I50 A;  2P4V A;  1K8A W;  3SPH A;  3CCU V;  4Z1V A;  4R7C A;  3STZ C;  2XUM A;  3BA9 A;  2M6Y A;  4CC5 A;  2E75 B;  4F6R B;  3TCU A;  4X9Q A;  3ZMT A;  1SZX A;  4RWU A;  4LC1 A;  3U11 A;  2ITD C;  1BGY H;  3HKE B;  4LF5 O;  1S5H C;  2HG5 C;  2LP7 A;  3JCZ A;  2Q7E A;  3CXH F;  4TWK A;  3CEI A;  4TQF A;  2EIJ B;  1GRJ A;  2DW4 A;  4Q6G A;  4ZHQ B;  4GKJ O;  4YY3 B;  5EYP A;  1YXB A;  1AJN A;  4U7N A;  4GX1 A;  2HJF C;  1IXM A;  2ZE7 A;  5KHG A;  4NTX A;  2QSA A;  4LNU B;  5LHH A;  3RYC A;  5JQG B;  1Y74 A;  4FVM A;  1WN7 A;  4JAA A;  3H1H H;  1PPJ H;  2X0L A;  1N32 B;  1FFX A;  3KCX A;  2ZE8 A;  2W0X A;  4J9Z B;  3E8B A;  4PA4 A;  3ZRS A;  4JV5 B;  1US6 A;  2WAM A;  1JVM A;  4MVO A;  4NB5 A;  4UV8 A;  3JSL A;  1BT8 A;  3T1Y O;  4O4J A;  5BZB A;  4O4H A;  5ITZ A;  3ICX A;  4FLY A;  1XL4 A;  1PV0 A;  3CMA V;  4F6E A;  5KX5 B;  2WSS G;  2QM8 A;  2D3O W;  2FYU H;  1Y74 B;  1GKF A;  4X62 O;  2EUL A;  2HKO A;  1FFX B;  1I5X A;  3BA8 A;  1VIB A;  2ZXW C;  3ABM B;  4MTO A;  3N2G A;  1B6Q A;  1EN4 A;  3B8M A;  2QE7 G;  1Y66 A;  3ZJZ A;  3STL C;  3PJS K;  5JH7 B;  4O4H B;  5ITZ B;  1QVG U;  3FD9 A;  3N27 A;  4DR4 O;  4MTG A;  4ZI7 A;  1VMG A;  3B8N A;  5CA1 A;  3WB2 A;  1NH2 D;  3CS5 A;  5J2T B;  4D7T A;  4JAS A;  3TJT A;  5LBQ A;  4GLX A;  4LFB O;  2Q7G A;  5EZY A;  3ZX6 A;  1MOF A;  5CBF A;  1E1R G;  1Y4M A;  2ADP A;  1K92 A;  1NS1 A;  1X59 A;  2VWK A;  5LHG A;  5DN6 G;  4JI7 B;  2HR3 A;  1K97 A;  1GAX A;  1AR4 A;  3GVM A;  1K4C C;  3HKD A;  4NXM O;  2JS3 A;  3OUF A;  1KKC A;  3JD0 A;  3MHH C;  3BVO A;  1XRE A;  3CCE V;  3E22 B;  3CCR V;  3QO7 A;  4LF9 B;  2AZ2 A;  5B3S C;  2V7Q G;  2WLJ A;  1AR1 B;  1URF A;  1J5E B;  3HKC A;  1IBL O;  2ZE6 A;  1AJP A;  1XHZ A;  2QJ1 A;  3ZS8 C;  3DSQ A;  4O4L B;  3GWK C;  3RYH A;  1VQ5 V;  1HR0 O;  1FPO A;  4KL1 A;  1FFT B;  4FPP A;  2VQF B;  2WPD G;  4DW0 A;  3ZN1 A;  4I50 B;  1OCR B;  1R1B A;  4PI0 A;  4B3R B;  2OTL V;  2MK3 A;  2ZIO A;  3ETG A;  1BQ0 A;  3NXS A;  1XBL A;  2N04 A;  3SPJ A;  1GM8 A;  5LP6 C;  1XUQ A;  3P32 A;  3G6E V;  3OMN B;  3BCC H;  1S5J A;  3CJH B;  3K04 A;  3C3S A;  2WLI A;  5CN0 A;  1A32 A;  3B2E E;  4NTY A;  2UUB O;  4IYH A;  2AHY A;  2BOB C;  1I08 A;  4X1Y A;  3JSN A;  1KBH A;  4DUY B;  4O2A A;  4LF6 O;  2F93 B;  4PHZ A;  4ZHQ A;  1QVF U;  1NQT A;  4GUN A;  3K0G A;  3ZHU A;  2QTO A;  4MVM A;  4MSW C;  4DUZ B;  1YF2 A;  4FZ0 A;  2EIK C;  3CC7 V;  2QM4 A;  3ZRX A;  1Y67 A;  4LF8 B;  3DC5 A;  2UUB B;  2MW2 B;  3OR6 C;  5LOV B;  5EIB C;  3LSQ A;  4B08 A;  1N8R W;  5CB4 B;  5B1N A;  1HNX B;  1AR5 A;  1NVP B;  4X1I A;  4O4J B;  1Q82 W;  4JI2 B;  1XOU A;  3HPL C;  1P7G A;  2QKS A;  3A0H Z;  1FD9 A;  2EIN B;  3DC6 A;  2K1E A;  3RVZ A;  4PA3 A;  3SJC C;  1THZ A;  2X6A A;  1NR1 A;  2Y4U A;  4B3R O;  3CP1 A;  1EZV H;  3AG4 B;  3ZRW B;  1ARO P;  1EZJ A;  4HNA B;  1FXH A;  1HP8 A;  1G4Y B;  3N2G B;  4DO2 A;  2RCV A;  4I0X B;  3LSU A;  3DXR A;  4GX5 A;  1SQQ H;  2CTQ A;  2DQ3 A;  4ASU G;  4WCE V;  5CA1 B;  1YVW A;  1BSM A;  2Y69 B;  3AG1 B;  4FZ1 A;  3CSX A;  1VQ4 V;  2P06 A;  3IC9 A;  4JTA B;  1JA8 A;  2BSK A;  4GX0 A;  2WLM A;  3W7S A;  4WFG A;  2CGO A;  3SJQ C;  1XQ8 A;  3MHS C;  1I94 B;  3D36 A;  1N36 B;  2KB1 A;  1DLB A;  1FXK A;  4DR6 B;  1AP6 A;  4WFF A;  1EN5 A;  4I9W A;  2ZKO A;  3H1L H;  1XMO O;  1J95 A;  1H2N A;  5DEC A;  3SDL A;  2VQF O;  4I55 A;  5BY1 A;  3HKD B;  2UU9 B;  2CDY A;  1H8H G;  3IJ4 A;  2IH3 C;  3ASO B;  4YHH B;  1L0L H;  4TV8 B;  2DJV A;  4DV4 B;  4JF3 A;  4PA6 A;  1IBK B;  3CRQ A;  2OYQ A;  1KQS U;  5FLX N;  4J9Y B;  2OT5 A;  1PP9 H;  1T5E A;  1BL8 A;  4JI8 B;  1IBK O;  1PNK A;  3JD4 A;  1H2K A;  1AP5 A;  1KP2 A;  3TXQ A;  2UXX A;  1HW7 A;  2ZR3 A;  4JTD B;  5LA6 A;  2PUS A;  1KP3 A;  3CCS V;  1RM1 C;  4JTC B;  1KB9 F;  2JEX A;  3T1C A;  2JRI A;  1JFF A;  3JYC A;  1Q81 W;  2F4V B;  3CCQ V;  3SGI A;  5LMU O;  4JI5 B;  1YIT V;  4OPA A;  4DV0 O;  1AIL A;  5LMN B;  2ZD9 A;  2DYR C;  4JV5 O;  4HBN A;  1R3K C;  3KCY A;  3VQY A;  3WG7 C;  1LNQ A;  4ZI7 B;  2WLI B;  3QO8 A;  1N32 O;  2Z0A A;  1VF7 A;  2HJD A;  4X20 B;  4PD4 F;  2VS0 A;  2BOC C;  1HNZ O;  5BXZ A;  2GTS A;  4TUY B;  3FB8 C;  5H5N A;  4B3S B;  1H8E G;  2ARH A;  2XAG A;  3K79 A;  3ZRV A;  2IBZ H;  5KX5 A;  5BMV B;  3UKM A;  2L35 A;  3FYE B;  3JAW B;  1WJZ A;  2N74 A;  3AG2 C;  2RN9 A;  4KFM A;  3SYQ A;  3CC4 V;  3SYC A;  4CZZ A;  1Q6U A;  4RQE A;  1K9M W;  5D5Q A;  4DV0 B;  4MVS A;  5FNV A;  5H2F Z;  4ZIB A;  2F4V O;  5KLV H;  2CE4 A;  4U3J A;  2PYL A;  5KHK A;  2QKC A;  3H1K H;  3P3N A;  4TV9 B;  1JCH A;  2PGG A;  4LF4 O;  4HNA A;  1G6U A;  3CME V;  5LYJ B;  2DYR B;  1EFR G;  3GB7 C;  2XAQ A;  1F23 A;  2EBO A;  3HKE A;  1IZ3 A;  2Y4T A;  2VRZ A;  3M7M X;  1QR8 A;  4X65 B;  3DXR B;  2YEV A;  5BR8 O;  1RP3 B;  4BIU A;  1VF5 B;  1WNS A;  4B3M B;  1MZE A;  1BE3 H;  3CHX A;  4UV9 A;  2EIL B;  1V54 C;  1OCR C;  1JJO A;  1EM1 A;  5EYP B;  1Z5W A;  2XAF A;  4X1K A;  2ODM A;  1HNW O;  4FJC C;  1NTZ H;  3E89 A;  1OV9 A;  4B3M O;  3OR7 C;  3RBZ A;  1NH2 B;  1IX9 A;  3SPG A;  2Q7H A;  2YXL A;  4XDJ A;  3CJH A;  1E79 G;  2EZO A;  4PA9 A;  2BCC H;  2H94 A;  2DE0 X;  3ZMV A;  1KMI Z;  1VQ8 V;  4LF4 B;  1VQL V;  4WFB V;  3B77 A;  4Z1M G;  2CTW A;  4DR6 O;  1RSO A;  1R3L C;  3SPI A;  3K3W A;  4BW9 A;  5JVD B;  3W7T A;  3L9D A;  5DM6 V;  1NT2 B;  1B3Q A;  1FAF A;  4DV6 O;  2EJR A;  2XND G;  1O9G A;  4FLV A;  3ABL C;  4CH5 A;  2UXD O;  3T1H O;  3AG3 B;  4G27 B;  4J11 A;  2E5L B;  2X7R B;  3K58 A;  3K5L A;  4MVU A;  4K0K O;  5JH7 A;  1DGS A;  1YSC A;  1K73 W;  4PDV A;  1R6T A;  4FM0 A;  3LNN A;  1WPB A;  3ZHQ A;  1V9P A;  1YIJ V;  1GM9 A;  5KAI Z;  3IGA C;  1BQZ A;  2HFE C;  2UXC B;  4IHJ A;  3A0R A;  2P22 C;  2IJH A;  3SYA A;  4IGG A;  2R9I A;  2JIZ G;  5J9P C;  4OX9 O;  2AGA A;  3E86 A;  3UO3 A;  3QTC A;  2HVJ C;  5CA0 A;  4D7S A;  3QG5 A;  3B4S A;  4ZBM A;  2JJ2 G;  3K9S A;  2ITC C;  4X66 O;  4MW8 A;  2HHH B;  1JQ0 A;  1ZLZ A;  2B5U A;  3ETQ A;  4BIZ A;  3JAT A;  4DV3 B;  1TAE A;  4MVZ A;  4P9P A;  1WA8 A;  3JAW A;  4DV4 O;  3ZHT A;  2QWP B;  4E2L A;  4JPR A;  3RT3 C;  4TSF G;  3RYH B;  3ABM C;  3JAK A;  5C93 A;  2CGN A;  1N4C A;  2ZT9 B;  3BY6 A;  1TUB B;  5HFL A;  2R9A A;  1COW G;  2GHY A;  4UXN A;  1L8D A;  1XMO B;  3C3T A;  2FML A;  2C2A A;  4I9Q A;  3UQ8 A;  4YJ2 B;  1VQK V;  1U96 A;  2Q6A A;  1NZ6 A;  4K35 A;  1HR0 B;  3L74 H;  4QJF B;  3X2Q C;  3N2K B;  5LA6 B;  4DV2 O;  2IH1 C;  3ZHV A;  4JI6 B;  2E3C A;  4CS3 A;  2YID A;  5CA3 A;  4UB8 Z;  4B7K A;  3T2M A;  2W0F C;  1M1K W;  1M57 C;  1P7B A;  4IYI A;  2YIC A;  2LW7 A;  3KKY A;  1JFF B;  1RFY A;  3UO2 A;  4RUE A;  1OCZ B;  2IJI A;  4UB6 Z;  3L72 H;  4WFA V;  3BEH A;  3ZMZ A;  3RWR D;  2HP8 A;  3CRA A;  3KG2 A;  4NXM B;  4BIO A;  2LFR A;  1DTO A;  1BMF G;  3E83 A;  3B09 A;  2LO1 A;  4JI1 O;  4YXW G;  5JVD A;  4UVB A;  1M90 W;  4OX9 B;  4X64 B;  1FS0 G;  3OUS A;  3RYC B;  1LUW A;  4J80 A;  1MA1 A;  5LXT A;  1UJW B;  3QF7 A;  3EFF K;  4DK0 A;  1XDC A;  2UXC O;  1BS3 A;  4WFH A;  1HNW B;  1TUE B;  4I0X A;  4LFC O;  1ZL8 A;  2GBO A;  2AW9 A;  2R9R B;  4PA7 A;  4JI4 O;  5IYZ B;  1QR9 A;  1K5S A;  4PV1 B;  4Q20 A;  4FFK A;  4DV7 O;  1VQ6 V;  4JAV A;  2UXD B;  5EC2 C;  5IYB O;  1XIL A;  2B1G A;  2W6J G;  4GCZ A;  2IJK A;  1YHQ V;  3LDE A;  3OW2 U;  3BRC A;  1VEW A;  2L6L A;  5KUK A;  4Z2W A;  5JWP A;  2O57 A;  4FLZ A;  2WLH A;  5CA0 B;  1JPX A;  3AK3 A;  1S76 D;  3ZHS A;  5BMV A;  1YEW A;  3VOU A;  2YUA A;  2ADQ B;  3MD0 A;  4DV5 O;  4B7E A;  4C7U A;  4N21 A;  1N33 B;  1R3I C;  3O65 A;  4OGQ B;  1WLE A;  3J7A U;  5KHH A;  2PI5 A;  3T4Z A;  5IY5 B;  3ZED A;  1AI7 A;  1QU7 A;  3H01 A;  4TV8 A;  4BWA A;  5LL6 Y;  5B1O A;  3K9A A;  1KC8 W;  3M8A A;  1OCO B;  1W59 A;  1SER A;  3K0D A;  3T1H B;  1KEC A;  2QA4 V;  4LF9 O;  1WA8 B;  1ROP A;  2YSU B;  5IT9 N;  2NN4 A;  1NR7 A;  2QR4 A;  5B66 Z;  4UCO A;  5J2U B;  3AG7 A;  4J41 A;  2ZDI A;  4H44 B;  3Q4H A;  3K57 A;  1XMQ O;  1AJQ A;  2X6C A;  1NVP D;  3G4S V;  3ASN C;  2GSM B;  2Q73 A;  2WLL B;  3AK1 A;  2EIN C;  4PI2 A;  3CRC A;  1PNL A;  1QQC A;  4X64 O;  4KP4 A;  4LFA B;  2F43 G;  3RW0 A;  2UU9 O;  3CX5 F;  2EIK B;  4U7O A;  3CWB H;  2GTA A;  4I4T B;  2JJ1 G;  4CBC A;  5KMG A;  4LFA O;  1M5I A;  4FK5 C;  1MAB G;  2WLN A;  3K5N A;  1YJW V;  4KHP O;  4PEL A;  2Q9L A;  3Q4H B;  1Z5V A;  4CH6 A;  3JD1 A;  1VQM V;  2QGN A;  1YI2 V;  4LFB B;  1YTF D;  1GO3 F;  4P9O A;  1AVM A;  3CE2 A;  1AI5 A;  4ZOL A;  2PY5 A;  3OTO O;  3TGU H;  4QE7 A;  4NYK A;  3FAV A;  5KA5 A;  1Y76 A;  1SQG A;  4JI8 O;  1WB7 A;  3RYI B;  3AG4 C;  1N34 B;  4IHJ B;  1VP7 A;  3CRM A;  4DR3 O;  3C90 A;  5C8Y A;  4DRX A;  5BR8 B;  2P67 A;  1I5Y A;  2V4D A;  2KQX A;  4X8A A;  3JD2 A;  3ZHR A;  4P30 A;  4X65 O;  3BPZ A;  3W7W A;  1VF6 A;  4UCS A;  2UUC O;  2DN9 A;  1SQB H;  5L3F A;  3LDD A;  3HKB B;  2LGQ A;  3JAM N;  4XBF A;  2YDE A;  1SQP H;  2OCC B;  3AEI A;  3RYI A;  1YCI A;  4J10 A;  3S3W A;  3FB5 C;  5FNV B;  4DR5 O;  5C8Y B;  1I94 O;  5JCO A;  1Q86 W;  2DMX A;  1FKA O;  4U3J B;  4DR5 B;  1QHT A;  4QNH B;  5EC1 C;  5CMU A;  4EFE A;  2BTQ B;  3WFV A;  4B3T O;  2Y0I A;  2RDC A;  2EJ7 A;  3D3I A;  2UXB B;  3D8C A;  1TGO A;  4WBN A;  1XHX A;  4AQY O;  2CUG A;  2IM9 A;  5IJ0 A;  2EIL C;  5CB4 A;  2CTR A;  2LGW A;  4FLU A;  1GN2 A;  3FYI B;  1NBM G;  3U0Z A;  3CCM V;  3RYF A;  2P5O A;  3JAK B;  1ZL8 B;  4NVP A;  4X88 A;  2Q0O C;  4IT5 A;  3TXS A;  1D2D A;  2K9P A;  4BW5 A;  3B40 A;  2Q5Z A;  4X66 B;  1IXB A;  3CXC U;  1SF9 A;  2BTQ A;  4G2K A;  1YJN V;  1YDX A;  4LH7 A;  1P4R A;  5J2T A;  4YJ2 A;  1PKX A;  3ZRW A;  3K5M A;  4LF6 B;  3U10 A;  2F95 B;  2A7W A;  4FLW A;  5EZY B;  1P49 A;  3ABU A;  4JYC A;  4MS2 A;  3OT7 A;  4YHH O;  4BAY A;  3SR2 C;  4FMT A;  5IYC O;  4YIO A;  4L8J A;  3R66 A;  1CEZ A;  2PI4 A;  4PDR A;  4D6T H;  2Q67 A;  5EBM C;  5H6Q A;  5K1X A;  3UCS C;  3NR7 A;  3K06 A;  3A8T A;  1RSO B;  1HNX O;  1YTF B;  3D3Q A;  4DR2 O;  4GZR B;  2CH7 A;  3RGB A;  4EFB A;  4QPJ A;  3I56 V;  5LP6 A;  4DV1 O;  4R6Z A;  5IJ9 B;  3DGE A;  2DWE C;  2WA3 A;  1QCE A;  4MTF A;  1MSW D;  1F4N A;  3ABL B;  3ABK C;  3TET A;  1MMM A;  4K0K B;  4H33 A;  4LH6 A;  5IE9 A;  1CP9 A;  2QWQ B;  2Q69 A;  1FJG O;  2H8P C;  1ENV A;  1SKV A;  5FL7 G;  4ICG A;  4DUY O;  3K5O A;  2HEP A;  1DF5 A;  4JI6 O;  1LR1 A;  1NTM H;  4DV2 B;  4DR7 B;  4QIW F;  4DV6 B;  3K08 A;  1VQN V;  2A0L A;  3G80 A;  1W2B U;  5A9G A;  3QO5 A;  2OWO A;  2LFS A;  2JS5 A;  4DR1 B;  3OFN G;  3JAL A;  2QWN B;  1K33 A;  2H3O A;  4JGS A;  3RVY A;  4U3F H;  4GKK B;  4NXN B;  2ZM6 B;  5B5E Z;  2Q68 A;  5GTH Z;  2CTP A;  4J7K A;  2ZNJ A;  4YIP A;  1Q3E A;  1HDJ A;  1SQX H;  2YXY A;  4DV5 B;  3L73 H;  2NNU A;  1JR9 A;  2ZM6 O;  2ZNI A;  4GKK O;  4LNU A;  1VQO V;  1ZWI C;  2YIA A;  3P3P A;  3VQX A;  4JI7 O;  1XNQ B;  1BCC H;  2YI9 A;  5TIS Z;  2UUA B;  1WAZ A;  2PF4 E;  2E74 B;  3G6B A;  1V54 B;  5KA6 A;  4OXS A;  2XTA A;  1I7F A;  2IW5 A;  1Q8I A;  3GWO A;  2VQE O;  2N05 A;  4RAI A;  2LW1 A;  2JEU A;  1XL6 A;  4CC6 A;  2FKX A;  4UVC A;  3RFR A;  1V55 B;  2Q0A A;  1XNR O;  5F2V O;  4JAU A;  2ZDI C;  1JOY A;  2WLK A;  1RPO A;  4RUF A;  2GUZ A;  2F66 C;  4JYB A;  3JD3 A;  4JYA B;  1MNG A;  3WB0 A;  5B3S B;  2PYJ A;  2LJ2 A;  4TUY A;  3K03 A;  4DK1 A;  4PDL A;  1TA8 A;  1K4D C;  2XHB A;  1PL0 A;  3WU2 Z;  1NU1 H;  1B04 A;  3OGI B;  4JI2 O;  4JI1 B;  2EX3 A;  3H1J H;  3X2Q B;  4AIL C;  4HYO A;  1GN4 A;  3WG7 B;  1FXK C;  1K7D A;  4H0L B;  1SQV H;  4I5S A;  2R70 A;  1AB3 A;  5JJN B;  3FFQ A;  1HWY A;  3SJB C;  3QVN A;  4LWS B;  3N2K A;  5LGU A;  4UUJ C; 
#chains in the Genus database with same CATH homology
 2ZQM A;  1OCC C;  1M57 B;  4DO2 A;  5H9C A;  1GTO A;  3KG2 A;  2LFR A;  4MTX A;  1Q7Y W;  1DTO A;  1BMF G;  3CD6 V;  4GX5 A;  3E83 A;  4EKW A;  3OE7 G;  4G28 B;  4FIP C;  2DQ3 A;  4ASU G;  4YXW G;  4WCE V;  2HLD G;  4UVB A;  1M90 W;  3R65 A;  2Y69 B;  1VQ9 V;  1K34 A;  5L3G A;  1FS0 G;  3OUS A;  3AG1 B;  1UJW B;  3EFF K;  1SRY A;  1VQ4 V;  3ASO C;  4JTA B;  3CCL V;  2EIM B;  3P30 A;  3AG1 C;  3CYO A;  4XDL A;  4GX0 A;  2WLM A;  2Z3Y A;  4WFG A;  3W7S A;  1R3J C;  4WFH A;  2V1D A;  3SJQ C;  3IFX A;  4ZKI A;  3LNM B;  4MT8 A;  1TUE B;  1EBO A;  1K5Q A;  3MHS C;  3W7U A;  3D36 A;  1F4M A;  2R9R B;  2KB1 A;  1DLB A;  1FXK A;  3ABT A;  4PA7 A;  4WFF A;  4I9W A;  3E2E A;  1QR9 A;  1S77 D;  1FXK B;  1R73 A;  2ZR2 A;  1J95 A;  1K5S A;  4QE9 A;  1S3J A;  3OEH G;  4Q20 A;  5H6R A;  1W0J G;  1VQ6 V;  1H8H G;  1PNM A;  4JAV A;  2AHZ A;  2IH3 C;  5EC2 C;  5IYB O;  1E1Q G;  2B1G A;  3ASO B;  5B1A B;  2W6J G;  4GCZ A;  2UXN A;  2IJJ A;  2IJK A;  1YHQ V;  3LDE A;  3OW2 U;  1S72 V;  3OGC C;  4TT3 G;  3W7X A;  1M56 B;  1YJ9 V;  4JF3 A;  4PA6 A;  5KUK A;  3HB3 B;  1KQS U;  4WF9 V;  4J9Y B;  2OT5 A;  2WLH A;  1JPX A;  1S76 D;  1DF4 A;  3VOU A;  2Z5U A;  5CBG A;  1BL8 A;  4QPK A;  3MD0 A;  2JK5 C;  4DXW A;  1GK9 A;  4N21 A;  1PNK A;  1CPY A;  3FKS G;  3JD4 A;  4LP8 A;  3OAA G;  1R3I C;  1KP2 A;  2UXX A;  2ZR3 A;  1WLE A;  4JTD B;  1R6K A;  2PI5 A;  4GX2 A;  2Y48 A;  1KP3 A;  3VBB A;  2WWW A;  5IYD O;  3T4Z A;  3CCS V;  1RM1 C;  2CK3 G;  5L3D A;  5IY5 B;  3G71 V;  1AI7 A;  2EIJ C;  3ABK B;  1M56 C;  3H01 A;  4JTC B;  1AI4 A;  2W6I G;  2ZXW B;  5B1O A;  2JEX A;  5IDJ A;  1VQP V;  3K9A A;  3T1C A;  3T4D A;  1KC8 W;  5E1A C;  3JYC A;  5B1B C;  1OCO B;  4MVQ A;  3OM3 B;  1SER A;  1Q81 W;  3ZMS A;  1K3E A;  1VQ7 V;  4UVA A;  3K0D A;  3CCQ V;  1KEC A;  2QA4 V;  1YIT V;  4P2Z A;  3M99 B;  2YSU B;  1ROP A;  2ZD9 A;  2DYR C;  1H2G A;  1NR7 A;  1R3K C;  2A9H A;  1WPX A;  2ZDI A;  3WG7 C;  1LNQ A;  1RPR A;  2WLI B;  2WLL A;  2XAH A;  5L3C A;  1AJQ A;  2X6C A;  3QO8 A;  1NVP D;  3G4S V;  3CC4 V;  3ASN C;  5IY5 C;  1H38 A;  2GSM B;  2WLL B;  2EIN C;  4HAM A;  1PNL A;  1ORQ C;  2BOC C;  4KP4 A;  1W0K G;  2M7W A;  3ZCC A;  4WFE A;  2F43 G;  3RW0 A;  3FB8 C;  2EIK B;  1K8A W;  3I55 V;  4U7O A;  3SPH A;  3CCU V;  1H8E G;  4R7C A;  3STZ C;  2A79 B;  2JJ1 G;  2XAG A;  3K79 A;  3ZRV A;  4CBC A;  3E8H A;  2P7T C;  3TCU A;  3ZMT A;  2OTJ V;  3UKM A;  4FK5 C;  3FYE B;  1MAB G;  2WLN A;  3LDC A;  1YJW V;  4LC1 A;  4PEL A;  2ITD C;  3AG2 C;  3E8G A;  3JD1 A;  4KFM A;  1VQM V;  1AI6 A;  1S5H C;  2HG5 C;  3OEE G;  3SYQ A;  1GM7 A;  4X89 A;  3SYC A;  2LP7 A;  1YI2 V;  1YTF D;  1GO3 F;  3JCZ A;  4P9O A;  4LCU C;  4CZZ A;  1AI5 A;  3OMA B;  3ASN B;  5HFM A;  4RQE A;  1K9M W;  4MVS A;  4QE7 A;  3ZN0 A;  5KA5 A;  4TWK A;  2FTK A;  2EIJ B;  5B1B B;  1OCZ C;  3AG4 C;  1S0V A;  1MG1 A;  2DW4 A;  5EK0 A;  3CPW U;  1AJN A;  4U7N A;  4GX1 A;  2HJF C;  1IXM A;  1JCH A;  2P67 A;  1I5Y A;  3SYO A;  4X8A A;  3JD2 A;  3ZIA G;  3CME V;  2DYR B;  4P30 A;  1EFR G;  2XOK G;  3GB7 C;  2QM7 A;  5LHH A;  2XAQ A;  3W7W A;  1M9N A;  1KKD A;  1F23 A;  2EBO A;  3E8F A;  5L3F A;  3LDD A;  5GW7 A;  2X0L A;  1QR8 A;  4XBF A;  2YEV A;  4J9Z B;  2OCC B;  3AEI A;  3E8B A;  4PA4 A;  3ZRS A;  4BIU A;  4KUM A;  2IU3 A;  5LGN A;  3FB5 C;  2WAM A;  1JVM A;  4UV9 A;  4MVO A;  4RO2 A;  4UV8 A;  2EIL B;  1V54 C;  1OCR C;  1Q86 W;  5BZB A;  1G8M A;  4LBE C;  2XAF A;  1XL4 A;  4FJC C;  3CMA V;  4QNH B;  3E89 A;  2WSS G;  5EC1 C;  2QM8 A;  5CMU A;  2D3O W;  2NLJ C;  3OR7 C;  3WFV A;  2P90 A;  3D3I A;  1GKF A;  3RBZ A;  1NH2 B;  4XDK A;  1OCC B;  2HKO A;  3SPG A;  1I5X A;  2EZP A;  4R8C A;  4XDJ A;  1SES A;  2EIL C;  2ZXW C;  3DTU B;  5EBW C;  1E79 G;  3ABM B;  1BHA A;  1RM1 B;  2EZO A;  3FYI B;  4MTO A;  1NBM G;  2H94 A;  1OZ0 A;  2JDI G;  2OCC C;  4PA9 A;  3CCM V;  3ZMV A;  4F4L A;  1B6Q A;  3B8M A;  2QE7 G;  1Y66 A;  3SPC A;  3ZJZ A;  1VQ8 V;  3STL C;  3PJS K;  1VQL V;  4WFB V;  4X88 A;  3B77 A;  1QVG U;  1PD3 A;  3AG2 B;  4Z1M G;  4BW5 A;  2DYS B;  1QLN A;  1R3L C;  3CXC U;  4HZ3 A;  4MTG A;  3SPI A;  4G2K A;  1YJN V;  3K3W A;  1P4R A;  1PKX A;  3B8N A;  3ZRW A;  3W7T A;  1NH2 D;  5DM6 V;  4JAS A;  4PDM A;  3ABU A;  5LBQ A;  4JYC A;  4MS2 A;  1KD1 W;  2EJR A;  2IU0 A;  1MOF A;  1OCO C;  2Y69 C;  1E1R G;  1Y4M A;  2XND G;  3ML0 A;  4BAY A;  5CBF A;  5LGT A;  1K92 A;  2XAS A;  5B1A C;  3ABL C;  3AG3 B;  5LHG A;  4FMT A;  4G27 B;  5DN6 G;  2HVK C;  5IYC O;  2X7R B;  2HR3 A;  1K97 A;  1CEZ A;  1JJ2 U;  3CCV V;  2PI4 A;  3CC2 V;  4MVU A;  2DYS C;  4PDR A;  2Q67 A;  1YSC A;  5EBM C;  1R6N A;  4PDV A;  5H6Q A;  1K73 W;  3K06 A;  1K4C C;  1YTF B;  3OUF A;  5L3E A;  3I56 V;  1YIJ V;  4QPJ A;  3JD0 A;  1GM9 A;  3MHH C;  5KUM A;  2QEX V;  4R6Z A;  2DWD C;  3IGA C;  3DGE A;  1QLE B;  2HFE C;  3CCE V;  2DWE C;  3A0R A;  1QCE A;  4MTF A;  3EHB B;  3CCR V;  3QO7 A;  2IJH A;  5EBL C;  3SYA A;  1MSW D;  1F4N A;  3ABL B;  3ABK C;  3TET A;  2R9I A;  5B3S C;  2V7Q G;  4H33 A;  2JIZ G;  2WLJ A;  5J9P C;  1AR1 B;  1CP9 A;  1OHH G;  3E86 A;  2Q69 A;  3TK1 A;  2H8P C;  1ENV A;  2XAJ A;  3F5W C;  5FL7 G;  2HVJ C;  1DF5 A;  1AJP A;  4QIW F;  3K08 A;  1VQN V;  4ZBM A;  3OMI B;  2A0L A;  2JJ2 G;  4N23 A;  1W2B U;  1VQ5 V;  3QO5 A;  2LFS A;  2ITC C;  3OFN G;  1F51 A;  1FFT B;  4FPP A;  2WPD G;  1K33 A;  4JGS A;  3RVY A;  3ZN1 A;  2Q68 A;  1OCR B;  4MW8 A;  4L87 A;  4GT1 A;  1JQ0 A;  1JX9 A;  2B5U A;  2OTL V;  4BIZ A;  2MK3 A;  2NNU A;  3ETG A;  4MVZ A;  1BHB A;  3NXS A;  1VQO V;  4P9P A;  1NJI W;  1ZWI C;  3F7V C;  3SPJ A;  1NKD A;  1GM8 A;  3P32 A;  3G6E V;  3OMN B;  3FB6 C;  4WFA V;  3SYP A;  3K04 A;  2WLI A;  5CN0 A;  1QLE C;  4JPR A;  4E2L A;  4H37 A;  1V54 B;  4TSF G;  5KA6 A;  4OXS A;  2AHY A;  2BOB C;  3ABM C;  1SZT A;  2YEV B;  2IW5 A;  5C93 A;  3BY6 A;  3GWO A;  4MVR A;  5HFL A;  4RAI A;  1COW G;  2GHY A;  4UXN A;  2JEU A;  1QVF U;  1NQT A;  1XL6 A;  5CBH A;  4UVC A;  1V55 B;  2ATK C;  2C2A A;  2X6B A;  4JAU A;  3K0G A;  3ZMU A;  1VQK V;  2ZDI C;  2QTO A;  1JOY A;  4MVM A;  2DQ0 A;  2Q6A A;  4MSW C;  4R50 A;  2WLK A;  1RPO A;  2EIM C;  4RUF A;  3QNE A;  2EIK C;  3UM7 A;  4JYB A;  3CC7 V;  3LUT B;  3JD3 A;  2B1I A;  3E35 A;  3ZRX A;  4QJF B;  1FXV A;  3X2Q C;  5B3S B;  1SET A;  3OR6 C;  1QBZ A;  5L3B A;  3LSQ A;  2IH1 C;  1N8R W;  5B1N A;  1NVP B;  3K03 A;  4PDL A;  1GMG A;  3FB7 C;  5CA3 A;  1K4D C;  1Q82 W;  3HPL C;  3T2M A;  2QKS A;  2W0F C;  1PL0 A;  4RQF A;  1M1K W;  1M57 C;  1P7B A;  3AG3 C;  2EIN B;  2K1E A;  3RVZ A;  1V55 C;  3ETD A;  3LSS A;  3IC7 A;  4PA3 A;  4MW3 A;  3X2Q B;  1THZ A;  2X6A A;  1NR1 A;  3F7Y C;  4HYO A;  1L1F A;  3CP1 A;  3WG7 B;  1FXK C;  1K7D A;  5LHI A;  3ETE A;  4RUE A;  3ZRW B;  1OCZ B;  3AG4 B;  3CCJ V;  4I5S A;  1ARO P;  1EZJ A;  2IJI A;  1FXH A;  2P6J A;  1HWY A;  1G4Y B;  5LGU A;  4UUJ C;  3BEH A;  3ZMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...