1R3LC

Potassium channel kcsa-fab complex in cs+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab fragment light chain
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r3lC00
1BL8A 4RUEA 3FB7C 4RUFA 2K1EA 3ZJZA 3WG7C 4QE7A 2HVKC 3SYCA 3TETA 3T1CA 3K06A 2ITDC 2ZD9A 1OCCC 1P7BA 3R65A 4UUJC 5CBGA 2WLNA 2ATKC 3LNMB 4J9ZB 3UKMA 3OR7C 1M57C 2Q68A 3HPLC 4X88A 5EK0A 4PDRA 4H37A 3SPIA 1M56C 1V54C 3OR6C 4WFGA 2Y69C 4P2ZA 2WLJA 3K0DA 3SPJA 2A9HA 3E8FA 4PA7A 5B1BC 2R9RB 2WLIB 2QKSA 3SYOA 4JTCB 4MTGA 3E8HA 3K03A 2A79B 4DXWA 3F7VC 4MW8A 3RBZA 4PDVA 5J9PC 4R8CA 3JYCA 4R50A 4MVSA 4PDMA 3STZC 5E1AC 2DYRC 2ZXWC 4XDJA 3E89A 1J95A 3LUTB 3SYQA 4CBCA 1ORQC 3E86A 2A0LA 2H8PC 2YEVA 3ABLC 2W0FC 3F5WC 3T2MA 4BW5A 3VOUA 2EINC 4JTAB 2AHYA 2Q6AA 4PDLA 4GX0A 4MSWC 4MVUA 2DWEC 2IH1C 2X6CA 4G27B 2DYSC 4R6ZA 1K4CC 2EIJC 3FB8C 4I9WA 3RW0A 4F4LA 2HVJC 3GB7C 2WLIA 3SPGA 3T4ZA 2Q67A 2EIMC 3UM7A 3X2QC 3PJSK 3E8GA 5KUKA 3SYPA 3FB5C 3SPCA 2HFEC 2KB1A 4OXSA 2BOCC 3ZRSA 4MVRA 1K4DC 3E83A 1KKDA 1R3IC 3K08A 4ZBMA 4MTOA 5CBFA 4P30A 2EIKC 4HYOA 2HG5C 2IH3C 2WLMA 4P9PA 3RVZA 4QNHB 2EILC 4XDLA 3BEHA 1G4YB 4G28B 4KFMA 2QTOA 3STLC 4JTDB 3KG2A 3AG3C 3IGAC 1S5HC 2WLKA 2ITCC 3LDDA 2P7TC 3AG1C 4GX5A 2X6BA 1LNQA 3OGCC 3E8BA 4MW3A 5EBMC 4PA6A 1R3KC 4EKWA 4WFEA 3AG4C 4WFFA 5B3SC 4MVOA 4MTFA 3SYAA 4GX1A 4R7CA 4WFHA 4RO2A 1OCRC 3IFXA 4J9YB 3AG2C 5EBWC 4RAIA 2X6AA 2AHZA 5B1AC 3T4DA 5KUMA 3SJQC 4LCUC 4MVZA 4P9OA 5EC2C 2DWDC 2WLLB 4HZ3A 1JVMA 3K04A 1XL6A 3OUSA 3K0GA 2OCCC 4TWKA 4PA4A 4MVMA 3LDCA 4QE9A 4X8AA 1V55C 5IY5C 2NLJC 3FB6C 1XL4A 3ASNC 3LDEA 4PA3A 4XDKA 3RVYA 4H33A 3SPHA 2JK5C 3ABKC 4GX2A 3ABMC 1OCOC 2Q69A 4MVQA 1ZWIC 4PA9A 3ASOC 3EFFK 4LBEC 4LP8A 5EBLC 5CBHA 5BZBA 1R3LC 4MS2A 4X89A 5EC1C 1R3JC 2WLLA 2BOBC 3OUFA 1OCZC 2WLHA 3F7YC 2HJFC 1QLEC 3TCUA
chains in the Genus database with same CATH superfamily
2IBZH 3L70H 3A0RA 3MD0A 4YXWG 1WLEA 5KHJA 1Q43A 1YF2A 4DR1O 2IW5A 4O4JB 2Q68A 4BIZA 3W7TA 4FLYA 1DK1A 5C93A 1NT2B 2Y69C 4ZOLB 2WLJA 2Y48A 1BMFG 2BTOA 3L74H 1I5XA 3RYCA 4DUZB 3G6EV 1I5YA 3RYHB 1I0HA 2ZM6B 1RPOA 3T2MA 1XOUA 1Q6IA 3CRCA 1IBMO 1QQCA 3A0HZ 4R6ZA 2ZDIC 2P6JA 1QVFU 2EJRA 3RWRD 1FPOA 2DJVA 4X65O 4DYLA 4ZI7B 3K08A 4JI4O 5DEDA 2ZE5A 1Y76A 1I08A 4DR2B 1H2KA 2CTRA 2IH3C 3N2GB 4XDLA 2XASA 3CC2V 1SKVA 4KFMA 2QTOA 4GKKO 4WF9V 2WLKA 2XOKG 3SJAC 3P3NA 4MW3A 4UCTA 1D2DA 3IFXA 3AG2C 5B1AC 3ZMTA 4X62B 4NXMO 3P3PA 1V55C 4L8JA 2BE3A 3UO3A 2VQFB 2Q7GA 3CCRV 3HB3B 2CDYA 4MVQA 3UO2A 3SJBC 1FXKB 3QG5A 1QLNA 3LSQA 4Z1VA 4Z1MG 2WPDG 3AK1A 3JAWA 1HNXO 4UUJC 3U11A 5KHIA 3ETEA 3ZHRA 4JI6O 2JGDA 4HAMA 4PDRA 4CS4A 3SPIA 2BSKB 1V54C 4X66B 4P2ZA 3WFVA 4DUYO 4LC1A 4PELA 2GTSA 5FNVB 4DV5B 4LWSA 2YDEA 1IBKO 1KQSU 3H1LH 3ZX6A 4DK1A 3ETQA 2LP7A 4DR5O 3OD4A 1VARA 1H2MA 1WP8A 1I94O 4JI8O 4MSWC 2JEUA 3GB7C 1N0JA 4UCOA 3U0ZA 1NBMG 4FVMA 4LR3A 4K0KO 2BOCC 2NR5A 2UUCO 1FS0G 4JZ2A 2Z3YA 3E83A 4YIPA 1SERA 4UXNA 3C90A 3CC4V 1FJGO 4L87A 2MK3A 2XAHA 4UVBA 3STLC 4JZGA 4HNAA 1EN4A 2X6BA 4BIOA 4UCRA 4FMTA 1P84F 1YJWV 1JR9A 5DN6G 4RAIA 1SQXH 5KMGB 4BAYA 4DR7B 1N36O 4B3SB 1OCOB 4UB6Z 1TVKA 4B3MB 2KKWA 2QM8A 2ARHA 2OCCC 1R6NA 4X1KA 4X20B 3ZRVA 4MVMA 3L9DA 5LOVA 4DV7B 2GUZB 4IIJA 2QTSA 3T1HB 1DTOA 1LUVA 1RFYA 4IHJB 3ABMC 1S3JA 2PYJA 3HKDA 5IYBO 1GMGA 4I55A 1KC8W 5FPRA 3OUFA 1AP5A 2QWNB 1M57B 1ROPA 1I7FA 3E22A 5LXTA 3K57A 3VQVA 3QO8A 2OCHA 4LFBB 2R9IA 2WLNA 3K9AA 3LNNA 3Q4HB 4YHHO 1PNKA 2F4VO 1BT8A 1VQLV 1BHBA 5LGNA 4QPKA 2YXYA 5IWAB 4D6TH 4J11A 3CCQV 2ZE6A 3M8AA 2E74B 2EBOA 3ETDA 5K1XA 2CGOA 2JVDA 5FL7G 1OCRB 5J2UA 4MVUA 3JASA 1F4NA 2Y4UA 1MSWD 5KUKA 5EIBC 3FB5C 1NH2B 3JD1A 2ZDIA 3L71H 4MVRA 1NJIW 2B5UA 1G6UA 1Q6UA 3MHHC 5CB4B 5BMVB 2W0XA 1SESA 2RNBA 5GONA 4HYOA 1DF4A 4FZ1A 1ZLZA 2EZOA 5CA0A 5B3SB 3JALA 1G4YB 2A3QA 4GYCB 3TJTA 3AG1C 1TGOA 2UUBB 2M6YA 1VQMV 3EXAA 5LYJA 4CS2A 3L72H 1ZL8B 1WA8B 3CHXA 4CH5A 2UXBB 4O4LA 3W7XA 1YTFB 2WWWA 2O57A 5KX5B 2QM7A 3BCCH 3RFRA 1B04A 1XL6A 1PP9H 2HR3A 3RGBA 5IJ9A 4DV6B 4NXNO 1YZBA 3ZMZA 2Q8VA 1NVPD 1VQ4V 1NKDA 3A8TA 3RVYA 5JQGB 2GV9A 1U96A 5CA1B 1R6KA 5JJJB 2XT9A 2WLHA 3D36C 4JI5O 1VP7A 1M56B 4I50B 4FLXA 1OCCC 4JPRA 3OT7A 3EVKA 3B8NA 2E5LB 2BCCH 4JI1O 3LSUA 5A9GA 1KMIZ 1RM1B 1L8DA 3HKCA 3SYOA 5IJ0A 5LA6A 3CCUV 3RBZA 1ZTEA 4MVSA 5JH7B 4JI2B 3SYQA 3E89A 2YEVA 3ZHUA 1MMMA 4G2KA 4DV4B 4NR1A 2IH1C 2IJIA 3S3XA 1XMQB 4B3RB 3JARA 3CRMA 2HFEC 4DV1B 5AG2A 4OXSA 1XNQB 3AG3B 4MTOA 1N33O 1NR7A 2WLMA 5LMNO 1OCZB 1QVGU 1S5HC 5JVDA 4CH6A 3CCEV 1M4UA 3DC5A 3OEHG 1KB9F 4PV1B 4GCZA 5IY5B 4FLUA 3CB2A 3QNEA 3WB2A 3OM3B 3ABKB 2Y69B 4H13B 2AGAA 3ASOB 4PA4A 1PNMA 3S3WA 2Q7EA 2UU9O 4N21A 4LF4B 4EFEA 4H33A 3EHBB 4D7SA 1Y74B 4JYYA 2PI5A 2FYUH 3CXCU 4UCVA 4DR3O 3ZHSA 5EBLC 5CBHA 4OX9B 2CGNA 1QCEA 2QKAA 4UV9A 4X89A 1R3LC 2XAGA 4LF5O 2YIBA 5EYPA 3CJHB 4EB6A 2HKOA 5JJNB 3FB7C 2W6JG 3ZJZA 5C8YA 2X0LA 5EZYA 5LBQA 3T1CA 4CZZA 4FZ0A 2LW7A 2ATKC 4BWAA 1KP3A 2WA4A 2R72A 3CYOA 4X88A 1IX9A 1JFFB 3SDLA 1JCHA 1YSCA 3ABUA 5BY1A 3W7SA 3H1IH 3CMEV 4W4LA 2R9RB 3D8CA 2QKSA 2WAMA 2A79B 4MW8A 2Q5ZA 3ZHVA 3BFRA 4PDMA 1M90W 4WBNB 1S5LZ 2H8PC 4F6RB 3G4SV 2EINC 4PI0A 1COWG 4YY3O 4GX0A 3N2KA 5IT9N 5B1AB 2X6CA 1IBLB 2DYSC 4DR1B 2EIJC 4NKGB 3RW0A 3PJSK 3RYIA 4UB8Z 4JI0O 1V55B 2WA3A 3H9VA 4TQDA 3IC9A 2FL4A 2YICA 4LF8O 3CCJV 1IZ3A 4P30A 4P9PA 3RVZA 1MSDA 1RSOB 2BTQB 4CC5A 2ZNIA 1EZJA 1IBMB 4NB5A 1Q81W 1FFXB 3O9OA 4EKWA 4TUYB 2QDOA 4J10A 4J9YB 1THZA 2CTWA 2XUMA 1V54B 1MABG 4X65B 2AW9A 4JI4B 3MDSA 4IGGA 1VQOV 1LUWA 1HNWO 2ADQB 5CMUA 5H5NA 2P4KA 1FXKA 1GN2A 3G80A 4CC6A 4GKKB 1Y66A 4DR4O 2F23A 3VQYA 5EC1C 3H01A 3CE2A 1L1FA 4NTYA 4RWUA 1AVMA 3CPWU 4WCEV 4NXMB 2QWPB 4PI2A 1K7DA 2DYRB 1M93A 2A9HA 1W0JG 1D5NA 1TUBB 2N04A 5E1AC 3LUTB 1H2SB 1E1RG 3L73H 2IU3A 3JSNA 1HNXB 1IBLO 1URFA 3JAKB 1S5JA 4DO2A 5ITZA 4AILC 2EIMC 3ZRWB 1JMKC 3ZMUA 4LF6O 4JI6B 2OCCB 3KCYA 4TV9A 2DW4A 4O2BA 1K73W 4DUYB 4X9QA 1AILA 5B1OA 1IBKB 3RYFB 3NXSA 2EILC 4DR5B 1I94B 5H2FZ 3KKYA 3W7WA 5J2TA 2P5OA 3LDDA 2P7TC 1Y4MA 4JI8B 3UT5A 4MTXA 2V4DA 3JATA 4X20A 4K0KB 4KXRA 5EC2C 1D5AA 4DV0O 1P49A 2UUCB 1TAEA 3H1JH 4O4IB 4O2AB 1Q82W 1FJGB 1GK9A 2XAJA 4FM0A 3APOA 2JK5C 1JJOA 4FFBA 1NQTA 4GX2A 2RDCA 3K5LA 1GN6A 3WG7B 4DW1A 1QU7A 4U3JB 1DLBA 3DXRA 5KHGA 2ADPA 2ZE8A 1QLEC 2JIZG 3ABTA 3OTFA 2XHBA 4RUFA 2GDSA 1S72V 1N36B 1RPRA 5CBGA 4JYCA 4I5SA 2HP8A 2R70A 4UVCA 1KECA 3BRCA 3OR6C 4K35A 1CEZA 5GTIZ 3K0DA 2WLIB 1H2GA 1K97A 1ZSPA 2CH7A 5J9PC 3AG1B 5FPOA 3OAAG 1IDSA 1EN5A 1ORQC 2LQTA 3IC7A 4EFBA 3CRQA 1S0VA 3JCUZ 4JYBA 5L3DA 4YHHB 2ODMA 3X2QC 3RN4A 3ZN1A 3SYPA 2IJHA 2PZSA 4FFKA 2F4VB 1GN3A 2FB5A 1FKAO 3OTOO 1SA0B 1XUQA 1N4CA 1RP3B 2AXTZ 4UVAA 2G38A 4B7EA 4JTDB 3IGAC 2HLDG 4FPPA 4ZHQB 3ZMSA 1SQQH 1KKCA 5D5PA 1OCCB 5K1PA 4EEQA 4RO2A 5LP6C 1PV0A 1VQ5V 5LMUO 1JJ2U 1H2NA 1M9NA 3FAVB 4Z2WA 4IT5A 4OPAA 3HR0A 1OHHG 3M99B 1NTMH 2K9PA 4DW0A 2NLJC 3TXQA 3ASNC 3JCZA 3SPHA 2RN9A 4O4HB 4UV8A 2Q69A 5IE9A 5LGUA 4LFCO 4U7NA 3BPZA 3K58A 5IYZA 2BOBC 3RYCB 1ZUQA 3CCMV 1HDJA 2HVKC 4MT8A 4JAVA 2L35A 3TETA 5JCOC 2CTPA 3ETGA 1QR9A 1W59A 4NXNB 3P30A 5E79Z 5JWPA 1FYJA 5KA6A 4X1IA 1AR4A 4FM2A 1EBOA 2Y0IA 3E8HA 3CX5F 3FYEB 2QGNA 4DRXB 1T5EA 4B3TO 3STZC 1YITV 1XMOO 4JI5B 3E86A 2E75B 1F23A 4CS3A 2YIAA 4UFZA 3VOUA 4JTAB 4QPJA 4K8XA 5H9CA 1BQ0A 1K4CC 1F7YA 3M7MX 3FX7A 1UPGA 4W4KA 3UM7A 3D3QA 3E8GA 4GT1A 4JI1B 1VIBA 3A2FA 3F5TA 1PPJH 5LGTA 1KKDA 4ZIBA 1EM1A 2JS3A 2HG5C 1YI2V 4G28B 3KG2A 2PUSA 3K3WA 1PKXA 5KAFZ 2OWOA 3LSSA 1LNQA 1Q8IA 1IXMA 4GZRB 1OJHA 5IDJA 3A0BZ 2ILMA 1VEWA 3CRAA 3SJQC 4D7TA 1UJWB 4YJ2B 2UXDO 4AHCA 2CUGA 3LDCA 4X8AA 2EZPA 3OGIB 1N33B 3JAWB 1Q86W 3LDEA 3E2EA 1HNZO 1WAZA 4CH4A 5LMNB 3WB1A 2Q4PA 4DK0A 5HFMA 4I4TA 2JGDB 1NZ6A 1IXBA 1K33A 2EINB 1N0NA 3TCUA 2DYSB 4GUNA 2EIJB 3APQA 1SF9A 4GLXA 2F93B 4LWSB 3CC7V 1JFFA 1FXKC 2CK3G 2IJKA 3LNMB 4J9ZB 3HKEA 2LGWA 2UU9B 5L3FA 5L3BA 3B8MA 4ASUG 2VRZA 1K5QA 1CPYA 4DR3B 4MTGA 1XHZA 1M1KW 2L6LA 2QWRB 4LF5B 4X1YA 4R8CA 3JYCA 4J42A 2ZXWC 2QE7G 3WU2Z 1JA8A 3F5WC 2AZ0A 3HKBA 4DV2O 1TA8A 4Q6GA 1GO3F 1XDCA 5L3CA 4LF9O 4PHZA 3SPGA 2Q67A 3AG7A 3IJ4A 4B7KA 3SPCA 4ABMA 4YJ3A 5KLVH 4WFAV 1Y67A 1VQ6V 2YXHA 3B09A 1TVKB 4TV8A 4X1KB 1EFRG 5JJEB 5LOVB 3I56V 4YY3B 4PD4F 4AQYO 1AI7A 1NI8A 4CH3A 3PN1A 1BHAA 2PY5A 4WFEA 3AG4C 3QVNA 4MTFA 5HFLA 2UXNA 4WFHA 4LNUA 4KUMA 4JI0B 1Q5OA 4I55B 1CP9A 4LF8B 5LP6A 3E22B 2DQ3A 3TK1A 5LXTB 2KSDA 3OMAB 4FLVA 4PJ0Z 1OCOC 1FAFA 3NR7A 4LBEC 4I7ZB 5BZBA 3MHSC 4JF3A 4H44B 1HWYA 2WLLA 2P90A 3FYIB 2F95B 3ZHTA 4JV5O 1XREA 2QEXV 3K06A 1P7BA 4FLWA 1M57C 3DSQA 3HPLC 1XNRO 1HNWB 4NVPA 4F6EA 4WFGA 4RQFA 5JCOA 5J2UB 5L3EA 4ICGA 4IYHA 2VQEO 4TSFG 1HP8A 4LH7A 3CS5A 4DR4B 2YSUB 4DXWA 2YI8A 2GTAA 2OYQA 1PL4A 2XTAA 1J5EO 4KHPO 4O4JA 1BE3H 3ABLC 4PDLA 5GONB 5GTHZ 3GWOA 4ZOLA 2CE4A 1SZXA 4ZKIA 2LO1A 5CA0B 2MW2B 3JALB 3GWKC 2IM9A 2ZR3A 5B5EZ 5LHHA 1B06A 4DR6O 4K3AA 1NR1A 2Y0PA 1IURA 2P67A 3RYHA 3SGIA 5LYJB 1K4DC 2UXCO 1VQKV 1SQPH 1O9HA 5IYDO 4GKJB 4O4LB 2EIKC 2EX3A 2PI4A 3G67A 4LH6A 1X59A 5IJ9B 1QLEB 3AG2B 4BR6A 1W0KG 1XEQA 1B3QA 3E8BA 4IL6Z 1ENVA 1GKFA 5B3SC 4ZI7A 4LF6B 2Q9LA 1H2LA 2AHZA 2DN9A 5KUMA 4UCSA 3QTCA 4P9OA 1Z2GA 4X64O 3N2GA 3BA9A 4TOIA 4QE9A 1BSMA 4OPHA 2Z0AA 2FTKA 1H38A 4PA3A 4XDKA 3DTUB 3BA8A 5IYCO 2ZKOA 4JI7O 2YUAA 2N05A 3P32A 1HR0O 1VF5B 2XAFA 2ZNJA 3HKCB 1N32O 4FJCC 1GN4A 4KP4A 5IJ0B 5LA6B 3X2QB 4QE7A 1B6QA 1MA1A 1SQBH 4DV0B 2OIEA 4A5UB 1WP7A 3RT3C 3TGUH 1M56C 5CA3A 5KA5A 4PA7A 2H94A 2YXLA 5GW7A 2JDIG 1PNLA 1QHTA 3ZN0A 2LW1A 3JARB 1RM1C 4B08A 4CBCA 2KG7B 1NU1H 3QF7A 2RQ6A 3J7AU 2BSKA 1N34O 2VWKA 4G27B 1FFTB 4F4LA 2NNUA 4QIWF 2HHHO 4LFAO 2QM4A 5FNVA 5JVDB 1SA0A 1V9PA 3T1YO 1WPXA 1MNGA 2OT5A 3KZIZ 3CRRA 4GKJO 4JI3O 4ZBMA 1M5IA 5D5QA 2QKCA 1SZTA 2YC0A 5KAIZ 1SC5B 3K5MA 2QJ1A 2RJZA 2ZT9B 3JAMN 1SQGA 4I9QA 1WN7A 3AG3C 3H1KH 3SJCC 4GX5A 2UUAO 4PA6A 1K3EA 4WFFA 2QWOB 4C7UA 2V7QG 4U3FH 5LHGA 5EYPB 3OTOB 3ABMB 1L0NH 3MAQA 3CCLV 4EB6B 2XNDG 4O4HA 3D3IA 5C8YB 5IY5C 5EZYB 1CXZB 3ABKC 1ZWIC 3ASOC 5KMGA 1GTOA 1Y6XA 1AJPA 1PD3A 2B9ZA 3OW2U 5A2QN 2Q0OC 2GUZA 1IVSA 5LMUB 3SYCA 2FMLA 3BY6A 4IHJA 1YVWA 1Q6HA 3OR7C 4FM1A 3JSLA 4WFBV 3FKSG 1AI4A 3N2KB 5B66Z 5B1BC 4DRXA 4LFCB 5BR8O 3JD3A 3RYIB 3R66A 4R50A 3IAYA 3Q4HA 3L75H 1KU9A 1GAXA 4BW5A 2P06A 3W7UA 4JAAA 1AJNA 2EJ7A 4BIUA 1NH2D 3T4ZA 1S76D 3J81N 3K59A 1MOFA 2QSAA 1Z5VA 2KB1A 3ZS8C 3ZRSA 5DM6V 1E1QG 4DV3O 3B2EE 1R3IC 3BHPA 1WB8A 2PF4E 2ZQMA 2CTQA 4I0XB 4B3TB 3ZCCA 1XI1A 1XMOB 3BEHA 4JYAO 3UCSC 1VQPV 4JAUA 2QR4A 4JASA 2ZE7A 3K79A 2JJ2G 5EBMC 1L0LH 5CB4A 5BMVA 1YTFD 1XBLA 4YJ2A 3SYAA 4LF7O 3BAAA 1GM8A 4J7KA 2P4VA 2M7WA 3K04A 4XBFA 3K0GA 4TWKA 3SR2C 3DGEA 1ZL8A 1WA8A 4QJFB 2ZXWB 3E35A 2QWQB 4DUZO 1SQVH 5KX5A 2Y4TA 2HEPA 4OGQB 1FXVA 3F7YC 2HJFC 1K8AW 4J7JA 5LHIA 1NTKH 2ZM6O 4RUEA 3ICXA 1YEWA 1BCCH 2JJ1G 1QR8A 4H0LB 2UXXA 2UXDB 5JQGA 5CA1A 1AR1B 1WPBA 1HNZB 5ITZB 1JQ0A 2DQ0A 3FD9A 4I50A 4TV9B 4O2BB 4DR2O 4NTWA 5B1NA 2DYRC 2E3CA 2VWJA 1EN6A 3AG4B 4TQFA 1K34A 3N27A 1AI6A 2Q6AA 2Q0AA 4TT3G 5J2TB 3GVMA 1K9MW 3UT5B 5JH7A 1SETA 2R9AA 1Q90D 4X62O 1K5SA 1AI5A 3THOA 2GHYA 2B1GA 5CBFA 1HW7A 3JATB 4NTXA 2E76B 2RCVA 1WJZA 1KUQA 2VQFO 1VF6A 1Y76B 4FK5C 1KYOF 2PTMA 1O9GA 1YJ9V 1YDXA 4DV2B 3CMAV 4FFBB 4LF9B 4UCUA 4N23A 1ZAUA 1S77D 3DXRB 3I5DA 2LGQA 2P22C 2VS0A 3G71V 4Q20A 4X66O 3J80N 2JRIA 5L3GA 5DECA 1SRYA 2A7WA 4LP8A 3ABLB 4DV5O 4MS2A 4AQYB 1A32A 3AK2A 1BL8A 3K5NA 3UQ8A 3WG7C 2LFSA 1FXHA 2CH7B 2HJDA 4NYKA 2ITDC 2GBOA 3R65A 3ZMVA 3C3TA 4RQEA 1Y74A 1E79G 4KL1A 3FFQA 4QGPA 1KD1W 1VQ8V 5FLXN 4FIPC 3G6BA 3CJHA 2EIKB 3E8FA 1U97A 4JTCB 3ZRXA 4IYIA 3F7VC 3K9SA 3OMIB 4PDVA 3CCSV 1FD9A 4JV5B 2W0FC 2CAZC 2AHYA 2H3OA 2A06H 2DMXA 2IJJA 4I9WA 2OTLV 2PYLA 1KBHA 1XNRB 2YIDA 2IU0A 2ZCEA 1X4TA 2ETNA 5H6QA 4DR7O 4B3SO 4HBNA 3O65A 1VQ9V 4J7ZA 2VQEB 2X7RB 2DOSA 4WBNA 5TISZ 4F6RA 4B3MO 4DV7O 2ZR2A 3T1HO 3K5OA 4FLZA 3WB0A 1J5EB 2EULA 1G1XB 4KHPB 5H6RA 2ITCC 1YXBA 1MZFA 1YIJV 3OGCC 4J80A 1R3KC 4HNAB 4MVOA 3CWBH 1XQ8A 3AK3A 2X6AA 5IYZB 4DR6B 1AR5A 4LCUC 1GRJA 2F43G 1RSOA 4HZ3A 4LFBO 1JVMA 2BTQA 3OUSA 2JEXA 2UXCB 1BS3A 3VQWA 1XHXA 1K92A 3B40A 1FFXA 1XL4A 1H8HG 1PL0A 1NS1A 4IIJB 4TUYA 4PA9A 3C3SA 3TXSA 5IWAO 3EFFK 2Q73A 2Z5UA 4X1IB 1AB3A 3OEEG 3HKDB 1AP6A 4U7OA 1WB7A 1JPXA 3QO7A 4JGSA 1TUEB 1YHQV 1G8MA 1DGSA 1Q7YW 4X64B 2ZD9A 3OFNG 3VBBA 4K8ZA 2ZINA 1R1BA 3UKMA 5EK0A 4E2LA 2ZIOA 3SPJA 1BQZA 3K03A 3CP1A 4JI7B 1AJQA 2KG7A 2WSSG 1R6TA 1GM7A 1EZVH 1HR0B 3AEIA 1J95A 2EIMB 1N32B 2A0LA 1LR1A 2RMKB 1JOYA 2UUBO 1YCIA 1GM9A 2DWEC 2HVJC 2NN4A 2UXBO 1MZEA 2YIBD 1TUBA 3JASB 2EILB 3CEIA 4DV6O 3JAKA 1OZ0A 3B77A 2LJ2A 5F2VO 3ZIAG 3ZRWA 3CXHF 3ZEDA 3OMNB 1N34B 2LFRA 1P4RA 3BABA 2GSMB 2HHHB 4LFAB 3H1HH 3U10A 1OCRC 3T1YB 5EBWC 3T4DA 1US6A 4I4TB 1P7GA 4MVZA 1H8EG 3RYFA 2DWDC 4BW9A 1VQNV 1F4MA 3ML0A 4AI8A 3B4SA 2OIGA 1PM9A 4JI3B 5B1BB 1VF7A 2E5LO 3KCXA 1SQFA 3FB6C 1ZX3A 1F51A 1WNSA 2N74A 1AROP 1BGYH 1Q3EA 3HKEB 3JD4A 2UUAB 1R3JC 5KHKA 1SS3A 2D3OW 4JI2O 4O4IA 4O2AA 5EIBD 2K1EA 4X1YB 4DV4O 2KQXA 3DC6A 1XMQO 4B3RO 4H37A 4U3JA 3HKBB 4DV1O 1UFIA 1XNQO 1NVPB 1BZKA 2ZIMA 1N8RW 2AZ2A 3JD0A 4YJ3B 1JX9A 4XDJA 1VQ7V 1QBZA 3ZHQA 1VMGA 2YEVB 3FB8C 3OE7G 2WLIA 4TV8B 2DE0X 3VQXA 3CD6V 5CN0A 2XAQA 1W2BU 3QO5A 1MG1A 1KP2A 4I0XA 2F1MA 5BR8B 4LNUB 1NTZH 4E4EA 3CSXA 4QNHB 3I55V 4LF4O 1QNMA 2OTJV 2B1IA 2FKXA 5LP6B 4OX9O 1OV9A 2PGGA 3BVOA 3CCVV 2JGUA 2D2CB 4FLTA 2JS5A 4GX1A 4R7CA 1XILA 2F66C 1R73A 3ASNB 4YIOA 2WLLB 1VF6C 2QA4V 4DV3B 1YJNV 4ZHQA 3D36A 3JD2A 2W6IG 2YI9A 4J41A 5KHHA 4JYAB 2C2AA 1DF5A 5BXZA 2V1DA 1GH6A 2Q7HA 2YS8A 3FAVA 1OCZC 5LL6Y 1Z5WA 3ZBHA 4LF7B
chains in the Genus database with same CATH topology
2DYSB 2EIJB 5LHIA 2HKOA 4RUEA 3FB7C 2W6JG 3A0RA 3MD0A 4YXWG 3ZJZA 1WLEA 2X0LA 3CC7V 5LBQA 3T1CA 2JJ1G 1QR8A 4CZZA 1FXKC 2UXXA 2CK3G 2IJKA 2ATKC 2IW5A 3LNMB 1KP3A 4J9ZB 2Q68A 4BIZA 1AR1B 3W7TA 3CYOA 4X88A 5C93A 5L3FA 5L3BA 2Y69C 1JCHA 1YSCA 2WLJA 1BMFG 2Y48A 3ABUA 1I5XA 1K5QA 1CPYA 3B8MA 4ASUG 3W7SA 3CMEV 2R9RB 1JQ0A 2DQ0A 2QKSA 4MTGA 2WAMA 2A79B 1M1KW 4MW8A 4R8CA 3JYCA 3G6EV 4PDMA 1I5YA 5B1NA 2DYRC 2ZXWC 2QE7G 1M90W 2H8PC 1RPOA 3F5WC 3T2MA 3AG4B 3G4SV 1K34A 1AI6A 2EINC 1COWG 2Q6AA 4GX0A 5B1AB 4TT3G 2X6CA 1GO3F 2DYSC 4R6ZA 2EIJC 2ZDIC 2P6JA 3RW0A 5L3CA 1QVFU 2EJRA 3SPGA 2Q67A 3PJSK 1K9MW 3SPCA 1V55B 1SETA 1K5SA 1AI5A 3K08A 2GHYA 4WFAV 3CCJV 2B1GA 5CBFA 4P30A 1VQ6V 2IH3C 4P9PA 3RVZA 4XDLA 3CC2V 2XASA 4KFMA 2QTOA 1EFRG 1EZJA 4FK5C 4WF9V 2WLKA 3I56V 2XOKG 1YJ9V 1Q81W 1AI7A 4MW3A 1BHAA 3CMAV 4EKWA 4WFEA 3AG4C 4MTFA 5HFLA 2UXNA 4WFHA 4J9YB 3IFXA 3AG2C 5B1AC 4N23A 4KUMA 3ZMTA 1S77D 1THZA 1V54B 1MABG 1CP9A 2DQ3A 3G71V 3TK1A 1VQOV 1V55C 4Q20A 3OMAB 5CMUA 5L3GA 3CCRV 1FXKA 1SRYA 3HB3B 1OCOC 4MVQA 4LP8A 4LBEC 1Y66A 5BZBA 3MHSC 4JF3A 3ABLB 4MS2A 3H01A 5EC1C 1HWYA 1FXKB 2WLLA 1L1FA 2P90A 3CPWU 3FYIB 1QLNA 3LSQA 4Z1MG 1BL8A 2WPDG 3WG7C 2LFSA 1FXHA 2QEXV 3K06A 2ITDC 3R65A 1P7BA 4UUJC 3ZMVA 4RQEA 4WCEV 1E79G 3ETEA 1M57C 3HPLC 1KD1W 4HAMA 4PDRA 3SPIA 1VQ8V 4WFGA 1V54C 4RQFA 4FIPC 4P2ZA 3WFVA 1K7DA 2DYRB 2EIKB 5L3EA 2A9HA 3E8FA 1W0JG 4LC1A 4PELA 4TSFG 4JTCB 3ZRXA 2YSUB 4DXWA 3F7VC 3OMIB 4PDVA 1KQSU 3CCSV 5E1AC 2LP7A 3LUTB 3ABLC 2W0FC 1E1RG 2IU3A 4PDLA 2AHYA 4MSWC 2JEUA 3GWOA 4DO2A 4ZKIA 2IJJA 4I9WA 2OTLV 3GB7C 2EIMC 3ZRWB 3ZMUA 1NBMG 2ZR3A 2OCCB 5LHHA 2IU0A 5H6QA 2DW4A 2BOCC 1NR1A 1K73W 2P67A 1VQ9V 1FS0G 2X7RB 1K4DC 2Z3YA 3E83A 5B1OA 1VQKV 2ZR2A 4UXNA 1SERA 3CC4V 5IYDO 2EIKC 4L87A 2MK3A 2PI4A 3NXSA 2EILC 2XAHA 4UVBA 3STLC 3W7WA 1QLEB 3AG2B 5H6RA 2ITCC 3LDDA 1W0KG 1Y4MA 2P7TC 2X6BA 1YIJV 3OGCC 3E8BA 4FMTA 1R3KC 1ENVA 1GKFA 4MTXA 4MVOA 5B3SC 1YJWV 5DN6G 4RAIA 2X6AA 2AHZA 5KUMA 4BAYA 4LCUC 4P9OA 5EC2C 2F43G 4HZ3A 1JVMA 1OCOB 3OUSA 2JEXA 2QM8A 3ZRVA 2OCCC 1R6NA 4MVMA 4QE9A 1Q82W 1GK9A 2XAJA 1DTOA 1K92A 1XL4A 2FTKA 1H38A 4PA3A 4XDKA 1H8HG 1PL0A 2JK5C 1NQTA 3ABMC 3DTUB 4GX2A 1S3JA 5IYCO 4PA9A 3EFFK 3WG7B 2Z5UA 5IYBO 1GMGA 1DLBA 1KC8W 3P32A 3OUFA 3OEEG 1QLEC 2XAFA 4U7OA 1M57B 1ROPA 2JIZG 3ABTA 4FJCC 1JPXA 3QO7A 4JGSA 4RUFA 4KP4A 1TUEB 3X2QB 1YHQV 1S72V 4QE7A 1G8MA 1B6QA 3QO8A 1Q7YW 2ZD9A 3OFNG 1RPRA 2R9IA 3VBBA 2WLNA 3K9AA 5CBGA 4JYCA 4I5SA 3UKMA 4UVCA 1PNKA 1KECA 5EK0A 4E2LA 1M56C 3OR6C 1CEZA 5CA3A 3SPJA 3K0DA 5KA5A 1VQLV 1BHBA 5LGNA 4QPKA 4PA7A 2WLIB 2H94A 1H2GA 5GW7A 1K97A 3K03A 2JDIG 1PNLA 3CP1A 1AJQA 3ZN0A 3CCQV 2WSSG 5J9PC 1GM7A 3AG1B 3OAAG 2EBOA 1RM1C 3AEIA 4CBCA 3ETDA 1J95A 2EIMB 1ORQC 2A0LA 3IC7A 5FL7G 1JOYA 1S0VA 1OCRB 4MVUA 1GM9A 2DWEC 1FFTB 4G27B 4JYBA 2NNUA 5L3DA 4F4LA 4QIWF 1F4NA 2HVJC 3X2QC 1MSWD 5KUKA 3ZN1A 3SYPA 2IJHA 1WPXA 3FB5C 1NH2B 3JD1A 2EILB 2ZDIA 2OT5A 4MVRA 1NJIW 2B5UA 3MHHC 1SESA 4ZBMA 1SZTA 4HYOA 1DF4A 1OZ0A 2EZOA 4UVAA 3B77A 5B3SB 1G4YB 3ZIAG 3ZRWA 4JTDB 3AG3C 3IGAC 2HLDG 4FPPA 3ZMSA 3AG1C 4GX5A 3OMNB 2LFRA 1P4RA 2GSMB 1VQMV 4PA6A 1K3EA 1OCCB 4WFFA 2V7QG 1OCRC 4RO2A 5EBWC 3T4DA 1VQ5V 4MVZA 1H8EG 2WWWA 3W7XA 2DWDC 1JJ2U 1M9NA 1F4MA 5LHGA 1YTFB 1VQNV 2QM7A 3ABMB 3ML0A 1XL6A 2HR3A 3CCLV 2XNDG 5B1BB 1OHHG 3M99B 3D3IA 3ZMZA 5IY5C 2NLJC 3FB6C 3ASNC 3JCZA 1NVPD 1VQ4V 1NKDA 3RVYA 1F51A 3SPHA 3ABKC 4UV8A 2Q69A 1ZWIC 1AROP 5LGUA 3ASOC 4U7NA 3JD4A 1GTOA 1AJPA 1R6KA 1R3JC 1PD3A 3OW2U 2BOBC 2WLHA 2D3OW 3CCMV 2K1EA 1M56B 2HVKC 4MT8A 4JAVA 3SYCA 3TETA 1OCCC 4JPRA 3BY6A 3ETGA 3OR7C 1QR9A 3P30A 3B8NA 4H37A 4WFBV 3FKSG 1AI4A 5KA6A 1RM1B 1NVPB 5B1BC 1EBOA 3SYOA 3E8HA 1N8RW 3CCUV 3JD3A 3FYEB 3RBZA 3JD0A 4R50A 4MVSA 3STZC 1JX9A 1YITV 4XDJA 3SYQA 3E89A 3E86A 2YEVA 4BW5A 1F23A 1VQ7V 3W7UA 4G2KA 3VOUA 4JTAB 1QBZA 4QPJA 2IH1C 2IJIA 1AJNA 5H9CA 4BIUA 1K4CC 2YEVB 3FB8C 3OE7G 1NH2D 2WLIA 3T4ZA 3UM7A 3CD6V 1S76D 5CN0A 3E8GA 1MOFA 2XAQA 4GT1A 2HFEC 2KB1A 4OXSA 1W2BU 3QO5A 3ZRSA 1MG1A 5DM6V 1E1QG 5LGTA 1KP2A 3AG3B 1KKDA 1R3IC 4MTOA 1NR7A 2HG5C 4QNHB 2WLMA 2ZQMA 3I55V 1YI2V 2OTJV 3ZCCA 2B1IA 3BEHA 4G28B 1OCZB 1QVGU 3KG2A 1VQPV 1S5HC 3K3WA 4JAUA 1PKXA 3CCEV 4JASA 3LSSA 1LNQA 3K79A 2JJ2G 3OEHG 5EBMC 3CCVV 1IXMA 1YTFD 3SYAA 4GCZA 5IDJA 4GX1A 4R7CA 5IY5B 1GM8A 1R73A 3ASNB 3SJQC 3QNEA 1UJWB 2WLLB 3OM3B 2M7WA 3ABKB 2QA4V 3K04A 2Y69B 4XBFA 1YJNV 3K0GA 3ASOB 4TWKA 4PA4A 1PNMA 3LDCA 4X8AA 2EZPA 3D36A 3JD2A 4N21A 1Q86W 2W6IG 3LDEA 3E2EA 3DGEA 4H33A 3EHBB 2PI5A 3CXCU 2C2AA 1DF5A 4QJFB 2ZXWB 5EBLC 5CBHA 5HFMA 2V1DA 1QCEA 3E35A 1R3LC 4UV9A 4X89A 2XAGA 1K33A 2EINB 1OCZC 3F7YC 1K8AW 1FXVA 2HJFC 3TCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL8 A;  4RUE A;  3FB7 C;  4RUF A;  2K1E A;  3ZJZ A;  3WG7 C;  4QE7 A;  2HVK C;  3SYC A;  3TET A;  3T1C A;  3K06 A;  2ITD C;  2ZD9 A;  1OCC C;  1P7B A;  3R65 A;  4UUJ C;  5CBG A;  2WLN A;  2ATK C;  3LNM B;  4J9Z B;  3UKM A;  3OR7 C;  1M57 C;  2Q68 A;  3HPL C;  4X88 A;  5EK0 A;  4PDR A;  4H37 A;  3SPI A;  1M56 C;  1V54 C;  3OR6 C;  4WFG A;  2Y69 C;  4P2Z A;  2WLJ A;  3K0D A;  3SPJ A;  2A9H A;  3E8F A;  4PA7 A;  5B1B C;  2R9R B;  2WLI B;  2QKS A;  3SYO A;  4JTC B;  4MTG A;  3E8H A;  3K03 A;  2A79 B;  4DXW A;  3F7V C;  4MW8 A;  3RBZ A;  4PDV A;  5J9P C;  4R8C A;  3JYC A;  4R50 A;  4MVS A;  4PDM A;  3STZ C;  5E1A C;  2DYR C;  2ZXW C;  4XDJ A;  3E89 A;  1J95 A;  3LUT B;  3SYQ A;  4CBC A;  1ORQ C;  3E86 A;  2A0L A;  2H8P C;  2YEV A;  3ABL C;  2W0F C;  3F5W C;  3T2M A;  4BW5 A;  3VOU A;  2EIN C;  4JTA B;  2AHY A;  2Q6A A;  4PDL A;  4GX0 A;  4MSW C;  4MVU A;  2DWE C;  2IH1 C;  2X6C A;  4G27 B;  2DYS C;  4R6Z A;  1K4C C;  2EIJ C;  3FB8 C;  4I9W A;  3RW0 A;  4F4L A;  2HVJ C;  3GB7 C;  2WLI A;  3SPG A;  3T4Z A;  2Q67 A;  2EIM C;  3UM7 A;  3X2Q C;  3PJS K;  3E8G A;  5KUK A;  3SYP A;  3FB5 C;  3SPC A;  2HFE C;  2KB1 A;  4OXS A;  2BOC C;  3ZRS A;  4MVR A;  1K4D C;  3E83 A;  1KKD A;  1R3I C;  3K08 A;  4ZBM A;  4MTO A;  5CBF A;  4P30 A;  2EIK C;  4HYO A;  2HG5 C;  2IH3 C;  2WLM A;  4P9P A;  3RVZ A;  4QNH B;  2EIL C;  4XDL A;  3BEH A;  1G4Y B;  4G28 B;  4KFM A;  2QTO A;  3STL C;  4JTD B;  3KG2 A;  3AG3 C;  3IGA C;  1S5H C;  2WLK A;  2ITC C;  3LDD A;  2P7T C;  3AG1 C;  4GX5 A;  2X6B A;  1LNQ A;  3OGC C;  3E8B A;  4MW3 A;  5EBM C;  4PA6 A;  1R3K C;  4EKW A;  4WFE A;  3AG4 C;  4WFF A;  5B3S C;  4MVO A;  4MTF A;  3SYA A;  4GX1 A;  4R7C A;  4WFH A;  4RO2 A;  1OCR C;  3IFX A;  4J9Y B;  3AG2 C;  5EBW C;  4RAI A;  2X6A A;  2AHZ A;  5B1A C;  3T4D A;  5KUM A;  3SJQ C;  4LCU C;  4MVZ A;  4P9O A;  5EC2 C;  2DWD C;  2WLL B;  4HZ3 A;  1JVM A;  3K04 A;  1XL6 A;  3OUS A;  3K0G A;  2OCC C;  4TWK A;  4PA4 A;  4MVM A;  3LDC A;  4QE9 A;  4X8A A;  1V55 C;  5IY5 C;  2NLJ C;  3FB6 C;  1XL4 A;  3ASN C;  3LDE A;  4PA3 A;  4XDK A;  3RVY A;  4H33 A;  3SPH A;  2JK5 C;  3ABK C;  4GX2 A;  3ABM C;  1OCO C;  2Q69 A;  4MVQ A;  1ZWI C;  4PA9 A;  3ASO C;  3EFF K;  4LBE C;  4LP8 A;  5EBL C;  5CBH A;  5BZB A;  1R3L C;  4MS2 A;  4X89 A;  5EC1 C;  1R3J C;  2WLL A;  2BOB C;  3OUF A;  1OCZ C;  2WLH A;  3F7Y C;  2HJF C;  1QLE C;  3TCU A; 
#chains in the Genus database with same CATH topology
 2IBZ H;  3L70 H;  3A0R A;  3MD0 A;  4YXW G;  1WLE A;  5KHJ A;  1Q43 A;  1YF2 A;  4DR1 O;  2IW5 A;  4O4J B;  2Q68 A;  4BIZ A;  3W7T A;  4FLY A;  1DK1 A;  5C93 A;  1NT2 B;  2Y69 C;  4ZOL B;  2WLJ A;  2Y48 A;  1BMF G;  2BTO A;  3L74 H;  1I5X A;  3RYC A;  4DUZ B;  3G6E V;  1I5Y A;  3RYH B;  1I0H A;  2ZM6 B;  1RPO A;  3T2M A;  1XOU A;  1Q6I A;  3CRC A;  1IBM O;  1QQC A;  3A0H Z;  4R6Z A;  2ZDI C;  2P6J A;  1QVF U;  2EJR A;  3RWR D;  1FPO A;  2DJV A;  4X65 O;  4DYL A;  4ZI7 B;  3K08 A;  4JI4 O;  5DED A;  2ZE5 A;  1Y76 A;  1I08 A;  4DR2 B;  1H2K A;  2CTR A;  2IH3 C;  3N2G B;  4XDL A;  2XAS A;  3CC2 V;  1SKV A;  4KFM A;  2QTO A;  4GKK O;  4WF9 V;  2WLK A;  2XOK G;  3SJA C;  3P3N A;  4MW3 A;  4UCT A;  1D2D A;  3IFX A;  3AG2 C;  5B1A C;  3ZMT A;  4X62 B;  4NXM O;  3P3P A;  1V55 C;  4L8J A;  2BE3 A;  3UO3 A;  2VQF B;  2Q7G A;  3CCR V;  3HB3 B;  2CDY A;  4MVQ A;  3UO2 A;  3SJB C;  1FXK B;  3QG5 A;  1QLN A;  3LSQ A;  4Z1V A;  4Z1M G;  2WPD G;  3AK1 A;  3JAW A;  1HNX O;  4UUJ C;  3U11 A;  5KHI A;  3ETE A;  3ZHR A;  4JI6 O;  2JGD A;  4HAM A;  4PDR A;  4CS4 A;  3SPI A;  2BSK B;  1V54 C;  4X66 B;  4P2Z A;  3WFV A;  4DUY O;  4LC1 A;  4PEL A;  2GTS A;  5FNV B;  4DV5 B;  4LWS A;  2YDE A;  1IBK O;  1KQS U;  3H1L H;  3ZX6 A;  4DK1 A;  3ETQ A;  2LP7 A;  4DR5 O;  3OD4 A;  1VAR A;  1H2M A;  1WP8 A;  1I94 O;  4JI8 O;  4MSW C;  2JEU A;  3GB7 C;  1N0J A;  4UCO A;  3U0Z A;  1NBM G;  4FVM A;  4LR3 A;  4K0K O;  2BOC C;  2NR5 A;  2UUC O;  1FS0 G;  4JZ2 A;  2Z3Y A;  3E83 A;  4YIP A;  1SER A;  4UXN A;  3C90 A;  3CC4 V;  1FJG O;  4L87 A;  2MK3 A;  2XAH A;  4UVB A;  3STL C;  4JZG A;  4HNA A;  1EN4 A;  2X6B A;  4BIO A;  4UCR A;  4FMT A;  1P84 F;  1YJW V;  1JR9 A;  5DN6 G;  4RAI A;  1SQX H;  5KMG B;  4BAY A;  4DR7 B;  1N36 O;  4B3S B;  1OCO B;  4UB6 Z;  1TVK A;  4B3M B;  2KKW A;  2QM8 A;  2ARH A;  2OCC C;  1R6N A;  4X1K A;  4X20 B;  3ZRV A;  4MVM A;  3L9D A;  5LOV A;  4DV7 B;  2GUZ B;  4IIJ A;  2QTS A;  3T1H B;  1DTO A;  1LUV A;  1RFY A;  4IHJ B;  3ABM C;  1S3J A;  2PYJ A;  3HKD A;  5IYB O;  1GMG A;  4I55 A;  1KC8 W;  5FPR A;  3OUF A;  1AP5 A;  2QWN B;  1M57 B;  1ROP A;  1I7F A;  3E22 A;  5LXT A;  3K57 A;  3VQV A;  3QO8 A;  2OCH A;  4LFB B;  2R9I A;  2WLN A;  3K9A A;  3LNN A;  3Q4H B;  4YHH O;  1PNK A;  2F4V O;  1BT8 A;  1VQL V;  1BHB A;  5LGN A;  4QPK A;  2YXY A;  5IWA B;  4D6T H;  4J11 A;  3CCQ V;  2ZE6 A;  3M8A A;  2E74 B;  2EBO A;  3ETD A;  5K1X A;  2CGO A;  2JVD A;  5FL7 G;  1OCR B;  5J2U A;  4MVU A;  3JAS A;  1F4N A;  2Y4U A;  1MSW D;  5KUK A;  5EIB C;  3FB5 C;  1NH2 B;  3JD1 A;  2ZDI A;  3L71 H;  4MVR A;  1NJI W;  2B5U A;  1G6U A;  1Q6U A;  3MHH C;  5CB4 B;  5BMV B;  2W0X A;  1SES A;  2RNB A;  5GON A;  4HYO A;  1DF4 A;  4FZ1 A;  1ZLZ A;  2EZO A;  5CA0 A;  5B3S B;  3JAL A;  1G4Y B;  2A3Q A;  4GYC B;  3TJT A;  3AG1 C;  1TGO A;  2UUB B;  2M6Y A;  1VQM V;  3EXA A;  5LYJ A;  4CS2 A;  3L72 H;  1ZL8 B;  1WA8 B;  3CHX A;  4CH5 A;  2UXB B;  4O4L A;  3W7X A;  1YTF B;  2WWW A;  2O57 A;  5KX5 B;  2QM7 A;  3BCC H;  3RFR A;  1B04 A;  1XL6 A;  1PP9 H;  2HR3 A;  3RGB A;  5IJ9 A;  4DV6 B;  4NXN O;  1YZB A;  3ZMZ A;  2Q8V A;  1NVP D;  1VQ4 V;  1NKD A;  3A8T A;  3RVY A;  5JQG B;  2GV9 A;  1U96 A;  5CA1 B;  1R6K A;  5JJJ B;  2XT9 A;  2WLH A;  3D36 C;  4JI5 O;  1VP7 A;  1M56 B;  4I50 B;  4FLX A;  1OCC C;  4JPR A;  3OT7 A;  3EVK A;  3B8N A;  2E5L B;  2BCC H;  4JI1 O;  3LSU A;  5A9G A;  1KMI Z;  1RM1 B;  1L8D A;  3HKC A;  3SYO A;  5IJ0 A;  5LA6 A;  3CCU V;  3RBZ A;  1ZTE A;  4MVS A;  5JH7 B;  4JI2 B;  3SYQ A;  3E89 A;  2YEV A;  3ZHU A;  1MMM A;  4G2K A;  4DV4 B;  4NR1 A;  2IH1 C;  2IJI A;  3S3X A;  1XMQ B;  4B3R B;  3JAR A;  3CRM A;  2HFE C;  4DV1 B;  5AG2 A;  4OXS A;  1XNQ B;  3AG3 B;  4MTO A;  1N33 O;  1NR7 A;  2WLM A;  5LMN O;  1OCZ B;  1QVG U;  1S5H C;  5JVD A;  4CH6 A;  3CCE V;  1M4U A;  3DC5 A;  3OEH G;  1KB9 F;  4PV1 B;  4GCZ A;  5IY5 B;  4FLU A;  3CB2 A;  3QNE A;  3WB2 A;  3OM3 B;  3ABK B;  2Y69 B;  4H13 B;  2AGA A;  3ASO B;  4PA4 A;  1PNM A;  3S3W A;  2Q7E A;  2UU9 O;  4N21 A;  4LF4 B;  4EFE A;  4H33 A;  3EHB B;  4D7S A;  1Y74 B;  4JYY A;  2PI5 A;  2FYU H;  3CXC U;  4UCV A;  4DR3 O;  3ZHS A;  5EBL C;  5CBH A;  4OX9 B;  2CGN A;  1QCE A;  2QKA A;  4UV9 A;  4X89 A;  1R3L C;  2XAG A;  4LF5 O;  2YIB A;  5EYP A;  3CJH B;  4EB6 A;  2HKO A;  5JJN B;  3FB7 C;  2W6J G;  3ZJZ A;  5C8Y A;  2X0L A;  5EZY A;  5LBQ A;  3T1C A;  4CZZ A;  4FZ0 A;  2LW7 A;  2ATK C;  4BWA A;  1KP3 A;  2WA4 A;  2R72 A;  3CYO A;  4X88 A;  1IX9 A;  1JFF B;  3SDL A;  1JCH A;  1YSC A;  3ABU A;  5BY1 A;  3W7S A;  3H1I H;  3CME V;  4W4L A;  2R9R B;  3D8C A;  2QKS A;  2WAM A;  2A79 B;  4MW8 A;  2Q5Z A;  3ZHV A;  3BFR A;  4PDM A;  1M90 W;  4WBN B;  1S5L Z;  2H8P C;  4F6R B;  3G4S V;  2EIN C;  4PI0 A;  1COW G;  4YY3 O;  4GX0 A;  3N2K A;  5IT9 N;  5B1A B;  2X6C A;  1IBL B;  2DYS C;  4DR1 B;  2EIJ C;  4NKG B;  3RW0 A;  3PJS K;  3RYI A;  4UB8 Z;  4JI0 O;  1V55 B;  2WA3 A;  3H9V A;  4TQD A;  3IC9 A;  2FL4 A;  2YIC A;  4LF8 O;  3CCJ V;  1IZ3 A;  4P30 A;  4P9P A;  3RVZ A;  1MSD A;  1RSO B;  2BTQ B;  4CC5 A;  2ZNI A;  1EZJ A;  1IBM B;  4NB5 A;  1Q81 W;  1FFX B;  3O9O A;  4EKW A;  4TUY B;  2QDO A;  4J10 A;  4J9Y B;  1THZ A;  2CTW A;  2XUM A;  1V54 B;  1MAB G;  4X65 B;  2AW9 A;  4JI4 B;  3MDS A;  4IGG A;  1VQO V;  1LUW A;  1HNW O;  2ADQ B;  5CMU A;  5H5N A;  2P4K A;  1FXK A;  1GN2 A;  3G80 A;  4CC6 A;  4GKK B;  1Y66 A;  4DR4 O;  2F23 A;  3VQY A;  5EC1 C;  3H01 A;  3CE2 A;  1L1F A;  4NTY A;  4RWU A;  1AVM A;  3CPW U;  4WCE V;  4NXM B;  2QWP B;  4PI2 A;  1K7D A;  2DYR B;  1M93 A;  2A9H A;  1W0J G;  1D5N A;  1TUB B;  2N04 A;  5E1A C;  3LUT B;  1H2S B;  1E1R G;  3L73 H;  2IU3 A;  3JSN A;  1HNX B;  1IBL O;  1URF A;  3JAK B;  1S5J A;  4DO2 A;  5ITZ A;  4AIL C;  2EIM C;  3ZRW B;  1JMK C;  3ZMU A;  4LF6 O;  4JI6 B;  2OCC B;  3KCY A;  4TV9 A;  2DW4 A;  4O2B A;  1K73 W;  4DUY B;  4X9Q A;  1AIL A;  5B1O A;  1IBK B;  3RYF B;  3NXS A;  2EIL C;  4DR5 B;  1I94 B;  5H2F Z;  3KKY A;  3W7W A;  5J2T A;  2P5O A;  3LDD A;  2P7T C;  1Y4M A;  4JI8 B;  3UT5 A;  4MTX A;  2V4D A;  3JAT A;  4X20 A;  4K0K B;  4KXR A;  5EC2 C;  1D5A A;  4DV0 O;  1P49 A;  2UUC B;  1TAE A;  3H1J H;  4O4I B;  4O2A B;  1Q82 W;  1FJG B;  1GK9 A;  2XAJ A;  4FM0 A;  3APO A;  2JK5 C;  1JJO A;  4FFB A;  1NQT A;  4GX2 A;  2RDC A;  3K5L A;  1GN6 A;  3WG7 B;  4DW1 A;  1QU7 A;  4U3J B;  1DLB A;  3DXR A;  5KHG A;  2ADP A;  2ZE8 A;  1QLE C;  2JIZ G;  3ABT A;  3OTF A;  2XHB A;  4RUF A;  2GDS A;  1S72 V;  1N36 B;  1RPR A;  5CBG A;  4JYC A;  4I5S A;  2HP8 A;  2R70 A;  4UVC A;  1KEC A;  3BRC A;  3OR6 C;  4K35 A;  1CEZ A;  5GTI Z;  3K0D A;  2WLI B;  1H2G A;  1K97 A;  1ZSP A;  2CH7 A;  5J9P C;  3AG1 B;  5FPO A;  3OAA G;  1IDS A;  1EN5 A;  1ORQ C;  2LQT A;  3IC7 A;  4EFB A;  3CRQ A;  1S0V A;  3JCU Z;  4JYB A;  5L3D A;  4YHH B;  2ODM A;  3X2Q C;  3RN4 A;  3ZN1 A;  3SYP A;  2IJH A;  2PZS A;  4FFK A;  2F4V B;  1GN3 A;  2FB5 A;  1FKA O;  3OTO O;  1SA0 B;  1XUQ A;  1N4C A;  1RP3 B;  2AXT Z;  4UVA A;  2G38 A;  4B7E A;  4JTD B;  3IGA C;  2HLD G;  4FPP A;  4ZHQ B;  3ZMS A;  1SQQ H;  1KKC A;  5D5P A;  1OCC B;  5K1P A;  4EEQ A;  4RO2 A;  5LP6 C;  1PV0 A;  1VQ5 V;  5LMU O;  1JJ2 U;  1H2N A;  1M9N A;  3FAV B;  4Z2W A;  4IT5 A;  4OPA A;  3HR0 A;  1OHH G;  3M99 B;  1NTM H;  2K9P A;  4DW0 A;  2NLJ C;  3TXQ A;  3ASN C;  3JCZ A;  3SPH A;  2RN9 A;  4O4H B;  4UV8 A;  2Q69 A;  5IE9 A;  5LGU A;  4LFC O;  4U7N A;  3BPZ A;  3K58 A;  5IYZ A;  2BOB C;  3RYC B;  1ZUQ A;  3CCM V;  1HDJ A;  2HVK C;  4MT8 A;  4JAV A;  2L35 A;  3TET A;  5JCO C;  2CTP A;  3ETG A;  1QR9 A;  1W59 A;  4NXN B;  3P30 A;  5E79 Z;  5JWP A;  1FYJ A;  5KA6 A;  4X1I A;  1AR4 A;  4FM2 A;  1EBO A;  2Y0I A;  3E8H A;  3CX5 F;  3FYE B;  2QGN A;  4DRX B;  1T5E A;  4B3T O;  3STZ C;  1YIT V;  1XMO O;  4JI5 B;  3E86 A;  2E75 B;  1F23 A;  4CS3 A;  2YIA A;  4UFZ A;  3VOU A;  4JTA B;  4QPJ A;  4K8X A;  5H9C A;  1BQ0 A;  1K4C C;  1F7Y A;  3M7M X;  3FX7 A;  1UPG A;  4W4K A;  3UM7 A;  3D3Q A;  3E8G A;  4GT1 A;  4JI1 B;  1VIB A;  3A2F A;  3F5T A;  1PPJ H;  5LGT A;  1KKD A;  4ZIB A;  1EM1 A;  2JS3 A;  2HG5 C;  1YI2 V;  4G28 B;  3KG2 A;  2PUS A;  3K3W A;  1PKX A;  5KAF Z;  2OWO A;  3LSS A;  1LNQ A;  1Q8I A;  1IXM A;  4GZR B;  1OJH A;  5IDJ A;  3A0B Z;  2ILM A;  1VEW A;  3CRA A;  3SJQ C;  4D7T A;  1UJW B;  4YJ2 B;  2UXD O;  4AHC A;  2CUG A;  3LDC A;  4X8A A;  2EZP A;  3OGI B;  1N33 B;  3JAW B;  1Q86 W;  3LDE A;  3E2E A;  1HNZ O;  1WAZ A;  4CH4 A;  5LMN B;  3WB1 A;  2Q4P A;  4DK0 A;  5HFM A;  4I4T A;  2JGD B;  1NZ6 A;  1IXB A;  1K33 A;  2EIN B;  1N0N A;  3TCU A;  2DYS B;  4GUN A;  2EIJ B;  3APQ A;  1SF9 A;  4GLX A;  2F93 B;  4LWS B;  3CC7 V;  1JFF A;  1FXK C;  2CK3 G;  2IJK A;  3LNM B;  4J9Z B;  3HKE A;  2LGW A;  2UU9 B;  5L3F A;  5L3B A;  3B8M A;  4ASU G;  2VRZ A;  1K5Q A;  1CPY A;  4DR3 B;  4MTG A;  1XHZ A;  1M1K W;  2L6L A;  2QWR B;  4LF5 B;  4X1Y A;  4R8C A;  3JYC A;  4J42 A;  2ZXW C;  2QE7 G;  3WU2 Z;  1JA8 A;  3F5W C;  2AZ0 A;  3HKB A;  4DV2 O;  1TA8 A;  4Q6G A;  1GO3 F;  1XDC A;  5L3C A;  4LF9 O;  4PHZ A;  3SPG A;  2Q67 A;  3AG7 A;  3IJ4 A;  4B7K A;  3SPC A;  4ABM A;  4YJ3 A;  5KLV H;  4WFA V;  1Y67 A;  1VQ6 V;  2YXH A;  3B09 A;  1TVK B;  4TV8 A;  4X1K B;  1EFR G;  5JJE B;  5LOV B;  3I56 V;  4YY3 B;  4PD4 F;  4AQY O;  1AI7 A;  1NI8 A;  4CH3 A;  3PN1 A;  1BHA A;  2PY5 A;  4WFE A;  3AG4 C;  3QVN A;  4MTF A;  5HFL A;  2UXN A;  4WFH A;  4LNU A;  4KUM A;  4JI0 B;  1Q5O A;  4I55 B;  1CP9 A;  4LF8 B;  5LP6 A;  3E22 B;  2DQ3 A;  3TK1 A;  5LXT B;  2KSD A;  3OMA B;  4FLV A;  4PJ0 Z;  1OCO C;  1FAF A;  3NR7 A;  4LBE C;  4I7Z B;  5BZB A;  3MHS C;  4JF3 A;  4H44 B;  1HWY A;  2WLL A;  2P90 A;  3FYI B;  2F95 B;  3ZHT A;  4JV5 O;  1XRE A;  2QEX V;  3K06 A;  1P7B A;  4FLW A;  1M57 C;  3DSQ A;  3HPL C;  1XNR O;  1HNW B;  4NVP A;  4F6E A;  4WFG A;  4RQF A;  5JCO A;  5J2U B;  5L3E A;  4ICG A;  4IYH A;  2VQE O;  4TSF G;  1HP8 A;  4LH7 A;  3CS5 A;  4DR4 B;  2YSU B;  4DXW A;  2YI8 A;  2GTA A;  2OYQ A;  1PL4 A;  2XTA A;  1J5E O;  4KHP O;  4O4J A;  1BE3 H;  3ABL C;  4PDL A;  5GON B;  5GTH Z;  3GWO A;  4ZOL A;  2CE4 A;  1SZX A;  4ZKI A;  2LO1 A;  5CA0 B;  2MW2 B;  3JAL B;  3GWK C;  2IM9 A;  2ZR3 A;  5B5E Z;  5LHH A;  1B06 A;  4DR6 O;  4K3A A;  1NR1 A;  2Y0P A;  1IUR A;  2P67 A;  3RYH A;  3SGI A;  5LYJ B;  1K4D C;  2UXC O;  1VQK V;  1SQP H;  1O9H A;  5IYD O;  4GKJ B;  4O4L B;  2EIK C;  2EX3 A;  2PI4 A;  3G67 A;  4LH6 A;  1X59 A;  5IJ9 B;  1QLE B;  3AG2 B;  4BR6 A;  1W0K G;  1XEQ A;  1B3Q A;  3E8B A;  4IL6 Z;  1ENV A;  1GKF A;  5B3S C;  4ZI7 A;  4LF6 B;  2Q9L A;  1H2L A;  2AHZ A;  2DN9 A;  5KUM A;  4UCS A;  3QTC A;  4P9O A;  1Z2G A;  4X64 O;  3N2G A;  3BA9 A;  4TOI A;  4QE9 A;  1BSM A;  4OPH A;  2Z0A A;  2FTK A;  1H38 A;  4PA3 A;  4XDK A;  3DTU B;  3BA8 A;  5IYC O;  2ZKO A;  4JI7 O;  2YUA A;  2N05 A;  3P32 A;  1HR0 O;  1VF5 B;  2XAF A;  2ZNJ A;  3HKC B;  1N32 O;  4FJC C;  1GN4 A;  4KP4 A;  5IJ0 B;  5LA6 B;  3X2Q B;  4QE7 A;  1B6Q A;  1MA1 A;  1SQB H;  4DV0 B;  2OIE A;  4A5U B;  1WP7 A;  3RT3 C;  3TGU H;  1M56 C;  5CA3 A;  5KA5 A;  4PA7 A;  2H94 A;  2YXL A;  5GW7 A;  2JDI G;  1PNL A;  1QHT A;  3ZN0 A;  2LW1 A;  3JAR B;  1RM1 C;  4B08 A;  4CBC A;  2KG7 B;  1NU1 H;  3QF7 A;  2RQ6 A;  3J7A U;  2BSK A;  1N34 O;  2VWK A;  4G27 B;  1FFT B;  4F4L A;  2NNU A;  4QIW F;  2HHH O;  4LFA O;  2QM4 A;  5FNV A;  5JVD B;  1SA0 A;  1V9P A;  3T1Y O;  1WPX A;  1MNG A;  2OT5 A;  3KZI Z;  3CRR A;  4GKJ O;  4JI3 O;  4ZBM A;  1M5I A;  5D5Q A;  2QKC A;  1SZT A;  2YC0 A;  5KAI Z;  1SC5 B;  3K5M A;  2QJ1 A;  2RJZ A;  2ZT9 B;  3JAM N;  1SQG A;  4I9Q A;  1WN7 A;  3AG3 C;  3H1K H;  3SJC C;  4GX5 A;  2UUA O;  4PA6 A;  1K3E A;  4WFF A;  2QWO B;  4C7U A;  2V7Q G;  4U3F H;  5LHG A;  5EYP B;  3OTO B;  3ABM B;  1L0N H;  3MAQ A;  3CCL V;  4EB6 B;  2XND G;  4O4H A;  3D3I A;  5C8Y B;  5IY5 C;  5EZY B;  1CXZ B;  3ABK C;  1ZWI C;  3ASO C;  5KMG A;  1GTO A;  1Y6X A;  1AJP A;  1PD3 A;  2B9Z A;  3OW2 U;  5A2Q N;  2Q0O C;  2GUZ A;  1IVS A;  5LMU B;  3SYC A;  2FML A;  3BY6 A;  4IHJ A;  1YVW A;  1Q6H A;  3OR7 C;  4FM1 A;  3JSL A;  4WFB V;  3FKS G;  1AI4 A;  3N2K B;  5B66 Z;  5B1B C;  4DRX A;  4LFC B;  5BR8 O;  3JD3 A;  3RYI B;  3R66 A;  4R50 A;  3IAY A;  3Q4H A;  3L75 H;  1KU9 A;  1GAX A;  4BW5 A;  2P06 A;  3W7U A;  4JAA A;  1AJN A;  2EJ7 A;  4BIU A;  1NH2 D;  3T4Z A;  1S76 D;  3J81 N;  3K59 A;  1MOF A;  2QSA A;  1Z5V A;  2KB1 A;  3ZS8 C;  3ZRS A;  5DM6 V;  1E1Q G;  4DV3 O;  3B2E E;  1R3I C;  3BHP A;  1WB8 A;  2PF4 E;  2ZQM A;  2CTQ A;  4I0X B;  4B3T B;  3ZCC A;  1XI1 A;  1XMO B;  3BEH A;  4JYA O;  3UCS C;  1VQP V;  4JAU A;  2QR4 A;  4JAS A;  2ZE7 A;  3K79 A;  2JJ2 G;  5EBM C;  1L0L H;  5CB4 A;  5BMV A;  1YTF D;  1XBL A;  4YJ2 A;  3SYA A;  4LF7 O;  3BAA A;  1GM8 A;  4J7K A;  2P4V A;  2M7W A;  3K04 A;  4XBF A;  3K0G A;  4TWK A;  3SR2 C;  3DGE A;  1ZL8 A;  1WA8 A;  4QJF B;  2ZXW B;  3E35 A;  2QWQ B;  4DUZ O;  1SQV H;  5KX5 A;  2Y4T A;  2HEP A;  4OGQ B;  1FXV A;  3F7Y C;  2HJF C;  1K8A W;  4J7J A;  5LHI A;  1NTK H;  2ZM6 O;  4RUE A;  3ICX A;  1YEW A;  1BCC H;  2JJ1 G;  1QR8 A;  4H0L B;  2UXX A;  2UXD B;  5JQG A;  5CA1 A;  1AR1 B;  1WPB A;  1HNZ B;  5ITZ B;  1JQ0 A;  2DQ0 A;  3FD9 A;  4I50 A;  4TV9 B;  4O2B B;  4DR2 O;  4NTW A;  5B1N A;  2DYR C;  2E3C A;  2VWJ A;  1EN6 A;  3AG4 B;  4TQF A;  1K34 A;  3N27 A;  1AI6 A;  2Q6A A;  2Q0A A;  4TT3 G;  5J2T B;  3GVM A;  1K9M W;  3UT5 B;  5JH7 A;  1SET A;  2R9A A;  1Q90 D;  4X62 O;  1K5S A;  1AI5 A;  3THO A;  2GHY A;  2B1G A;  5CBF A;  1HW7 A;  3JAT B;  4NTX A;  2E76 B;  2RCV A;  1WJZ A;  1KUQ A;  2VQF O;  1VF6 A;  1Y76 B;  4FK5 C;  1KYO F;  2PTM A;  1O9G A;  1YJ9 V;  1YDX A;  4DV2 B;  3CMA V;  4FFB B;  4LF9 B;  4UCU A;  4N23 A;  1ZAU A;  1S77 D;  3DXR B;  3I5D A;  2LGQ A;  2P22 C;  2VS0 A;  3G71 V;  4Q20 A;  4X66 O;  3J80 N;  2JRI A;  5L3G A;  5DEC A;  1SRY A;  2A7W A;  4LP8 A;  3ABL B;  4DV5 O;  4MS2 A;  4AQY B;  1A32 A;  3AK2 A;  1BL8 A;  3K5N A;  3UQ8 A;  3WG7 C;  2LFS A;  1FXH A;  2CH7 B;  2HJD A;  4NYK A;  2ITD C;  2GBO A;  3R65 A;  3ZMV A;  3C3T A;  4RQE A;  1Y74 A;  1E79 G;  4KL1 A;  3FFQ A;  4QGP A;  1KD1 W;  1VQ8 V;  5FLX N;  4FIP C;  3G6B A;  3CJH A;  2EIK B;  3E8F A;  1U97 A;  4JTC B;  3ZRX A;  4IYI A;  3F7V C;  3K9S A;  3OMI B;  4PDV A;  3CCS V;  1FD9 A;  4JV5 B;  2W0F C;  2CAZ C;  2AHY A;  2H3O A;  2A06 H;  2DMX A;  2IJJ A;  4I9W A;  2OTL V;  2PYL A;  1KBH A;  1XNR B;  2YID A;  2IU0 A;  2ZCE A;  1X4T A;  2ETN A;  5H6Q A;  4DR7 O;  4B3S O;  4HBN A;  3O65 A;  1VQ9 V;  4J7Z A;  2VQE B;  2X7R B;  2DOS A;  4WBN A;  5TIS Z;  4F6R A;  4B3M O;  4DV7 O;  2ZR2 A;  3T1H O;  3K5O A;  4FLZ A;  3WB0 A;  1J5E B;  2EUL A;  1G1X B;  4KHP B;  5H6R A;  2ITC C;  1YXB A;  1MZF A;  1YIJ V;  3OGC C;  4J80 A;  1R3K C;  4HNA B;  4MVO A;  3CWB H;  1XQ8 A;  3AK3 A;  2X6A A;  5IYZ B;  4DR6 B;  1AR5 A;  4LCU C;  1GRJ A;  2F43 G;  1RSO A;  4HZ3 A;  4LFB O;  1JVM A;  2BTQ A;  3OUS A;  2JEX A;  2UXC B;  1BS3 A;  3VQW A;  1XHX A;  1K92 A;  3B40 A;  1FFX A;  1XL4 A;  1H8H G;  1PL0 A;  1NS1 A;  4IIJ B;  4TUY A;  4PA9 A;  3C3S A;  3TXS A;  5IWA O;  3EFF K;  2Q73 A;  2Z5U A;  4X1I B;  1AB3 A;  3OEE G;  3HKD B;  1AP6 A;  4U7O A;  1WB7 A;  1JPX A;  3QO7 A;  4JGS A;  1TUE B;  1YHQ V;  1G8M A;  1DGS A;  1Q7Y W;  4X64 B;  2ZD9 A;  3OFN G;  3VBB A;  4K8Z A;  2ZIN A;  1R1B A;  3UKM A;  5EK0 A;  4E2L A;  2ZIO A;  3SPJ A;  1BQZ A;  3K03 A;  3CP1 A;  4JI7 B;  1AJQ A;  2KG7 A;  2WSS G;  1R6T A;  1GM7 A;  1EZV H;  1HR0 B;  3AEI A;  1J95 A;  2EIM B;  1N32 B;  2A0L A;  1LR1 A;  2RMK B;  1JOY A;  2UUB O;  1YCI A;  1GM9 A;  2DWE C;  2HVJ C;  2NN4 A;  2UXB O;  1MZE A;  2YIB D;  1TUB A;  3JAS B;  2EIL B;  3CEI A;  4DV6 O;  3JAK A;  1OZ0 A;  3B77 A;  2LJ2 A;  5F2V O;  3ZIA G;  3ZRW A;  3CXH F;  3ZED A;  3OMN B;  1N34 B;  2LFR A;  1P4R A;  3BAB A;  2GSM B;  2HHH B;  4LFA B;  3H1H H;  3U10 A;  1OCR C;  3T1Y B;  5EBW C;  3T4D A;  1US6 A;  4I4T B;  1P7G A;  4MVZ A;  1H8E G;  3RYF A;  2DWD C;  4BW9 A;  1VQN V;  1F4M A;  3ML0 A;  4AI8 A;  3B4S A;  2OIG A;  1PM9 A;  4JI3 B;  5B1B B;  1VF7 A;  2E5L O;  3KCX A;  1SQF A;  3FB6 C;  1ZX3 A;  1F51 A;  1WNS A;  2N74 A;  1ARO P;  1BGY H;  1Q3E A;  3HKE B;  3JD4 A;  2UUA B;  1R3J C;  5KHK A;  1SS3 A;  2D3O W;  4JI2 O;  4O4I A;  4O2A A;  5EIB D;  2K1E A;  4X1Y B;  4DV4 O;  2KQX A;  3DC6 A;  1XMQ O;  4B3R O;  4H37 A;  4U3J A;  3HKB B;  4DV1 O;  1UFI A;  1XNQ O;  1NVP B;  1BZK A;  2ZIM A;  1N8R W;  2AZ2 A;  3JD0 A;  4YJ3 B;  1JX9 A;  4XDJ A;  1VQ7 V;  1QBZ A;  3ZHQ A;  1VMG A;  2YEV B;  3FB8 C;  3OE7 G;  2WLI A;  4TV8 B;  2DE0 X;  3VQX A;  3CD6 V;  5CN0 A;  2XAQ A;  1W2B U;  3QO5 A;  1MG1 A;  1KP2 A;  4I0X A;  2F1M A;  5BR8 B;  4LNU B;  1NTZ H;  4E4E A;  3CSX A;  4QNH B;  3I55 V;  4LF4 O;  1QNM A;  2OTJ V;  2B1I A;  2FKX A;  5LP6 B;  4OX9 O;  1OV9 A;  2PGG A;  3BVO A;  3CCV V;  2JGU A;  2D2C B;  4FLT A;  2JS5 A;  4GX1 A;  4R7C A;  1XIL A;  2F66 C;  1R73 A;  3ASN B;  4YIO A;  2WLL B;  1VF6 C;  2QA4 V;  4DV3 B;  1YJN V;  4ZHQ A;  3D36 A;  3JD2 A;  2W6I G;  2YI9 A;  4J41 A;  5KHH A;  4JYA B;  2C2A A;  1DF5 A;  5BXZ A;  2V1D A;  1GH6 A;  2Q7H A;  2YS8 A;  3FAV A;  1OCZ C;  5LL6 Y;  1Z5W A;  3ZBH A;  4LF7 B; 
#chains in the Genus database with same CATH homology
 2DYS B;  2EIJ B;  5LHI A;  2HKO A;  4RUE A;  3FB7 C;  2W6J G;  3A0R A;  3MD0 A;  4YXW G;  3ZJZ A;  1WLE A;  2X0L A;  3CC7 V;  5LBQ A;  3T1C A;  2JJ1 G;  1QR8 A;  4CZZ A;  1FXK C;  2UXX A;  2CK3 G;  2IJK A;  2ATK C;  2IW5 A;  3LNM B;  1KP3 A;  4J9Z B;  2Q68 A;  4BIZ A;  1AR1 B;  3W7T A;  3CYO A;  4X88 A;  5C93 A;  5L3F A;  5L3B A;  2Y69 C;  1JCH A;  1YSC A;  2WLJ A;  1BMF G;  2Y48 A;  3ABU A;  1I5X A;  1K5Q A;  1CPY A;  3B8M A;  4ASU G;  3W7S A;  3CME V;  2R9R B;  1JQ0 A;  2DQ0 A;  2QKS A;  4MTG A;  2WAM A;  2A79 B;  1M1K W;  4MW8 A;  4R8C A;  3JYC A;  3G6E V;  4PDM A;  1I5Y A;  5B1N A;  2DYR C;  2ZXW C;  2QE7 G;  1M90 W;  2H8P C;  1RPO A;  3F5W C;  3T2M A;  3AG4 B;  3G4S V;  1K34 A;  1AI6 A;  2EIN C;  1COW G;  2Q6A A;  4GX0 A;  5B1A B;  4TT3 G;  2X6C A;  1GO3 F;  2DYS C;  4R6Z A;  2EIJ C;  2ZDI C;  2P6J A;  3RW0 A;  5L3C A;  1QVF U;  2EJR A;  3SPG A;  2Q67 A;  3PJS K;  1K9M W;  3SPC A;  1V55 B;  1SET A;  1K5S A;  1AI5 A;  3K08 A;  2GHY A;  4WFA V;  3CCJ V;  2B1G A;  5CBF A;  4P30 A;  1VQ6 V;  2IH3 C;  4P9P A;  3RVZ A;  4XDL A;  3CC2 V;  2XAS A;  4KFM A;  2QTO A;  1EFR G;  1EZJ A;  4FK5 C;  4WF9 V;  2WLK A;  3I56 V;  2XOK G;  1YJ9 V;  1Q81 W;  1AI7 A;  4MW3 A;  1BHA A;  3CMA V;  4EKW A;  4WFE A;  3AG4 C;  4MTF A;  5HFL A;  2UXN A;  4WFH A;  4J9Y B;  3IFX A;  3AG2 C;  5B1A C;  4N23 A;  4KUM A;  3ZMT A;  1S77 D;  1THZ A;  1V54 B;  1MAB G;  1CP9 A;  2DQ3 A;  3G71 V;  3TK1 A;  1VQO V;  1V55 C;  4Q20 A;  3OMA B;  5CMU A;  5L3G A;  3CCR V;  1FXK A;  1SRY A;  3HB3 B;  1OCO C;  4MVQ A;  4LP8 A;  4LBE C;  1Y66 A;  5BZB A;  3MHS C;  4JF3 A;  3ABL B;  4MS2 A;  3H01 A;  5EC1 C;  1HWY A;  1FXK B;  2WLL A;  1L1F A;  2P90 A;  3CPW U;  3FYI B;  1QLN A;  3LSQ A;  4Z1M G;  1BL8 A;  2WPD G;  3WG7 C;  2LFS A;  1FXH A;  2QEX V;  3K06 A;  2ITD C;  3R65 A;  1P7B A;  4UUJ C;  3ZMV A;  4RQE A;  4WCE V;  1E79 G;  3ETE A;  1M57 C;  3HPL C;  1KD1 W;  4HAM A;  4PDR A;  3SPI A;  1VQ8 V;  4WFG A;  1V54 C;  4RQF A;  4FIP C;  4P2Z A;  3WFV A;  1K7D A;  2DYR B;  2EIK B;  5L3E A;  2A9H A;  3E8F A;  1W0J G;  4LC1 A;  4PEL A;  4TSF G;  4JTC B;  3ZRX A;  2YSU B;  4DXW A;  3F7V C;  3OMI B;  4PDV A;  1KQS U;  3CCS V;  5E1A C;  2LP7 A;  3LUT B;  3ABL C;  2W0F C;  1E1R G;  2IU3 A;  4PDL A;  2AHY A;  4MSW C;  2JEU A;  3GWO A;  4DO2 A;  4ZKI A;  2IJJ A;  4I9W A;  2OTL V;  3GB7 C;  2EIM C;  3ZRW B;  3ZMU A;  1NBM G;  2ZR3 A;  2OCC B;  5LHH A;  2IU0 A;  5H6Q A;  2DW4 A;  2BOC C;  1NR1 A;  1K73 W;  2P67 A;  1VQ9 V;  1FS0 G;  2X7R B;  1K4D C;  2Z3Y A;  3E83 A;  5B1O A;  1VQK V;  2ZR2 A;  4UXN A;  1SER A;  3CC4 V;  5IYD O;  2EIK C;  4L87 A;  2MK3 A;  2PI4 A;  3NXS A;  2EIL C;  2XAH A;  4UVB A;  3STL C;  3W7W A;  1QLE B;  3AG2 B;  5H6R A;  2ITC C;  3LDD A;  1W0K G;  1Y4M A;  2P7T C;  2X6B A;  1YIJ V;  3OGC C;  3E8B A;  4FMT A;  1R3K C;  1ENV A;  1GKF A;  4MTX A;  4MVO A;  5B3S C;  1YJW V;  5DN6 G;  4RAI A;  2X6A A;  2AHZ A;  5KUM A;  4BAY A;  4LCU C;  4P9O A;  5EC2 C;  2F43 G;  4HZ3 A;  1JVM A;  1OCO B;  3OUS A;  2JEX A;  2QM8 A;  3ZRV A;  2OCC C;  1R6N A;  4MVM A;  4QE9 A;  1Q82 W;  1GK9 A;  2XAJ A;  1DTO A;  1K92 A;  1XL4 A;  2FTK A;  1H38 A;  4PA3 A;  4XDK A;  1H8H G;  1PL0 A;  2JK5 C;  1NQT A;  3ABM C;  3DTU B;  4GX2 A;  1S3J A;  5IYC O;  4PA9 A;  3EFF K;  3WG7 B;  2Z5U A;  5IYB O;  1GMG A;  1DLB A;  1KC8 W;  3P32 A;  3OUF A;  3OEE G;  1QLE C;  2XAF A;  4U7O A;  1M57 B;  1ROP A;  2JIZ G;  3ABT A;  4FJC C;  1JPX A;  3QO7 A;  4JGS A;  4RUF A;  4KP4 A;  1TUE B;  3X2Q B;  1YHQ V;  1S72 V;  4QE7 A;  1G8M A;  1B6Q A;  3QO8 A;  1Q7Y W;  2ZD9 A;  3OFN G;  1RPR A;  2R9I A;  3VBB A;  2WLN A;  3K9A A;  5CBG A;  4JYC A;  4I5S A;  3UKM A;  4UVC A;  1PNK A;  1KEC A;  5EK0 A;  4E2L A;  1M56 C;  3OR6 C;  1CEZ A;  5CA3 A;  3SPJ A;  3K0D A;  5KA5 A;  1VQL V;  1BHB A;  5LGN A;  4QPK A;  4PA7 A;  2WLI B;  2H94 A;  1H2G A;  5GW7 A;  1K97 A;  3K03 A;  2JDI G;  1PNL A;  3CP1 A;  1AJQ A;  3ZN0 A;  3CCQ V;  2WSS G;  5J9P C;  1GM7 A;  3AG1 B;  3OAA G;  2EBO A;  1RM1 C;  3AEI A;  4CBC A;  3ETD A;  1J95 A;  2EIM B;  1ORQ C;  2A0L A;  3IC7 A;  5FL7 G;  1JOY A;  1S0V A;  1OCR B;  4MVU A;  1GM9 A;  2DWE C;  1FFT B;  4G27 B;  4JYB A;  2NNU A;  5L3D A;  4F4L A;  4QIW F;  1F4N A;  2HVJ C;  3X2Q C;  1MSW D;  5KUK A;  3ZN1 A;  3SYP A;  2IJH A;  1WPX A;  3FB5 C;  1NH2 B;  3JD1 A;  2EIL B;  2ZDI A;  2OT5 A;  4MVR A;  1NJI W;  2B5U A;  3MHH C;  1SES A;  4ZBM A;  1SZT A;  4HYO A;  1DF4 A;  1OZ0 A;  2EZO A;  4UVA A;  3B77 A;  5B3S B;  1G4Y B;  3ZIA G;  3ZRW A;  4JTD B;  3AG3 C;  3IGA C;  2HLD G;  4FPP A;  3ZMS A;  3AG1 C;  4GX5 A;  3OMN B;  2LFR A;  1P4R A;  2GSM B;  1VQM V;  4PA6 A;  1K3E A;  1OCC B;  4WFF A;  2V7Q G;  1OCR C;  4RO2 A;  5EBW C;  3T4D A;  1VQ5 V;  4MVZ A;  1H8E G;  2WWW A;  3W7X A;  2DWD C;  1JJ2 U;  1M9N A;  1F4M A;  5LHG A;  1YTF B;  1VQN V;  2QM7 A;  3ABM B;  3ML0 A;  1XL6 A;  2HR3 A;  3CCL V;  2XND G;  5B1B B;  1OHH G;  3M99 B;  3D3I A;  3ZMZ A;  5IY5 C;  2NLJ C;  3FB6 C;  3ASN C;  3JCZ A;  1NVP D;  1VQ4 V;  1NKD A;  3RVY A;  1F51 A;  3SPH A;  3ABK C;  4UV8 A;  2Q69 A;  1ZWI C;  1ARO P;  5LGU A;  3ASO C;  4U7N A;  3JD4 A;  1GTO A;  1AJP A;  1R6K A;  1R3J C;  1PD3 A;  3OW2 U;  2BOB C;  2WLH A;  2D3O W;  3CCM V;  2K1E A;  1M56 B;  2HVK C;  4MT8 A;  4JAV A;  3SYC A;  3TET A;  1OCC C;  4JPR A;  3BY6 A;  3ETG A;  3OR7 C;  1QR9 A;  3P30 A;  3B8N A;  4H37 A;  4WFB V;  3FKS G;  1AI4 A;  5KA6 A;  1RM1 B;  1NVP B;  5B1B C;  1EBO A;  3SYO A;  3E8H A;  1N8R W;  3CCU V;  3JD3 A;  3FYE B;  3RBZ A;  3JD0 A;  4R50 A;  4MVS A;  3STZ C;  1JX9 A;  1YIT V;  4XDJ A;  3SYQ A;  3E89 A;  3E86 A;  2YEV A;  4BW5 A;  1F23 A;  1VQ7 V;  3W7U A;  4G2K A;  3VOU A;  4JTA B;  1QBZ A;  4QPJ A;  2IH1 C;  2IJI A;  1AJN A;  5H9C A;  4BIU A;  1K4C C;  2YEV B;  3FB8 C;  3OE7 G;  1NH2 D;  2WLI A;  3T4Z A;  3UM7 A;  3CD6 V;  1S76 D;  5CN0 A;  3E8G A;  1MOF A;  2XAQ A;  4GT1 A;  2HFE C;  2KB1 A;  4OXS A;  1W2B U;  3QO5 A;  3ZRS A;  1MG1 A;  5DM6 V;  1E1Q G;  5LGT A;  1KP2 A;  3AG3 B;  1KKD A;  1R3I C;  4MTO A;  1NR7 A;  2HG5 C;  4QNH B;  2WLM A;  2ZQM A;  3I55 V;  1YI2 V;  2OTJ V;  3ZCC A;  2B1I A;  3BEH A;  4G28 B;  1OCZ B;  1QVG U;  3KG2 A;  1VQP V;  1S5H C;  3K3W A;  4JAU A;  1PKX A;  3CCE V;  4JAS A;  3LSS A;  1LNQ A;  3K79 A;  2JJ2 G;  3OEH G;  5EBM C;  3CCV V;  1IXM A;  1YTF D;  3SYA A;  4GCZ A;  5IDJ A;  4GX1 A;  4R7C A;  5IY5 B;  1GM8 A;  1R73 A;  3ASN B;  3SJQ C;  3QNE A;  1UJW B;  2WLL B;  3OM3 B;  2M7W A;  3ABK B;  2QA4 V;  3K04 A;  2Y69 B;  4XBF A;  1YJN V;  3K0G A;  3ASO B;  4TWK A;  4PA4 A;  1PNM A;  3LDC A;  4X8A A;  2EZP A;  3D36 A;  3JD2 A;  4N21 A;  1Q86 W;  2W6I G;  3LDE A;  3E2E A;  3DGE A;  4H33 A;  3EHB B;  2PI5 A;  3CXC U;  2C2A A;  1DF5 A;  4QJF B;  2ZXW B;  5EBL C;  5CBH A;  5HFM A;  2V1D A;  1QCE A;  3E35 A;  1R3L C;  4UV9 A;  4X89 A;  2XAG A;  1K33 A;  2EIN B;  1OCZ C;  3F7Y C;  1K8A W;  1FXV A;  2HJF C;  3TCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...