1R3QA

Uroporphyrinogen decarboxylase in complex with coproporphyrinogen-i
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
357
structure length
357
Chain Sequence
GFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen Decarboxylase
publication title Structural basis for tetrapyrrole coordination by uroporphyrinogen decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 126
structure length 357
sequence length 357
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1r3qA00
4AY7A 1JPIA 4L61A 4EXQA 1U1HA 1JPKA 1XDJA 3PPHA 1R3TA 1T7LA 3BQ5A 4ZTYA 3PPCA 4L64A 3PPFA 4ZTXA 1R3WA 3BQ6A 2Q71A 2INFA 4L5ZA 1XR2A 3GVQA 1U1UA 3CYVA 1UROA 1U1JA 3GW0A 3PPGA 4L6HA 1R3VA 1R3YA 4WSHA 4QQUA 4ZR8A 1J93A 3GVWA 4L6OA 4AY8A 2NQ5A 3T0CA 1R3QA 1R3SA 3GVRA 1YPXA 3GW3A 3GVVA 1JPHA 1U22A 1XPGA 2EJAA 2Q6ZA 4L65A 3RPDA 1R3RA 3L7RA
chains in the Genus database with same CATH superfamily
4UQAA 1JQVA 5FSEC 4PE8A 1V6VA 3AUJA 1WDQA 1SFLA 1LUCA 2QPSA 5DMMA 4MMWA 3URBA 3FNDA 5B7ZA 2VEPA 2X30A 3NO5A 1SMDA 3OA5A 4GZIA 1UD4A 4F2BA 4GGHA 1AH0A 1E1CA 5AYBA 4OGZA 1EGMA 1KRMA 4DPPA 4AY1A 4QG8A 4RZBA 5MHBA 4NVTA 1IIHA 2GSJA 4W88A 4B3ZA 4WDXA 2QUTA 3ITYA 3TTSA 3UPBA 2D0GA 5I3KA 2O55A 3V75A 4NJGA 1HF6A 1XKJA 4HU0A 4J3SA 3KBNA 2AGTA 2F9RA 4QDPA 2XFWA 3A23A 5LNVA 1T0OA 4MNMA 1ISXA 4AH7A 3WUBA 1I1WA 1LBFA 4DPQA 4IOTA 4B91A 4GQRA 1XCWA 3ITCA 5FOOA 1W9UA 3ZR5A 1BWVA 3IACA 3XIMA 2Y8KA 4CN4A 2VOMA 4HOXA 4S39A 4IQLA 4YTSA 3RJYA 3GS6A 1VS1A 4GIYA 4NRSA 1JZ4A 1R85A 2Y0FA 3QPEA 3W37A 1FDYA 2X1SA 1UR3M 1JNEA 2ALRA 3KOFA 1X7IA 4KEZA 1G69A 2V30A 4HPNA 3IGXA 3LQGA 3KOYA 1NARA 3GC5A 3MUZ1 1E6SM 3TNOA 3E74A 1ZP3A 1TRIA 5DT7A 2Y7FA 1VBGA 4UWMA 5TD4A 3IJQA 4C6PA 8CGTA 4PTNA 3T0BA 2DZXA 3G3MA 5HUPA 4XVEA 2YCEA 1EXBA 2PP1A 3W84A 4TMCA 3KVKA 1W32A 4DWSC 3KCLA 2VX7A 1R7OA 1S2UA 3H55A 1H5YA 3VM5A 4NJJA 1MFUA 4NYYA 2Z2UA 4F9JA 5D03A 4RZ5A 4K8EA 2YLAA 3RMEA 1R2SA 3ES7A 2YCJA 1BGAA 4JBRA 4IIBA 2WHLA 2CLKA 3W75A 1FTXA 2IKJA 1H50A 1QI0A 2QDEA 4IMEA 1K6WA 4MWAC 1HVXA 1Q8AA 3NQ7A 2KX9A 4U3CA 4WDWA 1J0KA 1HXJA 1V08A 1KC7A 1SJAA 2Q8LA 3DFTA 3ARVA 1R7AA 5FESA 2RUSA 4FLRA 1DTNA 2WCGA 2OX1A 2HRWA 4FNQA 3OBEA 3WNKA 1D9EA 5LIUX 1PEZA 1DYSA 3MUXA 3JU2A 4ML4A 1J6PA 3A9IA 5FIPA 3TONA 3UZJA 3VYLA 3GVGA 1LT7A 2V5LA 3QZ6A 1W54A 4LVBA 1C8YA 3WJZA 2OTDA 3W9ZA 4KIRA 2JF7A 1Q13A 1D7FA 2L5HA 1R0MA 4Q4QA 4LV4A 4H8UA 3W88A 4DUVA 1Q6DA 4NUWA 3NVDA 3U0HA 2C71A 2XPKA 4A3RA 3AMGA 1BVZA 4C7GA 4J3ZA 5DXXA 1NOFA 4LFYA 1XC6A 1XDLA 1F4HA 3UG8A 3B4UA 1PBGA 3JW7A 1EBGA 4DX3A 4PTVA 4AWTA 3LLDA 5K3VA 4BQ2A 2D2HA 2QHAA 1JIBA 3B8VA 4H9YA 3OLDA 3S5SA 1WOBA 2ZX8A 4QCEA 3W7JA 5HNRA 3GO2A 1X38A 5DCBA 3N04A 1JYXA 5U4NA 1VRDA 2Q71A 3Q94A 4LSBA 5K2ZA 4FK9A 1W3LA 3QYQA 2C19A 1WZAA 1EGZA 4F40A 1XRTA 3VA8A 3PFMA 2Z1XA 2V2DA 2QJHA 1YX1A 1WX0A 4X2PA 2X05A 1QO5A 1LYXA 2C79A 2HQAA 4GO9A 1MXSA 4GYPA 1UYQA 3W7HA 3U4AA 1O68A 1RCOB 3EPMA 4EOUA 1E6XM 4EK7A 4H2HA 5I24A 3PS7A 1OADA 1TTPA 3ITVA 3W6MA 1LWJA 2JKAA 3WDRA 2VRJA 1ISZA 1NOUA 2WQPA 1TYGA 1K02A 2P10A 2CHOA 3CZ8A 3SCNA 3T55A 3PBWA 1BQCA 4B16A 4M19A 2OYKA 2YW4A 1WAWA 3B8TA 3TCSA 4PUJA 4OOZA 5I23A 2NXHA 3PB2A 1JD9A 3E0VA 1WBJA 1GQJA 4B5SA 3N3TA 3T4CA 3VD5A 1GORA 2OR2A 1R3RA 4MDOA 3IJIA 2BV9A 3EOUA 3PANA 1RUSA 1U2YA 1S5NA 4PMJA 4F66A 3GTIA 1EXPA 3W71A 2FPTA 3R5EA 3PWAA 5I5RA 4AU0A 1DIKA 1OCQA 2XIBA 1QOQA 4O1AA 3MUIA 4RUBA 4JX6A 2R9RA 4XZMX 5H8PA 1UW9A 1VF8A 1TJ2A 3FN9A 5F4SA 4OECA 1OD8A 1HQTA 1K3UA 5T26A 4PA8A 3WBXA 3VIIA 3KBMA 1EWDA 4TMBA 2V3DA 5I79A 2ISSA 1R5YA 3GDLA 1UWTA 3TNBA 1OZMA 3HBLA 1P6WA 1D3CA 5EB8A 2FTWA 4J27A 3UW6A 1LM1A 2Y24A 3PUDA 3GDBA 3GU2A 1OFQA 5FF7A 1PAMA 3UYIA 3MV01 1BGGA 1ICSA 2ZRYA 4GUIA 5HNNA 4CUCA 3QTGA 1B31A 2NUWA 4ZL1A 1FRBA 1TMQA 3P2VA 2GZXA 4DZAA 3SCVA 8XIMA 1E0VA 2EPKX 5FKYA 3WBEA 4LUIA 1FXQA 3BJFA 1TMLA 2WC4A 4HYVA 1Q2RA 2NV9A 5HK4A 3VX1A 1HKWA 1QK2A 5IOBA 2XSXA 1B3OA 2OSYA 3BVJA 4B2DD 3WMCA 4GY7A 4WCJA 3N14A 4M56A 5CPSA 3TJ4A 3AZSA 2JALA 2ZRZA 3TOYA 3TV8A 3VIHA 1TPH1 1FWAC 1TV5A 2PP0A 2BGSA 3CAKA 4XAZA 1UD6A 5KTLA 4AY8A 4HN4A 2B0MA 3BAYA 2OMAA 3IAPA 3DN5A 7A3HA 1TKKA 2O92A 2H90A 3RXZA 1N8WA 1M7XA 4C6OA 1BRLA 2PZ0A 3LTSA 5M5DA 3WF0A 3RRAA 4OTKA 2XG9A 2J25A 3HMCA 3UWQA 3M0JA 5FJUA 5CG0A 4JFSA 3ZR6A 2NWRA 4QLLA 3O0FA 3I3BA 1F05A 3LRMA 4N9CA 4PCTA 4E8DA 2CLFA 4RV8A 3O8AA 4GNJA 4Q4OA 4IFKB 3VDHA 2JK2A 5D2VA 4DJDA 1GOIA 3DGRA 1E5NA 2ZRVA 4OU1A 1BRLB 1S2AA 4IHCA 4YTTA 4MFEA 1QWKA 1QNQA 3OYZA 4HGXA 1B30A 2AAAA 1JI1A 2PWEA 3KVMA 4O19A 1LRTA 4RE2A 3OTRA 1EF2A 1HW6A 2INFA 3WEOA 3FYPA 4JEQA 1UR0A 4AVNA 1WUFA 2GJXB 2SFPA 3LB0A 2WPBA 5KETA 4Y7EA 4FXJA 1W3JA 2PDUA 1B3VA 2X1TA 3GKFA 3WJXA 3WLHA 4BR1A 2Y1HA 5G4EA 3GU9A 3MYPA 2Z7KA 4R34A 2VGFA 4Q8UA 1BEUA 1K8CA 4C6MA 4R9OA 3ERPA 1OFBA 1O1ZA 1L6FA 1KGWA 2DH2A 3UU0A 1RVGA 1J93A 1KNWA 5LSMA 4TQTA 1FCBA 2V67A 1WDDA 4ATWA 1P0DA 4CD5A 3WEZA 5HOSA 1PUDA 1K4HA 4IGSA 3BLPX 4X22A 4AC7C 1F8IA 4GLEA 3CWOX 4O28A 1Q7ZA 2W91A 3VOCA 3AJXA 3LXCA 2WVUA 1VHNA 3SI9A 3DFHA 2A7NA 4QQUA 1V7YA 2A3LA 2F7FA 3K8MA 4WKFA 3NGJA 3TU9A 2ESCA 3T7VA 2V5DA 3EKLA 4YYCA 1XGEA 2E6FA 4RXGA 1POJA 1TB3A 4CNNA 2RKXA 3LHYA 4NAFA 1VFMA 5RUBA 3C2OA 1ZJAA 4JDBA 1AMKA 1H61A 1BF2A 3H7RA 1P48A 3CEUA 3TYUA 3U48A 4AMCA 1BHGA 4W87A 1BD0A 2PA6A 5DEZA 3AO0A 4S3FA 4S3KA 2WAGA 1S1RA 1EX1A 4Q8NA 3W7KA 4ZFCA 1RAKA 2WYSA 4M7TA 4B5XA 1I4NA 3OVPA 3KM8A 4O12A 2XIQA 5BXTA 1M3UA 3U4FA 3W1QA 1GEQA 1RPKA 1SUXA 3GBEA 1W1ZA 3C2FA 4NJKA 3ZVIA 4ZZ9A 3TZFA 4IICA 1Q6LA 1W1A1 1YNPA 4FZIA 2CKRA 1R3WA 4GD0A 4ZE4A 1AD1A 2VXNA 4IUGA 3TUUA 3MI3A 3QC3A 1IXPA 1B2YA 2WMIA 2FB2A 1E56A 3KCJA 5C9RA 4XUYA 3QFWA 3GQYA 1RD5A 2FLIA 4QG6A 3DKJA 4JTHA 4C6JA 1Q6QA 3M7WA 3F4DA 4EWND 3C61A 3QMSA 2WMGA 4QGCA 3PZNA 3WO8A 4EF8A 1R6WA 2FB3A 4YVVA 4HOWA 3R25A 3V3WA 2XM2A 2YFNA 1XS2A 3MCMA 2PSNA 4ZMGA 1TR9A 2R1LA 4REQA 5HJYA 2A85A 1XIFA 1O5RA 3AIEA 4DO4A 1WOAA 2C8NA 3CIXA 4NAEB 3PTKA 4NZFA 3GSMA 1Z6KA 4PYSA 1A47A 3GG7A 2CBVA 3E2QA 3BZGA 4X0NA 3KRZA 1YE6A 2EQDA 1CXEA 4WZHA 2C13A 3W73A 1IZJA 3KL3A 3H4WA 3C0QA 1OFEA 4IXHA 1OVDA 3TFXA 3OIHA 4C6NA 4DB7A 3A4WA 2A6NA 3DAQA 3OLIA 2TODA 2O9RA 3QPZA 1RVKA 2XVNA 1I45A 1YPIA 2DU2A 3S5NA 1EO5A 1R3QA 2YCLB 3VDGA 1EJXC 4Z2HA 1RJRA 4P5UA 3CV7A 3OB8A 4Q8PA 1GHSA 3WCZA 1PTDA 3Q58A 4PL2A 3QMTA 1YNYA 3WDQA 3BZJA 4IJRA 2H9AA 1UJPA 4AHPA 5A2BA 4US6A 3LCIA 2GQAA 4H8NA 1W8GA 3RO8A 4PSRA 1VYRA 3GX9A 2I5IA 2WMKA 3LDVA 3CLWA 4TUFA 3NPWA 1HO1A 3QZEA 4JN8A 3BW4A 3VOGA 3MSDA 1W9DM 3QZAA 3F4CA 3B05A 1MDLA 3MHFA 1B0IA 3TQKA 3AIBA 3BJTA 3T0CA 1OINA 4F0KA 3VOHA 3VPLA 2Q8XA 2WQDA 1TE6A 1W3HA 1TZ7A 4DY1A 2E8YA 5FF3A 3XINA 1XQKA 4MYXA 5FJRA 1K03A 1A5NC 1XM3A 1GTHA 2VRKA 1Q6OA 1LOLA 4CD7A 3UBPC 5HWMA 4GUHA 3L7RA 3UA4A 1C91A 3T81A 2NXGA 3TEVA 3KVLA 2DW6A 1JDDA 2QCHA 2Q3RA 3W7MA 3LHWA 1C7TA 4JTGA 3AQUA 4HZMA 4LH8A 1KM3A 2AOSA 2HBVA 2PDXA 1M7OA 1S3HA 1ZBCA 4AISA 3EEZA 3TAOA 1XBZA 4E2VA 3P5YA 2E9MA 3EDFA 1KCZA 3KP0A 1IR2A 3RLGA 3DG6A 4HCLA 4ZQRA 3K13A 2E5BA 2WZIA 3IVTA 1A5UA 2FFIA 4IJCA 3F5JA 4Y8FA 3QN3A 2DSWA 4UUIA 5L9FA 1NDZA 5EU9A 4HNOA 5G5IA 5CAHA 1DWJM 4GH3A 4CLMA 1XL9A 3HGJA 3FA5A 9XIMA 4C1KA 1EP1A 2FZMA 1O66A 3SY1A 1P0KA 3LMYA 4X2RA 1IR1A 3G1FA 4QDMA 4MDPA 5HXMA 3SCSA 3ZLFA 3NQ6A 5IBXA 3FHQA 3LI1A 3R89A 2YOCA 4C6LA 1JEZA 1PIFA 3TMQA 1A5AA 1EPXA 2XU2A 4NJIA 4P7NA 1Z8AA 1EHNA 2VC9A 1NWUA 4L80A 3HURA 5FJIA 1KKRA 3NIYA 3N9KA 3TOPA 2YL9A 1TPFA 4M7SA 1P43A 4O16A 3IUDA 1CECA 2ZTJA 2BVDA 1PJ9A 1ECEA 1SR9A 3LOTA 4GNVA 1DORA 4DBDA 3WQ6A 4PMQA 1NF7A 1DJXA 1JFHA 4IT1A 1V0LA 2CETA 2PLCA 3EWXA 1F74A 1KTCA 3C6CA 2YCKX 3MMDA 2Z6IA 1QI2A 4E2DA 1NFBA 3W1RA 2D69A 1GVSA 3CYJA 4S3JA 5CPOA 1XWYA 4C6KA 4PUEA 3OIXA 1M68A 2PBOA 4L1GA 4GABA 2DUZA 1LDCA 3CPUA 4O1DA 5JBEA 3KWSA 3W6YA 5A8MA 3DC0A 4KRUA 4QRNA 3PSVA 1F07A 1W1TA 1BKHA 2ZZ5A 3E02A 5BXRA 3G18A 1DJQA 4RDWA 2J79A 4AB4A 1KBKA 2P76A 4DBEA 5CSSA 2FHFA 5DXYA 4X9YA 4RL3A 3RN6A 1DQUA 1N2VA 1NY1A 3RYSA 3UG4A 1UKSA 4BQ3A 2DGAA 2DT3A 2V5BA 4MKSA 4OT7A 2J9ZA 3W22A 3KOZA 3S9IA 3EDEA 1JUKA 2VZVA 1NDWA 4FPSA 1EBHA 3P0XA 2ZA1A 2CLHA 3LPOA 3EWZA 1XXXA 1AH4A 1VJZA 3GTHA 2I17A 3HA1A 1RK6A 1SZFA 3CZLA 4OBSA 1NVMA 3P5ZA 1CPUA 1GVOA 3CB8A 4QR6A 1GOOA 3H2AA 4S38A 3VNMA 2WVVB 5J8LA 5D9MA 1E70M 1S5VA 2XIOA 1GVYA 5AHMA 1V3MA 1QHOA 1JYVA 2ZZ6A 3C86A 4IIHA 3GRIA 1PHQA 4JYEA 2YR1A 3AU6A 1FH7A 1EEXA 1JCTA 3WDHA 2QF8A 3M0XA 4A8NA 4DYJA 1UZDA 2CCRA 4FNUA 1PKLA 4OZOA 3EGJA 3VNJA 2YW3A 3BV4A 3P74A 4UFMA 2PCQA 1TE1A 4DJED 4HJFA 3HG3A 3W7LA 1W9PA 4W5UA 3W85A 2IPWA 1TPC1 1J9YA 3WQPA 3GHSA 1KB3A 3EPNA 3MBFA 4LNYA 1H60A 1ECQA 4AUBA 3M5XA 2CEQA 2G41A 4W86A 4HNUA 5K9XA 5D02A 1KKOA 3BICA 2ZWZA 2BS9A 3RHGA 3VIMA 3KLKA 4ORIA 3QV9A 4E4FA 4JNMA 5LGXA 3ZJ7A 4W7VA 3NEHA 3RLHA 3S2MA 1XSJA 3R0UA 2WCAA 4I9JA 3ANUA 4MKNA 2VMFA 4P8VA 4ICMA 1G4SA 2WC3A 1HKKA 2YL5A 3ZWSA 2DIKA 2NQHA 2OWXA 3GZ3A 3EMQA 4UTTA 1VFTA 3G2GA 4U5IA 1PDYA 4HOZA 3MT1A 3N4EA 3KZPA 4HZ6A 4B4HA 1PZ0A 4WDTA 1KQZA 5C71A 4KS0A 3VDBA 3ECQA 3MI2A 5BU6A 1OF6A 3LYEA 1IZKA 1SSGA 3CV1A 5JMUA 3KXQA 1TSIA 2JQXA 1CLVA 1PS9A 4D1IA 3BXWA 4JFTA 3G77A 3OQ8A 1W9XA 1GW1A 3A9BA 1Q2SA 3O16A 1JPIA 3BLDA 3WY1A 4F2TA 4X61A 3QR3A 4JIEA 2XWEA 3QOMA 1JDEA 1EQCA 2BX7A 3TAKA 2YXGA 4UCGA 1W5MA 2V5CA 2CLOA 1LORA 3LV6A 4BEQA 2BODX 2HCVA 1RP8A 1UZ4A 4AEFA 3ATYA 2EO7A 5LNSA 4ZO7A 2WOQA 1TV3A 2AL2B 4KQNA 3PBYA 4GXWA 1ONWA 2PDCA 4LS1A 1T99A 1MNSA 3RX2A 2Z6JA 3F4VA 1FCQA 3UEQA 5F7UA 1W5QA 3W7OA 4M1BA 4KCVA 4QXIA 3NVTA 4XD6A 1R9XA 5GNXA 4RV3A 4AIOA 3CT2A 4BI5A 4PFHA 2GVYA 4LF1A 1EUNA 4GYFA 1UKOA 3E3HA 4WXYA 1XIHA 4UC5A 5HJXA 1MO0A 1NSJA 4P7LA 3W1TA 1T8XA 5ABFB 1H7XA 1K7EA 3LHVA 3NYDA 1DWFM 3AS3A 1TREA 1RR2A 4DQWA 2IW0A 5ECUA 3ZR4A 4S3DA 2HJPA 1UASA 3NQ8A 4EE9A 1XH1A 3W82A 4JYFA 1A0EA 3HB9A 1VIWA 3EA3A 3QF0A 4Z2LA 4MJ4A 3VKBA 1WB0A 1EZ2A 1UOKA 4US5D 4JTTA 5IFTA 4QLKA 1X1ZA 5AB3A 3RR4A 2VDGA 3QQ1A 3RLUA 2A7RA 3THQA 2B7QA 3B9AA 4DZIA 2DPEA 3G1YA 1KR0A 4QE4A 3GYCA 3VU2A 1H7WA 4M80A 3H6OA 1TO3A 5K4ZA 1YTDA 4GZEA 3WD3A 1IEIA 5I2UA 4ZODA 3WH5A 2VHLA 5AC8A 3GXMA 1UHVA 1RXOB 3TP4A 3V5CA 2FDSA 4FIRA 1GOQA 2FVMA 1HJWA 4KWOA 4XIMA 1PSCA 3GTXA 3CWNA 3SBFA 3FEMA 1F6PA 4I90A 4M51A 5D32A 3UCCA 3AIUA 4H6KA 4AZHA 3EB4A 4LC6A 1NM9A 4G9PA 1LTDA 1DJZA 1G9HA 1HO4A 1E55A 1F6YA 1QDSA 4UZUA 5G2IA 1JG9A 4JNZA 2FZ8A 1XGDA 2R1NA 3P14A 3UGRA 1BQGA 4HIBA 1YADA 4EAMA 4GA8A 4ERIA 3VCCA 4KWVA 3EB2A 1XLMA 5FJTA 1C93A 5F2MA 3S2CA 4MADA 3S5YA 2GVEA 4JTIA 5L6UA 1CXLA 4LUYA 1R30A 3DG7A 1WO2A 1OC7A 3HG5A 4RLIA 4ZQOA 2XIMA 4GKTA 3VFCA 2OOFA 3VGBA 5CJMA 4DXKA 2RGMA 3G0XA 4GVGA 2CIPA 5MKGB 5DFAA 1UWUA 5BRQA 1UH4A 3NQEA 3NQGA 1JXKA 2HDJA 1UUMA 2QCCA 3N19B 2J9YA 3M7SA 3FDKA 3UP8A 4DBSA 2B31A 1OYAA 1RV8A 5LA0A 2PDGA 1QASA 2RDXA 3IK2A 2UY2A 2GL5A 1PDZA 1E9YB 2XN1A 4M5PA 2V0TA 1H51A 4XSMA 1X8FA 2ZZ3A 2PBGA 3BQ5A 2VZOA 3CL8A 1UB3A 1VD6A 3DYPA 2EAWA 1ENUA 4B9YA 5AECA 3VD4A 1C29A 1ZENA 4MZYA 2R1MA 5M17A 2H8XA 1GG0A 3OJGA 1FWEC 1J8VA 4M81A 2WWDA 1LCOA 1ZAJA 1U5VA 3VIJA 4UQBA 2Z27A 2VFIA 1KTNA 3A3HA 3MSGA 4H04A 1LOQA 1OFRA 2A5HA 5FJPA 3GXFA 1RA5A 1YRRA 2ZE0A 3TK7A 4CD8A 4XTIA 4OOUA 5IDZA 4GACA 1W1YA 4C60A 1AA1B 4XD5A 1KV8A 3WLSA 1SPQA 1FWSA 4E38A 3AAMA 1Q65A 2J7EA 5I3HA 5JVLA 1CTNA 1BAGA 2ZFAA 1KFKA 2C6QA 5LKYA 5C2XA 2ISWA 4TIMA 1JZ7A 1I2QA 3UYCA 3L4ZA 2WB5A 5JIPA 2W63A 3NQFA 1E40A 1EFZA 5HWJA 3V0UA 2TSYA 3TJLA 1L8NA 3M0IA 3LPFA 2PU1A 3SM0A 4RZ6A 3RRXA 2O9PA 4D72A 1PX8A 1U5JA 4N6FA 1QPKA 4TTGA 4RJEA 1XBVA 3QY6A 3H12A 4GY1A 2PMQA 3RO6A 1F3WA 4WEVX 5C2GA 2VCBA 3O7UA 1FWBC 3VGEA 2V82A 1YTKA 4HTYA 3FVMA 3SIZA 4FLOA 1JPDX 4JAWA 2DH3A 1R9ZA 3UZXA 3V35A 1KCLA 1IXNA 3I7QA 2AGKA 3CZGA 4P7OA 2NT1A 2Z24A 4IPJA 3N6HA 4UR9A 3PZIA 4FO4A 3W7CA 5I07A 1QI5A 1WA3A 4O54A 1GTEA 4LYKA 1REQB 3PJUA 4H00A 3PPFA 1QPNA 4Q4RA 6TIMA 1ONRA 1NP0A 1XYMA 1GZJA 3W1NA 4C90A 3RPTA 2GGHA 4PBEA 1F3TA 1TELA 1VR6A 1VCVA 4BKNA 2G97A 3L0GA 2GQ8A 4ZSUA 2B7NA 3NJ3A 4WXZA 4X3ZA 4AF0A 4F8XA 1IV8A 4EPDC 1RQEA 2XINA 2VEKA 4U10A 5A8QA 1EUAA 4D8AA 5DMNA 1MNZA 1P0EA 1LT8A 4AYSA 5E6ZA 3CMFA 1C90A 2ABBA 2Y5SA 3WNNA 2FZNA 5I00A 3VK5A 3PG9A 1LL7A 2JF6A 4LUTA 3RG6A 4GQBA 3BV7A 1E9LA 1C7SA 2NWSA 3GU1A 8TIMA 1Q4NX 5HATA 2E28A 4KH2A 2JGQA 2OKOA 3M6DA 2Z4GA 1H11A 2WSPA 4Q8QA 3CPRA 1GVFA 1OCBA 3LS9A 5XIMA 1PV8A 3OHMB 4LUTB 3HO8A 3SFKA 4POCA 3P61A 2HPMA 2D22A 2C18A 4LW7A 3IANA 1MEIA 2OFJA 1UJQA 4XIAA 4QM1A 1DL3A 4HPHA 3KVJA 1PXGA 5BU9A 5C70A 3KUMA 3Q67A 2FJKA 4AIEA 4NXKA 2CLIA 2OLAA 2WJEA 4D9PA 3GC4A 2RFGA 1XLFA 1Z41A 1QTWA 1TR1A 4QE1A 3WQ4A 3W7GA 5GQBA 1VYPX 3OQEA 4H6EA 1V6XA 3TYEA 4E3VA 2PGFA 1GKRA 3T40A 1VH7A 4IF2A 3OZMA 4A29A 1EDQA 1HGYA 2PGWA 2VR2A 2Y7EA 4JKLA 4A3HA 3W74A 2CBUA 1HP4A 2OT1A 3N2TA 4TO8A 3UPMA 5HMFA 2BVYA 1A0CA 4WK9A 4KWUA 1ZNNA 2FZ9A 4QITA 3HJZA 4MAVA 4PMVA 3TJXA 2CXEA 3VCRA 2W5FA 3BMVA 2FFCA 3IV3A 1I8JA 3ANVA 4ZB2A 2GSEA 1VAHA 4CVUA 2V81A 3DH7A 1HUVA 5F2LA 4B5UA 1JXJA 2CLPA 3TQ0A 3VILA 5BWFA 1ODUA 2C16A 1VIZA 5FF0A 2WCSA 4DXXA 4IMCA 1OK6A 3TN5A 1GZGA 4F0SA 4AZCA 1X39A 3M1ZA 4ASTA 5AHIA 3ZT7A 2A0NA 1B3WA 2QCDA 3C0JA 5HJLA 1UKQA 2WPGA 3HFTA 4GHRA 4IP4A 3O1NA 3OGSA 2PWDA 3GG0A 1P7TA 2J7GA 2FPVA 2R8WA 4GUGA 5HMSA 3CIVA 2OYLA 3LCLA 1DV7A 1Q7MA 2ZCGA 1EIBA 1QVBA 1E73M 5TF0A 2O9TA 3RDKA 3L0KA 7ODCA 5F2IA 4IMGA 3ARXA 4FLSA 1CGYA 3SR7A 2FMOA 1ADOA 2A79A 5T91A 1JR1A 3VNIA 4WQ6A 4CU6A 3KDOA 1H49A 3DUGA 3UXIA 3O6AA 1PCKA 4WUIA 3QKEA 4M8UA 4EVZA 4OKDA 3M0KA 2QJIA 1GHRA 4DBUA 3TMLA 5CPTA 5EYWA 3FIGA 3A6OA 4Q4MA 4NRRA 1V8EA 7REQB 1OJXA 4GBDA 2J78A 4MZ8A 5HR6A 1J12A 1RPXA 4Y96A 1HJUA 2J7DA 4HSOA 5CAKA 4ZO6A 4L5ZA 3AIWA 4HTBA 3FCPA 3HG4A 3GXPA 5GNYA 2ATMA 3BCDA 2W9MA 1RH9A 1TPB1 1SZEA 4DNMA 4GI4A 4O8AA 3LY0A 3TWAA 2FGBA 3NZPA 1KFEA 1XINA 1KM0A 4O57A 1WKDA 1G4EA 2ZX6A 3EOOA 2VC6A 4MWAD 5AZ1A 2J47A 4D2JA 3OZPA 3WX7A 3K4AA 3WLKX 4PRTA 3WLLA 5A6BA 1J2BA 5E9AA 2V63A 2GVGA 2BY3A 4NY2A 1L0PA 4XB3A 1KLYA 4IX2A 4I8YA 4AC1X 5AVNA 1NWTA 1XYAA 4RNJA 3ALFA 1CCWB 3HJEA 3T08A 3BK0A 2HVNA 3N18A 2CU0A 2QCLA 5HAOA 3WLPA 4GYPC 1GOMA 2D2OA 4IPNB 3CUFA 2PDWA 1XDJA 2WSRA 4ZCWA 4ATDA 4AD4A 3TFCA 1H7PA 2NQ9A 1H0GA 1NELA 1DJGA 1US2A 4UOJA 1CGXA 2PF0A 1V0NA 2CW6A 1ME9A 1Q6RA 1VENA 1VC4A 2HE8A 4FNPA 3C4UA 5IFPA 1NP2A 4PR4A 3DYOA 1OG0A 3ENLA 4J3VA 1Q45A 2CYGA 1XFCA 1DHPA 1CBGA 1WAUA 2EPLX 1QBAA 4RDVA 1AW1A 3NOYA 3PBVA 4GC3A 1UP3A 4FOUA 3KLLA 2BMBA 2VUNA 4K8GA 1P6BA 3G1DA 3WNMA 3H4GA 4XZWA 3DX5A 3R11A 2ZZ7A 3UCQA 1JZ3A 3FXYA 4PB4A 3LV5A 2PP3A 3NTYA 1OZQA 1GOWA 5KZDA 3ARWA 3IVSA 2QCMA 4KBXA 3TKFA 3GG8A 1E6ZA 2EXOA 2IKGA 1W1IE 4MKVA 3WUEA 1FWHC 3VE7A 6REQA 2IPJA 3G1XA 3UESA 2I1OA 3FA3A 4Z0SA 1QPRA 1JCNA 4E2BA 6ALDA 1X8CA 2PF8A 3L4WA 4OV9A 1HVQA 1HKIA 2FPYA 2HVOA 5DCDA 3S3GA 3M07A 1F2JA 5DY3A 3KOWA 2VZUA 1W5OA 4Y9OA 5TBOA 3AWNA 2DEPA 3CMGA 3LQLA 2NLIA 1TVNA 5J5RA 2VI0A 3AS0A 3EWDA 3SDOA 1PZ1A 2XN0A 2XM1A 1MEWA 3ZXWA 2MANA 4J9JA 3N29A 3WLJA 2V5JA 2GUYA 2RAGA 3CZEA 2XGIA 3DDMA 4W85A 4FLQA 5ABTA 3L4VA 3I65A 3W38A 4JEJA 4TTUA 4XBJA 3TN4A 4PMYA 3ITLA 4L9YA 4FMVA 2P5NA 1GPFA 1I2NA 2QT3A 1LQ0A 3MPGA 4ADTA 3EA2A 2YLLA 1TQXA 4HCDA 3NURA 2AAMA 3GIQA 2J8TA 2J9XA 4LVAA 2OG9A 2QS8A 2ZE3A 4W84A 4DJEC 4AHOA 1B9ZA 4XZ9A 5FD0A 4WIWA 3Q2DA 1PHWA 1TPVA 1FHVA 3S2LA 4I3GA 5FA5A 2X09A 5C54A 3KTSA 1M7PA 4A6GA 4JY8A 4XV0A 4N9BA 4E8CA 4H7ZA 4MSSA 1G4PA 3CHVA 1RLCL 4AHQA 3IRDA 3FEQA 4LS0A 2EPOA 3EYPA 1I75A 1UIPA 1GPWA 4FX7A 5AOUA 4AZ7A 1QCWA 4JQ1A 4ERAA 1HNYA 2WJFA 4QJ4B 1W31A 5K4XA 5A8NA 3CWHA 4DJDC 3EWWA 1X1NA 4HHPA 4KRZA 5G1MA 3LU2A 1VFHA 2REQA 1WPCA 3VNZA 4AEEA 2RDUA 4J3WA 2CITA 3WLIA 3AFBA 1F4AA 3BWWA 2P50A 3BLIA 4YWSA 1YBQA 1AD4A 3RMJA 5LHFA 3NPXA 2GGIA 4FXFA 2F2HA 4H6RA 2PRLA 4NZJA 2DZSA 3VC5A 2PFHA 3KRSA 2UY4A 1EWEA 2G3FA 1E3ZA 1EGVA 3BO9A 2G3IA 1XISA 3AYRA 4YJ5A 4JKMA 4IFOA 1QUMA 3WQEA 3BCJA 1KXQA 2Z2BA 3EX3A 5D09A 4K37A 1IF2A 4HZ7A 1ZBWA 3T2QA 4NZ4A 2E77A 2J8FA 1DVJA 1W8SA 2KAUC 4P61A 5EMMA 3ZSTA 2VR5A 4JTAA 2HISA 2PC4A 3LI0A 2PU0A 3KW3A 2XVLA 2PWFA 1XJBA 3R10A 3BOFA 3UG3A 5C9XA 4XD3A 3GH7A 2Y4SA 5A6JA 1TV7A 1XIGA 4J3TA 2DSZA 3LHUA 4XZNX 4K3ZA 3NL5A 1KRAC 4QG9A 2NX9A 1MQQA 3LXBA 2IQTA 1QAPA 2UY5A 4F0RA 4ILSA 4NX0A 4IMAA 4NASA 3W07A 5DMYA 2ZYFA 2X0YA 2GGGA 1BF6A 1NH6A 2DZTA 1RHCA 2DVTA 1MZRA 1OX4A 3UWZA 1SSDA 4QHRA 4GI6A 4N02A 2XDFA 4B5TA 1I60A 5LIWX 5AVHA 2PDMA 1GQNA 4NI3A 5I02A 1P5BA 1F3EA 4KPLA 2YL6A 4CQ9A 2ZUSA 3BG5A 3F1QA 5JQ9A 2ASHA 4DWSA 4Q8VA 4GC4A 3RPDA 1V03A 4I9AA 4DJFA 1I2PA 2AMGA 5I3GA 3LTPA 1KFCA 4V2XA 4PFMA 2NQZA 1CNVA 1CEOA 1XICA 4ZTYA 5U7SA 3W2UA 1AW5A 4WSKA 1CI1A 3GNNA 4G1NA 3TR2A 1Q5MA 4UTLA 4S3BA 1P1XA 1FOBA 3GXIA 1J10A 2O7QA 1D3GA 3I4KA 5DBTA 4RW3A 4AX6A 1PYMA 1KFJA 2PD9A 1UKPA 3ZOAA 4FF7A 1A3HA 4CN6A 3C0LA 4JHOA 4AWUA 1ZRQA 5CJNA 1ZL1A 2FTYA 1RJQA 4YTQA 1RSCA 3RAOA 4FX6M 4LXFA 5AY7A 3CAQA 4JQ4A 2OQLA 3ME3A 4WX2A 2XGZA 1V5XA 4EANA 5E0KA 4NXSA 1E4LA 4MWAB 2VWSA 1ZU8A 4KWSA 4GYKA 3TLQA 3REQB 1V77A 3V0SA 3AMLA 3PVFA 3BL3A 3OBAA 4LBRA 3WQOA 4S23A 1FWGC 5E0FA 3SCUA 2ZVIA 3H8AA 5EMKA 4ES4A 1VPXA 4INFA 3E2VA 1T96A 4WY0F 2PWUA 3NR0A 3T0DA 4GO8A 4EF9A 2P53A 2OEKA 5TNVA 3FHAA 1YPXA 4LT9A 1FA2A 1V02A 3H23A 4PZVA 1VFOA 1YYAA 3DC8A 4UOQA 4QCFA 3P93A 3QSTA 4JL1A 1UA7A 5AN7A 4HA3A 3WLRA 4M6QA 4A3UA 1FBAA 2Y85A 4AXKA 4A8LA 5M3WA 4S2CA 1XKYA 1EQPA 2WKLA 3TX9A 1VYSX 4NKCA 1FWNA 3MYOA 3UJ2A 5CZ0A 1UPPA 3EXSA 4LVDA 3I68A 3UF9A 3APTA 4BK9A 1UR9A 3PAOA 4J4KA 1XIEA 4RE3A 3TDFA 1B57A 1T41A 3PZ9A 3UJEA 3OHIA 3XISA 4FNSA 5HQEA 1K6AA 1MDRA 1KV5A 1CIUA 4E0CA 1I2RA 1FDJA 3GXTA 3N17A 2WJDA 1FVPA 5AC7A 5CZSA 2B4GA 4H3DA 3WNPA 3HPZA 3AHZA 2NSXA 1U1UA 4KW2A 1YHTA 1CB2A 4IM4A 2WZTA 2C91A 4L1WA 4D6FA 4KKXA 4AZ6A 1OGGA 5E93A 3WDIA 3K4DA 2VZTA 3PPCA 3HV9A 3W53A 1QO2A 2Y2WA 3QEZA 4QSHA 4HSNA 3W1UA 3GVQA 5I6SA 4YWIA 2G3NA 2QUMA 3VOJA 4YIWA 3S2JA 3SURA 5T8GA 4YNGA 4PULA 4QBXA 3W7IA 4J3XA 3VINA 4MF4A 1XGZA 1ISYA 2CLLA 4NT0A 1UZHA 1ADSA 2JE8A 1ZUAX 3GW0A 1BVWA 2F6KA 4KT2A 2GGJA 4WGHA 2PLKA 4LRTA 2Z1WA 3OGRA 2VD9A 1ME7A 4LOCA 1GQIA 1XIMA 2HPIA 3VUPA 1MWOA 3BLLA 2PDLA 5H1WA 2XVGA 2BOFX 3MA8A 1A5BA 1RALA 1HZYA 4R33A 1W2VA 2MNRA 3K8LA 4CD4A 4ZXOA 3QSRA 2CXGA 4NHVA 1F3XA 2FQIA 3DESA 2R82A 1LLOA 3W24A 3FW6A 3TW7A 4D6JA 1CZ1A 4LAMA 4QFUA 4MM1A 4O53A 1F9CA 3L2LA 1QW9A 1RZMA 4AEOA 3KL0A 2DORA 1Z69A 3TA9A 2QJNA 3IGHX 3B0VC 5CKSA 2XWDA 3BAWA 2C15A 1WXZA 1JD7A 4M3PA 3BE7A 5A2AA 1UH2A 2WHKA 3TN3A 4F0MA 3B0PA 2W92A 2BP1A 5K9CA 2POTA 3D46A 4PN2A 2OODA 3EOEA 3VGGA 1EC9A 4UFHA 3E0WA 4K7YA 5A94A 1JUEA 3F4WA 2VEIA 2UWFA 3HN3A 5D2TA 1XUZA 3AWOA 4IQJA 3VC6A 3BMXA 2GK1A 4IG2A 2I56A 5EY5A 3WH6A 1UBPC 4KCWA 3IK4A 3A4AA 4YVXA 3WFLA 3WJYA 3EBVA 3HFYA 2DW7A 1B4EA 5F2GA 3C8FA 3CT7A 1BG9A 3MSYA 4K38A 5A6TC 3WK2A 2EGZA 3O15A 3W81A 2BNJA 1K77A 1UA3A 1TG7A 4Q32A 1R38A 5JBFA 2P0OA 2EJ1A 3R12A 3NEVA 3CQIA 4AD2A 5M1TA 3ARQA 1O4UA 3SQLA 3N15A 1VJSA 3SSZA 3H2CA 5E6YA 3T6CA 2E4TA 3KHDA 3N2XA 3KBJA 3ZSSA 2WLZA 5CGMA 3P82A 2PI6A 3P8IA 1SZRA 1Q8JA 3WKZA 3IJ8A 4K7VA 1W9BM 3ZVHA 3APGA 4Q3MA 5A95A 3U2CA 3ABRA 1QR7A 4ZQMA 1NFGA 4IGNA 1O7AA 3E5PA 5AFDA 1MW2A 4PEEA 2J62A 4KERA 4CGTA 3S46A 1HIZA 4A2SA 3H21A 5B7YA 2ZVRA 5D05A 1E6QM 5FL1A 4J2PA 3G8EA 4AZIA 3W87A 4R7OA 4B5VA 5LYRA 1UPMB 2GJNA 4LALA 3W29A 3FAXA 3ZVHB 3S42A 4PRWA 2D73A 2A3CA 3WFZA 3WELA 1G01A 4G8TA 4ZVJA 2P1FA 3EWYA 4Z2KA 1AG1O 1JGIA 3SY5A 4E4UA 3M5YA 1P0NA 4YYFA 3BLFA 3S6OA 3R94A 2WSQA 1T6MA 3P84A 1BSLA 4HVXA 2I9UA 1TCMA 3VUSA 5I06A 3M41A 1V3JA 3V7PA 1SM9A 1FXPA 1LG1A 3B9DA 2CZ5A 1W1PA 1OK4A 3TR9A 2VGIA 1VPYA 2ZUVA 2G5WA 1MZHA 1Q6EA 5CZJA 3BDKA 3N3MA 3S1GA 2ZRUA 5I77A 5G4WA 1CXFA 2C0AA 1S2TA 4M29A 3TC6A 5BZAA 4XVDA 1GYMA 4WR3A 1EB3A 4PMDA 3LGEA 3DENA 3URQA 1UD8A 2HS8A 3R8HA 3BSGA 3VDAA 4CQ8A 3GVVA 2J7BA 3F4NA 2ZX7A 5FF2A 4HU4A 3DFYA 2QW5A 3M0ZA 5BOOA 2VC7A 4JIQA 3R6IA 3PN8A 3TXZA 5HINA 1DIDA 1JDAA 4PCPA 3BC9A 5A6SA 3I6EA 4L4MA 5EMYA 2GQ3A 2VZSA 4LAOA 2X40A 3ITTA 1VCGA 5C7HA 3W0KA 3VMOA 3SCOA 1XYBA 2CKSA 4RNHA 2XYLA 1ZTVA 4ZSTA 4MY9A 1XR2A 1DWAM 3LA4A 3DECA 4R9XA 4UTTC 2FH8A 4Q22A 5EBAA 3UJSA 3UWUA 4W5ZA 1A0DA 3YPIA 4L6DA 1GOXA 3AUOA 3APYA 4ZQNA 4LNCA 1VEOA 2PDFA 2DUXA 1JAEA 4UTKA 2BOEX 2H8ZA 2ZZ4A 3W83A 1TFVA 3IVUA 3ITXA 4W89A 3IUIA 3NUKA 1W17A 4H2CA 1RA0A 1J4EA 1ICQA 1J0ZA 3GNPA 3WMLA 1JZ8A 3VAVA 1GJPA 3N13A 1FWIC 2FGLA 4H9XA 1IGSA 4GIEA 1NAL1 3GD6A 2JIEA 2O7SA 5C55A 2FYMA 3JR2A 4J5NA 3PC0A 4LYRA 1DIEA 1H5VA 3MQTA 2XZ7A 6CGTA 1JCLA 3GAKA 5HBFA 1H4PA 4BEUA 3H70A 3Q45A 4IGHA 4KGJA 5DMLA 4ZOCA 1C3FA 2V68A 4O52A 3CQKA 3EOSA 1J5SA 1WXJA 4S3AA 1KM5A 4U3AA 2BY0A 2OEMA 2XH7A 1PL9A 3FA4A 3CM4A 3LRLA 4PB3A 4WJEA 4KEUA 5G4HC 4DAFA 2DSKA 3UWEA 1TZ9A 1LJYA 3ARUA 3HQ1A 3HMJG 4AXNA 1N8IA 4QJ5B 4FR6A 1SZGA 4LPCA 4MLRA 4U5KA 5D9NA 2DP3A 2OT0A 3G3DA 1EEPA 4I7WA 3UWYA 3IJ7A 5CPLA 4OE7A 2Z2AA 3SUVA 3VX0A 4JFVA 1K9EA 2EBNA 1W1B1 1N55A 1MYRA 3C3UA 3KS5A 3WZ0E 3ZM8A 5BRBA 1E15A 3BJSA 2X0HA 3CQJA 3OEXA 2QLYA 1XLEA 4K39A 4X60A 3VZYA 3OGVA 1XX1A 1TWSA 4LS2A 2HMCA 5CZKA 1KCXA 2GDQA 3LHZA 3UG5A 4R3UA 3PP7A 1JRCA 2NVDA 3K4WA 3WN6A 1YIXA 3TA6A 3FSUA 1CT5A 2VD8A 3FDGA 5C5YA 4GKLA 4MTVA 3C2VA 2ISVA 4GVHA 2Y89A 1ZP4A 4IPPA 3K1DA 3HF3A 2OJPA 4O15A 3ALGA 1H3GA 3BMWA 4CU7A 4DF1A 3U7BA 4DN1A 1PWLA 4MVAA 2C1HA 3TYBA 2VFGA 2F6XA 5D2XA 1U1HA 3WBYA 4V27A 4QIUA 3ZO9A 2X8RA 8A3HA 1H1NA 1CXIA 2BWGA 4PH6A 1VHCA 2D20A 3WF4A 3EX4A 3OA3A 3QR0A 3CHCA 3O63A 2DUAA 4ZOAA 4L4PA 1PZ3A 4MJZA 3SUTA 3D0CA 3AISA 3NO1A 1RQBA 4CU8A 1DKWA 3B9OA 2J7CA 4PUWA 4FHAA 4XKYB 1GCYA 1HL9A 4B92A 3N9SA 5CC6A 4DIAA 1U30A 1SFJA 4UTFA 4LCQA 4CCCA 4D71A 3BTNA 3WIJA 3CXOA 4DXVA 3K5XA 4L6OA 3F2CA 4AVOA 4C1NA 1OGBA 1XD1A 2BY2A 4UIOA 3NGFA 3TQVA 2FKPA 2Q8ZA 1NQ6A 3SZ8A 4IWWA 4C5YA 2X42A 4LUJA 4XO7A 2E6YA 2RDWA 4LYQA 5F4WA 4Q8OA 4KWWA 4ADUA 2JEPA 3JRKA 1V02E 4HNVA 1R3YA 1K8XA 3FJ4A 3LBCA 5CH9A 1P6CA 1W5NA 4XZLX 3W2NA 3EMCA 1UG6A 3CH9A 2DT1A 4C1NB 1VZWA 2ANUA 3NL2A 2DZBA 3NQDA 3PPHA 3RGTA 3T78A 3NFUA 3TVAA 2Y7DA 4XKMA 2YBUA 3BLEA 4AWSA 4HCHA 3A3WA 4U4MA 1ZS2A 2NQ5A 2G4JA 3AXKA 3WJWA 1OX6A 3AJ7A 3DOPA 3AALA 4HPGA 3MJMA 3KRBA 3WL1A 1A3XA 2HWGA 1GG1A 2QQ6A 3WNOA 3BW2A 5DLCA 4JTJA 4MLJA 4BF5A 4LBSA 4IIFA 1TJRA 1FWDC 4JTEA 4B15A 3MJYA 4Y90A 3A5FA 5E5CA 3P3BA 3WQ5A 2PDIA 4YPJA 4YCOA 3C5QA 1W5PA 3MUY1 1FWCC 1X6LA 5AYZA 1J0HA 1JNDA 3UZ5A 2OO6A 3LSCA 4DUWA 4PRRA 1L9WA 5AKQA 3FKRA 4E3TA 1XV8A 1ZGDA 3QY7A 1ELSA 2YZ5A 1RP9A 4I7UA 3SSJA 2QNEA 5EKYA 2NZLA 4MY8A 3UWVA 2Q6ZA 5LNRA 2MUCA 1CB7B 3BLOA 3C0SA 4DWDA 3E2SA 1AQ0A 6XIAA 3IAQA 1A4LA 1VFSA 2JIWA 2YDSA 1DJIA 1Z3NA 4XAGA 3VD9A 4Q7IA 5I0DA 1ZAHA 1IWAA 1OD0A 1DJNA 2PB1A 2D3NA 3EB3A 4FNTA 3T2OA 2WNZA 4B9ZA 4IFKA 1QJWA 4E8GA 4QROA 1V3KA 3D3FA 2E3ZA 1WCGA 1E4MM 1NTHA 3L4UA 3SEPA 4Y9NA 2E25A 3SO7A 1Y7VA 5HMDA 3E1F1 3LCGA 3GR8A 2I57A 4HMEA 2DZVA 4K36A 4OBRA 1SFTA 5FJOA 4MB4A 3G24A 3UJFA 1TWIA 2R1KA 3W01A 2EG7A 1JFXA 4XZBA 1DXEA 2CHRA 1EP3A 1TRDA 4EPBC 3LBOA 5DQPA 1XYLA 3FFSA 4MNLA 1ZZMA 4BI6A 2XTKA 1KQYA 1PCWA 3ELFA 2GJXA 2FZBA 3OZOA 2YFOA 1L6YA 1EHAA 4V1XA 3IGSA 1AW2A 4AAJA 2GJRA 1KD0A 2PDNA 4URIA 1A49A 3U2ZA 1H09A 4K6AA 4RXFA 2EHHA 2PPGA 3LCXA 2PDBA 1QK0A 2YYTA 3AZRA 4XQ6A 1E0UA 3GNXA 3AXMA 3BSMA 2X16A 2CBJA 4EXBA 3AC0A 4C91A 4NF7A 3WG6A 1ZAIA 1JPHA 2YA2A 2H6RA 5AZ0A 2GPTA 3GDTA 3CUZA 5KEZA 3ZQ9A 3DKLA 3W2LA 4KEVA 4JTSA 3ZFHA 3MCNA 4L6HA 5BRPA 2Z7GA 3PF3A 1GONA 5K7JA 3SRDA 1TPWA 1OYBA 4O17A 3VNDA 4AX7A 4HA4A 1SFSA 3Q37A 3A4JA 3S6TA 1UD2A 1HJVA 2DZWA 2PRMA 3DBNA 1XCXA 4H19A 3W1XA 2D23A 2NQLA 3QVQA 2ZUWA 2OSWA 3WUGA 2INEA 4NX5A 3A21A 3NZ1A 3SGGA 4YTRA 1XC4A 4PMUA 2B7PA 3B8DA 2ZADA 2WNWA 3VNLA 1E9IA 3WDJA 4NZ1A 4OBTA 1K8YA 3WK3A 3O05A 3QLLA 1UROA 4GUFA 5ABEA 3MB9A 1LWIA 5CG7A 1HL8A 2VX4A 4PC8A 1BFNA 1BXCA 5I7GA 2HNHA 4NU7A 3W2JA 1JPKA 1YTEA 3M6YA 1LBLA 4TU1A 4UTMA 1XRVA 1KBIA 3CU2A 1OSEA 2V3GA 1D7KA 3R4IA 2QJMA 3BURA 3KZSA 3NWRA 2BZNA 1IT0A 1IT7A 3MW7A 2OSXA 3LZ5A 1XF0A 4MOZA 4HBKA 1EA9C 5A8OA 3CJPA 5DELA 3HG2A 4K2SA 3SADA 3LX9A 1DXIA 3W7RA 1MW3A 5BMWA 4TVCA 1IXOA 1O60A 5FEWA 3CHFA 4CNOA 1GZ1A 1K8ZA 4AMAA 3RILA 1MRAA 3MUCA 3N11A 4ZEPA 5IM51 2FHBA 4ECLA 2OQHA 3ABQA 4MY1A 3TTEA 7CGTA 2BXYA 5CSUA 4ACZB 4PMOA 5EBUA 2G37A 4R53A 3ATZA 3U8GA 3NAVA 3WSUA 5C8BB 3NG3A 1XHGA 2UZ9A 2IQ0A 2AQOA 5C7VA 3GH4A 1R86A 1R8LA 4NAEA 4H9UA 2FHCA 4OVXA 3TW6A 4AY7A 3WLNA 2Z26A 3OP2A 2X7WA 3BLKA 1PIGA 1A5SA 1ZCCA 3T42A 1ZY9A 3MP3A 5BXPA 3AMKA 5CCZA 4FEZA 3PZVA 2J4GA 3F2DA 1JF6A 4G1KA 3D5HA 2C7FA 1P1MA 2G3JA 5EMLA 4FSAA 3STPA 4GZJA 5HWNA 1F8MA 1XLGA 4BI7A 1YKWA 3PBMA 1OGSA 1H1YA 2YCLA 2X1UA 2WZHA 3UY8A 2ATSA 4J1OA 2X1IA 2TYSA 2Q3OA 3TQPA 2DT0A 3SAZA 1YDVA 3LGDA 3F03K 1DBTA 4GUJA 3LM7A 5C9ZA 3KEHA 3M64A 3T09A 1BPLB 3WD4A 3L67A 4YS1A 2ACRA 4HB7A 4RR4A 1POKA 2AKMA 4IIDA 3S6DA 3QJAA 2XISA 2QCFA 2XVPA 1VCFA 1IZCA 2G50A 5AHFA 5D04C 3CH0A 1JZ5A 3W86A 1NQKA 3WUFA 3ONBA 2E6DA 3VZXA 4ROPA 3RR1A 4CNTA 1IQ8A 1VEPA 4QAIA 1WDRA 1KXVA 4P2VA 4HA1A 5DN1A 4KCUA 3S0CA 4BWLC 7TIMA 5T9BG 1TPDA 4UTWA 4P8UA 2PWGA 2WVSA 4GH1A 4ADSA 3DU0A 5GJPA 3MY9A 3CL7A 2XFRA 2ZOXA 5TIMA 2WWCA 5SWUA 1UWSA 4EKJA 4HMCA 4UMAA 2XH4A 3BQ6A 4B2DA 3EPOA 3PULA 4HHMA 3SCTA 3L68A 4Z17A 4FALA 3VD7A 1XSKA 2YX0A 3CB3A 3OW1A 2E9BA 5TAOA 4K1GA 2WLYA 1E5JA 3S5OA 1E4IA 1ZALA 1CYGA 4JIRA 3B0UX 3M0VA 3AHXA 2PGRA 2GWGA 1KM2A 3VKKA 4W93A 1Z44A 1QNRA 4U2ZA 4DHGA 2OZ3A 1QI4A 1G4TA 4CEUC 4NSBA 1X1OA 2IUZA 1PE1A 3ES8A 3E0IA 4LVFA 1D8CA 2QCNA 2FVKA 3RPMA 2C0HA 3GAYA 1U22A 1QI3A 3CO8A 3VABA 3DHUA 1S1PA 1OT1A 5REQB 4KFPA 2ZUTA 3NXLA 2INZA 2VFDA 4I9MA 3WNLA 1PWMA 7TAAA 2CZDA 4CCEA 5D37A 1V0KA 2E1DA 4IPIA 1SO4A 2BY1A 1UCWA 3L5LA 3EXRA 1RJPA 1BXNA 5D9OA 3KAOA 1EYEA 1XUUA 3LRKA 1B90A 3RITA 2VEGA 3EKGA 2J8GA 4Y6GA 3TIMA 3RIKA 2OKTA 4PUKA 4GX9A 5ABHA 5D38A 4JHZA 5HDRA 4HNNA 1FWTA 3PUGA 2E5CA 4IX0A 3WD2A 4C6FA 3UZWA 2PE4A 4WF7A 2YB1A 4X63A 2HK0A 1JI2A 2CWNA 4O10A 3GLCA 1LOSA 2WV8A 4U2YA 3R0KA 1TA3B 1NU5A 3LD5A 5D33A 5FL0A 4UR8A 2AQWA 2A2IA 4Q6XA 3DFPA 3PUOA 4JTDA 5BMXA 1GQLA 4G2DA 4HQVA 4HPXA 1TV8A 4TX6A 1PX4A 1HJXA 3GDRA 1XG4A 4CVWA 3TC7A 2IPFA 1UH3A 1X97A 3B03A 1JQXA 3WLTA 2D2JA 3SGZA 3W7DA 2PAJA 2HVMA 1GK8A 2G95A 3EDJA 5K9DA 1HP5A 3SRKA 5AC5A 2V3FA 4L7ZA 2TPSA 2ZUNA 1DWGM 1W56A 3RCNA 1YEYA 3S2NA 4J40A 3IIZA 3AROA 8XIAA 1UWIA 4G56A 2HK1A 4PUDA 2XSBA 1JAKA 1AK5A 3ICJA 4AD0A 1IEVA 4O8RA 4AZ5A 2Y88A 4U31A 2VENA 3N12A 2BGNE 4QDWA 1D3HA 4PUUA 2WVVA 3AOFA 1NOWA 1G7VA 3DFNA 5B80A 5D8WA 4FX8A 2V3EA 3E49A 3VM7A 3AXXA 1EPVA 4Q7BA 2Y8UA 2BVTA 2DDXA 3GXNA 3ZJ6A 1LUCB 3N9RA 1EA0A 3O6DA 1VFFA 2WMJA 2OEJA 2JGYA 1TX0A 1US0A 4G7FA 5ECVA 5KZ6A 2Z1VA 2PTXA 3PTQA 3W02A 3VTRA 5A6KA 4Z2GA 1E1CB 1OG6A 1MXDA 2QR6A 3NQBA 4N6EA 2WANA 2OLSA 4JICA 3DI0A 1YQ2A 3AS1A 5LHEA 1UMLA 1XPGA 4O1BA 4NQ1A 3U6WA 3KBSA 3KTCA 2E0PA 1R3TA 4C6CA 1R87A 2Z25A 3VGFA 4C7FA 2VNCA 2AQVA 4LTSA 3FS2A 2A3BA 2CLMA 4O0KA 3S83A 3M0MA 1AJ0A 9CGTA 2A4AA 3TH6A 4C7DA 4LUSA 4KFNA 2PD5A 4YXGA 4MUPA 1EL3A 2D1ZA 1AQFA 3EX6A 4R27A 1O12A 3HU7A 3F5LA 3VOFA 2I9EA 3UZYA 1U1JA 3QQWA 1LP6A 3IPWA 3PZUA 3WEMA 3G1HA 1QOXA 2X2GA 3ITOA 4CNPA 4LUSB 1CW2A 4JR5A 3IEBA 1OIMA 2Z28A 1SO5A 4GI8A 3D6NA 4XO6A 2GQ9A 4S3GA 1TIMA 2QUVA 2ZC8A 2A6LA 4DJDD 5KZMA 4W7WA 3M4HA 4WDUA 4UZSA 3E0FA 3SJNA 4WLCA 1S2CA 1KCKA 4GK8A 5DY2A 1A5OC 2ZXAA 3NSMA 1UZ1A 3NPUA 1OWQA 4DJFC 5I03A 2HTMA 4ZB0A 2JKEA 4GIRA 2C3ZA 5G2WA 4DI8A 3EDKA 2AL2A 4H9ZA 5IHSA 2J13A 4ZA0A 3CAWA 4QX4A 3B0YA 3SN0A 2Z0IA 3CUJA 3G1SA 3I3EA 1K4GA 4UQCA 4HK7A 2D24A 1OIFA 1E4NA 1P4CA 3STEA 4DI9A 4WKAA 3L9CA 1O5KA 2PC8A 1DQXA 4A3QA 4Q4SA 3W4RA 3G6LA 4XZHA 4IIEA 3AYVA 1CLXA 3TSBA 3MSRA 1DPMA 4IL0A 4QNWA 5ABFA 1SYTA 3QGVA 7XIMA 4JTFA 4DBWA 3WQFA 4FOJA 5CJ5A 1IXQA 3UR2A 3WQDA 1JRBA 4M6VA 3FOKA 1Y5WA 3D3AA 3C2YA 1FDZA 4P7RA 4DLMA 1WZLA 1ML1A 4QLJA 1UC4A 3H2MA 1SR0A 1OCNA 3TTQA 5JIWA 5IRPA 2OELA 3R7MA 4Y8EA 3SQMA 3CAVA 2DSVA 1VFUA 1E0XA 1Y0EA 3CLMA 2QIWA 1LF1A 2R94A 2IPGA 2ODOA 4W4QA 1KM1A 4ICNA 2UBPC 1V4YA 4TV5A 4LCRA 4PMNA 1H7RA 4E2OA 3I10A 4MPKA 3MMTA 1LRNA 4LYPA 3V1PA 2XSAA 1V3HA 4ZTXA 2CZEA 4LAZA 3SCWA 5AHEA 2J7HA 1XPYA 5LNUA 4FS9A 1WXYA 3FYOA 3HQOA 1R9YA 4HPJA 4OJYA 3WF3A 2J66A 3BARA 4HU8A 2XH0A 3GIYA 4V33A 4XWUA 3STFA 4V15A 3MWAA 4FR1A 3TTYA 1WKEA 3HPAA 3KWXA 1NIUA 2RJGA 3URAA 3S1VA 4UMBA 2QUNA 3MKVA 3NQCA 2RH9A 4LQ1A 2D2GA 3L4XA 2ABAA 5AC6A 2DQWA 2CZFA 2JBMA 4F0HA 1UP2A 1W3NA 3ZMRA 1CXKA 2PZNA 1J18A 2V9DA 4PBGA 1PIIA 4H9TA 1KGUA 2XH2A 1V6WA 3DBPA 3FJNA 3QRHA 9XIAA 3GHRA 3B97A 3DYMA 2DQXA 3GG1A 4OUEA 1FKWA 2PLJA 4CKQA 1M7JA 1TPUA 1A80A 3KTXA 2GSHA 2PDHA 3GZAA 4NNAA 5A3HA 5CGTA 3LPPA 3Q4DA 5JUVA 3I6TA 2HZGA 1RCXB 3ARZA 3J7HA 4AWEA 1J6OA 1LBMA 1A5MC 3H7VA 3N73A 5MKGA 2VJXA 1KFLA 4J7RA 1KWGA 1YXCA 3JZEA 1JCXA 3Q65A 2VP8A 3QM3A 1W3IA 1I0BA 1KWKA 5EA9A 3R13A 3OZYA 1VLIA 1EJWC 4DZHA 1XLIA 4IJBA 3CTTA 4ORMA 4XD4A 3GB6A 4G7EA 4JOMA 1CWYA 1OT2A 2PURA 2R6OA 4UOZA 5A8GA 4AW7A 3DGBA 1QNOA 4FXRA 2YSWA 2GJLA 1K9DA 1TJ1A 1M65A 7ENLA 2ONEA 5FACA 1XLCA 1TWWA 5T9CE 4F79A 1SMAA 1KTBA 3SFWA 2OB3A 1DEDA 1M6JA 2OVLA 4ZE5A 4G7EB 4LVGA 1V6UA 3WD1A 3R8RA 4QQ3A 1GJWA 4OIFA 3KHJA 1J2WA 3PZQA 1L2UA 1LG2A 3PBUA 4MAZA 2UY3A 3TJIA 1OABA 3MDWA 4GI9A 4XISA 3W1LA 1S5WA 3KX6A 1QNSA 2QAPA 3IS4A 3F5KA 3T4WA 3VD3A 4AZGA 3RFAA 4N2YA 2YXOA 2YXXA 2PEVA 2NXIA 3C8NA 3MCOA 1PX3A 5H8MA 4A8RA 4CQBA 1ZQ5A 4L4OA 3H24A 1SZNA 1M5WA 4FA3A 2V8ZA 1OFAA 4TV6A 4JFWA 4YLWA 4C6EA 2DVUA 1UBSA 4DELA 5LIXX 4GWEA 3PR2A 4O1EA 4EACA 3PTMA 3GNDA 2YL8A 4DJEA 3KRUA 5CBBA 1AVAA 2Y7GA 4UQEA 1DJWA 4JTQA 2VVSA 1FWRA 3SRHA 2ZDSA 3MVTA 1H63A 4KEMA 1N7KA 3IJDA 2WMFA 3O6CA 1HJQA 2WC7A 3LCWA 2PLMA 3SUUA 2QJJA 3QXBA 4PCSA 4ZOBA 2HXTA 1YDYA 2J75A 4WOZA 3L12A 3II1A 4ZO8A 4EP8C 3PB0A 5BROA 2VKZG 3QGAC 4QE5A 1REQA 3NL6A 4Y9MA 3AHYA 3TLLA 3AXHA 3M0HA 3AIRA 4ML9A 3OVQA 4XSLA 1XFBA 4H41A 1F76A 3LLFA 2XJ7A 3RF9A 1WYIA 2QV4A 5H6HA 2GLKA 3TZNA 1TTQA 1TQJA 3BUVA 3M16A 4PGLA 2DFAA 2ZRWA 4BCEA 1ME8A 3MTWA 4O11A 3S1UA 1L8PA 2X0SA 3OYXA 3U2OA 1XLLA 6A3HA 1SU5A 2E1WA 1X96A 2GJPA 3M43A 2ACUA 3W28A 2GWNA 4Y9PA 3GFXA 3TN6A 2BDQA 2HV5A 1EDTA 5ABGA 5EL1A 1CGTA 2VFFA 3H54A 3WDPP 3CIWA 1EO7A 3ITGA 1TPEA 1WDPA 5A1AA 3QV8A 4NILA 3ARSA 3N2CA 4MYAA 3RNDA 1EP2A 4DYEA 1XLDA 3MBDA 3HGOA 2VX6A 3EXTA 2J24A 4AVFA 3CPGA 3H2EA 3SCPA 1TV2A 1MEHA 1K9FA 1G5AA 1FP8A 1QWGA 1XW8A 1BYAA 5HANA 1JF5A 4WY0A 1CGVA 3H2NA 1OFDA 4EPKA 3V5OA 2VTFA 2G0WA 3PJWA 2WBKA 5KINA 3PWIA 2QIIA 4NI8A 3H26A 1TJPA 3TROA 3USZA 5DANA 3MS8A 4WRHA 1XG3A 3B9EA 3UETA 3B9NA 1FWFC 4DLFA 2GGEA 3VXGA 1DOSA 2DIEA 1D2KA 3S9ZA 1E51A 1EOMA 1E6RA 4WY0B 3S1XA 1UD5A 4DM1A 2EKCA 2IXVA 2NUYA 2ZZ1A 4US5A 4Q8WA 3NNTA 1DE6A 3NDOA 3CUGA 3EKZA 1EOKA 1MUCA 3A5VA 3ZWTA 3IV8A 5KSWA 4NAFB 4D6CA 2P8CA 3CQ0A 4UTIA 2ZZ2A 3WK0A 2FGZA 2QF7A 2QV5A 4L9ZA 3VKJA 1WDWA 4A8IA 5EPDA 1E0TA 4HMDA 1UOZA 4UR7A 3S5ZA 1ZLPA 2PS2A 3B40A 1O5XA 5LNWA 4PODA 5C9UA 2VOTA 3L23A 2YKKA 5A69A 2I7GA 1E6NA 2VFEA 3KE0A 1SGJA 1RY8A 1NJJA 2WVTA 1QFEA 3W1PA 2Z1BA 3ZLHA 4M0XA 4MHBA 1QBBA 2DJXA 4GY0A 1IEXA 5D2YA 2PRHA 2WMIB 3ABXA 5A5WA 3NM1A 2TRSA 1AQHA 1EJSC 2VURA 4N4PA 4LY8A 4S3CA 2FZDA 3M46A 3UR7A 4PTWA 4QJ3B 3VZZA 1DHKA 3EWCA 5GPRA 1OBAA 1UWRA 2A3HA 3WMSA 2XVKA 1SW3A 4AIBA 1KBJA 1MRQA 3L0NA 1NDVA 4PBFA 3S47A 3AI0A 1G6CA 4U28A 4A3YA 3QW4B 3W1MA 4Z2IA 1KR1A 1W0MA 5I3DA 1Q63A 2QXWA 5EFFA 2VEMA 1ONXA 2C1GA 3MZ2A 1V6YA 2GFTA 3WENA 1UUOA 4OWGA 3W1AA 4UBPC 1AL7A 1X7FA 1W1VA 5D9PA 4GCXA 3BH4A 1C9DA 3N2OA 2J6XA 2E9LA 2P88A 2Y63A 4IISA 1C9WA 2KZHA 4REQB 4XX6A 3ZYZA 3A3XA 1PKMA 2BG5A 3KL5A 3SECA 4P7QA 1AJZA 2GVJA 7REQA 1GVIA 4IIGA 2DZUA 6PTDA 1EJRC 3QLDA 1XLKA 4LAKA 3W72A 1M1BA 1WZMA 2OZTA 5XIAA 4CQDA 3INPA 4WKHA 3HZ3A 3TCEA 2WO5A 3W2MA 4JIIX 3ZT5A 1X6UA 1TCDA 1OEPA 3SQSA 3UQNA 3DHFA 5EMUA 1HL2A 2QGYA 1H41A 3W70A 4GYJA 2E67A 4AIUA 2NVAA 5D8ZA 3SN4A 2ON3A 4EXQA 5LXEA 1F61A 1FFRA 3MP5A 1C8QA 3M5VA 3V4BA 4PEKA 2QDHA 3L5MA 3WK1A 1JYWA 5G1YA 5J5DA 1XDMA 3LG3A 3NQAA 3CV2A 3WH7A 4HA0A 3LHTA 4QSFA 2H9AB 1M9HA 1N82A 4JQ2A 1EC7A 5DBUA 3CASA 4IL2A 1LWHA 1QPOA 3A47A 3K1GA 5BCAA 1E3XA 2PDYA 4Q33A 1R2TA 4W9TA 4DRSA 4LB4A 1JCYA 1EJVC 4TR9A 1JGMA 1Q6GA 5KMYA 2F8QA 4M82A 1S5MA 1L6SA 4KESA 4FIQA 4XAFA 4ICCX 4AG0A 5I78A 2PGEA 2QUUA 2J6VA 3FY1A 4N9EA 1CGUA 1UMYA 2VCCA 1BKSA 3GFYA 4A2RA 3QQ0A 2A7PA 3CZKA 3NZRA 4H01A 3CTLA 4GX8A 2W6RA 1R46A 1I2OA 1SJDA 2OWCA 2FJUB 6XIMA 1JJKA 2BHZA 4ZBCA 4TXEA 2VELA 3LN3A 4PUMA 3CHEA 5DX7A 1PVNA 3FVDA 1E9ZB 1Q85A 2ZICA 3CUIA 4XAYA 3G22A 4DEFA 2OPJA 5CGQA 4UFKA 4XBKA 5LXXA 2OZ8A 1DE5A 1B54A 3RM9A 4LANA 1QOPA 2W3ZA 4B3LA 1B3XA 3KCOA 1LZOA 5HQLA 4PTXA 1YLVA 3K30A 1E1EA 1GGOA 1XIBA 2BSLA 3NPVA 4JXCA 5XINA 4GFIA 1CX9A 5BWAA 3WLOA 3WJSA 3QPYA 5FCZA 3OLEA 1EYWA 3OVRA 3LBMA 1AH3A 1QRQA 4MB3A 1W2PA 4GVIA 4NG3A 3LEPA 2RHGA 3NZGA 4WGXA 1ADDA 2A3AA 1T7LA 1JULA 2BFGA 3MMUA 2HNEA 1RQHA 1XH2A 1IWPA 4JIHA 2VUYA 2I14A 3WQVA 1O94A 5A8PA 4TVUA 4YN5A 5FI8A 4BQ4A 5BW6A 1G67A 1XRSA 3L5AA 2ZA3A 2P3ZA 5C6MA 2F6UA 1OM0A 1FKXA 3GIPA 3VIPA 3QHOA 1VQTA 5FAJA 2P0IA 4W8AA 1H0IA 1YDNA 3LPGA 4FB7A 1KGXA 2BHYA 2G3MA 5H2ZA 4JKKA 3GW3A 3LGGA 3E12A 1ITUA 1GW9A 4XK2A 4GRSA 2YCIX 2E40A 4XAPA 1GWJA 3AXIA 2NLYA 3BAXA 4Q7NA 1A50A 4W8LA 4Q8TA 3WF2A 4DZ5A 2EG6A 5DT5A 3PPGA 2NVCA 3HPSA 3PJTA 1E71M 3WQWA 1Q3NA 3OVGA 1CGWA 3L4YA 2ISDA 2VGGA 1LROA 3P62A 1GVEA 4IXXA 1QHZA 1BXBA 1YMYA 7PTDA 3V5FA 5AHLA 4EX4A 1J11A 4GXPA 4H83A 1FWJC 3W7EA 2XUCA 2XZ9A 2ZUMA 3NCOA 4JHMA 4ZR8A 1YE4A 3RU6A 1FWWA 2R24A 3UVIA 5BOEA 4B3KA 1VLWA 5LGZA 3R43A 2Q02A 3TYZA 3HM7A 2J77A 3SIMA 1QNPA 3LERA 1A4MA 3EMZA 4IH3A 2UV8G 1XYZA 3O06A 3B8UA 3EZ4A 1UP0A 2POZA 3T8LA 4NNCA 4QEEA 2O4QA 3T8QA 2GUUA 1Q6CA 4L64A 4QS5A 3RLVA 3MDUA 1FHDA 4CD6A 1VB9A 3RX3A 4OUIA 1XD0A 1RY0A 3M0LA 2PDQA 4V1YA 3KDNA 2EPNA 3GYEA 3W7NA 2ICSA 3VNYA 4LB3A 3A13A 1W37A 1YNQA 1W3KA 2NQJA 1TVPA 4P8WA 2BTMA 4FXSA 3HPFA 1EIXA 4HK5A 5HNTA 3EX1A 5GJNA 1J96A 4KETA 1OC6A 4GG9A 2XHYA 4IMFA 1JYNA 3P0WA 4R85A 3ZT6A 4D6DA 4LAUA 2J88A 2ZWYA 4WD0A 1BYBA 2O56A 4O1FA 4JFUA 1QHPA 2YDAA 1Q66A 3T0AA 1N8FA 3MKCA 2O0TA 2A21A 1UR8A 2CC0A 1AQMA 1NF0A 1HX0A 1OC5A 3ONCA 2FDMA 4NL1A 4IMDA 2D0HA 2Y70A 3O6YX 5D2WA 3QKZA 2XFYA 4Q6JA 3DEQA 4O18A 2HE5A 2OCZA 2OU4A 3AHVA 1ONEA 1SW0A 3P67A 1BWKA 4Y9AA 1UQYA 5CC3A 2OGJA 1MSSA 3GUGA 5GJMA 5CBJA 1EJUC 2TAAA 3N34A 4JCLA 2HS6A 3IGUA 2HSAA 2H3DA 2ZTKA 2VR4A 1OYCA 1MW0A 2VQTA 3U5YA 4DO7A 4HMNA 3N2MA 3PY2A 4GQQA 2FTPA 4LRSA 2QJGA 2WM1A 1MVYA 1ALDA 1ZB5A 2I5GA 4OV4A 4MWAA 3FJ6A 3GC2A 3NSXA 3REQA 4GOAA 2VCAA 2ZXQA 3D47A 5A6MA 5TQLA 1W91A 2QDDA 3PBGA 2NV1A 5JH2A 4R88A 4PCNA 1BVNP 5PTDA 4JQ3A 4WJXA 4GGBA 3UCDA 3H2OA 1ITXA 1YXYA 2X41A 4I7VA 1GKPA 1OQFA 1BWLA 4KRTA 3P81A 1H7OA 3MZNA 3BAJA 3TSDA 1CLKA 3EEGA 3OG2A 1WBHA 5E70A 1C8VA 4YMZA 4RDYA 4K8HA 1L2QA 4F0LA 3GM8A 3FGCA 3IARA 3R8GA 3IIPA 4MIMA 1R2RA 5E0CA 1PYFA 3JS3A 4LF2A 4JZ5A 3THDA 4AZBA 2WHJA 4IFRA 2GDUA 1O95A 4QAWA 4ZO9A 3NYZA 1FP9A 4I5UA 2ZKMX 3H7UA 2DSUA 4AQLA 3I7SA 4Z0JA 1JL8A 4YL2A 5CQ1A 1H1ZA 3FGCB 1WV2A 2FIQA 2VVNA 3QHNA 4PSPA 3AU2A 3I3DA 3LXAA 4E6MA 2ZA2A 4C6QA 1TV4A 1U5HA 3W26A 3HGRA 3UJRA 4CN1A 4R7JA 2C14A 4D1JA 3C52A 2BVWA 2E6AA 3L66A 3PHAA 4BY3A 3VFLA 2W0UA 4L9XA 4MGGA 2AL1A 4JYDA 2I5QA 4L65A 3WBAA 4LX4A 3HPXA 3CNYA 1RK5A 4D6HA 2CPUA 1HFBA 3V18A 3GWQA 1G0CA 1ZSXA 4QJ1A 4J2MA 1ISWA 2YZRA 4LCSA 3GFZA 4E4PA 1HKMA 5FEPA 4FNRA 2F2KA 1D8WA 4UB9A 4OHQA 1WKFA 4F9DA 5J04A 4H9VA 1KRBC 3FYYA 2G8ZA 2OOGA 5DRCA 5EFDA 1Y8BA 2HXUA 3VO0A 4N42A 2ZC1A 1FY6A 3T1GA 1M03A 3A4XA 5CPQA 3SY8A 3DG3A 1Z9AA 3VNKA 4UMCA 3ARYA 3LENA 1V0MA 1THFD 1GQKA 3G0SA 3V0TA 3C3NA 3SCQA 4UTWC 1M01A 3ISIX 2DJLA 1K1DA 2CBIA 1XBYA 3R1ZA 3IJLA 1DJHA 2Y5JA 1J01A 3WFAA 4D8LA 3R0DA 3GTNA 4PTDA 4RPQA 1KM4A 1V3LA 2OX4A 5DF0A 1VBJA 4WHBA 2JFEX 3G1AA 2R14A 1DTUA 3MHGA 1C8XA 1CXHA 1M41A 2YYUA 4RK8A 4X9SA 3G8RA 5CBIA 3VKCA 5LA1A 4EIVA 5CPMA 4YCPA 2HEJA 1TTIA 1E72M 3NA8A 4ATLA 4D6EA 1FCVA 4GE8A 4IPLA 4NNBA 2VFHA 4N0RA 3I4EA 1HTIA 3VKDA 3L4TA 1IIGA 1TUFA 4I6VA 1QNVA 3TXVA 4Q4PA 5H91A 1T8QA 3R2GA 4RE4A 1UWAA 2V2CA 3H22A 3QH2A 2YJQA 1ODZA 3LNMA 2OQYA 1LL4A 1ZBKA 4QISA 5FEXA 4Z42C 1IYXA 1QATA 4EWJA 3THAA 1EZWA 1SW7A 1V93A 4MJ2A 3NDYA 2B7OA 2R91A 3PNZA 2Q09A 2VDHA 2QULA 4NYUA 3HGSA 3W00A 1FH8A 3QW3A 1TIWA 1F5ZA 4BA0A 2BHUA 1SJCA 5I3FA 1M53A 3WQCA 1G94A 4CCDA 3V1HA 1XI3A 2WM0A 4GIAA 4UTUA 1XYCA 3DFQA 3ABOA 3QV6A 4M1RA 1G7UA 5IBXC 3P80A 4CEXC 4ZQCA 1A5LC 3GH5A 2GDVA 5D4YA 2CNCA 1EJTC 1TMHA 2PWVA 2BXVA 4IP7A 3W7PA 3GBDA 4PCFA 4V28A 3ZS4A 2QCEA 3FV9A 2BLEA 3FSTA 1B3ZA 1KBBA 2G96A 1OY0A 3E2RA 3BG9A 3VE9A 3S4TA 5A6BD 2ALDA 3W2KA 2EJAA 1QPQA 1IE7C 4UQDA 3L65A 1WP6A 3BGGA 3B04A 4JS3A 3BPWA 3CYVA 1PB0A 4GMEA 4BF9A 2V6AA 1L6WA 3CS2A 4GJJA 3F2BA 2QMKA 1ITQA 3RX4A 4YVPA 3BOLA 3T9PA 3P7YA 4N9DA 1UWQA 4TX9A 5HPCA 2JKPA 3PWGA 4H8HA 4OQVA 4G5DA 2C1IA 4MG4A 2E8ZA 1B3YA 3KFTA 2I16A 2BASA 2EF9A 4NZ5A 3GNOA 1R3VA 5BOFA 2V2HA 2Z00A 4RDZA 4BQ5A 5I3JA 3WD0A 1RLDA 1ICPA 3T44A 4H8VA 1A5KC 1US3A 4LWWA 3LTYA 3HIJA 4G6CA 1FHUA 1R47A 1RBAA 2NUXA 3GR7A 3GUWA 4PMXA 5E1QA 1U83A 4R5EA 3LNPA 4ONVA 3RCMA 2F61A 3ARRA 1S39A 4B4FA 2Z1SA 3H2FA 2XIIA 1ZPTA 3ABZA 2RGLA 4UFJA 4I5XA 2W27A 2QPUA 1HJSA 1OCJA 4I8DA 1QU4A 1IEWA 3W3OA 1HT6A 2G4FA 5HNUA 3K2GA 1FQ0A 1XH0A 3T05A 3CQHA 3K8KA 2Y61A 4IGMA 4FP1A 1LRQA 3EX2A 4CNUA 2J7FA 4LC8A 4YHEA 1WNOA 4C6DA 4RZ4A 2VM8A 4UFLA 3PSWA 2EKGA 4AF0B 1V79A 4DUXA 4DM2A 4GXMA 3LK6A 3BOXA 4GNKB 2CHNA 1XLJA 2OYMA 4GINA 3VMNA 1IT8A 3H4XA 1F7BA 2BGQA 3ZLGA 2ACSA 5FJJA 2XIJA 2Q01A 3MI6A 5AYIA 3THUA 2CFFA 3U9IA 4H9MA 4JQAA 4RNFA 1KA9F 3DI1A 1S2VA 1XLBA 4XBSA 3GE7A 4LBUA 2W4XA 3B8WA 4HNCA 5CLTA 2NW0A 3B8IA 2Y5EA 2YA1A 3HOJA 4FF5A 3QY8A 1KXHA 2DZAA 3H53A 2W62A 2OZ0A 3E5BA 3B0XA 3O07A 1WDSA 1JZ6A 3QOKA 1UD3A 5A6LA 4MB1A 2E68A 4LEFA 4B5WA 2ZUUA 3EWBX 3R58A 5IDIA 1TWZA 4O1CA 3TYAA 2YPIA 3TYCA 3L2MA 5G1TA 3STGA 4HN8A 1PZ2A 1S3TC 1Q7QA 4W8BA 1GEHA 3VCNA 3TE9A 1EKOA 4HHLA 3A12A 1K9TA 4O50A 3IIXA 1BYDA 4UNKA 4I6KA 4MB5A 6TAAA 4ZENA 5CLWA 2DY3A 1O1HA 4PB5A 2PTYA 3W7QA 2J27A 4MNJA 3CMJA 1FX6A 2LLEA 4Z1AA 1XQLA 4JD4A 4JNYA 3MP4A 4JY9A 3GNRA 4WOQA 4NZ3A 3L2IA 4DF0A 5HQMA 3PK7A 1GNXA 4GFSA 5JXQA 4JGDA 5I09A 3G5EA 1MUMA 3RK8A 3MMWA 4XG1A 4LY4A 3N4AA 3POHA 1ISVA 3AZTA 2DV0A 3ANYA 5HUOA 4KIEA 3LSBA 5C9WA 2GVLA 4ENLA 4MZ1A 1Z42A 3MHUA 2F38A 2YDRA 1CENA 1KFWA 5FAGA 1E6PA 4BJHA 3GKAA 3ID7A 3PG8A 4HKPA 4YHGA 2PCEA 3AICA 4GZ7A 3WQ8A 1ZJBA 2YDQA 3I7RA 3G0UA 1OFOA 1XYFA 4Q4KA 3MWCA 1KFBA 3IRSA 1C92A 3FKKA 5CZTA 2NSOA 4JN7A 3LUTA 4AZCB 3UNTA 3MU7A 3AIQA 3BAIA 4O14A 3NQVA 4H4IA 1Z48A 2XN2A 2QCDB 4BF7A 1JVNA 4YU1A 3B06A 3CV6A 3PJXA 1FCUA 2PDPA 1P7TB 3QGKC 1FHLA 4EAYA 1UR4A 4ACYA 2PTZA 2WZEA 1E0WA 5JBDA 1HKJA 4Y2WA 1RD6A 2PTDA 3UERA 4RCXA 1LQAA 3G1RA 2BBFA 5E09A 5DRIA 3T0TA 4RE0A 5JU6A 5CXPA 4A4AA 1VGAA 2W66A 5AYXA 4EXAA 1EH9A 1VBHA 4ZFMA 3RCYA 4LU0A 1RCQA 2ZBTA 3B8SA 3DIPA 3UD6A 4GPNA 4JIPA 1ESWA 3UGVA 3W76A 4Z1YA 3LM3A 3BW3A 1XBXA 2PUZA 3S1WA 4DWSD 4BWLA 1MFVA 2E7FA 4DVOA 4DJFD 2YBTA 2ADAA 3PUEA 1XP3A 4O0QA 2JEQA 4RPPA 5C2CA 3EDDA 4O4WA 4QS6A 3N25A 1XSIA 2IXUA 1V7AA 1B4KA 4IZGA 1RBOB 2VX5A 2A1YA 3OU8A 1O5QA 3LZ3A 3BSHA 4A05A 2NX3A 1AJ2A 2ZXDA 3AHTA 3UPWA 3ZJKA 1UC5A 2R1PA 1DWHM 4UCFA 1V3IA 4JPGA 1NDYA 4OFCA 1MUWA 1ZCOA 4DAIA 3E6EA 1VP5A 1I0DA 4PMZA 1BSIA 3OBKA 4C6IA 3OLGA 3TTOA 4XKYA 1BTMA 1SVDA 2XFFA 4Z2JA 3MO4A 3QHMA 1AODA 4Q8MA 4MWAE 5HR7A 2QKFA 2CESA 1A3WA 3AIVA 1F6KA 2Y6ZA 3PZTA 2O9OA 5C0QA 3VMPA 1LQ2A 3DCPA 4FI4A 6ENLA 2WJZA 3GDMA 4U33A 1TVLA 5LIYX 2W61A 1HGWA 3UR8A 5IHRA 3POCA 5IXEA 1VBUA 5AC4A 3WH9A 3TSMA 2ZX5A 4BHYA 3KBWA 1ZBVA 3CUXA 4JN6A 4RNIA 2NX1A 2P3EA 1LLZA 2YB4A 3OO2A 2QGHA 4LGXA 1TX2A 2PDJA 1EF3A 2CERA 2QMJA 1J0YA 3G1VA 1A53A 3WH8A 1VPQA 3P60A 1GUVA 1Q6FA 3UZZA 1K7FA 3VVGA 4D6IA 4PTMA 5GVJA 1V6TA 9RUBA 2VQUA 1XLHA 1W9VA 4JX4A 3PFRA 4ZOEA 1BG4A 3NL3A 3USBA 1PTAA 1E43A 3FLUA 2CZVA 3THCA 4DO6A 2IKHA 1VRXA 1H62A 3QYSA 2Y8VA 3UVAA 3WBWA 3UR5A 4Z1DA 2QVHA 3CUHA 3E0LA 5E9XA 4N7QA 3TC3A 2ZDRA 1Y5XA 1Y65A 3NDZA 4A35A 1YDOA 1UR2A 1NEYA 5F1VA 1L6GA 1Q4WA 1DP0A 4KF1A 4W7UA 4S3EA 6REQB 4UQ9A 1GVRA 1GYLA 4JDYA 2QPXA 1KBLA 1JDCA 1S5TA 4L4LA 1AL8A 1DXFA 4J35A 3ARPA 1BYCA 3RM8A 4DF2A 4HYRA 2RJHA 4ERGA 1FUYA 1NWRA 3VI2A 3BG3A 4JTUA 1ZHAA 1OX5A 4HZ8A 3T2PA 2VT0A 3MV11 5MF5A 4FAMA 2QDGA 4R7WA 3CBWA 3STCA 1GOKA 2WKGA 3JVAA 4B90A 5KZEA 5CPNA 3ZZ1A 3C2RA 4CCZA 3FX4A 4H6QA 4J28A 1SO6A 3N1AA 3QR1A 1T40A 2YA0A 4C65A 5D30A 2DT2A 3URNA 5BYWA 4P8XA 3VIGA 3EAUA 3PM6A 1RBLA 1LLWA 1F73A 3LMZA 3QTPA 3FXGA 1NWSA 2OO0A 1JCMP 4L56A 2VRQA 4HSHA 5JH1A 4RKAA 3QC0A 3WQGA 2QEZA 1S38A 1Z89A 1VBRA 3UXKA 2IMRA 4O0ZA 3N6JA 3N4FA 3T07A 3DHPA 1IGWA 1MQRA 4AD3A 2YBVA 3NQMA 3ZJ8A 3ZIZA 3CO4A 3BCFA 3BGJA 4NP7A 4UTJA 2IS7A 2CLEA 1TWDA 1A5CA 3HQPA 5HULA 3WF1A 4PUNA 3O2LA 2OXNA 5DO8A 4C5ZA 1AUSL 3IJ6A 3GHTA 4MUZA 1AZ2A 1P0BA 4ZXLA 2NT0A 4PL1A 1GKQA 3MANA 3I6RA 2REQB 1OF8A 2V5KA 3KS6A 5M2FX 2VL4A 4QEHA 4XZIA 2PWHA 4UFIA 3VOIA 5M03A 1YPFA 1YBQB 3AYSA 2B81A 4IQDA 1MI3A 4C1LA 2VGBA 2YGYA 3CEPA 1Z32X 3BGAA 4GISA 2GYIA 2X1RA