1R3QA

Uroporphyrinogen decarboxylase in complex with coproporphyrinogen-i
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
357
structure length
357
Chain Sequence
GFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for tetrapyrrole coordination by uroporphyrinogen decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uroporphyrinogen Decarboxylase
total genus 126
structure length 357
sequence length 357
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1r3qA00
3BQ5A 3GVWA 4L64A 3GW3A 2EJAA 1U22A 1U1JA 1R3YA 1U1UA 1JPKA 3L7RA 3PPFA 4WSHA 1XPGA 3GVVA 2INFA 2Q71A 1XDJA 3PPGA 2Q6ZA 3RPDA 4AY7A 3BQ6A 3GVQA 3T0CA 1R3VA 1R3WA 4AY8A 4L5ZA 3PPHA 4L6OA 4QQUA 1R3TA 1J93A 1JPIA 1R3QA 4ZR8A 1U1HA 4L65A 1XR2A 4L61A 3GVRA 1R3RA 3CYVA 3GW0A 4L6HA 2NQ5A 1UROA 3PPCA 1YPXA 1T7LA 1JPHA 4ZTYA 4EXQA 4ZTXA 1R3SA
chains in the Genus database with same CATH superfamily
1GVYA 1ZS2A 1F3TA 1J4EA 1NP2A 1TJ2A 3S1UA 2I5IA 2DZXA 4DY1A 3BG9A 2J9XA 3W1UA 2GQ3A 4U33A 3NEVA 2PZNA 1J5SA 1HP5A 1SZFA 1PIIA 3MO7A 3L67A 3IVSA 3VIOA 2FVMA 3GR7A 2ISDA 5LA2A 2YDQA 1PS9A 3L66A 1OABA 4Q8QA 1QATA 4O1BA 2XM1A 4LALA 3G3DA 1A4LA 1L6SA 2RDXA 3LI0A 3HF3A 5LNSA 5A3HA 2XN1A 1TJ0A 1KQYA 1UD5A 2D2JA 1NWRA 4GX9A 3Q67A 3K1DA 4GJJA 3QSTA 1R86A 4TQTA 2JEQA 2VGFA 3GD6A 4AFYA 1R3SA 1US3A 1BEUA 1RAKA 1NDYA 3RPTA 3IACA 1D3HA 1SW0A 1KM3A 3HG5A 3UPWA 1R85A 2JGYA 2I5QA 4XD4A 3LENA 1E5JA 4C6OA 1KQZA 4ZVJA 1E56A 4CD8A 4NZJA 3B0VC 3RM9A 2FVLA 2Z1WA 3GRIA 3I7QA 1XIBA 1WCGA 2YIHA 2Q6ZA 4BJHA 5AECA 3KXQA 1XIHA 4K38A 4WDXA 4GH3A 2J47A 1ME8A 1WE5A 1DJZA 2I14A 4Q3MA 4PMNA 1OADA 5LSMA 4CD6A 4ZQRA 3B4YA 1M1BA 3ZSTA 2QV5A 1LTDA 1WZKA 2WHLA 1POKA 3FIGA 4XTIA 2PSNA 1SZRA 3QV9A 4POCA 4PGLA 4DO7A 3S1GA 2DGAA 4PMZA 3MC5A 4J3WA 2A3EA 3NCOA 3TZNA 3LHYA 3QZEA 4CGTA 3QQ0A 2D0FA 3EDFA 3ZWSA 1QHOA 3NPWA 4M82A 5U7SA 1OHLA 3LUTA 1YPIA 3EX1A 1DWAM 1DOSA 1REQB 1FQ0A 3IJLA 1RCOB 2UV8G 4XZIA 1UP3A 3V1HA 2PWUA 1YYAA 4D1IA 4IJBA 3SUUA 3SN4A 4QIUA 4F48A 1RH9A 1H49A 2DORA 2C19A 4MWAA 2ZC1A 5J8LA 4QJ1A 2ISWA 2IUZA 4O18A 5HULA 4ERGA 1YMYA 4N9BA 5BXTA 4MYXA 4FK9A 3GWQA 4K3ZA 3A3HA 1R87A 2QCEA 1GVIA 3C52A 4A3RA 3TC7A 3IJ7A 3SCTA 3WBXA 3CHFA 5C5YA 1P0NA 1P1MA 2MUCA 2VXNA 4YYFA 1EHAA 5A1AA 1XKYA 6TAAA 4ATLA 2ZRYA 1W2VA 5CPSA 1KXVA 1US0A 3SB0A 1RR2A 3VNKA 4ZO7A 5A8NA 3DC8A 5D05A 1ECQA 2QW5A 5FEPA 4UTHA 4J3VA 5J04A 1DXEA 1EIBA 4E3TA 1I75A 5LZLA 2KZHA 4YNGA 2YA2A 1R47A 2FPVA 4P8WA 2NUXA 1ICQA 3OA3A 4C6PA 1XPGA 3W84A 4QLKA 1V4YA 1M3UA 5CCZA 4UTKA 1E5NA 4AISA 1FWGC 3GNDA 3KVJA 2OU4A 3NQCA 4NQ1A 3LCFA 2R14A 3WF1A 4EK7A 4NG3A 2O4MA 4GQ0A 2QCCA 4C1LA 3EWWA 4WVXA 4ZL1A 3DN5A 2VURA 3IEBA 4ZOBA 2GUBA 3CO8A 4GY1A 3IK2A 4Q8OA 3W26A 1VRXA 4GO9A 1HJXA 1L6YA 3WDIA 3S42A 4PULA 4UQEA 1ISXA 1RCQA 2D20A 3E2VA 3A22A 3SADA 3RUBL 3QFEA 3N13A 3VNJA 3UETA 3LQGA 1V6XA 2DSZA 2GK1B 2DSUA 3TN3A 3W7QA 3RX3A 2YXOA 1E6PA 1OD8A 3E74A 3BOXA 4W86A 1JJKA 3G8EA 2NQZA 5HMEA 1NWSA 2YCEA 5AHFA 1T8XA 4FALA 3HPAA 3FK4A 3QOKA 3W83A 3VOFA 2I16A 3VABA 2CLPA 4CVWA 4HNNA 5G1YA 4B2DD 4XKYB 4QITA 4RK8A 4DLFA 4H19A 1YDOA 1XV8A 2P3EA 4MF4A 1GQNA 4GPNA 1FWSA 5DMLA 2G4JA 1GTEA 4JCMA 3AMGA 3G5EA 5EYWA 3P8JA 1TA3B 1KKRA 1ZBCA 3E02A 4GJ1A 1PDZA 2V5BA 3GNXA 3B9OA 1DORA 1RZMA 9XIAA 1KM4A 1HN1A 2FZNA 2XH0A 5DF0A 2F7FA 1Q6GA 3H7RA 3VKBA 1PZ1A 3R79A 1HXJA 2I9UA 5KZ6A 2XM2A 5G1MA 3SCSA 2NUWA 1TE6A 3U2CA 3EKLA 4A2RA 4L80A 3KBWA 5BWFA 4O52A 4HA1A 4V33A 3BQ5A 3AALA 4GKLA 1B2YA 4RDVA 3AXMA 3ZR4A 4DVOA 2BB0A 3NQ2A 1DJQA 1UR1A 3G1HA 4BQ4A 1DBTA 3GYCA 1PZ2A 2YLLA 2XGZA 1ONRA 4K8GA 3S4TA 1EH9A 2QHAA 6PTDA 2Z26A 3RO6A 2ZZ5A 1FWWA 2PDYA 1BWLA 3AMKA 5JMUA 1VC4A 1RP9A 2F84A 5KZDA 5JBEA 4XZNX 3U2ZA 1K8CA 1NARA 3FA3A 3GZAA 1CPUA 4IP4A 5DX7A 3ZT5A 4MB4A 1VFMA 1HVQA 1RVGA 3FDGA 2WMJA 3TTSA 3GTHA 1KBIA 2DQWA 3N04A 2PZ0A 3W2KA 3ZLGA 3M0KA 3VZZA 3W7OA 3RK8A 4HSHA 5B80A 4L9YA 1E6NA 5M17A 1OCBA 3MDWA 1KCKA 4B5TA 4ES4A 2F6KA 2G41A 1I2PA 3M1ZA 3PWAA 5GJMA 4Y8EA 1CXFA 3TMQA 3SFWA 5BXSA 4J3UA 2JIEA 2GOUA 3VDHA 2WSPA 3OZYA 4MZ8A 3UESA 1H0IA 3AIRA 1TV4A 4R9XA 2H9AB 2R6OA 3RHGA 3T05A 4XD3A 1WA3A 4JICA 5CAHA 3ARTA 3QW3A 2W67A 4NRSA 4OTKA 3MMUA 4PCSA 5DMMA 3N19B 1TCDA 1W9VA 4C7DA 3BW3A 4FX6M 3VAVA 3M07A 5AKQA 1UZHA 1FWTA 4Q4RA 1DQWA 1H4PA 1TWIA 1KC7A 4HKPA 2WZHA 1HL9A 5G2HA 5E5CA 4REQA 3BMWA 2ZQ0A 1KCXA 1P4CA 1BRLB 4RW3A 2C1IA 3HJEA 1AZ1A 3JR2A 3NZQA 4A3HA 2DT3A 4GQGA 4IX0A 3UT0A 3GC2A 3CZEA 3LGEA 3IUIA 2P88A 1I2NA 2G3JA 4F8XA 3FGCB 1EGMA 1FCUA 4K7VA 2WW5A 3APTA 1WBJA 4M6VA 3BG5A 3BK0A 3STEA 1K9FA 2CZFA 2WO5A 4ORMA 1JCJA 1RPKA 1G67A 4KF1A 2JK2A 3SJNA 4JTDA 5CBJA 3EOLA 1K4HA 2VDHA 1PKYA 4KGJA 4D2JA 1ZU8A 3KCLA 2XIIA 3T42A 4Y96A 3GVRA 2FFIA 3PJUA 1ZCCA 1DWJM 2VC7A 4K39A 1JQXA 1UBSA 2O0TA 3REQA 3UW6A 1UC5A 4LX4A 3ITLA 5HMSA 3H4GA 4B5XA 3WUEA 1A5OC 4NSBA 3W2JA 1UA7A 1UWIA 4F79A 3WLJA 1H1NA 1VJIA 1PWLA 1OY0A 4RE0A 1LRTA 1SVDA 1RK6A 4PH6A 3FAWA 5CPQA 1GVRA 1W5PA 4Q8UA 1VCVA 3QYSA 8TIMA 4AD1A 1KWKA 3GU2A 5A6JA 4B4FA 4WK9A 5AC6A 1AJ2A 4N0RA 4GI8A 6XIMA 2NT1A 2OSXA 3MT1A 2J7DA 1UHVA 4FS9A 4A8RA 3KE0A 3FYYA 3CNYA 5HDRA 9RUBA 3M0XA 3I3BA 1TV3A 3ALFA 5CZSA 4AIEA 1CW2A 1GUVA 2GDVA 3O6AA 3W1AA 1KCLA 3PG9A 4L64A 4OOZA 4K8HA 2HBVA 3EPOA 1BWVA 4FLRA 2A6LA 1LLOA 1DWFM 3AROA 3A4AA 2CZDA 1L6GA 3T2OA 1UD4A 3VCRA 5H91A 6ALDA 4AC1X 3IK4A 2WPBA 3FJNA 3K2GA 5AYXA 4JTSA 3DC0A 2VFIA 9CGTA 4LRTA 2WV8A 3TN6A 2PI6A 1FKXA 1ZLPA 3L4XA 3IANA 3NQAA 1OX5A 2HISA 4AHOA 2DUAA 4O10A 1DIDA 2PDXA 1ICPA 2V38A 3H22A 2QQ6A 3MHFA 5IDIA 1CGUA 3WNPA 4AMAA 2PCEA 4YIWA 1E51A 1K03A 1HJQA 2C1GA 1WXYA 1HT6A 1B3VA 4RXGA 3KS6A 2W61A 3N15A 1QNQA 4IMEA 4MJZA 3UJEA 3WD4A 3WMSA 4UMCA 1HX0A 3VFCA 3S9ZA 3Q2DA 1D8CA 1SYTA 2AGTA 4BK9A 5A95A 1DQUA 4L9XA 2OZ8A 3XISA 2QCNA 1G4TA 1XLCA 3NQVA 1QO5A 3MVIA 4WXYA 1K77A 3RFAA 4ZQCA 3GHRA 2DW7A 3GDTA 1L2UA 4LBRA 1SR0A 1DHKA 5FL0A 3C8NA 4R53A 4IPNB 2W62A 2R9RA 4ATWA 4AZ5A 3DYMA 4LUIA 2J7CA 4LS1A 1ML1A 1W3HA 4NVTA 3VFLA 1TPWA 1F73A 3OZOA 2E8YA 5BXRA 2AKMA 3O15A 2ALDA 2PTZA 1W0MA 5C9RA 1CLXA 3NPXA 4DBEA 4PMOA 2AQWA 4YWSA 1JDAA 1DWGM 3IGSA 4P5UA 4HA0A 5L6UA 3INPA 1FWIC 3SM0A 2DIKA 1VYSX 1QPKA 2OQHA 5E6ZA 3IRSA 1CEOA 1VCGA 3R10A 4PEEA 3B0YA 4MWAD 2ABBA 1M7XA 3GTIA 1UH2A 1ZZMA 2A2IA 1W31A 4CNNA 2PWEA 4X2RA 3W0KA 1S1PA 2O4QA 1J2BA 1KFEA 1QT1A 1MNSA 5C2CA 3O7UA 4C6IA 1UR4A 4HB7A 4C1NA 2VFDA 3H7UA 4JFVA 3FOKA 2YCKX 2J8GA 1FWFC 1AH3A 3FHQA 4JTIA 1HKJA 5MKGA 1JPKA 1OCQA 3W6LA 2VL4A 2RDWA 4IXXA 1GQLA 3GG7A 3PF3A 3F4NA 3M6YA 4ATDA 1XCFA 2PTXA 1GG0A 1ECEA 3QHOA 5FF7A 2D2GA 3ME3A 3R0UA 5LIKX 5CG0A 2VZUA 3DAQA 1P0KA 1PEZA 4IH3A 4Q7BA 3G1DA 4INFA 1SZGA 1I60A 5I3IA 1HZYA 3AXIA 3NO3A 2YXGA 1FP8A 3B9NA 2YL8A 1TTIA 2ATMA 2WOQA 3B8IA 3DBPA 4DLMA 4JX5A 1B0IA 3T0CA 1A3HA 3CAWA 2BY3A 1JCLA 3O07A 2CETA 4FO4A 1R0MA 4E2DA 1GJWA 3P67A 4XAYA 4AVNA 2V6AA 1DL3A 1GOKA 3ANUA 2HRWA 5D38A 2GDQA 2YCIX 4HSNA 2YGYA 4LYQA 4ENLA 4G7EA 3LM3A 3W76A 3B9AA 1ZAHA 3M0LA 4FOKA 4KCWA 1X39A 3TEVA 3N73A 2J27A 1LBFA 1IZKA 3WQGA 5LIXX 2IQTA 3F2DA 1YW1A 4FB7A 1V8EA 2ANUA 4PMXA 3PNUA 4OBTA 4EANA 2VYOA 2X42A 3ABXA 4JTEA 3CL6A 3GSMA 3NQEA 6ENLA 1ODZA 4LAUA 5EMYA 3CAKA 3APYA 1O60A 4GYKA 2X7WA 3S83A 4UTIA 4YYCA 2FPYA 1Y65A 3BW4A 4E8CA 4F66A 5FSDC 2E40A 1KM1A 4ICCX 5XINA 2W5FA 1HTIA 5DEZA 3WEMA 4BY3A 4N9DA 1MUMA 2F61A 2W3ZA 3ITTA 4WKAA 2BV9A 2V3GA 2ZX5A 1QHPA 2HROA 2XVKA 3P74A 4MAVA 4CNSA 2CLHA 2Z28A 3KLLA 1MXDA 2ZIDA 4FLOA 3O6CA 4ERAA 2WJDA 4L4PA 1ESWA 3WDQA 3VO0A 3PZ9A 2ZTJA 3QV6A 3T8QA 5HR7A 1XIGA 4QQ3A 3RF9A 2PLMA 2VENA 2DZBA 5MF5A 3GBDA 5AVHA 5HMFA 3OVPA 3B4UA 5K9XA 3OLGA 2YFOA 3OJGA 1GVFA 3P60A 3P2VA 3HU7A 1E9LA 1QOQA 1V3LA 1Z44A 2QCHA 3A6OA 3SZ8A 1NY1A 4ZOAA 1F6KA 1PYFA 4PFHA 1L6FA 1QPQA 4IISA 3NZPA 3W1QA 5A6AA 5MHBA 3PJXA 4Q8WA 2O92A 1FWNA 4WD0A 4L6OA 4PUKA 4HK5A 3NXFA 5J5RA 2V3FA 2RAGA 2QUMA 1B9BA 2Y70A 3NSNA 3O16A 3LBMA 4D71A 4HOWA 3UY8A 3OTRA 4XBJA 2ZKMX 4FF5A 4S3JA 2GFTA 2AL1A 4YHGA 4MWAC 5A6TC 4QG6A 4NP7A 1VCFA 4FOUA 4TXEA 2QUVA 4E6MA 1Z48A 2QDEA 2ZA1A 2NX3A 2PA6A 3SCUA 2HE8A 4EXAA 4DPQA 1ONWA 3FXGA 5LIWX 4MY9A 2NLYA 1M01A 1O5QA 3QVQA 1JEZA 3TZFA 3LCLA 1P43A 2HXTA 4LQ1A 1IYXA 4Q4QA 1F8MA 1E6XM 4MMWA 1K8YA 2PLCA 1NFGA 3DU0A 3NOEA 1XLJA 5EPDA 1C8YA 3C86A 1F6YA 3A12A 1SW3A 6TIMA 4MUZA 4ILSA 1VBJA 3L2LA 4OJYA 4RX0A 4OU1A 1G1YA 4KWVA 1GVEA 3N14A 2WNZA 5CGQA 3HGRA 4KGLA 3WK3A 1UP0A 1OX6A 3KOFA 1OC7A 1RQBA 3BH4A 1QW9A 2ZZ3A 3KRUA 4TX8A 3TK7A 3ZZ1A 2PFHA 5AYIA 1DVJA 4J9JA 1PZ0A 4D6GA 3A4XA 4RKAA 2GUYA 1TB3A 4HU8A 5HINA 3MKKA 1ALDA 5ENLA 3W1XA 1EX5A 3NOYA 3ARXA 1E6SM 4LC8A 4FNTA 1R38A 3QHNA 3RN6A 3I10A 3BGJA 4YVVA 2G8ZA 1BXBA 4NI8A 4AD2A 2F6UA 5U4NA 3GFXA 4KESA 2CBUA 2WZIA 4RDYA 5BYWA 1HUVA 3W70A 4XZBA 5F2MA 1R9YA 5ABFB 4RDWA 3TA9A 1XG4A 1YADA 3M0IA 4P7LA 1J96A 3LRLA 4L6DA 4Y7EA 4J3ZA 2DJXA 1R9ZA 4F0HA 4AY1A 4XAFA 4MTVA 4XK2A 1RVKA 1Q8AA 4NXSA 1XXXA 2AQOA 3TP4A 2XJ7A 3LLDA 1NELA 2HPIA 3E6EA 3KHDA 3VNDA 4BR1A 3TQVA 4P8VA 3RMEA 3LSBA 1CZ1A 1XDJA 3OLDA 3CUIA 2WKLA 4RZBA 3C0SA 4NZ4A 3QEZA 1US2A 3CWOX 3W7CA 2FH8A 1T0OA 2GJPA 1X7IA 4WX2A 3WF3A 2Y7EA 1RD5A 3CIVA 2REQB 4ACZA 1UKTA 1E0UA 3AMLA 2YL5A 3U0HA 3WLRA 1PV8A 1LRQA 2OO6A 1QI5A 4W84A 1C93A 3QR3A 5XIMA 3TYCA 2WC4A 4A21A 3W7RA 5GVJA 1GOXA 4S1FA 3AFBA 1TPC1 4GVFA 3TC3A 1ZNNA 1WPCA 1I45A 2CZVA 3A5VA 2QAPA 4JN7A 1G4SA 2VEGA 3WK0A 2R94A 5HJXA 4IMGA 1A80A 4ZMGA 4EP8C 4N9CA 3S2JA 1KKOA 5EMLA 4XG1A 5HMDA 3H26A 3QSRA 4C5YA 3CV6A 3LU2A 4AZHA 5K3VA 2J62A 1EO5A 5CC6A 2ISVA 3H2AA 2BVWA 4O0KA 2IKJA 5DT5A 2UZ9A 1CGTA 3RM4A 3PZNA 5I5RA 1QW8A 1XUZA 3KRZA 3W82A 1MDRA 4BI5A 5FEXA 1BSIA 2OEKA 3IJQA 3NL2A 1LBMA 2A85A 2X1TA 3AWOA 1PKLA 4P7QA 1J0HA 4AH7A 4GQRA 2OYMA 4FPSA 3U2OA 1MFUA 2YZ5A 3HZ3A 5DFAA 4EAMA 1H1ZA 1TJPA 1P6BA 4HZMA 1SJAA 1ZCOA 5EBUA 3QMTA 1LQ2A 1ADDA 1XIEA 4IL2A 1JI1A 3ZR6A 2O9RA 1IXNA 1VJSA 1WDPA 4GVIA 1E43A 3E2SA 1C3FA 3G6MA 1WDWA 1NFPA 2YXXA 4FIQA 4D72A 5SWUA 2A7PA 1K02A 3NQ6A 4C7GA 1KFCA 4TIMA 3KHJA 4U2YA 3T8LA 2INZA 1EF2A 3CH0A 4LUJA 4IJCA 2WC3A 3IAQA 3NL3A 4EKJA 1JI2A 1QI3A 1UASA 1A47A 4PL1A 1JL8A 3BLPX 2A3BA 4EXQA 1AVAA 7CGTA 4M80A 1FH8A 3V5CA 4OIFA 3NZRA 3AOFA 4JX6A 5FF3A 3WQ8A 1EEXA 4RV3A 4DZ5A 3AIVA 2R8WA 3E49A 4LU0A 3JU2A 2GGEA 2QLYA 1DYSA 4DNMA 3ZSSA 5AYYA 1MZRA 2EGZA 2I5GA 4UB9A 3ABSA 4DAFA 1JD7A 1TRIA 2OKOA 5A8GA 4NX0A 2VJXA 1E3ZA 3T2PA 2Z1VA 5HA7A 3UWQA 1IT7A 3RRXA 2VZOA 1ZTVA 3AYSA 4UTMA 4RZ6A 4WKFA 4AWTA 3THDA 3R8RA 4JQAA 4JR5A 3B8SA 2D0GA 3ZO9A 4PUWA 3I6TA 1SSDA 3RG6A 5CC7A 4BQ2A 2ZADA 3V75A 3SUWA 5HATA 1PTGA 1CGXA 2JKPA 3TV8A 1HP4A 1OFEA 4IWWA 3BLDA 1FWEC 5LGXA 3G1VA 1OZMA 3IUHA 1UJPA 3T0DA 1UG6A 4HNUA 3C5QA 3KZPA 4AZ7A 4QJ5B 1LUCA 2GSHA 3TCEA 1P48A 3PP7A 5H8UA 3NG3A 1J0IA 3GVQA 1DE6A 3EWBX 3LNPA 3DHPA 5A6KA 2DW6A 3W7LA 3OGRA 4TOQA 2NSOA 1EBHA 1GVOA 2D24A 2CHRA 1TPEA 3LV6A 2G5WA 2DUZA 1TIWA 4ZFCA 3BSGA 1MRQA 4PTXA 3RAOA 2P5NA 2ZYFA 1V6WA 4IQEA 2QDGA 2D3LA 2ZX8A 1TE1A 1I2OA 3FXYA 4X0VA 4Z2HA 1WAWA 3NNTA 1SO3A 3EKGA 4IG2A 5A2BA 4LH8A 4HPJA 1RXOB 4HZ7A 4I5RA 3QFWA 4LANA 2DT1A 1WBHA 3GDKA 2GGIA 4A3YA 3OHIA 5C55A 1A5MC 4CEUC 3HN3A 4ZGYA 3CLMA 2DQXA 3VE9A 2V68A 3F4WA 1V08A 3WH6A 2VRJA 4HCLA 2Y6ZA 3LG3A 4KT2A 4LFYA 3WMBA 4AD0A 1ITQA 3GHSA 4Q4OA 2NXIA 3T40A 2DT2A 1Z3NA 3H2NA 3LV5A 3ARZA 1VFUA 4GC4A 3DFOA 1H7OA 3C0JA 4IIGA 1IEVA 1KM5A 3HIJA 1EX1A 3UZZA 2BY2A 4MJ4A 3MPGA 4HHPA 3NM3A 4X0NA 1AW1A 3GHUA 2Z1XA 4IQJA 3EEZA 1I1XA 2VZTA 5AZ1A 4PRTA 2W4XA 4ECLA 1LM1A 3E38A 1S2VA 4PR4A 4S3KA 4DM2A 1NAL1 1LP6A 3PUEA 2VX6A 4XB3A 3H2FA 1V02A 4GUHA 3MZNA 4NASA 2AL2A 1O5KA 3FEMA 3DFPA 3H2CA 2QF7A 3XIMA 4LUSB 2J6VA 5AHLA 4D6DA 1O66A 4PBGA 2AKZA 4E8GA 3WBWA 1OYCA 2VM8A 3FDKA 2QZRA 1XS2A 4JXCA 2C91A 2PP3A 1PSCA 3ZR5A 2E5BA 4MFDA 3WLPA 1OX4B 3BJTA 1B1YA 3TQPA 3GTNA 3IIVA 2YBTA 3UP8A 4M7SA 3MA8A 3PHAA 3U5UA 5E09A 2OO0A 4ZTYA 4DJDD 3G0UA 1XISA 1BYCA 3CHVA 1IR2A 4O8RA 3EWUA 1V51A 3RX2A 3RCYA 1YDYA 3TTEA 1XC4A 1C8QA 2QT3A 1YNPA 1TQXA 1JR1A 4J27A 1YLVA 1K1DA 1UMYA 1VP5A 3T6CA 2XPKA 4J40A 2E28A 3OIHA 1J10A 1VHNA 2X2GA 1T99A 2VZVA 2E8ZA 3T0AA 4YCOA 2NXGA 4PZVA 3LX9A 1DV7A 3VD5A 1C7TA 4B16A 3ZJ7A 4U31A 4XQ6A 4HMDA 3D3FA 4C60A 4NI3A 3RM8A 3B04A 3DFYA 2PDHA 1BYAA 2INFA 3BGGA 4EOUA 3W02A 2GJNA 5AY7A 3CQJA 4AD5A 1ZRQA 3PBYA 3H55A 4AEFA 3ARYA 3TYDA 3W7JA 3E5BA 3LN3A 4UTTC 2BGSA 4HMNA 3CHDA 1TRDA 4CNPA 2WC7A 1FX6A 4TVUA 5LIYX 1E6RA 1J0YA 4JEJA 2XZ7A 1UA3A 3NDZA 4NZ3A 4A8IA 4Q8NA 1OQFA 4C6JA 3SN0A 4XZHA 3LTPA 2JGQA 4D8ZA 1BTCA 3E0IA 5DXXA 3A13A 2J77A 5E70A 2Y85A 1JIBA 3QH2A 3C61A 1XG3A 3C4UA 3TYEA 2VI0A 3OQEA 3P5ZA 4MOZA 5LA0A 4E2VA 1NDWA 2GQ8A 1VFHA 4GYPC 3PPFA 3UWVA 4KW2A 3PTKA 5FF4A 3DOPA 3UYCA 2VOMA 2VCAA 3VINA 4IUGA 2CFFA 3PPHA 5G4HC 2TMDA 2V2CA 3WD3A 4ZB5A 2PU1A 3PK7A 1G9HA 3CS2A 4NJJA 1EJ7L 3S0CA 4MKNA 1MFVA 3CB8A 5I78A 1EXBA 4PUNA 1KM0A 3ELFA 3E0FA 4UQCA 2ZZ1A 3OVGA 1W91A 2VVNA 2R1PA 2ISFA 2W79A 1NOUA 1G7UA 1AL7A 3HQOA 4Z2LA 5LKYA 2OZ0A 4QR6A 3DBNA 2GJXB 4OBSA 5BMWA 4AEOA 2BVDA 1XGEA 1HFBA 4MJ2A 3B9DA 1A5BA 3DEQA 3T81A 3HMJG 5F2LA 2E5DA 4J3XA 1IT0A 1JUEA 4YVXA 2XYLA 3WLHA 2BOEX 3ORWA 1OD0A 2Y7GA 3EA1A 4I5UA 1J5TA 3K4AA 1IWBA 3WDHA 3W7KA 4N6FA 2FIQA 1VYRA 4HHHA 4CLMA 1OINA 3O1NA 1FH7A 1D9EA 1TR1A 1JG9A 4CCEA 1FCVA 4J3TA 4YU1A 4BHYA 5D30A 3CWNA 3W1PA 3E0VA 5FJTA 3DGRA 3VD7A 4W8AA 1PX8A 3I68A 3WFLA 5EMKA 3FJ4A 2PCQA 5CBIA 1LORA 1ZAIA 2F2KA 3WDRA 2XFFA 4IJRA 3SR7A 3MVTA 1QCWA 1UOZA 2ZCGA 5H6HA 4HPXA 1SJDA 4RNIA 2DZPA 1IE7C 1XBVA 3PUDA 2PB1A 1IEWA 4M5PA 5PTDA 4M1RA 2TSYA 3QKEA 3NPUA 2GWNA 3L4ZA 2J9ZA 1U5JA 3WK2A 2WBGA 2WLYA 1UKPA 1XBYA 2EPLX 2QPUA 1SR9A 2X30A 4FA3A 3UQNA 4C6MA 1YRRA 3ICJA 3FEQA 1YDVA 2J8FA 3WLTA 2QXWA 3VX1A 4QRNA 4ASTA 3GG8A 4DWDA 2VO5A 1L2QA 3CQKA 5FJPA 2NX1A 2PGEA 1ZSXA 3ATYA 4XVEA 3TNBA 1P5BA 1TG7A 5A69A 3LHWA 3CK5A 4JTTA 3MCOA 3H24A 3JRKA 1VFLA 3MTWA 2XVLA 2QCDA 4JIPA 1UR8A 3TW9A 3ZVIA 3OBAA 2OGYA 5DO8A 1QK0A 1V3KA 5D37A 2DP3A 3ECQA 3RRAA 4ZE5A 4Y2WA 4JFUA 2FJKA 3LHVA 5E9XA 3L0GA 4H00A 1MW3A 1A5LC 3DCPA 1P0EA 1NDVA 1QXLA 4QM1A 3ARWA 3DXIA 1GK8A 1Z42A 3ARQA 1B9ZA 4BZYA 3MUAA 4K36A 4IL0A 1VR6A 4CU6A 2YDRA 3KDOA 2EKCA 3EB2A 5I03A 3GVGA 1U5HA 1ME7A 3Q65A 4ZSTA 1QPRA 4JIRA 1XCWA 5H1WA 2G3NA 1LZOA 3N1AA 2EPMX 4IICA 2DIEA 1S3HA 3EGJA 1U1UA 5CH9A 3TW6A 2XFRA 3A9IA 4KEMA 4UNIA 2DIJA 2X0HA 3AUJA 3WJYA 4M6QA 1K9DA 2WB5A 2HJPA 1D7FA 2F2HA 4MAZA 4K7YA 4XV0A 3IVUA 1DWIM 3SY1A 3UZWA 4NJHA 2FJUB 3ZM8A 3O3RA 5CGTA 3G24A 3G1SA 1AA1B 1SQ7A 1RQHA 2F8QA 1VLWA 3W1NA 2JF7A 4UOJA 2BVYA 4I7UA 4GWEA 1RBOB 3BWWA 2FHBA 3L2MA 2HS8A 1EBGA 2D0HA 2PDQA 3QMSA 1XW8A 4WJ8A 3TDFA 3AO0A 3SJ3A 5FAGA 4TUFA 1IV8A 3CMJA 1Q3NA 1E3XA 1JCMP 4K2SA 1RSCA 3KTXA 5TF0A 2FB3A 2WQDA 3R2GA 3PUGA 4V28A 3BV4A 4CQ9A 5AHMA 3U4FA 3W2LA 3MV11 4KWOA 3S9YA 4S2CA 1NM9A 4I8DA 4LVBA 4GYFA 5F2IA 5I07A 1KXQA 1VYPX 1OF8A 1CENA 2P1FA 4ZB2A 1YHTA 1WDQA 1RLCL 2V81A 2OG9A 2NQLA 4QAIA 3ZS4A 3HOJA 1RA0A 2ZA2A 3E2QA 3W6YA 2RKXA 4ACYA 3W71A 4LAMA 3MI3A 1RY8A 2Q3OA 4Z1CA 2JBMA 1F5ZA 5HXMA 1DE5A 3NAVA 4L56A 2E67A 4E0CA 1M03A 2XH7A 3VMNA 1PPIA 3R6IA 3CHEA 3IV8A 3UVIA 5BW6A 4YJ5A 2GVYA 1XYMA 3P62A 2QCFA 3D5HA 2IPFA 2O55A 3C3NA 4PFMA 1LWHA 1P0BA 4Q33A 4R33A 1FXQA 2P3ZA 1A53A 2QV4A 4JTJA 3TW7A 4CQDA 2NT0A 2A5HA 3JVAA 1L0PA 2DPEA 3HO8A 2PE4A 3OU8A 4H6RA 3TFCA 1U33A 3UR7A 3EZ4A 3N2TA 2VZSA 1UR0A 4LS2A 1QOXA 4LNYA 5E9AA 2B7PA 1XYBA 4UFJA 3LBCA 2C1HA 3ABRA 3DFHA 4GZIA 4IXHA 4UTJA 3L4TA 3L65A 4L1WA 2PURA 1PIGA 1U1JA 4CU8A 2HNHA 4C6DA 1C8VA 1XR2A 1CGYA 2Y7DA 1KTNA 4S3BA 3VIKA 3A21A 1V77A 1OWQA 1OFQA 1VRDA 1JZ6A 3VZYA 1GVSA 2QJHA 4IFKB 4A8LA 4QNWA 5FACA 3W1RA 3JZUA 2YYUA 3W7EA 5IFTA 4US5A 3ERPA 1XD1A 1ZFJA 3ARRA 2XVNA 3UJSA 2WBKA 4QS5A 4Z1YA 4GBDA 3WLNA 2XN2A 3UWUA 2Y88A 5JBDA 5HNTA 4IIBA 3R4IA 1XIIA 3TAKA 3RCMA 3WDPP 1IT8A 2IXVA 3OLEA 2ZDRA 1ODUA 1DKWA 1PL9A 3GKAA 2HQAA 3V4BA 4NZ1A 3EMZA 4FLSA 3H54A 4EACA 3P8IA 4ZA0A 3WJZA 5LYRA 2QKFA 4P7RA 5LXXA 1CGVA 1VLIA 4O13A 5DN1A 2ZX9A 3CQIA 1HQTA 4UFKA 3G1AA 4CN4A 4GNKB 2ZE0A 1S5WA 4HK6A 3SRHA 2WHJA 1IR1A 4K68A 4AHQA 3TR9A 2PRMA 4LC6A 4C6BA 3S47A 2PWHA 1MW1A 1TREA 1Z41A 3UNDA 1PJ9A 4HHMA 3W53A 3UPMA 4I8YA 3Q4DA 1W5NA 3ZWTA 3SCQA 1IGSA 1S5MA 2WVVB 4RLIA 3M46A 2G96A 4GX8A 3S5OA 3USZA 2PTDA 3P84A 3EOSA 3PVFA 3AJXA 3N9RA 4JTAA 3P0WA 5EU9A 3M4HA 3TN4A 4J4KA 2V2DA 4G6CA 4P7OA 2CNCA 2G95A 2JQXA 1A49A 1LQAA 1GVQA 1M7PA 3D0CA 2VUNA 1F7BA 4Q4MA 3PAOA 2TPSA 5H8MA 2ZUNA 3QV8A 5DY3A 2FLIA 1QASA 3LY0A 1KCZA 4UR7A 1KTBA 2DZUA 1A3WA 4V27A 2QS8A 3R8GA 4B2DA 1F3WA 5CQ1A 4GUJA 4BF7A 3T4WA 3MSGA 1TZZA 1W6TA 1XL9A 1EC9A 2J88A 4AIBA 2VFGA 3KL5A 1CECA 2HVNA 1R2RA 1TPVA 4DJDC 3O63A 3VKCA 4GZJA 3C2FA 4PTMA 2PAJA 2QPXA 5HNUA 2YB4A 1KA9F 3CC1A 3FSUA 1DWHM 4FHAA 3SQMA 3TJIA 1KFWA 2IQDA 4ML9A 2AAAA 2NUYA 3HQ1A 2NQJA 2PF0A 1EZWA 3W7GA 4MWAE 4B92A 4C65A 5BWAA 4BI7A 1DIEA 4CQ8A 4ZXLA 1DJXA 4FX7A 1Q63A 2J13A 4DWSA 1UR9A 3SY5A 3CTLA 4A35A 2RJGA 1D7KA 3BOLA 4PMRA 3RPMA 3G0SA 4PB5A 4U28A 5LNRA 1W3LA 1YNQA 4F0MA 4GVHA 3FGCA 4GE8A 3EX2A 5GQBA 2PDMA 4B4HA 4GACA 1F76A 2WHMA 3RR1A 4DUOA 1JRBA 4H83A 1BRLA 1JZ8A 1GZGA 2WNNA 4P7NA 4ROPA 2H90A 1V0MA 3UU0A 2YSWA 3SY8A 2E1WA 3QR1A 4CVUA 3IIZA 1HF6A 4CN6A 2CLKA 4EWND 5KITA 4GI9A 4PBEA 1PCKA 2WVVA 2ZXQA 4F0RA 1GNXA 2HXUA 2PU0A 1V6TA 5KSWA 4DF1A 5B7ZA 3FS2A 2DT0A 3W88A 5T9CE 5K4XA 3W75A 4V2XA 3RPDA 5C9WA 3KOXA 4QS6A 2EEXA 4MB1A 3W7MA 1CGWA 3ZMRA 4H7VA 4GIYA 1CIUA 4O1DA 1N82A 1CBGA 3S3GA 3TJLA 4UFMA 2GWGA 2ZBTA 3HJZA 3K8MA 2WCAA 4HT3A 4LGXA 3MYOA 3PFMA 5DANA 1OK4A 3SSZA 4PL2A 3ZT6A 2OPJA 2V5JA 1X96A 3WMLA 1PHWA 3CU2A 3SRDA 3AYTA 3DESA 1GTHA 1JAKA 3GUGA 2V9DA 4G2DA 4WHBA 1F9CA 1KGUA 2GLKA 2Y1HA 3VI2A 1DJIA 3WFZA 1EJUC 3WNNA 1UKQA 4XZWA 2ACRA 3HMCA 5EMJA 4ZE4A 2J75A 2YZRA 1EYEA 4M6PA 4K37A 4FXFA 3GYEA 3UERA 1C90A 2XWDA 5KTLA 4H8HA 3LCGA 4US6A 1V6UA 4WIWA 1PE1A 3OOQA 5EKYA 1N8WA 4J28A 5E0FA 1PTAA 8RUCA 2BBFA 2CBVA 3VKKA 4KKXA 2B0MA 1ISVA 2DZWA 3SUVA 2BXVA 3LPGA 4X61A 2H3DA 2GVJA 3N6QA 3N2MA 1P1XA 2RUSA 2VGIA 3FJ6A 3PTQA 2RGMA 1EQPA 1HGYA 4RJEA 3UZ5A 5E0CA 3H6OA 4K6AA 2OR2A 4MM1A 3NURA 1GW1A 2IMRA 2V67A 4HGXA 3UXDA 4ZSUA 3TX9A 4S23A 1Z69A 2W6RA 3K8LA 3LSCA 3CQ0A 3GLCA 2VEMA 4DELA 3B8DA 3VOIA 1FFQA 2X1SA 5AC5A 3B8UA 3U57A 2IPGA 3ARVA 3NA8A 1WDRA 2PWFA 2OT0A 3I6EA 1AH0A 1TA3A 2WVUA 1RBLA 2HSAA 2X1UA 4E4PA 3FFSA 5DBUA 2BP1A 1EC8A 1JYVA 3OODA 2WCGA 5REQB 3BVJA 1MQRA 3EOOA 2BDQA 1R8LA 1SU5A 1XH2A 1MQPA 1VD6A 4EE9A 1HKIA 2V30A 4FNPA 1UPPA 2VOTA 1TUFA 4I7WA 4JTHA 1GOMA 1RQEA 3OGSA 1QHZA 1GGOA 4AYSA 4JKLA 3TQ0A 4B91A 4GRSA 4LV4A 3T08A 1VAHA 2ZTKA 4LCQA 3VGHA 3RMJA 1UZ4A 1CXEA 3POHA 2BS9A 3OLIA 5M03A 1SZNA 2WNWA 1OG6A 3USBA 3F5KA 4MPQA 1QI0A 2PDIA 4QJ4B 1UD3A 2EXOA 5T8GA 3DG7A 3HQPA 4WKHA 3G2GA 1SJCA 2ACSA 2QMKA 3BW2A 3EDEA 2WMFA 3NQMA 4C6LA 3D6NA 1JF5A 2WMGA 4DXKA 2E9MA 3NR0A 1K6WA 1W56A 2WCSA 1SMAA 1XLGA 3A5FA 3ZT7A 4DBSA 2VNCA 1W9DM 3CUZA 4JIHA 1XFBA 3LYEA 4U4MA 1LLZA 2Z2AA 2OKTA 2QEZA 3F4CA 4PUDA 1KM2A 3OW1A 2VELA 1GJUA 2EAWA 2J7BA 4GUGA 4XTDA 3L7RA 2OFJA 3WENA 3BJSA 1MXSA 4X63A 4D6EA 4GI6A 4H6KA 3R12A 3CB3A 1S5TA 4NY2A 3UY7A 3KBNA 4O15A 3B8WA 5D9NA 1QW7A 1EGVA 2EQDA 3DFTA 2IPWA 3VKDA 5EY5A 2KAUC 1E6ZA 4FAMA 4AZIA 2P8CA 4R7WA 3L68A 4DZAA 3WH5A 1M6JA 1BF6A 4DYKA 2DZAA 3V35A 1G94A 2BHUA 3LQLA 3DHDA 5D2YA 3H2EA 3G22A 3LD5A 4H04A 5A6LA 1VPYA 5REQA 1EUNA 2ZZ7A 2WANA 1IXQA 2W92A 1UJQA 2ZRVA 3UZYA 4TX9A 4UR9A 1TJ1A 1LBLA 4AXKA 1K4GA 2FH6A 5HANA 4MLJA 3CPUA 4LUYA 4BI6A 4R7JA 1W8SA 1VH7A 3QTGA 2VWSA 2BOGX 2QJGA 2QCDB 4GCAA 1DTUA 1AK5A 3DHFA 3QHMA 1TELA 4KETA 4LVFA 3VC5A 4GC3A 4HBKA 4V1YA 3TN5A 1VB9A 3B05A 4R88A 2VWTA 1H7XA 1F74A 3CTTA 5A6MA 1D3CA 4UFIA 3FKKA 3DDMA 4GVGA 1NP0A 1XP3A 3ZJKA 4AZCB 3UJRA 5IFPA 3KCOA 3N9SA 3G1YA 2XHYA 1JVNA 5GNZA 3VM5A 4HN4A 3WF4A 4UOZA 3IPWA 4GABA 4IGSA 2ZFAA 5JH2A 4A05A 1KRAC 4F2UA 2P53A 2H6RA 3GXTA 4JFWA 2GDUA 3I7RA 2FPTA 4LVAA 4M56A 2Y61A 3W4RA 4O4VA 2QGYA 1HKMA 2OYLA 1O7AA 4GIAA 1CXLA 3RJYA 1LDCA 4XSLA 4HTYA 4WR3A 3HGOA 4JBRA 1GPWA 4AIOA 3SSJA 4Y6GA 1XFCA 2ZE3A 2PGWA 5KEZA 1JZ7A 2PTWA 5CZ0A 1AD1A 1LUCB 1K3UA 2CXGA 1EXPA 4YHEA 2WM0A 1WX0A 4L4MA 4KS0A 3WF0A 4NU7A 5I3FA 5BOEA 5CSRA 3KRBA 4ZTXA 3NO5A 1VBGA 2IPJA 3MP4A 4J7RA 3UEQA 2ZX7A 1O95A 4KPLA 3SN1A 1FWCC 3B8TA 2E9LA 3BMVA 1R3WA 3UWZA 1FUYA 3N2BA 4B3LA 4UQ9A 3IWPA 4O17A 1EJXC 4RE4A 5ABGA 3CEUA 4MADA 1Q6RA 3RX4A 2HK0A 3AIUA 5HAOA 4P8XA 3SAZA 4JPGA 2CZEA 1B31A 1XLDA 4NNAA 3TTQA 4GHRA 4QXIA 4U10A 5GNXA 5DMNA 3WL1A 2OOGA 2OOFA 3IJ9A 1ZBWA 2Z2UA 2WJEA 3UGVA 4H6EA 2R1LA 4QLJA 4X60A 1H7NA 3P93A 4NL1A 2NVCA 4YMZA 1VEOA 3VOHA 1F2JA 1JDCA 2O56A 1IF2A 4K1GA 2X05A 1Q7QA 5D8WA 2ESCA 2B7NA 3HBLA 1NU5A 2G37A 5GJNA 3MHUA 3PZVA 4D6CA 2YB1A 3EXSA 5BMXA 4NAEA 4R7OA 1E1CB 4FR1A 3KLKA 4PMUA 3VKJA 1IXPA 1KRCC 3KRSA 3TYBA 2FGLA 5FAJA 3TC6A 4WRHA 5I3GA 2WYSA 3LGDA 2GOKA 1SM9A 3VUSA 1K8ZA 4GMEA 1FTXA 3DFQA 5C6MA 5I23A 1BGGA 3GFYA 4WDTA 3IARA 4L9ZA 4O0ZA 4H1ZA 2DSVA 2QCLA 2FFCA 3M0JA 2PC4A 1A0EA 1WXJA 2Z25A 1WOAA 3W1MA 2VUYA 4F0SA 1V3JA 1E4MM 3AZTA 3LXAA 2DU2A 2WVSA 3FJLA 3GNRA 1A5AA 1R3YA 3WLSA 2OYKA 4W4QA 2CIPA 3WK1A 1AG1O 3APGA 4AY8A 3VE7A 3WQDA 2AOSA 2PDJA 4YTUA 1WKYA 1LWIA 1UWAA 1ITUA 1G01A 3GM8A 4JZ5A 3MUXA 3KZSA 1XYLA 3WQVA 2DVTA 1W1VA 1KBJA 1MW2A 1E0VA 1BWKA 3G8RA 2QR6A 3GY1A 4PTDA 2X0YA 4QQUA 5DBTA 2IQ0A 3LI1A 1C92A 1VBRA 3AU6A 3W7IA 3BAYA 1W1PA 2IS7A 3URNA 3KUMA 4R3UA 1KV5A 3SGUA 2ZX6A 5CXPA 3R0DA 1CWYA 3N18A 1H62A 1V3HA 1HIZA 2H8XA 4JQ3A 4PE8A 4W9TA 5LNVA 4HNLA 1P0DA 4QDPA 5K9DA 1JYXA 3GR4A 4G5DA 3IJ6A 3BV7A 4Z2KA 2FB2A 1U83A 4FXJA 1KD0A 3CPGA 6XIAA 1FHLA 2Y8VA 3DIPA 3QPEA 1TR9A 2GJRA 4HPNA 1A5NC 5JH1A 4W7VA 1DIKA 2D3NA 5I6SA 1TMLA 1YQ2A 1IGWA 3LB0A 4PMYA 4JNMA 4YTSA 5C8BB 1J11A 3SUSA 1X1ZA 3AHVA 3FVMA 3NUKA 5M3WA 3SRKA 2O7QA 4FZIA 5ABTA 1B30A 1CLVA 3M64A 4BF5A 1BKSA 2J7HA 5G4WA 2BG5A 1ZPTA 5DCDA 2E1DA 2CLFA 2VD9A 2Y0FA 5AHIA 2ZWZA 4UCGA 3UGRA 3S1XA 3UJ2A 3THUA 3L5LA 3W07A 4I3GA 5DY2A 4B5UA 4ACZB 3VIPA 3UZXA 4WSKA 2PDCA 3H23A 4QE4A 4UTUA 1AFSA 3BOFA 1AMKA 2VVSA 3TFXA 2QUTA 3L5MA 3TIMA 5KINA 3AMCA 2YOCA 1VFOA 4LUSA 4L1GA 4PSPA 3DH7A 2QPSA 4YTQA 1A3XA 1KM6A 4Z0SA 3MZ2A 1JPHA 1UWSA 3LPFA 5EB8A 3WFAA 3VIMA 2HDJA 1OT2A 3KAOA 3STCA 3IVTA 4H9TA 4HOZA 4K8EA 1PKNA 1MWOA 3UG4A 4W87A 5JXQA 2FZ9A 3MMWA 3N12A 2RDUA 3H2OA 1OIFA 3GE7A 4I9TA 2CHNA 3ALGA 1Z89A 1W3NA 5T91A 1H09A 1BPLB 4WGXA 3PBUA 5GJPA 3BCJA 4AVOA 3STFA 4RV8A 4OT7A 1MMFA 1RJQA 3URBA 5DLCA 4Q4PA 1GG1A 2PWVA 1BVNP 3WBAA 4JL1A 1UIPA 1WKEA 1N7KA 1OYBA 3E3HA 1R7AA 3AUOA 3WUBA 2BXZA 4Z2GA 5A6SA 1WDSA 4PEKA 3I3DA 3WZ0E 3KVKA 4UBPC 4W88A 5CPTA 3URAA 1WUEA 1YPFA 1OSEA 5D2WA 4BQ5A 2ASHA 3LXCA 4MKSA 2EPKX 4AYGA 1A0DA 1SFJA 1K7EA 4S38A 5HWMA 1GZJA 3O8AA 4ZOCA 4OECA 4AZBA 3G1FA 3TXZA 1LL6A 3GC4A 1NF7A 3EX3A 1WKFA 5ECVA 3NQFA 5BROA 1Y0EA 1ITXA 3VGBA 1OVDA 2XFYA 1TV5A 3T09A 1RY0A 3ITXA 3WQOA 4GINA 3BAWA 1T5AA 2JKAA 2V82A 4M1BA 2VDGA 3T1GA 5HK4A 2OCZA 1AODA 1TTPA 3RLUA 4ONVA 2B31A 5FJJA 3IJIA 3O0FA 4JFSA 4ZB0A 1E0WA 1E1CA 1Q7MA 1S46A 1GORA 4YVPA 1UUOA 4GOAA 3GG0A 4DRSA 2RH9A 2V5DA 4IF2A 3G1XA 4GXWA 3ARSA 4OWGA 5I06A 3AAMA 1Q13A 3WEZA 4N6EA 2ZZ4A 1J0KA 3EB4A 5K9CA 1EL3A 5ABHA 3MSYA 4CQCA 4C91A 3VMPA 1FWDC 3SDOA 2HNEA 4AVFA 4KQNA 3OO2A 3MS8A 2RHGA 1F3XA 2QJIA 2VEKA 2XG9A 1X6UA 1X6LA 3M5XA 3BSHA 3AIBA 2CYGA 3E12A 3AS3A 2YCLB 4WY0F 4NJKA 2DV0A 1NSJA 1E9YB 4DEFA 2VQTA 5CPOA 3I65A 4LXFA 1G69A 5D02A 4AG0A 1I6NA 2OLSA 2R1KA 1GOWA 3FN9A 1QNOA 3PPGA 2D1ZA 1M65A 4JS3A 1R3VA 3M16A 3L9CA 4C6EA 2WK2A 1NQ6A 5KZEA 4XIAA 3JUGA 2J6XA 2QVNA 4DYJA 2C14A 3WG6A 7ODCA 4I6KA 1FWRA 1P6WA 4JTKA 4JOMA 3W1LA 2FZDA 2I7GA 1A50A 2DZTA 4LYPA 5BRPA 3HA1A 2QYGA 4AY7A 3CL8A 2CCRA 4DO4A 1EOKA 1QRQA 4CNOA 3IRDA 3ZJ8A 1HO1A 1TWSA 1I8JA 1KTCA 3CUJA 1JAEA 5D2VA 2J66A 2PC8A 3TCSA 3L2IA 3LLFA 3AS1A 4EIVA 4XBSA 3R8HA 5DELA 1RV8A 1TMHA 2J78A 6REQB 1GEHA 1EQCA 1GCYA 2ZA3A 5TNVA 3VYLA 1XWYA 4WDWA 1BYBA 1YXDA 3MHGA 4QSHA 2H8ZA 3GS6A 3TSBA 3P81A 2FZMA 4UNKA 3K8KA 4PB4A 2YA0A 4FIRA 4JHZA 2WQPA 1Q65A 1HGWA 3KBJA 5DCEA 8XIAA 5H2ZA 2PF8A 3UZJA 3PB0A 1GJPA 2UY2A 2XH4A 3OA5A 4S3DA 3ITCA 3MJMA 4UQDA 1UKSA 3NJ3A 3LTYA 1ZBKA 3PZIA 4WSJA 1XM3A 4C1KA 2V2HA 3QGVA 3CMGA 1W3JA 2J24A 4O1CA 1S1RA 4AMCA 3VIGA 1O1ZA 2E3ZA 3IUDA 3QGKC 4WGHA 4S3EA 2XVGA 3B8VA 2P8BA 1Z9AA 3IIOA 4Y8FA 1XGZA 3WQEA 4C6NA 1U22A 3WLKX 3BURA 2Y62A 1DJYA 4OHQA 3TOPA 2X1IA 3H12A 3WCZA 1J6OA 1CDGA 2ZRUA 2DVUA 4WXZA 3I4EA 1UBPC 3HFYA 3OZMA 3B0XA 1SFSA 3RLHA 1QAPA 2NSXA 4IUOA 1R46A 3QV7A 1GQKA 1F4AA 4CQAA 4RE3A 1Q85A 1Q6CA 1ZJIA 4DPPA 4E4FA 4H3DA 3W2NA 5TIMA 2JALA 4O1AA 2HV5A 4AUBA 5CC5A 2HVOA 4PB3A 1DQXA 3VA8A 1KW1A 1A0CA 1VEMA 1XRVA 4BKNA 4GLEA 3AS2A 3V5FA 3FSTA 4CCDA 3BG3A 4FSAA 4PCNA 4MNLA 2VC9A 2A6NA 2GUUA 5BU9A 3PZMA 4AX7A 3LXBA 4JAWA 3ITGA 2NLIA 3V0TA 2XIBA 2W0UA 3W7DA 3WYZA 3WD1A 2REQA 3TE9A 4Z1AA 3MMDA 2QUNA 3BQ6A 3BDKA 1DIOA 1OIMA 1OYAA 1H63A 2EBNA 3CL7A 2O9PA 3W37A 5H8PA 5D9PA 5EA9A 4OUIA 2I9EA 3EWZA 4PCTA 2VX4A 2VX5A 3U7VA 2FMNA 4MB3A 5MKGB 3L12A 2GJXA 3F2CA 3UWYA 2HWGA 4DXXA 4S3GA 5FJUA 3MCMA 2D69A 5BCAA 1BQCA 2Y7FA 3EDDA 1QBBA 5I7GA 2CWNA 3UR8A 4JIIX 2BGQA 4QCFA 1FRBA 3HPXA 1GOOA 2XSXA 4F0LA 3TSMA 1E4NA 2BZNA 2GQ9A 3NEHA 4IIFA 4JKMA 4JDBA 1W37A 2ZICA 1GOQA 3LMZA 1N8FA 2ICSA 3EXRA 3GQYA 1Z6KA 4YXGA 1VJZA 1MUWA 3M5YA 3M5VA 4HZ6A 2ATSA 2A0NA 4HMEA 1CCWB 3RDKA 3WY1A 4ZFMA 1SFLA 1WV2A 1Z8AA 3MANA 1DJNA 1CB2A 4HN8A 3SUTA 1F61A 1GPFA 3P14A 4DJFC 1K6AA 1QUMA 2QUUA 3VILA 4F9DA 4PODA 4F0KA 1MXGA 3M0YA 2NZLA 3OG3A 3PUOA 4H9XA 3PJWA 4AB4A 3EDJA 3A47A 1O68A 3M9YA 3LK6A 2GZXA 3C56A 4R34A 4AQLA 4PMDA 1HKVA 4W5UA 5CZTA 1E40A 2BVTA 4LCRA 4D6IA 4KMQA 4KCTA 1VGAA 1JNDA 4GCXA 4S2BA 4FXRA 3O6DA 3O9NA 2X8RA 4ZZ9A 1BFNA 1AMYA 3RU6A 4UFLA 1DXIA 4PA8A 4N9EA 2OXNA 4GXMA 4E5TA 4HD5A 3W2MA 5IM51 3TJ4A 1Q4NX 2PWGA 4N2YA 1J8VA 3H53A 1M68A 4B9ZA 1FWJC 3GDRA 3LHTA 4QLLA 2VEPA 3K30A 2J74A 3HG4A 4WY0B 3XINA 5F7UA 1W32A 2A3CA 1E4LA 3CWHA 3K4WA 1SW7A 1XF0A 3RIKA 5HNNA 1H1YA 4QHRA 2X1RA 3EPNA 3GR8A 3WNMA 3T9PA 3ZLFA 2RJHA 1Q4WA 2EJ1A 3S2LA 4YCPA 2QIIA 1UWRA 3VNYA 1XLLA 1WYIA 3HB9A 1UR2A 1I9CB 1GYNA 2VFFA 3D3AA 1VQTA 5CZJA 4C7FA 4DWSD 3FVDA 3MJYA 5EGRA 1EUAA 3LCWA 3GAYA 3M41A 2E7FA 3SCNA 3WNLA 1NWTA 3CH9A 2C79A 3MMTA 4BWLC 1VFSA 1G6CA 1XSJA 3E0LA 3ONBA 2NW0A 4GGHA 8XIMA 2XVPA 1BQGA 4DNHA 3OB8A 4LNCA 1FHUA 3HGJA 1OB0A 3CIWA 3UFYA 1GEQA 4NJGA 2PLKA 2FQIA 5DXYA 4ZCWA 3U9IA 2YL9A 1RP8A 1SJBA 4QDMA 3STGA 1QPNA 1MEWA 2DEPA 2YW4A 3UR5A 2OLAA 1XSKA 5IRPA 2E9BA 1IWPA 3EOUA 4JHOA 4J2MA 3PBGA 4PUMA 1BAGA 3TUUA 3E2RA 4W8LA 1VF8A 3R89A 4TX6A 2V0TA 4QSFA 3KL3A 2NWRA 1MEIA 5L9FA 1TMQA 1EA0A 5T26A 3FX4A 4IPPA 4HYWA 5A5WA 2Z0IA 2Q02A 2GGJA 3II1A 3S5ZA 4UTLA 1SGJA 3MY9A 2MANA 1LT8A 2VEFA 3GU9A 1ICSA 4B5SA 4OQVA 3WSUA 4XD5A 4FP1A 3P3BA 3S2CA 1NIUA 3UYIA 2Z7GA 3GXMA 3KCJA 3DFNA 4C6QA 1M41A 3CIXA 3ZYZA 2OEMA 3W00A 3PFRA 1W1YA 3OZPA 9XIMA 1WKDA 3L4YA 3BPWA 3ITVA 3LZ3A 3V0SA 1AZ2A 4RPQA 2Y89A 3PZOA 5CAKA 5CG7A 3DYOA 5GPRA 3WL0A 1EDQA 3QM3A 2HZGA 4GNJA 2BODX 3SI9A 4Q6XA 3P61A 2AAMA 3WF2A 2QAFA 1TYGA 2FDMA 3W81A 4LBSA 2WMKA 4ADSA 3P82A 6REQA 1NH6A 1KFBA 3PTDA 4GZEA 2AMGA 5I3DA 1QU4A 3P5YA 1X8CA 1MNZA 4UUIA 1PBGA 4JEQA 4PTWA 3F1QA 4MFEA 2PDLA 1LOLA 1E70M 4ZQNA 3V36A 3D46A 1F07A 3H4XA 3N17A 3DECA 1RALA 3C0LA 5LHFA 4AIUA 1UWUA 2D73A 4MDOA 3GDBA 2UY5A 4MYAA 3P0XA 5EBAA 4UOQA 3F5LA 4YTTA 3AICA 1JULA 3TVAA 4QEHA 3DENA 3MBFA 3PBMA 1ENUA 4WUIA 3BAKA 2PDGA 4IHCA 4NZCA 1QWGA 1WDDA 3TLLA 2MNRA 4WLCA 4DI8A 3UF9A 1PUDA 1D2KA 3PWGA 3KTCA 3K13A 1OGGA 2C0AA 1PWMA 1LLWA 1EP1A 4MPKA 1M7OA 4WOZA 3STPA 3LHZA 4DIAA 4QAWA 2JIWA 5BOFA 5CPLA 2VTFA 2Q01A 3TWAA 3VDGA 4WEVX 4LBUA 3BAIA 1E9ZB 4PC8A 5LNUA 1FHVA 2Y63A 2ZWYA 1RHCA 2H9AA 4JFTA 4I5XA 1Y5XA 4L65A 2YFNA 1ZJHA 3VDCA 1Q6OA 3W85A 3W74A 3C6CA 3VNZA 1B3ZA 3GXIA 1RLDA 1EDGA 3KX6A 1M7JA 1SO5A 1NWUA 2WSQA 1WZMA 3CAVA 4PYSA 2Y24A 2PGFA 3WLIA 2CXEA 1S3TC 4DX3A 1UP2A 4C1NB 2ZZ2A 2JEPA 4JKKA 4FOJA 3WQWA 1R3RA 1UQYA 2VC6A 2WPGA 3IGUA 1CXHA 4NT0A 3ZOAA 3B06A 4KEVA 1KBBA 1E71M 2PODA 1BVZA 4W85A 5HWJA 4AHPA 4JX4A 4F40A 1Q8JA 3WDJA 2E0PA 1U2YA 3RLGA 1U1HA 2AMXA 4QISA 4IIDA 5ABEA 3M43A 4X9SA 4UR8A 3DFSA 2ZVIA 4JN8A 2EPNA 4TVCA 2CLIA 4IFKA 1FXPA 2XSAA 1S2WA 5CJMA 1AJ0A 1XLAA 2TODA 1YTKA 1XDLA 3P6LA 4KIEA 4IOTA 2VHLA 2C0HA 2HTMA 1CB7B 5FI8A 5FJRA 4NAFB 5K4ZA 1G5AA 1FWHC 3CYJA 3YPIA 5BOOA 5AC7A 3THCA 2CBIA 4AZCA 5AZ0A 2OSWA 5HUPA 2BHYA 4Y9OA 3EOEA 1XIFA 4W7UA 3JZEA 3QF0A 1GT8A 5FL1A 2BSLA 2OEJA 1B5TA 3UD6A 1UIOA 3MCNA 4HNOA 1TCMA 3L4WA 2JE8A 4QFUA 3EA3A 6CGTA 2XN0A 4QDWA 4N42A 1JZ5A 3T4CA 3S5NA 5C7VA 1TPDA 1F8IA 4YTRA 5C71A 4HMCA 1T40A 3EX6A 3QC0A 2X0SA 2QJMA 2NVDA 3NVTA 4KRUA 1KV8A 2GL5A 4LEFA 3RLVA 4QBXA 3PZQA 3GHTA 4KEUA 4Q32A 2P0OA 1GKQA 4A6GA 2P10A 1XYFA 1RBAA 1UMLA 5LA1A 4DUXA 5I3HA 3MDUA 1DPMA 4CNTA 1JYWA 3S6OA 4KIRA 4H2CA 4TMCA 1VZWA 3CMFA 2CKRA 4UTWA 2VQUA 3BXWA 1IZJA 4JNZA 4HZ8A 3FNDA 4AXNA 5EL1A 1R5YA 3QYQA 2WSRA 3ARUA 4NZ5A 3B9EA 4LRSA 4MG4A 1I1WA 3M0MA 1XBXA 3AXHA 4XO7A 1I0DA 5LGZA 3WLMA 4C6KA 1KXTA 1ZQ5A 5CKSA 3T55A 3BE7A 3L21A 1SMDA 4LWWA 4E38A 3PNZA 5EFDA 3TXVA 1Z32X 4Q6JA 1R3TA 2POTA 1ZENA 1UUQA 1WOBA 5D4YA 3F4DA 3EWCA 2EO7A 1CTNA 1J0JA 2C3ZA 2ZXAA 1XD0A 5D9MA 3VGDA 3ONCA 3N34A 3AIWA 2D22A 3PR2A 2Z1BA 4JQ2A 4LYKA 4WZHA 1BTMA 3MO4A 1AUSL 1SUXA 3PBWA 1VFFA 1V79A 2A1YA 1TVPA 4DZIA 2B81A 2AGKA 2UY4A 4LOCA 3GO2A 4MNKA 1OK6A 5AHEA 4IFOA 3R94A 1GW9A 3TTYA 3NXLA 3KL0A 4OGZA 3NZGA 2H3BA 1B54A 3GTFA 3HGSA 1QFEA 3OP2A 3PSWA 1JGMA 4RW5A 1KBKA 3BLIA 2A4AA 2B7OA 2VRQA 1OC5A 2ACQA 4CCZA 2J9YA 3WBEA 4XD6A 1J18A 3KBMA 3S2NA 3AHYA 1KNWA 4YWIA 3T44A 4AX6A 1TZ7A 2ZUVA 3TYAA 2XIMA 4RE2A 1LF1A 1PB0A 2OTDA 4HU4A 1W1B1 4PMJA 4Z42C 3GG1A 1WZAA 1FWBC 1DTNA 1FY6A 1KWGA 3GB6A 2NV1A 1AW5A 5I09A 3KBSA 4ADUA 4O50A 2J8TA 2PLJA 3N25A 1JXJA 1YTEA 4XVDA 1TPUA 1H7RA 3SW6A 2XUCA 1HKWA 3QBUA 4B5WA 1XICA 4CNUA 3OG2A 1KB3A 3NL5A 3SECA 3VOJA 1S5VA 4X22A 3GBEA 3BARA 1EWDA 1BSLA 3U48A 1REQA 4BEUA 1XIJA 2RDTA 3U5YA 4DM1A 4URIA 1MDLA 1XLFA 3I4KA 5FEWA 3AYRA 4LPCA 3RJXA 4HPGA 2FGBA 3UWEA 2Z27A 1EP3A 3B0UX 1AH4A 4ROQA 5IHSA 3AIQA 3S5YA 1EKOA 2C71A 4DJEA 1PYMA 2OJPA 5I24A 3B3DA 2Z6JA 4AF0A 1LL4A 3PSVA 4HJWA 3M47A 4IP7A 1SFTA 3BTNA 5CEWA 4LT9A 4YS1A 2BFGA 4L4OA 1FFRA 3U6WA 5BRQA 4A29A 4DJEC 3W9ZA 1V3MA 2Z00A 4HA3A 3UG8A 1JXKA 3VMOA 2ZXBA 3IIXA 2O7SA 4IP5A 5HQEA 1DJGA 4LTSA 3GNOA 3FA4A 1H61A 1WAUA 2X40A 3KFTA 4L4LA 4TTGA 4O4WA 3VM7A 1MEHA 2Q8LA 3UXKA 3RXZA 4DJFD 3WO8A 2PGRA 1W54A 2J7FA 3QLLA 1XLBA 3BSMA 3NQDA 2DZSA 3QQ1A 4K1WA 1OGSA 3VIIA 3WNOA 5HQLA 2GYIA 3EKZA 3WJWA 3OEXA 4LSBA 2CLOA 4Q8MA 4H6QA 1O5RA 5BZAA 1H0GA 4NRRA 1NQKA 1OG0A 3WX7A 3GKFA 1BLIA 3V1PA 3QC3A 3AMDA 1XIDA 4V1XA 3CM4A 3WQPA 3M5ZA 3LCHA 3TAOA 1PZ3A 1K7XA 3QY6A 2G0WA 1IHIA 1NTHA 2NV9A 4EPBC 1E1EA 2Q71A 5J5DA 1JQVA 1OFRA 4GIEA 4MHBA 4WF7A 1YDNA 4EF8A 5AB3A 3DHUA 4Q7NA 3GDMA 1GKPA 4KWSA 4AD3A 4C5ZA 4JQ1A 4FNQA 2ACUA 4J35A 4H9YA 2PPGA 4XZ9A 2CW6A 4O19A 4HPHA 1WP6A 4F4RA 5HOSA 1WQ5A 3BC9A 2IW0A 3OYXA 4L1XA 1Y8BA 2E77A 5EMMA 4AF0B 2I17A 2PDUA 3QY8A 3TJXA 2FKPA 5A6BD 1XYCA 1W17A 4O8AA 2EF9A 1L6WA 4O11A 1R2TA 3U4AA 4N4QA 3BMXA 1LWJA 5F1UA 4W8BA 3Q94A 1W3TA 4A3QA 4QTGA 3VX0A 3EWDA 1SSGA 1PHQA 1J12A 1EJWC 2Z1KA 1R3QA 4EPDC 4PMVA 1LROA 2CKSA 4AD4A 1M9HA 2OLHA 2C16A 1SZEA 1ZP3A 3S5SA 3AS0A 2Z1SA 5D04C 2PRHA 4HTBA 1CI1A 1Y7VA 4CUCA 3ITOA 3IIPA 3VTRA 3FY1A 4IPIA 1I2QA 1TO3A 4HCDA 1YXYA 2BXYA 3DYPA 1UOKA 2DUXA 3H70A 1ZBVA 5K7JA 1GQJA 3BJFA 3B97A 3PS7A 5A94A 2HCVA 4F2BA 4OFCA 3CAQA 1UH4A 2KX9A 4H8UA 4XAZA 4PCPA 2CHOA 1JDEA 3Q37A 2J4GA 2ZUWA 3GIYA 1QBAA 4AW7A 5DRIA 5C2XA 4PBFA 1EJRC 1T8QA 4LB4A 1QK2A 1V7YA 2R82A 3TLQA 4WJEA 2VFHA 2HVMA 2GGGA 2G3FA 2WVTA 4XO6A 4RCXA 1ZP4A 3QGAC 1H5YA 3KP1A 4HU3A 3WKZA 1BG9A 2C6QA 4RNHA 4RXFA 3KP0A 4I9JA 1VIWA 4QE5A 1KLZA 4IPJA 3PZUA 1UD6A 2AQVA 1UPMB 4MIMA 2HE5A 1JCNA 4GUIA 3KWXA 4NKCA 1N2VA 4GGBA 4JD4A 3CLWA 3NQ7A 4JHMA 5EMUA 4J2PA 3V16A 4IT1A 4DUWA 4X3ZA 1ONEA 1UKOA 5I3KA 3NFUA 3F5JA 3W25A 4X9YA 2OB3A 4DAIA 5D32A 1S2TA 3A9BA 4B3ZA 1T96A 4H9UA 5CSUA 5C2GA 3QPYA 1QI2A 1E6QM 1RD6A 3OVQA 3VKAA 5I77A 2UWFA 4ICNA 3NSXA 2W63A 1XH0A 1I0BA 1B3XA 3CT7A 3WUFA 4ZR8A 1IEIA 3G77A 3OIXA 1OX4A 2DH3A 1BHGA 4JDYA 1F05A 2UBPC 2GJLA 5I02A 2W91A 3QMRA 3SIMA 4JTLA 4R85A 2OX4A 1UB3A 2E6DA 1J0ZA 5E6YA 1K8XA 2YBVA 1TWZA 2CITA 4RL3A 4B3KA 3GH4A 2AL2B 2J7GA 4UZSA 4G1NA 1S38A 3UXAA 5RUBA 1S2AA 5AFDA 5HPOA 3LLXA 2EG7A 1TVNA 3LNMA 4GKTA 2QMJA 2XIJA 3SCVA 2JKEA 5C9XA 1TUXA 3GXNA 1C29A 1D3GA 4DJED 1A5CA 3KM8A 5D33A 4MWAB 4Y9AA 3WELA 3VGGA 4A4AA 4UTTA 2PP1A 2VR5A 4Y9MA 3VNMA 1JNEA 4O14A 1YTDA 4F2TA 2QIWA 3CUFA 3SBFA 2YL6A 1UD8A 2IKIA 1JDFA 3LA4A 3PN8A 4M6UA 5CJNA 3BGAA 1W9XA 2BY0A 1AW2A 3CUXA 5FA5A 3KDNA 4DJFA 1MW0A 4QE1A 1H3GA 4Y9NA 3VOGA 1OFOA 2BNJA 4QP0A 2WXDM 3UJFA 5FOOA 3F4VA 1G4PA 1YKWA 3EWYA 5DT7A 3W7PA 3UCDA 1OZQA 4NXKA 4NAFA 3N4FA 2YYTA 4EX4A 3BLEA 3ANVA 3BZGA 5JU6A 4KCVA 5F4XA 1UQZA 2TRSA 4FF7A 4DO5A 2WAGA 2D2HA 2YR1A 3HV8A 1XC6A 2WM1A 4PUUA 1KRMA 5M2FX 2ZC8A 1LCOA 5G1TA 1T41A 3C2VA 1QJWA 2EPHA 4HSOA 1V3IA 3FYOA 2R1MA 3PZTA 3AQUA 1E55A 2YA1A 2VCCA 3GH5A 1ADSA 1GHSA 3WMCA 3R0KA 1UROA 1JCTA 2XSBA 1JYNA 1O94A 2X2YA 1W9UA 4I9MA 4U3CA 1TKKA 4GFSA 4Z0JA 4I90A 1EPVA 3B03A 1E0TA 3VUPA 3WH8A 4IGNA 2Z29A 4R27A 3NZ1A 2DFAA 1HG3A 2PS2A 1DXFA 5CPNA 3SCOA 4Q22A 4L5ZA 1E73M 5CLTA 3LCIA 3GK0A 2ZVRA 3IGXA 2FHCA 2CERA 3N3MA 2QNEA 1QO2A 2CLLA 3LDVA 3CPRA 2YKKA 4H8VA 1JZ3A 4BS0A 3GVWA 1ZL1A 3MSRA 4CKQA 3SQSA 1EIXA 2D23A 4JGDA 1Q6DA 4PCFA 2P76A 3PC0A 2WWCA 3LRKA 3R13A 1N55A 4GIRA 4O57A 1J93A 4Z2IA 3W01A 2Y5SA 4DYEA 2QDHA 2GQAA 3DKJA 1ZAJA 3RR4A 3W6MA 3VCNA 4YPJA 4O54A 1V5XA 2ALRA 4EXBA 3TH6A 3GU1A 2W66A 1MSSA 3DZ1A 4WSHA 4GY7A 2E4TA 1TPH1 1X7FA 1GKRA 4ZODA 3GZ3A 4ICMA 5FF0A 4HK7A 2P0IA 1Q6QA 4BQ3A 5LHEA 4GYJA 3VNLA 5F4WA 3FHAA 1H60A 2G3MA 1RUSA 3OQ8A 2EG6A 3IAPA 1EHNA 3PULA 3OVRA 1TX0A 1TJRA 2YJQA 2VDIA 4UXDA 4TU1A 4JTRA 2GGHA 3IJDA 1B4KA 1ADOA 2NV2A 2EG8A 4DWSB 2V5LA 3MUIA 1V0NA 1JFHA 4JYFA 1V03A 1PKMA 4NUWA 1XHGA 3MV01 3REQB 3UA3A 1OJXA 3W3OA 3KOWA 1JGIA 3MKVA 1H5VA 4LS0A 3VPLA 5LIUX 2W9MA 3ES8A 2V3EA 3JS3A 4O53A 4PN2A 4M3PA 4DXVA 2PEVA 1L8NA 1ONXA 2C7FA 3M44A 1QPOA 3PZGA 3OYZA 3PAJA 3B40A 4ZO9A 5A8MA 1I2RA 3PB2A 3WBYA 3ZIZA 3PY2A 1RA5A 1JZ4A 4CQBA 4NNBA 1E15A 2EHHA 1GQIA 3G6LA 3EBVA 4UC5A 4IX2A 4XAPA 2WJZA 1TVLA 3CGTA 1VFTA 5JBFA 2E6YA 1KFLA 2PDKA 2ZZ6A 2VEIA 2JFEX 5CSYA 2J79A 2YCJA 5IXEA 4QX4A 1R30A 3TWBA 3G18A 1K7FA 1BXCA 3CHCA 1Q2SA 1NOWA 2WLZA 2OZ3A 3KS5A 3L4UA 2A3AA 3GW0A 1FWAC 3L5AA 5A8QA 3NQ8A 2P50A 1POJA 3KW3A 2B7QA 3JW7A 3U8GA 5FD0A 3NPVA 3BAXA 3GNPA 3C2YA 3U7BA 3WLQA 1P6CA 5G4EA 3ZXWA 2XIOA 1NJJA 2PDBA 3RILA 1T6MA 3AYVA 3HG3A 1VS1A 1X97A 4QROA 3H8AA 5TD4A 3H4WA 2WZMA 5B7YA 1WNOA 2OWCA 3TKFA 4GQQA 2ZDSA 1DJWA 4EF9A 3GC5A 2A79A 4GJIA 3GXFA 1LG2A 1BKHA 5IBXC 4ALDA 1Q6EA 1OCJA 4DB7A 1XH1A 3W2UA 2RFGA 3CZJA 1A5KC 3AHTA 3MYPA 3NVDA 2WKJA 1P7TA 4FI4A 4DI9A 4LAZA 1NDZA 3QZ6A 3HQNA 5CLWA 3NGFA 3WH9A 4J3SA 4QCEA 4GA8A 4LB3A 3THQA 3W24A 4M8UA 3W1TA 1KXHA 1J9YA 4R5EA 2Z6IA 4JY9A 3S46A 4E8DA 4WY0A 3UCCA 1Y5WA 1EPXA 1CNVA 1YBQB 3NGJA 1S5NA 3QQWA 2ABAA 3ATZA 1FP9A 4H4IA 4UIOA 3M0HA 4IMAA 3KOZA 1IIGA 1O6IA 1V02E 2ZXDA 4XSMA 3NTYA 4XKMA 3S8HA 1SO6A 4O1EA 1KO0A 4U2ZA 1EP2A 3V7PA 4DO6A 2CBJA 4JTUA 4OV9A 3WLLA 4UQAA 3DGBA 1OC6A 1FDZA 4H8NA 4RNFA 3RITA 1VBUA 3OHMB 2XZ9A 3RU8X 3ZVHA 2V5KA 5A6BA 2ZRZA 2NQ9A 1FDJA 4ZQOA 1UZDA 2E68A 1XCXA 3UXIA 4YLWA 3ZFHA 5ECUA 4IQLA 3GNNA 4PRWA 1KLYA 1BGAA 2OWXA 1QI4A 5GNYA 1BVWA 4GI4A 3W38A 2BASA 1UW9A 1RJPA 1VPQA 2EPOA 3TOYA 2WZTA 2ISSA 4LEQA 2XH2A 3I3EA 4MUPA 4QGCA 4XWUA 4BF9A 4BFAA 3C8FA 1WXZA 5I2UA 1AQMA 1XPYA 2VFEA 4KBXA 4JL2A 1FVPA 4XKYA 4ADTA 1YEYA 1XRFA 2FMOA 4FMVA 3AXKA 8CGTA 3UA4A 5JUVA 4JQ4A 3DI0A 1UZ1A 1XYZA 3C0QA 4LJ3A 3R43A 4NX5A 2WMIB 4IGMA 4M29A 1CLKA 1WO2A 2XFWA 4O1FA 1HO4A 2CPUA 2CZ5A 3CBWA 2GPTA 3KWSA 5BXPA 3I6RA 4ZENA 3UBPC 3OBKA 7REQB 1XDMA 3W28A 2WNQA 1KGWA 3A64A 4XBKA 4L6HA 1XJBA 2GK1A 2PUZA 4O0QA 5C9ZA 5JIWA 3EYPA 3QOMA 5IDZA 1KR0A 3WJSA 5C9UA 2PDFA 4Z17A 4GISA 3KBVA 1TX2A 3WEOA 2G4FA 3ABQA 2LLEA 4I7VA 3RCNA 4BA0A 5D2TA 4NNCA 2WKGA 3L4VA 1LOSA 2WHKA 1RJRA 3URQA 3M0VA 1TV7A 2DSKA 4ZOEA 5I00A 3BCFA 3CV2A 1IXOA 3K4DA 1S2UA 1W8GA 4HCHA 3T7VA 1QTWA 2FTPA 1UWTA 4ZXOA 3QRHA 1GWJA 3S6TA 3SO7A 4TO8A 4Z2JA 3LGGA 2Z4GA 3VVGA 3QY7A 3CUGA 3NQBA 3SCRA 1MO0A 5A8PA 3DG6A 3PTMA 1E72M 4M24A 5CJ5A 2OODA 4GD0A 2R1NA 2QVHA 1IIHA 3KVLA 1KFJA 3HTWA 4DN1A 5CSSA 4GY0A 1FOBA 1EO7A 2V63A 5D8ZA 2Y8KA 3QPZA 1IEXA 3S1VA 3SURA 2PD5A 5LXEA 4HVXA 4LW7A 3AHXA 1M04A 3N3TA 5F1VA 4KCUA 3FYPA 1M5WA 4UQBA 3WH7A 7TIMA 1VENA 2X16A 3FV9A 4RR4A 3LZ5A 2DJLA 3ITYA 5I0DA 3GW3A 4KWWA 1XLKA 4HYVA 3ES7A 4B9YA 4FNSA 1PCWA 1Y5VA 3D47A 3WNKA 3VGFA 2OSYA 3GIPA 3UG3A 1MYRA 3DX5A 3H7VA 4NF7A 2G97A 2FTYA 2VT0A 4FNUA 3VCCA 2I1OA 3P7YA 3WJXA 4P61A 4W89A 2PBGA 3WN6A 3C3UA 3GFZA 2OQLA 1JCXA 3G3MA 3VOCA 4M0XA 4UMAA 5KETA 1EJVC 4US5D 2QF8A 4TR9A 1JF6A 3W72A 4WDUA 3HURA 4I9AA 4DBUA 1W5OA 3GIQA 3CQHA 5I3JA 4QJ3B 1EFZA 1TTJA 3AXXA 3K5XA 2YDSA 4IMDA 1ZJBA 4MY1A 1HJVA 4IGHA 1B3OA 1O1HA 3S1WA 1K70A 1EC7A 4G7EB 4UCFA 3E5PA 4I6VA 3WQCA 2OELA 3NYZA 2GVEA 3MWAA 3QZAA 1X98A 1Z7AA 3CZLA 4XZMX 1AQHA 2NQHA 3LERA 3LOTA 5CBBA 8A3HA 1E4IA 5HR6A 2JF6A 4AWUA 3GXPA 4HIBA 3SGGA 5CC3A 1JPDX 3THAA 4OVXA 2WSYA 3IGHX 4PTNA 2BX7A 3GVVA 4Z1DA 2BY1A 2VX7A 2XGIA 5FESA 4MJMA 1THFD 1U5VA 4EWJA 4QNEA 1G7VA 2OT1A 3FW6A 2QGHA 1HL8A 3MP3A 4D1JA 3LHUA 1E0XA 1S39A 4V15A 2IXUA 3T07A 3BANA 2ZRWA 1XQLA 3POCA 1L8PA 4JCLA 5TQLA 4HJFA 3N2OA 4OKDA 1N8IA 3GDLA 4J5NA 5DCBA 4IQDA 4G56A 3CASA 4GFIA 1CXKA 2YCLA 3MI6A 5IOBA 1EB3A 3S9IA 1H51A 2C18A 3L0NA 2OGJA 1TTQA 4FR6A 4MKVA 4HHLA 4NILA 4GK8A 4O16A 4OZOA 2E25A 2Y8UA 3FA5A 3M0ZA 3PG8A 4G8TA 3RNDA 3N9KA 1ZJAA 3BCDA 4GH1A 2V5CA 1LJYA 4IIEA 3GH7A 5DRCA 3S6DA 2E5CA 4N4PA 1QR7A 3PJTA 2OX1A 4CD4A 1L9WA 1QWKA 1ZY9A 1IEQA 1QMLA 3GX9A 4AEEA 4MB5A 1GYMA 1F3EA 5K2ZA 3WLOA 2FTWA 4HU0A 5D03A 2C8NA 4Q7IA 3O2LA 1X1NA 1D8WA 1OF6A 3O06A 1S2CA 1W1ZA 1YXCA 4E2OA 1HKKA 1DHPA 1JDDA 3G1RA 4ERIA 2A21A 5E0KA 1OGBA 3AI0A 3LCXA 1JPIA 2L5HA 4LYRA 3DG3A 4ORIA 3AIEA 3R25A 3PPCA 4OBRA 5BU6A 3NO1A 4IZGA 1PIFA 2A3LA 4ML4A 3RO8A 4KERA 5HJLA 3VU2A 3RYSA 3CO4A 2GVGA 3H2MA 1QOPA 1UH3A 5AN7A 3UPBA 4F9JA 2QJNA 1V0KA 3N4EA 4NYUA 4RPPA 3PM6A 1GYLA 3C2OA 4P2VA 4HYRA 2YDAA 3MUZ1 3AU2A 4FEZA 3LS9A 4XX6A 2FZ8A 3LPPA 2DVXA 1TSIA 2PD9A 3AHZA 3ABZA 4XUGA 5D2XA 4TMBA 3HG2A 2QCGA 1JZ2A 3HPFA 1Q66A 1C9WA 3W27A 1ZB5A 2FGZA 4LV9A 4CD7A 4AU0A 5D09A 1BD0A 1X38A 1F6PA 3KEHA 1C9DA 3FLUA 3VD4A 1Q7ZA 1FHDA 7A3HA 3SGZA 1KGXA 4J1OA 2NX9A 3O05A 4FXSA 4KWUA 4WJXA 5A8OA 5T9BG 3WD0A 4IMCA 2BOFX 3T2QA 1W1TA 3AZRA 1IQ8A 2ZRXA 1XSIA 3P80A 2GSJA 3EDKA 1T7LA 1QNPA 2PBOA 1OT1A 4U5KA 4EAYA 2WSKA 2INEA 2HPMA 4Q4KA 2FVKA 3MI2A 2CEQA 3EMQA 4DF2A 4O28A 3SCPA 1XLHA 2GVLA 3F7JA 1UWQA 1G4EA 1B3WA 2Q3RA 4W5ZA 3GAKA 3O6YX 4DHGA 1QNRA 1ZUAX 4LY4A 3BZJA 4RZ4A 2HS6A 2YPIA 4BWLA 1PVNA 2V8ZA 1TWDA 4MNMA 3RGTA 3KVMA 3A3XA 2Z2BA 4GUFA 5A2CA 1XUUA 1PX4A 5IHRA 1V6VA 1VBHA 4B5VA 3QXBA 2BTMA 2WZEA 1XQKA 5FJIA 1PAMA 1TIMA 3B0PA 4GZ7A 1ISYA 3UXLA 7TAAA 1W9PA 2C15A 1MUCA 5BRBA 4M51A 1R6WA 2R91A 2BGNE 1EDTA 3ARPA 1MQQA 2WWDA 2BLEA 4YL2A 1Q6LA 1OBAA 3QW4B 3TYZA 2VR2A 4UTWC 4HNCA 4Q8VA 7REQA 1FDYA 1X1OA 4W93A 1LOQA 1XX1A 4AWSA 1U30A 3TYUA 3W7NA 1NVMA 1OM0A 2UY3A 3V0UA 3OPSA 3UNTA 3BLOA 1A4MA 1UR3M 2BMBA 4EVZA 5CZKA 3WIJA 1ISZA 1V0LA 4KRTA 1JD9A 5ABFA 1PDYA 1Q45A 3N4AA 4L61A 1M53A 3CYVA 4S3AA 4OUEA 1HVXA 1ZGDA 3AZSA 2SFPA 4KFPA 2PTYA 5FKYA 5BNKA 1GONA 1AJZA 2ODOA 3CEPA 1R9XA 5I79A 4GG9A 3UCQA 1JPMA 1SO4A 1EJSC 2ZUSA 4DJDA 4EPEC 3R5EA 3TQKA 4B90A 4QG9A 1WUFA 1FBAA 3TA6A 2DSWA 3V18A 1EEPA 4IG2B 4PTVA 1NOFA 4H7CA 4KFOA 1A5UA 5FIPA 2J7EA 4DBDA 3K1GA 2WJFA 4H41A 4H9VA 5DMYA 3E96A 4D8AA 4LVGA 1ISWA 1W1A1 2ONEA 3M7SA 5AVNA 3DI1A 1PTDA 5G2WA 2XIQA 4MZ1A 3NIYA 5TAOA 3T0TA 3T0BA 1V7AA 4REQB 1ZHAA 5G5IA 3CUHA 1H7PA 5FSEC 2Y4SA 3EPMA 1XKJA 4PSRA 2Q8XA 4AZ6A 5AC4A 4Y90A 3BL3A 3HV9A 4L7ZA 4TV5A 1XBZA 1O12A 1YE4A 2WMHA 4ZQPA 3U3HA 4B15A 4FX8A 2W27A 4NJIA 1EA9C 2OQYA 1PO9A 4RUBA 5C70A 3W29A 2TAAA 4JN6A 1B90A 3EMCA 1UUMA 2X09A 2YW3A 4JIEA 3A4JA 3MB9A 3AC0A 3AJ7A 4R9OA 3W87A 3BLLA 3BLKA 1W5MA 2E6AA 1B3YA 3UG5A 4HNVA 4XISA 5TBOA 3WQ4A 1RCXB 2VKZG 1P7TB 3A4WA 1B4EA 3TNOA 3N2CA 4IPLA 1V6YA 1KBLA 1HW6A 1MI3A 2VGGA 1TPB1 1FH9A 2BHZA 1OFPA 1KFKA 1NFBA 3KOYA 4TVDA 5CGMA 3SIZA 5KZMA 3AISA 1F4HA 3NL6A 2CC0A 2F38A 4IMFA 1AD4A 3C2RA 1GOIA 2Q09A 1H2JA 3CZ8A 1AQFA 4G1KA 4AWEA 1J01A 1OFDA 3CXOA 1KR1A 1XRTA 3MU7A 1ME9A 4MLRA 2J25A 3EAUA 4Q8PA 3EX4A 4DBWA 5HUOA 3E9AA 4HNTA 1HJWA 1A5SA 5KMYA 3VIJA 3EEGA 5E93A 3VIFA 2HBXA 2CU0A 4BCEA 3U2EA 3CZKA 3CJPA 3ISIX 1TWWA 3CV7A 2O9TA 3FKRA 3N6JA 2CWXA 2D2OA 1QDSA 3DERA 4MY8A 4PMQA 2QULA 5E1QA 1NF0A 2PMQA 4LCSA 3LRMA 1FKWA 3ANYA 3W22A 2Z7KA 7XIMA 5JVLA 4S3CA 3Q58A 1YX1A 3MBDA 4C90A 2FYMA 1XRSA 1J6PA 3WD2A 1JFXA 3HFTA 3QKZA 1SPQA