1R3QA

Uroporphyrinogen decarboxylase in complex with coproporphyrinogen-i
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
357
structure length
357
Chain Sequence
b'GFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen Decarboxylase
publication title Structural basis for tetrapyrrole coordination by uroporphyrinogen decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 126
structure length 357
sequence length 357
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1r3qA00
3GVRA 3PPFA 1R3YA 1JPHA 1U22A 3L7RA 3PPCA 3GVQA 1UROA 1JPKA 3GW3A 4ZTYA 4L61A 1R3SA 1R3WA 1T7LA 3GVWA 4WSHA 1XR2A 2NQ5A 3PPGA 3RPDA 3GVVA 4ZR8A 2INFA 4L6HA 1U1HA 2EJAA 4L65A 3CYVA 4EXQA 4L6OA 1XDJA 1U1JA 3GW0A 4L64A 1R3QA 1J93A 4L5ZA 3BQ5A 4QQUA 1JPIA 2Q71A 4ZTXA 1R3TA 1R3VA 1U1UA 2Q6ZA 3T0CA 4AY8A 4AY7A 1XPGA 1YPXA 3PPHA 1R3RA 3BQ6A
chains in the Genus database with same CATH superfamily
3RO8A 2WVTA 2BOEX 2H9AA 3NQDA 3DAQA 3B03A 2BVWA 1B3YA 3NPXA 3QOMA 4J3ZA 4E2OA 4ENLA 3W75A 1E9ZB 4GI4A 4MADA 2Z1SA 4GVIA 1J5TA 3LZ3A 3BQ5A 1W3NA 3G1YA 2VZTA 2FTYA 2BY1A 3M47A 3WLLA 1R5YA 4XTDA 3W4RA 3R0UA 1MXDA 4JTRA 3P84A 1XSKA 4AZCB 5CKSA 2XINA 2AMXA 4W93A 5AC4A 7PTDA 2DSKA 3T07A 3VIJA 3WUFA 3GVRA 3QRHA 4F2UA 3S1GA 1ODUA 3UBPC 1QMLA 1K4GA 2EEXA 1TZZA 5HXMA 1W5NA 3AXIA 3MVIA 2A0NA 2ZX7A 1W1YA 1K02A 2YFNA 3KRSA 4B9ZA 5JBFA 3W6LA 1XLCA 2D3LA 1Q13A 2D73A 4HN8A 4LAZA 4KEVA 2WMKA 1ISYA 1NDVA 2O55A 4IIHA 3FLUA 1F6YA 2OZ3A 2J6VA 3N13A 4R5EA 4JKMA 3EWWA 1QFEA 2FHFA 2X1UA 2QS8A 4PH6A 5BMWA 1TV2A 4PMUA 4L9ZA 1JYWA 2J88A 2WCAA 3NO3A 2EGZA 1L6WA 3EOSA 1E55A 3OA3A 1WQ5A 1KFEA 3FA5A 2OT1A 1UA7A 1ISZA 1SGJA 1G4TA 3EDFA 4HZ7A 1PIFA 4B5XA 4C6BA 3DGRA 5HJLA 2BXVA 3SY5A 2V5JA 1R86A 1KGXA 2V67A 3AU6A 3VPLA 1V3HA 4D8AA 4BEQA 3O15A 4DNMA 3BTNA 4GWEA 3E5PA 4DJDA 5GQBA 4R7WA 4KIEA 2OQLA 3NWRA 3CEPA 4J9JA 1JD7A 1R3VA 3NQ2A 1CXLA 4MNMA 1A5SA 5GJPA 4MPKA 5I3DA 5AYXA 4CQ8A 3RXZA 5EMYA 3WNPA 8XIMA 3VDHA 4EAMA 1IEQA 4HJWA 1WOAA 3P60A 1GPFA 3M0YA 1E43A 4UQCA 3SN4A 5IRPA 3NM1A 4S2CA 2PD5A 3RPMA 2IKGA 1EJTC 3B40A 1IGWA 1K1DA 1DHPA 2DQXA 2VEPA 4YYFA 4IIFA 3T81A 1N8WA 2WSKA 3CQHA 1VQTA 1D3CA 3M7SA 5FJRA 4MSSA 3FAXA 5T9CE 1BPLB 3WNLA 1XI3A 3CGTA 3Q65A 4G1NA 3TIMA 2G3MA 3UR2A 3G1XA 3G8EA 3KLKA 4QSHA 4HN4A 1U22A 4CU8A 4EWJA 2ZX8A 2I7GA 3NM3A 5AYIA 4NZJA 1WAUA 1QJWA 3KTXA 4O52A 3KS5A 2OB3A 3GXNA 4I6KA 2I9EA 3RAOA 5HWNA 3LYEA 1REQB 3S9ZA 2PZNA 2BASA 4UR7A 2V5LA 2OWCA 2DT1A 1RQBA 4QEEA 3SCRA 5E6ZA 3UGVA 1OX5A 1UH2A 1UZHA 3O63A 3F2CA 2XFYA 3P5ZA 2Z1XA 4JTTA 3SUVA 3S5NA 1TR1A 2EJ1A 1R9ZA 4ERGA 3PG8A 5E5CA 1PE1A 3FKRA 3GB6A 4MFEA 3AIVA 3NPWA 3TQPA 1QUMA 1YXYA 1FWCC 4ML9A 2NX1A 1WZLA 1DTUA 4FXSA 2XIBA 4IFRA 5TAOA 4BI7A 1EOMA 5FOOA 4XX6A 1KLZA 4X9SA 2NUWA 5DT5A 3G0UA 5I3FA 3TYCA 3GUWA 2OLAA 2XM2A 4JKLA 3RMJA 2REQB 4MF4A 3AI0A 3FNDA 1SVDA 2MANA 1JFHA 3VIFA 1OT1A 4PGLA 3W1AA 4HA0A 1BXNA 3S2CA 2QVHA 4AD5A 3RCYA 2J7DA 3MYOA 4A3HA 2EG7A 2INFA 1PCWA 3WNKA 2BY2A 3DFSA 1MZRA 3GIYA 2C13A 3V5FA 3BLEA 3VNIA 3OVPA 4K8GA 4AWUA 3UXDA 4NVTA 3CJPA 2IQTA 3INPA 1YE4A 3WQ4A 2OFJA 3M5YA 2ZC8A 3OZPA 4LS1A 4ZVJA 1F76A 5LIKX 3EX1A 5CC7A 5M1TA 5CC3A 5G4HC 2VX6A 1QOXA 3L67A 1PWLA 2JEQA 3LGGA 4O13A 3KBNA 4RZ5A 4OKDA 1GVFA 4DBEA 2ZA2A 3HFYA 1CT5A 1ZJAA 3KCLA 1JDAA 2X40A 4RXFA 3PS7A 1KM2A 3AXKA 2E8YA 1TMQA 1R85A 2DSUA 3DDMA 4QFUA 4IOTA 1HQTA 2E6AA 4IP5A 4CNNA 1XQLA 1ZL1A 3MJMA 4AHPA 2A3CA 3W1RA 3K8LA 1IF2A 4H9TA 2FLIA 3HIJA 3CH9A 4O4WA 4FNPA 3P80A 1WXYA 4GISA 4B92A 4PMNA 4CCCA 5IHSA 1XISA 1WDSA 4FF5A 4QBXA 2NT0A 1ELSA 4AG0A 1KCKA 5E0KA 4LRSA 3O7UA 4P7RA 3FJ6A 4PUEA 4AY1A 1PX4A 1VFFA 4TMBA 3FHAA 3WF3A 3W53A 5KINA 3IJ9A 3SRKA 2GUYA 1YTEA 4I6VA 3VKKA 4GY1A 1S5NA 4B9YA 4LNCA 4HOWA 1JYXA 1FCQA 4Y2WA 2VNCA 1OIFA 2Q3OA 1E3XA 2RDWA 2HDJA 1KLYA 4NZ5A 1NTHA 1U1HA 1ME9A 3CUXA 4KEUA 1G7UA 4HU3A 4FHAA 3GSMA 3GD6A 3R5EA 3BZJA 3HQOA 1CGTA 3LLXA 4UQ9A 4GQQA 1O95A 1F6PA 4J3XA 1PZ1A 1ONXA 4HD5A 5HUOA 2CLHA 5A8QA 1VLWA 4C6EA 2O9RA 3HM7A 4QITA 1XG4A 3D3AA 4UTJA 1GQKA 3RGTA 4ZODA 4UBPC 3VCRA 1LRQA 4PBEA 1XF0A 5EKYA 2O4QA 2QPXA 1IWBA 1TA3B 2C1HA 2PWGA 3STGA 1AQFA 4CD7A 1EHNA 3IIZA 2JALA 4XD3A 2GDUA 3OO2A 2OU4A 5ECUA 3N73A 5ABGA 1QW8A 1W3KA 4ZE4A 1KM6A 2R9RA 3U7BA 1VP5A 4F2TA 1QPQA 3WCZA 1IQ8A 4QHRA 2UY4A 3GDLA 4AIEA 2YL5A 1E9IA 5H8UA 1MW3A 3S6OA 3MSGA 4QISA 4N0RA 3IARA 5AOUA 3OOQA 4ONVA 1BYCA 4L9XA 4XAYA 5TQLA 3Q94A 3WD1A 5XIAA 3ELFA 1QPNA 3AALA 3LSCA 2ZRUA 2WLZA 3NEVA 3K4AA 3LN3A 4IX2A 1CZ1A 4FXJA 1LLWA 1W31A 1E1CB 4WVXA 1NOUA 3WH8A 4K8EA 3LMZA 1OYCA 1X38A 1TMLA 1RQHA 3SW6A 4O8RA 1CBGA 1C9WA 3ECQA 3ARZA 2YW4A 1V4YA 2V3FA 3LRKA 1XPYA 4KFNA 1RPKA 3VGFA 3NXFA 2H90A 1CNVA 5XINA 3WD0A 2RUSA 1W54A 1Q6GA 2Z25A 1NOWA 3U4AA 2WAGA 4L6DA 3TDFA 1LDCA 1TUXA 3VUPA 1MW0A 1JDFA 1IT7A 4K36A 2PDPA 1MMFA 1EQPA 1OCQA 1WZMA 4JEJA 4PMRA 3NZGA 1HJVA 4M6UA 3WLNA 4OE7A 3NGJA 1MDLA 3AZTA 3LBMA 3CAWA 2O7SA 1J4EA 3P14A 3SQMA 3V5CA 3WQVA 3KP0A 2FGZA 1QAPA 2A4AA 3OW1A 2BX7A 4WCJA 1XLIA 1OYAA 2ZBTA 1QWKA 2GJNA 2WJZA 1CLVA 4ZQCA 1G1YA 1AQMA 4ASTA 5I03A 4H9YA 6PTDA 3UWVA 1RBAA 4F9JA 2ZOXA 1UR9A 1OWQA 3SSJA 4DRSA 1JXJA 3W2MA 3DG3A 2D69A 1PAMA 1XG3A 3O0FA 4HHLA 3LTSA 3FXYA 3KWSA 4O8AA 2Y7EA 4MNLA 3V0UA 1VRDA 3NQMA 3PHAA 4WOQA 4S3FA 3E0WA 3LQGA 3W7OA 2DP3A 2FDSA 5AZ0A 1J10A 4JFUA 2W4XA 3FGCA 3VDGA 1X6UA 1J0HA 1D8CA 5DO8A 1MXGA 3WLMA 1DIKA 4CNUA 4DF1A 3GXIA 1ITXA 1LF1A 3U4FA 1QO2A 3VMOA 4Z42C 4FP1A 1V3KA 4K1GA 4EOUA 3LLDA 3E1F1 4IIGA 3UPWA 3LGEA 3NDZA 5F4WA 3SDOA 4EWND 5L6UA 1EDQA 3W70A 1HO4A 4C6MA 3NL6A 4S3KA 3B9NA 1EJXC 1Q7MA 4RNJA 4MJ4A 1B3XA 5JH1A 3TOPA 1F5ZA 1GOIA 2CITA 4JDYA 2QCCA 3T8LA 2QMJA 3CYJA 2DORA 1XHGA 1MEHA 1K9DA 5I3IA 4AC7C 4BF5A 4IF2A 1YTKA 1QNVA 3QV6A 1O6IA 3PK7A 3BLDA 2A85A 2WMIA 4J40A 2PP0A 5I3JA 1IYXA 4REQA 2WM1A 5KITA 5LIUX 4GZJA 2C8NA 1FY6A 1I8JA 3F4VA 2DUZA 2FQIA 3SIZA 3O6AA 3FV9A 1TE6A 5EBUA 2OR2A 2E7FA 3GXTA 5U4NA 3GXMA 4A35A 3PFRA 2NLYA 1A0DA 2QUNA 1M5WA 4GACA 1EUNA 3UZYA 4PEEA 1EP2A 1O94A 2WMFA 1RCQA 1BVWA 4M8UA 1CXKA 1OVDA 5H6HA 3W6YA 3IGUA 4YTRA 2YCLB 1ONRA 3GVWA 4Q33A 2WLYA 2VFFA 3M0ZA 5D30A 4PUWA 4WXZA 2W63A 5F7UA 1EB3A 3I10A 1R2RA 3MZNA 4W8BA 1I2RA 3LOTA 5A6LA 1EDTA 4NG3A 2VCBA 1CGUA 1O5QA 3M41A 2V3GA 2EHHA 2GGJA 3PJUA 2ANUA 5I7GA 3B8WA 2NLIA 4QLJA 1XV8A 3KBJA 1SMAA 4C6OA 3CMFA 2Y8KA 3C52A 3UA4A 2WXDM 2QULA 4P7OA 5CC5A 3ZJKA 2F38A 3N6QA 1US2A 3GC2A 4KWUA 3BSHA 1ZUAX 3P2VA 2JK2A 1G4PA 4D71A 1QCWA 5A2BA 3BE7A 1FFRA 3MPGA 3PZ9A 3CHCA 5CZJA 3LBCA 4U5IA 4OGZA 2H9AB 1E4MM 2VR2A 3CV6A 1JPHA 2G0WA 4J2PA 3HQPA 2E9LA 2HQAA 1AZ2A 1GYLA 3GBEA 4C6NA 3LM3A 2C16A 2QKFA 5GPRA 2NVCA 1L2UA 4BWLA 2W62A 4AVOA 3O3RA 3R7MA 3VMNA 4AY7A 3IK2A 1DWIM 4LC6A 4HP5A 4DF2A 5FEWA 3RF9A 1XRVA 2DSWA 5DCBA 3W07A 3PG9A 2WKJA 3W73A 4S3GA 2PCQA 4MOZA 1IEIA 2XVGA 3AZSA 3U5YA 4UQBA 5IHRA 4AF0B 3ABRA 4ZO7A 3H2NA 1U5JA 4J5NA 3PN8A 3A23A 4X61A 5IM51 3BURA 4IJCA 5FEXA 4KCWA 3VM7A 5HA7A 1J6PA 1XP3A 4I9MA 3BVJA 3MBDA 1UP3A 3W28A 1RVKA 4GXWA 4TUFA 4NXSA 1PHWA 3NGFA 3MKCA 1K7EA 4JHOA 1G94A 5H8PA 1BTMA 1DJNA 3N04A 1ISXA 5JMUA 3PPFA 2V38A 3A24A 3WO8A 3E6EA 4B91A 3NG3A 3ZXWA 3T8QA 3VOCA 3KL5A 5C2CA 3CZLA 3MU7A 1XLGA 3EMCA 5CZKA 3H2FA 3MUCA 4IPIA 2HE8A 3WBWA 4NRRA 1T5AA 4UR9A 1UQYA 3R2GA 2YCEA 3RHGA 2NV1A 2QCGA 3MHFA 3BGJA 2ZCGA 1Y5VA 4UTKA 4BK9A 1W1ZA 1OC6A 4Q8TA 3PZVA 1T41A 1NOFA 4PTXA 2G4FA 3N9RA 2DQWA 4FR6A 4ERAA 1YYAA 5C2XA 3C8FA 5AHFA 3BCFA 4PFMA 3WJYA 1NSJA 2XFWA 5ENLA 4GJ1A 2B7QA 4CCZA 2OMAA 4XVDA 4HPJA 3GTNA 1XCFA 2W61A 1TJ0A 3GVVA 3W76A 3S3GA 2RH9A 5A3HA 1LRNA 4EF9A 3EKLA 1VBUA 1FP8A 3AMGA 3OLGA 3ZJ7A 5DRCA 3QKEA 1PEZA 2OLHA 1XLLA 3FDGA 4H4IA 4HVXA 3BG5A 4TTUA 1Q3NA 4J28A 5FSDC 1XYLA 7A3HA 3CHEA 3DCPA 5FJJA 1XUUA 3VINA 3EPMA 3UY8A 3MWAA 2P1FA 4Y8FA 4ADTA 4S2BA 3GC5A 5JIPA 2VFHA 4WR3A 5HPOA 3WNOA 4PBGA 3GDTA 1CXEA 1BFNA 3EXSA 2R14A 1XINA 1XYCA 3K1DA 1A0EA 1GNXA 4WDWA 3L68A 2R82A 3U57A 4XAPA 4C1NA 4L6OA 1AJ2A 2PTWA 2DSVA 2P0OA 2ONEA 1M6JA 2VRKA 2YA1A 3W2KA 5C71A 1KKRA 3AROA 1GQIA 1X7FA 2FB3A 3R0KA 3JZUA 4FK9A 1EA9C 3PUDA 1MVYA 3W7EA 9RUBA 2CLMA 3TZNA 3FS2A 2F9RA 3DH7A 1UIPA 2ZUVA 3N2XA 2CFFA 3V7PA 4B2DD 4CN1A 5F4XA 1FOBA 1PVNA 1QOQA 3QQ0A 3S9IA 1Q45A 3GTXA 2FGLA 1L9WA 4HSNA 5FESA 2QF7A 1W32A 3FVDA 1VBRA 3AISA 4Z2GA 1B9BA 1SO3A 1E6XM 1JUEA 4MJMA 1BSLA 1R3RA 3S4TA 1QI2A 3AYSA 3CWOX 1YXCA 4GQRA 5BWFA 1KV5A 3NZPA 3W27A 3NL2A 4J3TA 2PGWA 2R6OA 1I6NA 5FF7A 1OFOA 3TUUA 1TV3A 2AL2A 1UWQA 3GU1A 3RU8X 3AZRA 1CXIA 3EZ4A 4M7TA 4ZQOA 1A5UA 3WJXA 4HU8A 3GFZA 1GGOA 1J6OA 4ERIA 2G50A 3S47A 4DM1A 1O7AA 4HKPA 3MANA 1EGVA 1N8FA 2Q01A 4AYSA 2H8ZA 4Z1BA 2XVKA 4X63A 4PMVA 3I4KA 1UA3A 3MKKA 5BOEA 5HNNA 4YN5A 4RZ4A 4GY7A 2E4TA 4A2SA 1TVNA 2WWDA 3ERPA 2DGAA 3DEQA 4L4LA 1T6MA 5JBDA 2XN0A 3OBEA 2YDAA 2J7EA 3BH4A 3GX9A 3IGHX 1H1NA 1O5XA 3K2GA 3VKDA 1HKKA 1NF7A 4RK8A 3DFPA 3UR8A 4GX8A 4EE9A 2CERA 4O1CA 1X6NA 4L1WA 3SSZA 1C91A 3V75A 4PN2A 2YIHA 3W7LA 1DV7A 5MF5A 1UR8A 2Q09A 3SCTA 3RILA 4JAWA 1XH0A 4W7WA 4U2ZA 2WYSA 3ISIX 1EOKA 4HTBA 4KRUA 3AIUA 1JZ8A 3TLLA 5AC8A 1EJRC 4GQ0A 1MQQA 1B54A 2WVUA 3S5SA 1GHSA 2JF6A 4MKVA 2Y2WA 2IS7A 3GHUA 2XUCA 3RIKA 4XBJA 3VD3A 3O9NA 1R6WA 4PTMA 2B7PA 1KCXA 3VNKA 3LXAA 2HK0A 5A95A 1SFTA 4UOZA 2W0UA 2ZUNA 3VIKA 4UOQA 3VGBA 2PDUA 1R2TA 1M3UA 1RAKA 4PC8A 5DMNA 4N9EA 3ZVIA 1E5JA 1UMYA 4XZWA 1R9XA 4HA4A 2P50A 2Y8UA 1Z3NA 3CUGA 3HB9A 2XN1A 4E6MA 2QCLA 2NVAA 4LAKA 5HQMA 3WX7A 2VR4A 3U5UA 3AHVA 4C60A 4JIIX 3D0CA 4ZO9A 6TAAA 3UZZA 3LERA 4PZVA 5A6JA 3DBNA 1X7IA 1TREA 5EB8A 1GW1A 3URAA 2XVLA 1H5YA 1HTIA 3PZOA 3W82A 1DQUA 1OY0A 1AH0A 4WDTA 5A6SA 3HOJA 2NXIA 3MBFA 5CEWA 3L4YA 3N2OA 4QAIA 3LENA 1L8PA 2I14A 2WZMA 4D1IA 4F8XA 4F66A 3LEPA 3I3EA 1AJZA 2ZE3A 3GKAA 1OGSA 1I1WA 1JZ4A 2A5HA 1GYNA 3NQAA 5FF2A 1BG4A 1TMHA 2MUCA 4DWSA 4JTQA 5LIXX 8A3HA 2Z1BA 5E6YA 3T0DA 3BOLA 5CAHA 1UD6A 1W8SA 1ZBWA 4LC8A 3T1GA 2RDXA 1UKSA 4CEUC 1BGAA 2X2YA 3GQYA 3ITYA 5LGXA 3V1PA 2HE5A 2PRLA 4V1XA 5K4ZA 1XC6A 1QTWA 4JYEA 3C2OA 5I00A 2G95A 2HROA 4IL2A 4ZB0A 3W37A 4L4MA 5D4YA 1VFLA 4Q4MA 6ALDA 1EJWC 3UA3A 4NAFB 2DT3A 2XHYA 4X0VA 5ABFB 3RCMA 5EU9A 4TTGA 3G1HA 1AG1O 2UY5A 2VCAA 3SO7A 3FA3A 1ZGDA 3QSRA 1B31A 4PCPA 2QCMA 3PTQA 1ADOA 2YDRA 2E28A 2E6YA 1SJAA 1GVEA 1HGWA 1TTIA 3LCFA 4P5UA 3RM8A 2Z1WA 3B8SA 1FWGC 2R24A 1LG2A 1WBJA 1IHIA 2BP1A 4XZIA 3BDKA 5DX7A 1XH2A 2NUYA 3ZS4A 3MHUA 3P8JA 2WZIA 5CGTA 3WLQA 1H1ZA 2GWGA 4ZCWA 2O7QA 3QY7A 3QMTA 2QIIA 3N9SA 3ZSTA 2PC8A 1WUFA 2OXNA 4JTFA 1WCGA 1K4HA 1GTEA 2IQDA 3J7HA 3OPSA 1ZRQA 3L4WA 3QQWA 1Z7AA 3E5BA 2DZBA 2Y85A 3L4XA 3FGCB 4H9UA 1NH6A 2E3ZA 1EF3A 3F5KA 3TAOA 4LJ3A 4KCVA 3HV8A 2Y1HA 4AISA 5CSYA 2OZ0A 3SCUA 3GU9A 1WDDA 1Q7QA 1E0TA 1U5VA 1O12A 4JN7A 1LCOA 1CW2A 3THAA 2VGIA 2Y89A 2ACQA 3PULA 4LFYA 3STEA 1NDYA 4ZQRA 4E8DA 4XAZA 1TQJA 2PA6A 1F4HA 4HBKA 1YDYA 3EBVA 2PDXA 3UXLA 3NQCA 4TV5A 1ONEA 1VS1A 4JNMA 4Q8UA 4K68A 2AAAA 1WNOA 3C2VA 3DU0A 4EP8C 2QT3A 2YCJA 3LI0A 2G8ZA 2WC7A 3GIPA 3CV7A 2DFAA 1GOMA 3D6NA 3O0KA 3DESA 3UD6A 4XBKA 3O16A 2NV2A 4FX6M 4YVXA 4DJEC 3NDYA 3R8HA 3EWCA 2PF0A 4FA3A 2WMIB 4EVZA 4DXVA 4JNZA 3WJZA 5AHIA 1TRIA 4Q4RA 3DYMA 1FWWA 3P0WA 1AODA 3W71A 1UR0A 3GNPA 1VHCA 5CJMA 1JRCA 2NQ9A 1J5SA 3ABSA 4GX9A 1W3LA 4GH1A 3LPFA 1GOXA 4S38A 3AO0A 2ZZ1A 5HR6A 1IZKA 3RLUA 1JVNA 4FOKA 3IJ6A 2F6UA 4LCSA 4MB4A 2CBIA 4GC3A 1WA3A 4MB5A 3T78A 2OX1A 1B4EA 1VPXA 1KRMA 3T09A 4N6FA 1RH9A 2CYGA 3G3DA 4JIRA 2IPWA 4RPQA 2YX0A 1BHGA 3IGSA 2CWNA 1QNPA 3P82A 3PJTA 4ZENA 3M4HA 2UBPC 4Q3MA 3OGVA 1JCXA 3VMPA 3RM4A 4S39A 5DN1A 1MDRA 1V93A 1V7YA 3BJTA 2VX4A 3ITVA 4B15A 3CB3A 1MSSA 4HU0A 3UP8A 4FLRA 5F1UA 3UYIA 3DECA 5J04A 3R79A 4LY8A 1DBTA 3WBXA 3PZIA 2P3ZA 4QQ3A 2ZVRA 1B4KA 1KM3A 3R43A 4LYKA 4EAYA 3VC6A 1PZ3A 1VFUA 1QASA 3QEZA 3W1UA 1CXFA 2QAFA 1QDSA 4QLKA 4ACZA 2DZPA 3NO1A 3IEBA 3TU9A 1FDYA 3LLFA 2XSBA 1L6GA 3BQ6A 4P2VA 2VL4A 4HZ8A 3DFTA 1S5WA 2V69A 1ZZMA 1TWZA 2PTZA 4RNHA 4Z0SA 2NZLA 6A3HA 1B9ZA 5BXRA 1W5MA 3POCA 4CNSA 1R7AA 1XFCA 3A3HA 4WKHA 4C6JA 4B5NA 1WZAA 3VAVA 2AKMA 1DOSA 4RV3A 2XIQA 2W91A 3KWXA 4C7FA 4GO9A 1HKJA 4UFKA 3VX0A 2O92A 3CL7A 1A5MC 3WH6A 3UCDA 2ZXQA 2CLIA 4XZMX 4AXNA 2VMFA 4ZL1A 1GJWA 1G4EA 3LZ5A 3WBYA 3EXRA 1T8QA 1M65A 1TPUA 2DUAA 4KH2A 1JCNA 4JIEA 5XIMA 3BZGA 4PA8A 5AHMA 3W7NA 2BVDA 3QR3A 2OYKA 1HJXA 5LGZA 3MUY1 4XD5A 2GWNA 3L5LA 1R2SA 5JUVA 3VYLA 1Q6OA 4J4KA 3YPIA 3UJRA 5J8LA 1AD4A 2NX3A 3KUMA 4PUDA 3A22A 4B3ZA 3NZ1A 3SUSA 2Z2AA 1EQCA 5CZ0A 1A53A 3DFQA 2GK1A 2I9UA 4HZ6A 4XKYA 1PDZA 2G3FA 4RE2A 2CZDA 1RP9A 3TNOA 3A4XA 4UFLA 2ZICA 4AD0A 4GI8A 5AVNA 2RJHA 4NRSA 5AZ1A 3BW4A 3GTHA 3HGSA 3TVAA 1SW7A 4Q4QA 1MEIA 1E15A 2Q8XA 1AMYA 4FZIA 4WKAA 4HGXA 2F84A 3EWYA 1FQ0A 1S46A 1W9PA 2F7FA 1UKPA 3BPWA 2ESCA 4B5SA 4QJ4B 1TX0A 5I2UA 5CGMA 1TPC1 1AZ1A 3SGZA 3IVUA 1T0OA 2VYOA 2Q3RA 1QHOA 3TKFA 5EFFA 1NF0A 3SFWA 4LAUA 2EPMX 3KDOA 5BRPA 1UUOA 2B31A 4F0HA 3PUEA 4QGCA 4ZXLA 3NIYA 1VF8A 4E2BA 5CH9A 4YTQA 1TPH1 1PXGA 2CLFA 4M1RA 1R46A 4C6FA 3PBVA 2ZE0A 1XR2A 2QXWA 1RR2A 1V0NA 3O1NA 4AWEA 1XH1A 2PWDA 1V03A 1WUEA 1GTHA 3LY0A 3KOYA 2J6XA 2YFOA 3AUOA 1OGBA 4H04A 3CB8A 3N15A 3N9KA 2XH4A 2A79A 4LEFA 2D23A 4LVDA 4AAJA 2JFEX 1SO5A 4AZ5A 1UD2A 3TH6A 3C2FA 4LCQA 2RFGA 2W9MA 1XW8A 4HOZA 2I5QA 4PSPA 3B8VA 4H2CA 5J5RA 3OU8A 3AHZA 4MZ8A 5BRBA 1W56A 2D0HA 4AFYA 1F4AA 2BY3A 3MI6A 4IGSA 4LOCA 1HZYA 2DZXA 1XSIA 2XN2A 4E2DA 4C1NB 3AMCA 1ZQ5A 4I8YA 1PUDA 2ISFA 1XDJA 1XGZA 2WWCA 3EMZA 4NUWA 4W9TA 3T44A 3ZLFA 3UCQA 1YHTA 1Q2RA 4GIEA 1JF6A 4BJHA 3QN3A 4QCFA 2Z6IA 4IPPA 2DIEA 3GO2A 3P62A 2HRWA 1UZ4A 2X09A 4UCFA 4V1YA 1A3WA 4O15A 2GZXA 3ARPA 4D6FA 2AMGA 3F5JA 4UWMA 3SRHA 4AHOA 4YMZA 3W23A 4IMDA 3LXCA 3M7WA 3G2GA 1GPWA 1BEUA 4GPNA 3R58A 1RK6A 1HFBA 1MWOA 5DMYA 2YYTA 4M3PA 1QI5A 4IQEA 2J62A 1XC4A 4ECLA 4H83A 3O05A 4V27A 2CC0A 1QOPA 1W5QA 1W1PA 2V82A 1ZBVA 1OX6A 4JTKA 1LZOA 2AL2B 3MB9A 1J8VA 1TPDA 4CCDA 1MNSA 3R13A 1BWKA 1PKLA 1B0IA 3AXMA 2RKXA 1YXDA 5D8WA 2XJ7A 4NZFA 1JCYA 3SN1A 5B7ZA 4UMBA 2P3EA 3Q67A 3VOIA 2Z7GA 5HPCA 1AVAA 1EPXA 3BW2A 3FEMA 2GFTA 3QM3A 4UC5A 2TODA 4RCXA 3LHTA 4KT2A 3D46A 1EJSC 3SY1A 2ZFAA 1TE1A 4IXXA 4HMNA 1ALDA 5A2CA 4LVAA 4L56A 1E4IA 1SZFA 4JPGA 4DJFA 2VC7A 1F05A 4IJBA 4JN8A 5HINA 1UUQA 3CC1A 3R25A 1DE6A 4I9AA 1Q8AA 3VX1A 1Z32X 5REQA 3RDKA 1IEWA 5C7HA 4XSMA 1H51A 1E71M 1F7BA 3KL3A 3W7PA 1VBHA 1I2QA 2OSYA 1F3TA 4G56A 4I9JA 1UQZA 3WDHA 3OG3A 1DPMA 1WKFA 1V51A 3CM4A 4GINA 4GIYA 1OC7A 2BWGA 1DXEA 4H8UA 1VHNA 4OU1A 4FNUA 2VUNA 2J24A 4MKNA 3TK7A 1TIWA 5FJOA 1OM0A 5K9XA 3W22A 1W2VA 4QAWA 4W89A 3UNDA 3S42A 3RUBL 4XZLX 3C0QA 4LUJA 1XX1A 3ENLA 3TR9A 3DC8A 1W1A1 4UXDA 2JGQA 3WK0A 1OK4A 1JZ7A 3ZT6A 4UTMA 2E68A 3M16A 1V3LA 1A5KC 4XTIA 4JTIA 1FTXA 2DVXA 3GM8A 4GHRA 3N34A 2A3EA 3TJIA 3OHMB 2NX9A 2EXOA 4A21A 2VX7A 4U31A 4YVVA 3UG3A 4H9VA 1T96A 3TYUA 3L2IA 2I16A 1XGDA 3GXFA 4IMGA 1IR2A 3HF3A 5T9BG 1M7JA 3OZOA 2OODA 2YXGA 2C7FA 1J96A 2QCEA 3DFHA 3DOPA 3VK5A 1LOQA 5IFPA 1RD6A 4B5TA 1IXOA 4EKJA 4HYRA 3ICJA 4LH8A 4GNJA 1W8GA 3NCOA 4IMAA 1EZ2A 3I3DA 3DG6A 2PD9A 1LL7A 1P6WA 2HVNA 2QUUA 3B9DA 1RA5A 3VUSA 1ZBKA 3TFCA 4EPBC 1HN1A 3TMQA 3I68A 3WMBA 3CU2A 3ITGA 4WY0B 3TE9A 1DQWA 2HJPA 2INEA 1KR0A 3UT0A 4RDWA 1UIOA 3Q4DA 1TTQA 4DI8A 2YKKA 2IKJA 1UZ1A 4FNSA 1M7XA 2QDHA 4H6QA 2V9DA 1F3WA 4HMCA 1R9YA 3CLMA 1CLXA 3F2BA 3BGAA 4UOJA 4JL1A 2E9MA 3QC3A 4K7YA 4EANA 2DV0A 4KESA 1GHRA 2OSXA 4UTWC 1B1YA 2A3LA 4OECA 4CQCA 1KM1A 1LBMA 2YCIX 3QR1A 2HISA 2X0SA 2IXUA 4C91A 3T6CA 4KQNA 5CPQA 4KIRA 2WANA 2W92A 3QPEA 3NTYA 3QPYA 3L23A 2V2DA 2DZTA 3LCGA 3ZR5A 2PU0A 2XZ9A 3WFZA 4JN6A 4DXKA 5M5DA 5HNRA 3GRIA 3TN4A 4H6KA 2G96A 4HNVA 5CG0A 5LNSA 2EKCA 3ZMRA 4QRNA 3W1MA 3TTSA 1KCLA 1WAWA 1FCUA 4NL1A 3KXQA 2IQ0A 3N2TA 3VKCA 4MPQA 5DY3A 6ENLA 1C8YA 1SR0A 2EAWA 1TTJA 3HPAA 3AOFA 1XSJA 1QATA 2A3HA 3PZQA 2NWRA 2ABBA 1UD5A 2XFFA 3CZ8A 3HJEA 3B97A 2CXGA 3PAOA 2JQXA 2E77A 3R94A 3UWEA 2QUVA 2YSWA 2C71A 4N42A 3VNZA 4RUBA 3WDQA 3LU2A 2NW0A 1UR1A 1HP5A 2HS8A 4KKXA 1LQAA 1P6CA 1UH4A 1ECEA 2CBVA 1DWHM 1KTNA 1VAHA 1R3WA 3ZVHA 1O68A 4E8GA 3M0XA 3UZJA 2VGGA 1HGYA 2WJEA 4I3GA 3M07A 1E0VA 4KW2A 1KXQA 3RLVA 2VC5A 1VCFA 3WQ5A 2OEKA 3PJXA 5HJXA 1OABA 4LRTA 2X2GA 3S83A 1EP1A 1W9UA 1N82A 4UTTC 4BI6A 2HNEA 4KMQA 3NQGA 3SJNA 3SR7A 1WB0A 3LHWA 3W7HA 3WQFA 1ZAJA 1PZ0A 4UFHA 4XISA 1E73M 3VNMA 1POJA 3ARTA 1BAGA 4R9XA 3SUWA 3M5ZA 3K5XA 2AL1A 2C91A 2GQ3A 4LTSA 2XSAA 4ICNA 5DQPA 3WBEA 3N2MA 3S1XA 3AS3A 5EY5A 2XH0A 1GVYA 3NSMA 4Z2IA 4FX8A 2UY2A 4UFMA 3IUIA 4KWSA 3SADA 3WMCA 3IIVA 4DJEA 4G7EA 4YCOA 4GUFA 3QTPA 2FYMA 2I57A 3NOYA 3II1A 1ZJHA 4US5A 1JJKA 4DJED 1LUCA 4JTEA 3UEQA 3CIXA 3FKKA 4IM4A 3QC0A 1ICQA 1TSIA 1VFHA 3VFCA 4Y90A 3NURA 4MYAA 4HPHA 1RUSA 1FHLA 2XYLA 5A8NA 3T4WA 3EB3A 4UZSA 4CKQA 1VRXA 4JOMA 3CAKA 4MG4A 1OF8A 3SBFA 3WMLA 1E6ZA 3QFEA 3S1VA 4D6IA 4FO4A 3WK1A 3N1AA 3NYZA 1BXCA 3TW9A 4AWTA 1R7OA 3I6RA 2GOUA 1A5NC 3TZFA 1E56A 4TMCA 3GYEA 4W4QA 5CJ5A 4WQ6A 4FLQA 1W91A 3I6TA 1IEVA 3S2NA 1QNOA 4JTHA 1HNYA 4OV9A 5C6MA 2CLLA 1W2PA 3MMUA 1E51A 1JGMA 4IMCA 3EMQA 3H23A 3QJAA 3SGGA 4DYEA 4OBRA 1VYPX 1NVMA 1FHUA 1EL3A 1YDVA 4HK6A 1U83A 3QVQA 4DUOA 4Q6XA 2WV8A 3MO4A 2XDFA 5CSSA 3F4WA 1JF5A 3OVQA 3RITA 3DGBA 2Z7KA 1OHLA 4J1OA 2X7WA 2ZWYA 2BMBA 2GGGA 3LHVA 4JQ1A 4E38A 4MWAB 1RP8A 3BARA 1P1MA 3R89A 3W74A 4QJ3B 3MZ2A 3KOZA 1JZ3A 4UTUA 3CT7A 3F1QA 1XLHA 3GK0A 2GPTA 2D24A 1K7FA 3MWCA 5CGQA 5HMFA 5ECVA 1SZEA 3A3XA 3HPFA 1H7RA 5DY2A 3TAKA 3TXZA 3MDUA 4AQLA 5A6MA 2JKAA 3L65A 3RLGA 3O8AA 2FH8A 3M0MA 4ZOEA 2PDFA 3VNLA 3VIMA 1OCBA 2HVOA 4O57A 2C0HA 3B0VC 1NQ6A 1WP6A 1GT8A 4JS3A 1NFGA 4DBDA 4Q4KA 3MSRA 4QE4A 3D3FA 4NYYA 2OPJA 4DPQA 1JYVA 3B0PA 4HNLA 5FJTA 2JEPA 1EGZA 5I24A 2WNNA 4HZMA 4W8LA 4EPKA 2X16A 2DVTA 3ZSSA 1KD0A 3PM6A 5HDRA 3A13A 3TN6A 4ZTXA 1EP3A 5EMUA 1UB3A 4H6RA 2G5WA 4WZHA 1JI1A 3W88A 1H4PA 4L61A 9CGTA 1H50A 4M80A 4IICA 1XIDA 1A4MA 4HPNA 2DJXA 3AXXA 2EF9A 3S1UA 5C5YA 2NSOA 1U1JA 3U2EA 3KVLA 2V5BA 2D2HA 3C4UA 1J0IA 1FWBC 3NFUA 1A5BA 4KWWA 4PTDA 1X1OA 4H8VA 4AEFA 4IQDA 3HV9A 2PRMA 3T7VA 2QEZA 3RNDA 4Z2LA 3C8NA 3EPNA 3ABQA 3AYVA 3ZR6A 4MB1A 3C2EA 2PODA 1GQNA 5FIPA 4DM2A 1CB2A 3S5OA 2F2HA 1GQLA 5D04C 3W81A 1JCLA 6CGTA 1Q4NX 1F74A 3OEXA 4MY8A 3WEOA 4AY8A 1GKQA 3IAQA 3VFLA 4CD6A 1UD3A 3N3TA 4K1WA 4AIBA 2Z2UA 3CQJA 4KPLA 2HMCA 3EKGA 1UD4A 1XLFA 3WLTA 1PV8A 1C7SA 2XSXA 4AW7A 1AFSA 3RR1A 2NSXA 4AMCA 7REQA 3KAOA 5A6AA 1EWDA 4PRRA 1M68A 1YE6A 3VC5A 3MC5A 1DXFA 2QDDA 1OSEA 4XZNX 5CPSA 4CCEA 4PE8A 1EGMA 2IKIA 1A80A 4XKYB 3V35A 4WSHA 5G4EA 1UJQA 5BU6A 4Z2HA 2C19A 1QNSA 3ATYA 4D6DA 3CYVA 3SCQA 4P7LA 4BHYA 2RHGA 1B3WA 2EQDA 4TVCA 1ZU8A 3QLDA 2BLEA 5A6BA 5IOBA 2HXUA 1E0WA 1S2TA 3LM7A 4G8TA 1FKXA 1VEMA 3F4DA 3QHOA 4DVOA 5A6BD 2BOGX 4A4AA 5G2WA 4W88A 4HA3A 2PTYA 3BCJA 3CUJA 3W7GA 1OADA 3N6JA 4Z0JA 4INFA 3UG8A 3M0KA 3FX4A 4OBSA 1NDWA 5K9CA 1OINA 5F2LA 4YCPA 4Z08A 5LKYA 5CJNA 4F0RA 2DZVA 2BB0A 2Y63A 3T55A 1AD1A 1HT6A 4U10A 1QXLA 4LQ1A 3KP1A 4C6DA 4F3HA 2Z00A 4XUYA 2QMKA 4MWAD 5AVHA 3RX4A 5H1WA 4A3UA 4O19A 2A6LA 1TPFA 1R0MA 4DO7A 4LUSA 1FWAC 3CWNA 4IIEA 2WHKA 4UR8A 4AVNA 1FH8A 3D5HA 1PKMA 5EPDA 1V3IA 1HVXA 1R3YA 3W02A 5DCDA 2VO5A 1GVRA 3TX9A 4M56A 1UG6A 3RRAA 2ZKMX 4GZIA 5AYZA 2G3IA 4NSBA 4XAGA 1U1UA 1SFSA 4UTIA 2V5DA 4IISA 1OCJA 4D8LA 3NL5A 1ADDA 3H4WA 3MW7A 4G9PA 3CZJA 2QPSA 4L9YA 1K8XA 1AW5A 2CKRA 1FX6A 4DUXA 4C5YA 3MY9A 5LA1A 3BO9A 1MFUA 3GUGA 5GVJA 2VURA 3MQTA 2BBFA 4R3UA 1S2VA 2WMGA 2R94A 2RDUA 1FWTA 2J9XA 5FKYA 3G1RA 5AYYA 1QPRA 3RRXA 1J93A 3WLJA 4IFOA 3B8IA 3FYPA 4FOJA 3PVFA 2YB4A 3KVMA 3M5VA 3W2JA 3OA5A 4N2YA 2WSPA 1YPFA 3GH4A 3F03K 3T0BA 3LX9A 1BGGA 1VYRA 2R1MA 1ICPA 1Z48A 3HJZA 2KAUC 4R27A 4GCXA 4LWWA 2C6QA 3CQ0A 3KE0A 3EWXA 1O1ZA 2XU2A 3A64A 3IVSA 2Y70A 1FWIC 2AAMA 1C8XA 3DUGA 3QV9A 1V6VA 1VJZA 1XRTA 1EZWA 4TVUA 4O54A 2EPLX 1L6SA 5HANA 1KQYA 4GFSA 4IX0A 3VGHA 1KRCC 2NQLA 1ONWA 1US3A 2X0YA 1SZGA 3WL1A 1BYBA 1D3GA 3IIOA 3P0XA 3MO7A 4LB3A 2WK2A 3A4WA 4ZXOA 1LWHA 3NQ6A 1J0YA 4JR5A 4XO7A 1UD8A 1EH9A 1X8CA 3FCPA 1LT7A 2V81A 1FHDA 2AKZA 2XIOA 1JPMA 3P81A 4UB9A 5AC6A 2E6FA 1KXHA 3L66A 3UG5A 3N2CA 4I7UA 4HYVA 3SM0A 4ZFMA 2ZX6A 5EMKA 3KHJA 2VZOA 3PTDA 4BY3A 3LB0A 3SCPA 3U7VA 5DANA 5IBXA 2OO6A 3TWBA 4ZQNA 2GUUA 2VI0A 4CQ9A 1F73A 5EA9A 4E4UA 1Z44A 3D47A 5CLWA 1TPVA 1WKDA 2BSLA 4HNOA 5DMLA 4AZCA 5EFDA 4Q8VA 2WC3A 3E2RA 3HPXA 2CETA 2D22A 4YHGA 2CLOA 4JIQA 1QNQA 3UXKA 3BLFA 4UFJA 1K7XA 4R7OA 2GVEA 4BF7A 2QJGA 3QW3A 3L4TA 3H26A 1W1IE 5C54A 4GRSA 5KSWA 1VFOA 2VQTA 3N25A 2P8BA 1H7XA 2IPFA 2CNCA 3AMLA 3EOLA 3Q2DA 3QH2A 3B4UA 5BWAA 4NJGA 3LSBA 3U9IA 1IXPA 3LHZA 2D0GA 3TJXA 4I8DA 3FW6A 4XIMA 2VJXA 3UY7A 1HKIA 1VEOA 3NL3A 4JX6A 3VIOA 1JPDX 4JTCA 3R12A 5FJIA 1CGYA 4WDUA 3T42A 4MWAE 3L4UA 1VKFA 2EBNA 4FIQA 1ZAHA 5LSMA 2BFGA 1O5KA 1Q7ZA 2WCSA 4U3CA 3VD9A 1R3QA 1DJYA 3AYRA 3SCSA 1HX0A 3TP4A 4UFIA 3H22A 3KW3A 2W5FA 3MJYA 4AZGA 2HBXA 4EIVA 4N4QA 3LCXA 2R91A 3CQKA 1K9TA 3HG4A 1FH9A 3VE7A 1TJRA 2OTDA 3M0VA 2X1RA 1CGWA 5ABHA 2ISSA 2ODOA 1MYRA 2JIEA 4QROA 3NDOA 1E9YB 3MP4A 1CGVA 2H3BA 1YNPA 3W7MA 4M0XA 1XBVA 4X22A 5E09A 1ZLPA 5FL1A 1VR6A 4QEHA 7TIMA 1TQXA 3DG7A 3HA1A 3WLSA 4DN1A 1ZP3A 3UWQA 1P6BA 3IJ8A 4LAOA 3W2LA 4IQJA 4KFOA 2BHUA 1V02E 2GJXB 1UJPA 2NQ5A 1TG7A 1MRQA 3B8DA 3U2CA 3BMWA 4MDPA 2PDBA 5D02A 1DQXA 1JRBA 2Y8VA 2WPGA 4MAZA 2IUZA 3CUZA 4Q8OA 4AZ7A 3P61A 4W85A 3WD2A 2POZA 4DJDC 4GGBA 1GVSA 2DZSA 1OYBA 3TQ0A 2PB1A 4LXFA 3WN6A 3CTTA 3LHUA 3IJ7A 4GO8A 2XTKA 4ZSTA 3A9BA 2VVNA 4S3AA 2FIQA 2IXVA 3W6MA 3VCCA 2GGEA 2Q8ZA 1PJ9A 3R6IA 4AHQA 1CENA 3QHMA 2ZUMA 2FVMA 4M24A 1SO6A 1KM5A 4NAEB 1GOOA 1T8XA 1WXZA 5GJMA 1MUWA 2YBTA 3N4AA 3T0AA 3WD4A 3UU0A 2IW0A 3ZVHB 1NP0A 1RQEA 4GYPC 2ABAA 3IAPA 3SZ8A 4HK7A 3V18A 2J25A 4CN6A 2VGFA 1YKWA 2Y5EA 4QS5A 3IVTA 3LCHA 3WUBA 4NZCA 4DAIA 2TRSA 4I7VA 4HYWA 4BQ3A 3XIMA 2OEJA 4GVHA 3G22A 3TSDA 4JYFA 3OLEA 4NILA 2XM1A 3CHDA 6XIAA 4FLOA 3MMDA 4IMFA 3AMDA 3THQA 3HBLA 4QJ5B 3EA1A 2B7OA 2V5KA 1HKMA 3WMSA 4KF1A 1LBFA 1SSDA 3ONCA 5F2GA 5DFAA 1I1XA 3BJSA 1J01A 3BAKA 2BOFX 3ZYZA 2CU0A 2XH7A 4A8NA 3QPZA 2TAAA 1NY1A 2J78A 2YOCA 4I9TA 3NQ8A 3UWUA 2XPKA 2HWGA 1WDWA 3CUIA 1GG1A 3C2RA 4NY2A 1YPXA 3W7CA 1X39A 4E5TA 1OG0A 3A12A 4IIBA 4XZHA 1E72M 2FZ9A 1F8IA 8RUCA 1CB7B 1RBOB 1NDZA 4HHPA 2QYGA 1EBHA 1BSIA 3VGGA 2B81A 2VGBA 2WSQA 5D9PA 1E3ZA 1LUCB 3AWNA 5FD0A 2P0IA 4F79A 4KCTA 4CD8A 2FGBA 3EA3A 5G1MA 4AD4A 4A3YA 4Q8QA 1OFQA 4KCUA 1BKSA 4AU0A 1R87A 3TW6A 5HMSA 4GKLA 5LZLA 4ZQPA 3OP2A 1C9DA 3M0IA 4OWGA 1HP4A 3SUUA 5BRQA 4GZEA 3ZLHA 2ZX9A 2X42A 2VHLA 2GYIA 2WKLA 8CGTA 4S3DA 3BLLA 4WEVX 1KM4A 1LLZA 3WUGA 1J18A 3CV1A 2E8ZA 3UGRA 1LRTA 4H8NA 4E4FA 2Z2BA 4C6KA 1E4NA 1RLCL 3W84A 4N02A 1EDGA 4NF7A 2BZNA 1N8IA 3F7JA 4IHCA 1P1XA 2QUMA 4GE8A 3TROA 4C6QA 1I45A 2RGLA 5M2FX 2AGTA 4NT0A 1I0BA 1FA2A 2FVLA 1Z8AA 3APGA 2BXYA 1NEYA 1CEOA 1UKQA 3H2MA 1K9FA 5BCAA 3B9AA 3L4ZA 3WQCA 1XRFA 3JW7A 3PZTA 5AN7A 4ES4A 1CLKA 2GQ8A 3QGVA 4X9YA 1TPB1 5FAJA 2Z1KA 1GK8A 1UKTA 2XIIA 4MM1A 3WK2A 4PSRA 4UNLA 1UASA 1NIUA 5LNRA 1C7TA 4Y9AA 1Z42A 3AXHA 4C90A 4G2DA 4K6AA 3LV5A 2OYMA 1NELA 3ARQA 3GE7A 1DJZA 1TB3A 1TWWA 1VFTA 3W7KA 1EX5A 1HG3A 1RPXA 2XIJA 3VVGA 3TC3A 1W5PA 2O0TA 1S2WA 2W3ZA 3K30A 2CZEA 2PLCA 3AJXA 2WNWA 2GVLA 1ODZA 3QYSA 1UR2A 4FSAA 1EJUC 1A5CA 2ON3A 4S3JA 2ASHA 1FUYA 2VTFA 2A7PA 2QDEA 2I56A 2C14A 1TA3A 2BGNE 5FF3A 3U0HA 5FSEC 2QDGA 3GIQA 3SAZA 5MKGA 2ZUTA 3CNYA 4ZO6A 5KTLA 3EX6A 5F4SA 1N2VA 2P8CA 3W2NA 1QI4A 3WF0A 4E2VA 1BVNP 4K2SA 4PCSA 4KEMA 2YBVA 4O53A 4O50A 3TC6A 4C6LA 3DHPA 4W7VA 3TQKA 3TA9A 5HUPA 2IPGA 2VFEA 4S3BA 3PC0A 5JBEA 4LSBA 1JCMP 4YS1A 2PMQA 1K70A 1J11A 2ZRVA 2ZIDA 4P8WA 3K13A 1HKWA 2FB2A 4RXGA 1ZJIA 5J5DA 1YX1A 2OT0A 1PKYA 1G67A 1HL9A 4ACYA 5EMLA 3RJXA 2ZC1A 1WO2A 4KGLA 3EAUA 2BY0A 2Z26A 1E1CA 3VGEA 4M6QA 1XQKA 3BAWA 1GYMA 3EOEA 1GORA 2QGHA 3LTYA 3VNYA 1EO5A 2FPTA 5C55A 4LB4A 4MDOA 3KOXA 4K8HA 5CSRA 3RR4A 3P74A 4LEQA 3MUZ1 4AMAA 1KTCA 5D32A 3WNNA 4QSFA 5EBAA 1JUBA 1MEWA 1KO0A 4RLIA 5ABTA 3C86A 3AHXA 1E1FA 2SFPA 2YB1A 2DH3A 2GGIA 3MA8A 2HSAA 1F61A 1CYGA 1R8LA 3MV01 5CG7A 1IIGA 1M7OA 5FF0A 3BV7A 4O18A 4C6CA 1XXXA 1TJ2A 1XDMA 4BEUA 1CI1A 3S8HA 3WLHA 4CD4A 2WVVB 3CEUA 3EKZA 5DXXA 4GXMA 4DLFA 2QHAA 2Z24A 5DELA 3LNMA 2XG9A 3IPWA 1UBSA 3RN6A 1E0UA 4MZYA 2V5CA 4O17A 1KBJA 1BQGA 4RNFA 3RK8A 1QU4A 3VDBA 3VI2A 1GUVA 3EYPA 3CK5A 2BV9A 4GIRA 3V1HA 5AKQA 4GUHA 1GVQA 4S1FA 1LORA 1VC4A 3UF9A 3LCLA 4I5RA 1BD0A 1XLMA 3OHIA 2W6RA 4ROPA 5CQ1A 3PTMA 1T40A 1DJIA 3L0KA 4FNRA 4Q4SA 1JXKA 3VILA 2VX5A 4QNWA 2P5NA 3OQ8A 4PMOA 3CAVA 3OODA 1OFEA 4ZOAA 1YQ2A 2W66A 5AB3A 2Y4SA 3HPZA 3TTYA 3W7QA 3BLKA 4C1KA 7XIMA 2VM8A 4WJXA 3THUA 4JQAA 4ZEPA 1JPKA 1L8NA 5F1VA 4AUBA 4LS0A 1QK2A 4RZBA 2E9BA 3CZEA 3WUEA 1E70M 3BCDA 3GH7A 1GCYA 2VRQA 1GWJA 3KS6A 3SY8A 4ICCX 1L2QA 4LYPA 1NQKA 1JR1A 4B16A 1TTPA 4RE3A 3ZR4A 4M82A 4GG9A 1GZJA 3T4CA 4NYUA 1PKNA 2PWFA 4O1AA 5LIWX 2CESA 3QR0A 1TVLA 2Q8LA 3SCNA 4NJIA 3DZ1A 4M6PA 5DEZA 2WMHA 3PWGA 2V2HA 1V77A 3KTSA 1KWKA 3GNXA 2JF7A 3DN5A 4BZYA 4IXHA 1H7WA 1KXVA 4WX2A 3FYOA 5T26A 3TSMA 1UWAA 3BAYA 3ITOA 2D2OA 4KFPA 4PCNA 1J0ZA 3GFYA 3QMSA 1ISVA 2DPEA 1PB0A 4G7FA 5CZTA 3G6MA 5I0DA 1W3TA 3WDIA 2GLKA 1PL9A 4HPGA 4N6EA 3LXBA 3GW3A 2VFGA 3FOKA 3ZT5A 3KRBA 4Q4OA 2I5GA 1DEDA 1T99A 2VZUA 3NQEA 1B3ZA 2V2CA 2B0MA 1W1TA 2V68A 2PWHA 3H7RA 3NNTA 1XPGA 1DIOA 1XLEA 3PJWA 3W9ZA 1UUMA 3HGOA 5TNVA 5DCEA 2XGZA 4IG2A 2E5BA 3FK4A 4XK2A 3GHRA 1F3EA 3AICA 2Y0FA 1KA9F 4LUTA 2JGYA 4S3EA 4LUIA 2QW5A 3CV2A 2IPJA 4LF2A 3LDVA 4GQBA 2E1DA 5BYWA 2ATSA 3ALGA 4GNKB 1XIBA 1OIMA 3ITTA 1XM3A 4JFWA 2J7BA 4UCGA 5JIWA 2GVYA 2CIPA 2Z4GA 1QPOA 1AK5A 4FALA 3VIHA 3GTFA 3OBAA 2QCFA 2XIMA 1YDNA 2PURA 4D9PA 1EFZA 1ZJBA 5CPNA 5DXYA 3VE9A 1K8CA 4UQDA 1UR3M 4MYXA 1N7KA 2ZXDA 4OOZA 2HPIA 2FFIA 2E5DA 4O0QA 5I3HA 3W3OA 3S46A 4YPJA 1P0KA 2J8TA 2Y88A 1L0PA 3V0SA 5AY7A 1TVPA 2PGRA 1QNRA 1IXNA 2QV5A 2YA2A 1TV7A 1DWAM 3BAXA 3RPTA 1X8FA 3E49A 3CLWA 3M6DA 5FF4A 1XBXA 2PI6A 3APYA 3S6TA 3QY8A 2Q02A 4NZ3A 3RYSA 5D2XA 1GONA 1EPVA 4TX8A 3BW3A 4EF8A 3VD4A 4IPNB 4B2DA 4N9CA 4DO6A 2V63A 2OWWA 3RPDA 3WK3A 1E9LA 2DJLA 1AH4A 3H2EA 5E0CA 4LVBA 2ADAA 1AW2A 4GUGA 2OOGA 3PZNA 3BLPX 5K3VA 3ONBA 2OELA 2C15A 4ZBCA 3NOEA 5CPTA 1IIHA 3NPUA 4AF0A 3A9IA 2J7CA 3SI9A 4NNCA 1ITUA 3R1ZA 4WIWA 1G4SA 3H24A 1H11A 1QRQA 4QG6A 1QI3A 4DB7A 4LV4A 2DZUA 2V3EA 2Y5JA 4I5UA 3U6WA 3QGAC 2ZWZA 4ZE5A 4HHHA 1ZNNA 2XGBA 3TN3A 4A05A 1UR4A 4FMVA 4BWLC 1EO7A 4IP4A 3WENA 1B2YA 4MLJA 3W1TA 4XUGA 2DIKA 2QR6A 4PYSA 4E4PA 4XAFA 4TV6A 4XZBA 1K6AA 1WDPA 1XLAA 3NQ7A 4FNTA 4IUGA 2WM0A 1BF2A 1FWFC 2QV4A 3B0UX 3KBVA 4Y8EA 3AIEA 1I9CB 2YDQA 3CIVA 2OZ8A 1K8ZA 4YLWA 2HXTA 3TLQA 3I7SA 1H0IA 3TW7A 3B9EA 1O1HA 4MVAA 4ZMGA 4JL2A 3N18A 4ZGYA 2PDQA 3SGUA 4HQVA 2J7HA 2WHJA 1XIJA 2VZVA 2Y7FA 4DHGA 3SRFA 1UPMB 4LAMA 4XD4A 3FFSA 3ARVA 3DI0A 2YLLA 1OEPA 5TF0A 2CKSA 4AB4A 3TYBA 4J3SA 4FOUA 2ZADA 2PDCA 2INZA 3MCNA 2XWEA 3RX3A 4EXAA 1UHVA 4KETA 4F0SA 2G97A 3LTPA 3R10A 2E25A 1JG9A 4DJDD 4HB7A 1GG0A 3W72A 2ZZ2A 3N12A 1GZGA 3TJ4A 1IEXA 4O0KA 1MFVA 4Y9PA 3H21A 4Q8NA 4BQ4A 1SM9A 4F0MA 3KZSA 1X97A 4HK5A 3QHNA 3L0GA 5AC7A 3PBGA 2FDMA 2CZVA 4R53A 3IK4A 1LWJA 1MO0A 2OWXA 3LQLA 3N14A 4GYPA 1F2JA 3AAMA 4X2RA 4AX7A 1BXBA 2DU2A 4PTWA 5BOOA 3QBUA 4XV0A 1DWJM 2NXHA 2BDQA 3M1ZA 5FCZA 1V3JA 1DYSA 4NU7A 3MYPA 3ZJ6A 1CX9A 4DY1A 3LA4A 4NKCA 1JZ5A 4XD6A 1ADSA 2CXEA 5GJNA 4ROQA 2PCEA 3DHFA 1Q63A 5FI8A 1WDRA 4JFVA 4C1LA 1PS9A 4JNYA 3HGRA 3BXWA 1WDQA 1H3GA 1OD0A 2Y7DA 4ZOCA 4NHVA 4QG8A 3WLRA 4E0CA 1NU5A 1Q6EA 5K9DA 4HNNA 5HNTA 3XISA 3UZWA 3L9CA 3LPOA 1C90A 4PUNA 2QJMA 1UW9A 3K1GA 2NXGA 1SU5A 3NA8A 3VOFA 2J9ZA 3TA6A 2XFRA 5I09A 3E2QA 3WQWA 1VPYA 1BKHA 2ZUWA 1IXQA 3KOFA 2ZZ4A 4JYDA 1B5TA 3P67A 1RJPA 4US6A 2ZDSA 3GZ3A 3GTIA 2YBUA 3V36A 3CT2A 1HL8A 2V6AA 3EX3A 1HJSA 4QTGA 4P8XA 4CD5A 5KMYA 5LNVA 4L4PA 3G24A 2FZMA 4DBUA 3MUXA 2QJNA 2X7VA 4OBTA 3V5OA 1L6FA 3T9PA 5A69A 3KL0A 4Z2KA 3UETA 1XLJA 3BG9A 3PZUA 2POTA 3GKFA 3TOYA 3WG6A 3CL6A 2J75A 4RL3A 1UP0A 5GNYA 3LPGA 2WO5A 2DZAA 4FXFA 3ABZA 3OZMA 4LT9A 1P43A 3URNA 4QDMA 1EHAA 4NJKA 4LW7A 1KXTA 3P7YA 1KBLA 2OKOA 2CCRA 1R3TA 3IUDA 3SCWA 3SB0A 1PTGA 3VCNA 5T8GA 3WIJA 4Q8PA 2WHMA 4D6HA 3H4XA 5I77A 1GEQA 2WBKA 1VB9A 2WW5A 2VEKA 3PFMA 1XYZA 1TPWA 1JNDA 4HSHA 3W0KA 1SR9A 2DSZA 4CLMA 4IH3A 4PULA 1Q6LA 3QV7A 1LP6A 2QCNA 4AEEA 4GYFA 1X1ZA 3P8IA 3EEZA 3VOHA 5LNWA 1CECA 1KC7A 1IGSA 1WX0A 2R1PA 3LI1A 3WQOA 5KEZA 1YEYA 3GNNA 4GLEA 5D03A 3AUJA 1HJQA 1SJDA 3F5LA 4BCEA 3SJ3A 4QG9A 4F9DA 1V5XA 2PSNA 1XS2A 1BG9A 5M3WA 4XO6A 3VU2A 3TWAA 4ZA0A 2DW6A 1TO3A 4H9MA 4JBRA 4XZ9A 3GG7A 3N2BA 3FIGA 3DYPA 1WV2A 4A6GA 1GJUA 3HURA 2YZ5A 3MMWA 5LYRA 4H19A 2E5CA 2E40A 5MHBA 3BLIA 2QIWA 3A4JA 3TC7A 3K4DA 4L64A 4OJYA 1M53A 1Y65A 4UTHA 4F0KA 1UOZA 3KVKA 3NZQA 4WY0F 3CPGA 4AXKA 1FHVA 4GIAA 1UYQA 2AOSA 1ZAIA 2VQUA 4QXIA 3WY1A 3WEMA 2FMNA 2PDWA 1DJWA 2G3JA 1RK5A 4C65A 4NNAA 2DDXA 3H53A 4KRTA 3C61A 5M17A 1AMKA 1YNQA 1S3HA 1V08A 4HCLA 3HQ1A 1XUZA 1FWDC 1ZS2A 4PL2A 3U2OA 5C7VA 5FJUA 2X30A 1VZWA 4LYQA 1ZCCA 4LBSA 1TJPA 5MKGB 1C29A 4RDVA 4E3VA 3TTQA 1ZCOA 3RM9A 4GGHA 1Z9AA 3P93A 3EX4A 2ZA1A 4Z1CA 4LF1A 3GZAA 4ALDA 1EJ7L 4LS2A 3KRUA 2YYUA 5I6SA 3WLPA 2OZTA 1DJHA 1KFWA 3BUVA 4EXBA 1H2JA 1YW1A 4FLSA 4WJ8A 4DX3A 2HBVA 1ZB5A 4FI4A 2GL5A 2V0TA 2QJHA 2VDHA 1RJRA 3GWQA 4JGDA 1KNWA 2A7NA 1VFMA 4REQB 1KBBA 4KRZA 3WDRA 2C1IA 5A6KA 1TZ7A 1GOKA 1LQ0A 1TRDA 3GR4A 3EWDA 4NQ1A 2VCCA 1CXHA 4FPSA 3PR2A 5D9NA 3E2SA 4JICA 3CQIA 3AC0A 5JU6A 3BL3A 5LXEA 1HL2A 4Y9NA 3W1QA 4HNTA 3FVMA 1TWSA 5IFTA 4AEOA 3W7IA 4W8AA 3QZEA 3OBKA 1OC5A 4DZ5A 3H7UA 1OGGA 3NZRA 4QDPA 3C3UA 1DJGA 3WSUA 2GJPA 4GI6A 3REQA 1OBAA 3A47A 2PBGA 4GD0A 7CGTA 3RLHA 3ZQ9A 4BS0A 1E40A 5H8MA 1AQ0A 4NZ1A 1UBPC 4WUIA 4DUVA 4GJIA 2VP8A 2GOKA 3EA2A 2FH6A 5I02A 1A5OC 4NAFA 3VOJA 4CVUA 3GLCA 2YL9A 4KWVA 4DO5A 3THDA 1ITCA 3CUFA 1VGAA 4QJ1A 1I75A 5ABFA 5HR7A 3PF3A 3BANA 3DC0A 2XH2A 2GSEA 3UFYA 2ISWA 1RBLA 4H7CA 3COTA 3JRKA 3M0HA 3LNPA 2NUXA 1MUCA 1A4LA 2ALRA 3OG2A 3VD5A 1OK6A 4PMXA 2QPUA 4DWSC 1J0KA 1ITQA 3PSVA 3AS2A 2ZZ3A 4UTFA 4URIA 4CNPA 2JKPA 3NPVA 1QW7A 1AL8A 1PHQA 2G37A 4PMQA 4LPCA 4DWDA 3HPSA 5HATA 1DVJA 2HK1A 1IT8A 4HTYA 5F2IA 3BG3A 4BQ2A 2OCZA 1YDOA 2CZFA 1H7OA 1MRAA 1PYMA 2Y6ZA 4PUUA 3GS6A 1CCWB 3VTRA 3PNUA 4B4HA 1FKWA 3OJGA 4O1FA 3LCIA 2X8RA 3MDWA 3TXVA 2G4JA 4Q22A 3BMXA 4O1DA 3QLLA 3SQSA 3ARSA 3GDRA 1KW1A 2WPBA 5FACA 3MP3A 3OLIA 1U2YA 4DYKA 1JDDA 4L65A 1P48A 4V28A 2W27A 1H62A 4QNEA 1PX8A 1CWYA 3WF2A 4W5UA 1VENA 5HWMA 1SZRA 3H54A 1XICA 2D2GA 3KHDA 3QYQA 3CXOA 4BFAA 4O14A 5AYBA 5KZMA 3L2LA 2VVSA 1KCZA 1W3IA 2OKTA 3NQFA 4YVPA 3SUTA 1JDCA 3C0LA 3IGXA 1F6KA 4GYJA 1RA0A 4PBFA 1QW9A 1K8YA 4L5ZA 3T40A 1V3MA 1IV8A 3E0LA 3SURA 4J35A 3BSMA 3PUOA 1UWIA 4A3RA 5HWJA 4IPJA 4QCEA 1OZQA 4IJRA 3U48A 3BOFA 8TIMA 2VEFA 4JD4A 2EPOA 3KOWA 3DYOA 3CZKA 1OFDA 5D05A 5CC6A 4A2RA 2PEVA 1Q2SA 3EB2A 3EWUA 1MQRA 2RAGA 3EDDA 4PTNA 1FCVA 3CUHA 1EXPA 4N7QA 4V33A 4LANA 1XKYA 1EJVC 4IGMA 5D2TA 3G8RA 1SW0A 4K39A 3EB4A 4Q6JA 2FJKA 5CXPA 4K7VA 3CHVA 1UROA 5LXXA 1EYWA 4D8ZA 1PDYA 3N17A 5B7YA 3AS1A 4CUCA 3BICA 4ML4A 3W1NA 1M04A 3ATZA 2F6XA 2C3ZA 3AFBA 1TPEA 2FZDA 1OZMA 2OSWA 4CNTA 3EDEA 1G7VA 2EPHA 3NQBA 4IG2B 3M6YA 5A8GA 1ZPTA 3G18A 3GNRA 2BS9A 4OFCA 4LUTB 4F4RA 3OTRA 1U33A 4N9BA 1K6WA 2E09A 5A8OA 6XIMA 3C5QA 2CW6A 3W85A 1EC9A 2OQYA 1FVPA 1Q4WA 5RUBA 1XD0A 3BC9A 2YXXA 1A47A 1RY0A 1W0MA 1M1BA 1JQVA 3QW4B 3RJYA 3JR2A 2OGYA 1Y5WA 1XLDA 4UZUA 1V0KA 3PWAA 5EGRA 4AZHA 2J47A 3CAQA 1FWSA 5D2WA 1BRLA 4LX4A 5BW6A 1P0NA 1S2AA 2V3DA 3IJLA 4AX6A 1KFJA 3PB2A 4IIDA 4H9ZA 5D2VA 2VC6A 5ABEA 2W79A 2PP3A 4HNCA 3C6CA 3KEHA 4RW5A 1I0DA 4DUWA 1PIIA 3GVQA 2QJJA 5BXSA 1S1PA 2XWDA 3VNDA 4Q7BA 5C70A 3WH7A 4FAMA 3M0JA 4BF9A 3MV11 1VJSA 5G1TA 3QV8A 1CIUA 3IANA 1IWAA 5FEPA 2ZZ6A 4MWAC 2A7RA 4ZO8A 2ZXAA 4LVFA 1FP9A 1VIZA 2FFCA 3T2OA 3A3WA 2G41A 1DIEA 3CPRA 3DENA 1R47A 1Z89A 3UYCA 2ZDRA 4ZSUA 4N4PA 1AUSL 3S2MA 4B5VA 3G6LA 4FR1A 3VZYA 4PRWA 5CAKA 3OLDA 2IMRA 2WZHA 4DLMA 3S1WA 2HTMA 2UY3A 1IT0A 3TJLA 3VIGA 1C3FA 4W7UA 3UVIA 3OYZA 2WMJA 1KR1A 2J7FA 3HO8A 1AQHA 3M5XA 2ZUUA 5FA5A 1JFXA 3TCEA 3M64A 1PWMA 3KVJA 4LYRA 2V8ZA 5DT7A 1E6RA 9XIAA 4F48A 1F9CA 4C5ZA 3BJFA 2J8GA 4H00A 2NQHA 4ZFCA 2J13A 1JNEA 3DFYA 1JEZA 3PZGA 2VUYA 1DL3A 4U4MA 5I07A 1KGWA 1THFD 3W7DA 3GNDA 1LJYA 3ME3A 4GXPA 3EEGA 3GU2A 1CGXA 3RMEA 3WLKX 3SQLA 1OX4A 2PAJA 2ZRXA 1YTDA 2PLKA 3WH5A 1EEXA 1OJXA 4L1XA 2FTPA 1MNZA 3E0FA 1Z6KA 3O6YX 3ES8A 5CLTA 1UCWA 1VFSA 1JULA 1PCKA 2R1KA 1CTNA 1J2BA 4CQBA 1QT1A 3PBMA 4X60A 1EF2A 3UZ5A 4JIPA 1M7PA 1H0GA 1RD5A 1LQ2A 3N11A 3W25A 2VD9A 2ZRYA 4R88A 3GC4A 4OV4A 4ZB2A 3SFKA 3FEQA 2KX9A 2PBOA 3TTOA 1E6QM 2PC4A 4DQWA 4XB3A 1JAKA 4O12A 5EL1A 4WOZA 4KEZA 2Y7GA 2VDGA 3NSXA 1RV8A 5CPLA 3TCSA 2HS6A 3WQPA 1ZHAA 2X05A 4U33A 3LPPA 3GW0A 4TIMA 1A3HA 1S5MA 2O4MA 3BGGA 4LU0A 3EWBX 5G1YA 3RCNA 5DMMA 4A3QA 4GBUA 3TNBA 4DZHA 1B57A 3DFNA 2F8QA 1EKOA 5D8ZA 2HNHA 3URBA 4LNYA 3ZT7A 4C6PA 2Y24A 4LY4A 1DWFM 4BA0A 3QY6A 1JCTA 4X2PA 3GG0A 1DXIA 2UV8G 1KQZA 2OO0A 1V7AA 2PDHA 3QOKA 3EWZA 4YIWA 3OGSA 4QR6A 3ANUA 1FWNA 3CPUA 3UJSA 1DJXA 3HG2A 3QMRA 2X1TA 5C8BB 4Z2JA 4Y7EA 4PMJA 2Q6ZA 4RNIA 1W9XA 2GJLA 1DKWA 4PUJA 4CU6A 1UC4A 2TYSA 3A4AA 4QE1A 2ZZ7A 1XYMA 4GJJA 3UWZA 4XKMA 4NASA 3THCA 4DXXA 1B3VA 2PDGA 2EO7A 4RX0A 1ZTVA 3HTWA 2D3NA 2FZ8A 4Q32A 4JZ5A 5I78A 1W3JA 4O11A 3WFAA 1LYXA 1HXJA 3H70A 3K4WA 4FNQA 3UJEA 3O06A 6REQA 4AWSA 3WQDA 3PPGA 3VGDA 3ZO9A 4F0LA 4MHBA 4RPPA 4A8RA 1D7KA 4JKKA 4IWWA 3APTA 3W2UA 4B3LA 1JUKA 4WHBA 4MUZA 4WSKA 2CBUA 4GK8A 4AD1A 4GMEA 4QE5A 4GQGA 4M7SA 4BKNA 4HJFA 3OYXA 3C0SA 3Q45A 1E6SM 4MFDA 5HJYA 4OUIA 1JPIA 4C7DA 5DBUA 4FIRA 1W37A 1QBAA 2BTMA 1TV4A 3HMJG 2XGIA 1ZSXA 2H6RA 1Z69A 1A5LC 3M43A 2CLKA 2VELA 3N6HA 4D6GA 3FY1A 1IR1A 3FSTA 3CTLA 5D9OA 3H12A 1YLVA 5LHFA 2WCGA 3N29A 2WB5A 1NFBA 1BWVA 4NJJA 1VH7A 3TYAA 4NI3A 4L4OA 4ORIA 4JX4A 5A6TC 3PZMA 5E93A 3VA8A 2CEQA 4RE0A 2ZRZA 3ARWA 1V6UA 3S9YA 3AIBA 4W5ZA 4R34A 5CBJA 3NEHA 2QVNA 2J4GA 4ZB5A 4EPEC 3IRSA 1RCXB 4DZIA 4IMEA 3GXPA 5LA0A 2E6DA 4TOQA 2JKEA 2JBMA 4JY9A 3K8MA 4DWSB 3W38A 2CHRA 3E0VA 4XQ6A 2WJDA 2E0PA 3M46A 4L1GA 1UKOA 3MP5A 5C9UA 4HU4A 3QFWA 4J27A 4W87A 1MZHA 1LTDA 3IUHA 5DRIA 3IACA 1E4LA 5E0FA 4TVDA 1W3HA 1OFBA 1DP0A 2PWUA 4M6VA 4YHEA 4IL0A 1WXJA 2ACUA 4Z1YA 4H6EA 4F40A 1YNYA 3GFXA 4GI9A 1EC7A 1G9HA 4D6EA 1ENUA 1KRBC 4MJ2A 1UOKA 1E6NA 1ICSA 2BNJA 1OFAA 2NV9A 3GY1A 4PB3A 4QM1A 5T91A 2FZBA 4JQ3A 3H55A 4HNUA 1RALA 3NSNA 3VO0A 1HVQA 2XISA 3PBWA 1S1RA 4HOXA 4DJFC 2AQOA 5HQLA 3KZPA 3C2YA 4POCA 3WF4A 4ADSA 3TYEA 1I2NA 1SSGA 4JTGA 3WEZA 4EK7A 3KCJA 1BF6A 4E8CA 4OOUA 3ARUA 2DUXA 1XCXA 1M03A 5I3KA 1SJBA 2GDQA 3WFLA 3G1SA 3B04A 2W67A 3ALFA 1GKRA 5D37A 2A6NA 5JVLA 2TSYA 1E1EA 2ISVA 3SRDA 3TYDA 2HVMA 2Z28A 3ANYA 4KBXA 4H7ZA 5AC5A 5BU9A 4GUJA 4HA1A 4A29A 3MHGA 3PB0A 3ZZ1A 3T2QA 3OVRA 1G01A 1Q6FA 3W87A 4DZAA 4M81A 2C0AA 3PY2A 2J77A 3OIHA 1ISWA 4WDXA 1RY8A 2OLSA 1E6PA 1X96A 4NIRA 5EYWA 3DXIA 1P0EA 1D2KA 1UWTA 5D2YA 3BAJA 3FDKA 1C8QA 3JU2A 5LIYX 2CWXA 1PBGA 4LVGA 4QX4A 4DELA 4WY0A 4QP0A 3U8GA 3GHTA 4MGGA 3H4GA 1OCNA 5GNXA 3C0JA 4PMDA 4ZTYA 3WQEA 2WOQA 6TIMA 1AA1B 3AIWA 4B5WA 1JZ6A 1G69A 3QGKC 2GVJA 3FAWA 1FH7A 2ICSA 1TR9A 3AHYA 3SN0A 5E9XA 1F8MA 1HO1A 5F2MA 3PWIA 1D3HA 1NFPA 4MIMA 3G5EA 2RDTA 2D2JA 5LNUA 3PBYA 1BTCA 3TSBA 4JTDA 4B3KA 1S3TC 3ARXA 1W6TA 5A1AA 2OQHA 1GZ1A 1VJIA 1XDLA 3EXTA 2BODX 5KETA 1B90A 2FHBA 5FJPA 5IDIA 3W00A 1XJBA 4OIFA 3IJDA 3H6OA 4PB5A 4PR4A 3E74A 3GBDA 3MI2A 2X0HA 1P7TA 4JTSA 1S2CA 2DH2A 4RV8A 4JEQA 1EXBA 5GNZA 3DKLA 1SUXA 4O28A 2OX4A 2PP1A 2VZSA 3CMGA 3E02A 3S5YA 2PE4A 3K8KA 2PDLA 1KTBA 2BXZA 1EX1A 4DWSD 1H1YA 2WQPA 4PFHA 3Q58A 3SCOA 3REQB 3H2AA 2ZX5A 1TJ1A 5PTDA 3AMKA 3PP7A 4YNGA 3ZOAA 1H09A 4O4VA 3WDJA 3ORWA 3NQVA 1W9DM 4H3DA 3RFAA 2HEJA 1VIWA 4GH3A 2A3AA 1KBIA 1J0JA 3UWYA 2C18A 3LV6A 3BOXA 4Q4PA 1EEPA 4GY0A 2X1SA 1XGEA 2BHYA 1JZ2A 3B9OA 1IWPA 1M01A 4TXEA 4TR9A 2Z6JA 3S6DA 1ESWA 2OJPA 3KFTA 4LCRA 3PAJA 3DIPA 1Z41A 1NJJA 4XG1A 1VCGA 1OG6A 2XZ7A 1H7NA 2QCDA 3UXIA 2YXOA 1XFBA 2DY3A 2FPVA 3KTCA 2JE8A 2HZGA 1SW3A 3U2ZA 4ADUA 2OGJA 1ZBCA 2PGFA 4YWIA 3TR2A 1QI0A 1QBBA 3E96A 4ACZB 1R3SA 1PX3A 2O9OA 2H3DA 4PODA 1GEHA 2EJAA 3IV3A 3OIXA 1IZCA 2GDVA 4M5PA 5K2ZA 1BQCA 4JHMA 1X6LA 1S39A 4BQ5A 2YR1A 4DF0A 3XINA 3GXDA 2F61A 2L5HA 3ITXA 4K38A 5AFDA 4M19A 4AH7A 2HV5A 2VENA 1WOBA 2VWSA 3QKZA 1ME7A 2FTWA 5E70A 4RDZA 1HJUA 1KFBA 3G1AA 1ML1A 2EPKX 1JCJA 4HCHA 4P8UA 3W01A 2I5IA 2CZ5A 1DJQA 2R8WA 3NVDA 1KM0A 1TKKA 3S2LA 3GDBA 1SFJA 3A6OA 4GBDA 1KKOA 4ATDA 2P76A 3W7JA 4NP7A 3KRZA 1LT8A 7ODCA 1EUAA 4DO4A 3MTWA 1W1VA 4PB4A 3P5YA 3ES7A 4HSOA 3CBWA 4J3VA 4FEZA 3A5VA 2Y5SA 3NAVA 4AZBA 1XLBA 3HMCA 4IFKA 4IGHA 4D6CA 3STPA 2X41A 5AHLA 3L12A 2ZYFA 2TPSA 2GK1B 1TFVA 5M03A 3GG1A 3S5ZA 2V30A 3KLLA 4V2XA 3MVTA 4FX7A 1YBQA 3V4BA 3W29A 2WSYA 1FXPA 3WQ8A 2ISDA 2P10A 1D7FA 1K77A 2QJIA 1K03A 3SEPA 1AW1A 1RXOB 4S3CA 4WD0A 3W83A 4J7RA 1CDGA 3BMVA 4R33A 5U7SA 3IJIA 1PO9A 1E0XA 2WJFA 2R1LA 2TMDA 4V15A 1TX2A 2VFDA 2CHNA 4OUEA 3WJSA 3M44A 3O6DA 1X98A 1S5TA 2PS2A 3HGJA 5E1QA 4N9DA 4AC1X 1E5NA 4GCAA 3G0XA 1XLKA 1JDEA 5C0QA 4MWAA 3VD7A 5HMEA 1MW1A 2YW3A 4XWUA 2PLMA 3NR0A 4LV9A 3KCOA 1POKA 4WGHA 3W86A 4JIHA 3MMTA 1BRLB 4GZ7A 2VEGA 3KBSA 3LBOA 2J8FA 1WKYA 4E3TA 1AJ0A 4JFSA 4MJZA 3V16A 2VWTA 3LD5A 1L6YA 1O60A 5A2AA 4BR1A 2WZEA 1FCBA 3ZLGA 5K4XA 2PWEA 4G6CA 9XIMA 3HZ3A 3DBPA 2ZVIA 2Z29A 4ZQMA 5LHEA 4U28A 1FWHC 2EG6A 1TWIA 2CHOA 2F6KA 4UNIA 3N4EA 1Q8JA 3NJ3A 2QQ6A 5C9RA 2Z1VA 5FAGA 2PTDA 1DORA 1SQ7A 1QR7A 5IXEA 1A49A 5AHEA 2IKHA 1HKVA 4EX4A 1S38A 3P6LA 3FA4A 4OZOA 1GQJA 2NWSA 2WNZA 1A0CA 3VZZA 4IT1A 3EDJA 1V02A 4FF7A 1J79A 2NQZA 3W1LA 2GVGA 3TONA 1FXQA 4D2JA 4DPPA 4PRTA 4CNOA 1AH3A 4C7GA 3QTGA 1EBGA 3K46A 4GC4A 5AHNA 3OB8A 3HG3A 4H8HA 5EMJA 3VIPA 4R7JA 3DERA 3IWPA 1W9BM 1HW6A 2DZWA 3CL8A 3UERA 1DHKA 1V6YA 5E9AA 1QHPA 4XVEA 1JQXA 4D1JA 1PYFA 3KDNA 2XVPA 4X0NA 4WXYA 3AU2A 2QNEA 3HQNA 4ZOBA 4A8LA 2D1ZA 2J9YA 3CH0A 3PUGA 1W1B1 1Q85A 4HHMA 3GHSA 1AL7A 3SCVA 3STCA 4KS0A 2X1IA 4JTLA 3MCMA 4MZ1A 3RX2A 2A2IA 4H2HA 3TN5A 4WF7A 1SZNA 4LBRA 5EMMA 1LROA 1WKEA 3PSWA 4EACA 4PTVA 1I2PA 1XYAA 1OX4B 1BYDA 2BG5A 4PUMA 1FWJC 2ZRWA 3H8AA 5B80A 1KV8A 3I3BA 3LHYA 1VEPA 1LM1A 4W84A 4WRHA 4DYJA 1MXSA 5DF0A 3EPOA 4WKFA 3TMLA 3G77A 3TEVA 4HMEA 5A5WA 1O4UA 4R85A 3IJQA 2BGSA 2QAPA 1PZ2A 3LRLA 1I2OA 4YL2A 4O1EA 3R8GA 3B0XA 2C79A 3IV8A 2AGKA 1C92A 4UQAA 3RG6A 5KZ6A 3O6CA 1XBZA 4OQVA 3NUKA 4GVGA 3MS8A 1ZP4A 5C9XA 4DI9A 1N55A 2PDIA 4L7ZA 4RE4A 5REQB 3VABA 3E12A 3WNMA 2FKPA 3ZWSA 4RKAA 1ZALA 1DWGM 4H41A 2VXNA 4HPXA 3URQA 4PCTA 4H9XA 2LLEA 1G5AA 4LUYA 3UESA 1OT2A 4NX5A 3TV8A 3WQGA 4J3UA 4JQ2A 4Z1DA 3I6EA 3A5FA 3T2PA 4MY1A 1TV5A 2B4GA 3ZIZA 3EGJA 3PPCA 1Q66A 3PBUA 3WELA 5TBOA 3LS9A 1VBGA 1UWUA 1GJPA 3UG4A 4K3ZA 2PGEA 1FDZA 4M1BA 2EKGA 3L21A 2ZXBA 3LRMA 3GDMA 2P88A 3QQ1A 4MMWA 1VBJA 5A8MA 3R4IA 3AWOA 1P5BA 4Y96A 2A1YA 1JIBA 4MKSA 3EDKA 4TX9A 1FFQA 4EPDC 4P7QA 4A8IA 3LK6A 4GUIA 3VZXA 4GOAA 4FB7A 3PPHA 3HU7A 1DTNA 2YGYA 1EC8A 1US0A 3AQUA 3UPBA 6REQB 4Q7IA 3ZFHA 1JI2A 4UTWA 3ZJ8A 3LCWA 2YJQA 1WYIA 4P8VA 3MUIA 2VKZG 4DBWA 1V8EA 2EPNA 1U5HA 1NWUA 2VC9A 2CLPA 1NWSA 4RJEA 4B90A 5C2GA 1V79A 3ITCA 3CO8A 3IIPA 2YL6A 1SFLA 1UZDA 2GQAA 1G0CA 2PLJA 1B30A 2VT0A 3MSYA 2GGHA 2YL8A 4YYCA 3ABXA 2O9PA 3MCOA 3TQVA 4NI8A 1EA0A 3DI1A 3JUGA 1ECQA 4K37A 4H1ZA 3HG5A 3U3HA 1RVGA 4QS6A 2QCHA 2WNQA 3F2DA 1NM9A 4PCFA 3DFOA 1QO5A 3OQEA 3E2VA 2QUTA 3FJNA 2WQDA 2PF8A 2VR5A 3H7VA 4YXGA 5I3GA 1TV8A 4AYGA 4EXQA 1EYEA 3WBAA 1V0MA 2ZUSA 1MUMA 1F3XA 4ATWA 2DEPA 3AIRA 3PTKA 4A22A 5BZAA 1Q6CA 4H7VA 2FZNA 4XIAA 5KZEA 2NVDA 3OVGA 5JQ9A 2P53A 1OD8A 1OB0A 4C6IA 1FWEC 2DT2A 1ME8A 2J27A 2OEMA 3G1FA 1IE7C 1YADA 3JS3A 3G1VA 2RGMA 3FN9A 4OTKA 1XIEA 3IIXA 1TCMA 2PZ0A 2FJUB 5A94A 3QXBA 4RR4A 2J66A 4Z1AA 4CU7A 1PSCA 1UC5A 1C93A 3ID7A 2AQWA 3G1DA 3G3MA 2Z27A 3H2OA 3M9YA 5H2ZA 2PUZA 1BWLA 3R8RA 1TWDA 4RZ6A 1XRSA 2WC4A 4O1BA 4AZ6A 1RHCA 3CASA 4DJFD 3WQ6A 4UTTA 4GVFA 5AECA 1REQA 1XWYA 3VIIA 1A3XA 1TUFA 1UWSA 1H49A 1NAL1 4Q7NA 1JL8A 4JDBA 4I7WA 2CLEA 3E9AA 3GR8A 1F07A 1TELA 3N19B 4G5DA 5BROA 1KRAC 2GJRA 4R9OA 5A8PA 3I7QA 3P3BA 4LGXA 5I23A 2DT0A 2KZHA 3QZ6A 2F2KA 4M29A 4BI5A 3UPMA 1ZENA 5DBTA 3TFXA 3N4FA 2Q71A 4RDYA 4HT3A 1A50A 3GG8A 3VKAA 3AYTA 4XBSA 4QIUA 4HIBA 3UWWA 2O56A 2J7GA 1J12A 1O5RA 1JAEA 3IS4A 4NJHA 2YDSA 3ANVA 1G6CA 1LOLA 2YPIA 4JX5A 1RSCA 3Q37A 2DVUA 4GKTA 4GFIA 5IBXC 4M51A 2REQA 1YRRA 3CWHA 5BOFA 3G0SA 4HCDA 1MI3A 2Y61A 5BXTA 1B3OA 1Q5MA 2UZ9A 2R1NA 2VOMA 2VOTA 1H63A 3FHQA 4ILSA 4JY8A 1EWEA 5G2IA 4DNHA 1MW2A 1XL9A 1I60A 1PTDA 1D9EA 3FSUA 3CIWA 4NXKA 4WLCA 2PWVA 1HF6A 4G7EB 4HMDA 5D33A 3ARRA 2WVSA 3V0TA 1Y0EA 1XYBA 3WH9A 1XIFA 4Q8MA 5BMXA 4X3ZA 4IGNA 5BNKA 3BAIA 3MUAA 1YPIA 2FMOA 3NVTA 4WK9A 4CVWA 1JGIA 1EIXA 1XIHA 1FWRA 2PU1A 2J74A 3TTEA 4B4FA 1LL4A 3GH5A 2QZRA 1U30A 1KWGA 1Y5XA 4UTLA 3JVAA 4UQEA 1VD6A 1LG1A 3KBWA 3B8TA 3FYYA 4UMCA 2DW7A 4B5UA 3QF0A 3GAYA 4JCLA