1R3QA

Uroporphyrinogen decarboxylase in complex with coproporphyrinogen-i
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
357
structure length
357
Chain Sequence
GFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for tetrapyrrole coordination by uroporphyrinogen decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uroporphyrinogen Decarboxylase
total genus 126
structure length 357
sequence length 357
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1r3qA00
3RPDA 1R3WA 2Q6ZA 1T7LA 3GVVA 1R3VA 3BQ6A 1J93A 3GVWA 4ZR8A 4L6HA 4ZTYA 1U1JA 4AY8A 2EJAA 3PPCA 4L61A 1JPIA 1U1UA 1XR2A 3GW0A 3PPHA 2NQ5A 4AY7A 3T0CA 4EXQA 4ZTXA 1U1HA 1UROA 2Q71A 3L7RA 1R3SA 4QQUA 3PPGA 1YPXA 1R3YA 1JPKA 4WSHA 1U22A 1R3QA 1XPGA 1JPHA 3CYVA 4L6OA 1R3TA 3GVRA 3PPFA 3GVQA 4L65A 2INFA 4L5ZA 3BQ5A 1R3RA 4L64A 1XDJA 3GW3A
chains in the Genus database with same CATH superfamily
2EPOA 4DO5A 5D37A 4NAFB 1K7XA 1RPXA 5EA9A 2VVNA 4NZFA 3NR0A 2TRSA 4UFLA 5FESA 3CO4A 1KFLA 4NQ1A 1RA5A 2OCZA 4UTWA 2GJXB 2ZZ2A 4YWSA 1W1B1 1SFSA 1KTCA 2F6UA 3G1AA 4E8GA 3UR5A 4YVXA 1J2BA 3URQA 5JUVA 4W4QA 1CPUA 4FNPA 4KCTA 4GK8A 4WGHA 3WJXA 4B9YA 1UKTA 2QUMA 1LL6A 3W7QA 4JTLA 3NA8A 3WMBA 3RM8A 1E6QM 3KL5A 3E6EA 2QT3A 4PB3A 1JULA 3W7RA 2PFHA 3WX7A 1TTJA 1SFTA 1EUNA 4PRWA 4PUEA 5E09A 3GZAA 1B4KA 1E6RA 4X0NA 1FKXA 4PL1A 3SDOA 3NQGA 3SURA 4GKTA 2GSHA 2HISA 2HTMA 1F4AA 3B9EA 1MRQA 3EWWA 5FA5A 2PU0A 3FV9A 3KRZA 1HKMA 3L2LA 4PSRA 2YDAA 4GY1A 5C2CA 3N25A 1XP3A 1GOKA 2Y7DA 3B8UA 4UOZA 1UD5A 4FNTA 3W7EA 2PLJA 4UTFA 3IACA 1F05A 2YDRA 2I5IA 4ERIA 3AU2A 3LLXA 2PA6A 1I1WA 2FVMA 3KVLA 1NF0A 3HPXA 1UUQA 5E1QA 1JD7A 3T0CA 2I5GA 1E9IA 4YNGA 3EX3A 4GINA 1O95A 1CI1A 4C60A 1SZNA 1X1NA 1CBGA 7REQA 3OODA 3WQ6A 5I24A 2DIEA 3VDCA 1H41A 1R3WA 3W7HA 4ZQRA 2WVUA 5LXXA 3IS4A 1NWUA 4CD7A 6ENLA 4DB7A 3W1RA 1ITCA 4E4UA 3P5ZA 4O53A 2G3JA 1WV2A 2CXGA 1CXEA 4XISA 1M65A 2FPVA 4Z2HA 1H09A 1TR9A 4J3UA 3WMSA 2QUUA 3BG9A 1MNSA 4M19A 3APYA 4NG3A 4Y9AA 2H8ZA 1KGWA 3U6WA 4YCPA 1OFDA 4GZ7A 4O19A 4A4AA 1MMFA 5FSEC 4WDUA 5I3JA 3ZJ8A 3FLUA 4HPJA 3G1YA 4O11A 1ADSA 2GSEA 2YZ5A 1TREA 3VNMA 4AIEA 1MZHA 1W9VA 3RFAA 4DM2A 4BF7A 4QEHA 3E0FA 2HWGA 1KFCA 3E9AA 4H7CA 5D2TA 2Y88A 4DQWA 3AIEA 1GOMA 1B30A 3WDQA 1FCVA 4AY7A 3CQ0A 3SW6A 2WWCA 1YNQA 1DJZA 2WZTA 3U7VA 4Y96A 2X1UA 4K8HA 1UKQA 3TCEA 2A2IA 4AZ7A 5CJMA 5KINA 4FXSA 3QYSA 1Z9AA 5T9CE 4XK2A 2FHBA 4Q6XA 4CD4A 2PTYA 3LGEA 1CLKA 3NURA 1CGXA 2QCGA 1AMYA 2W91A 2DORA 4JL1A 4V15A 4XTDA 1PTAA 1LT7A 1MXSA 4F8XA 5DRIA 1MO0A 1UQYA 1RV8A 3GXTA 1OX5A 1FFRA 2NQ9A 5G1YA 1T8QA 3W1MA 2ZYFA 3B8VA 1G4SA 1Y5XA 2D24A 3R94A 1FFQA 1EZ2A 1JXKA 1ZENA 3SCQA 4GX9A 4DX3A 1EBGA 4BS0A 3AQUA 2PE4A 3RM4A 3AS2A 1OYCA 3WF1A 2QGHA 3AU6A 1N8FA 1KR0A 3AIQA 5ABEA 1KRBC 1QWKA 4UFHA 2FYMA 2CZFA 2D0FA 1R3SA 1NARA 3BZJA 1XG4A 3QR1A 3BAJA 1D3CA 1WZKA 4HSOA 1B3XA 4M24A 4C6QA 4HBKA 1XV8A 5A6TC 3MDWA 2VXNA 1KC7A 4JX4A 4C6KA 3ZZ1A 3BJFA 4AD2A 4RE3A 4F2UA 2TSYA 1P0EA 4IGSA 2F6KA 5B80A 2Z4GA 3ANYA 5FJOA 5D2YA 1Q3NA 2WOQA 1MUCA 3M6DA 4WF7A 4A3QA 4JKKA 5J5DA 4R88A 3IAQA 1Q8JA 1QAPA 3OLIA 1KM0A 3LHWA 4Y90A 3W70A 1IWBA 4W7VA 4XAZA 2Y85A 1M5WA 3P84A 3T42A 1FY6A 1VAHA 1AQ0A 7CGTA 2J24A 1GG0A 2WJZA 1KGUA 5C7VA 3R10A 3V5CA 4YL2A 3PF3A 2X40A 2GFTA 1EA0A 3H2OA 3GH5A 3KHDA 3VNYA 3ITOA 5AHMA 2NWRA 3F5JA 3GWQA 4MJ4A 3QOMA 1LORA 3MV01 2GWGA 3TU9A 1Q6GA 5FEZA 4TIMA 1DXFA 4ZSUA 3P2VA 4CNOA 4CN6A 2DW6A 2YOCA 3RHGA 4KEUA 5H2ZA 3SAZA 1Q13A 1QBBA 4Z0SA 4HNLA 4XKYA 5HNUA 1S2CA 4Z17A 5G2WA 5M17A 2PTXA 2G3MA 1YTKA 3LV5A 3GIYA 4QISA 1KWGA 4N42A 4F40A 3IVUA 4D6CA 1GQNA 2VUNA 3MKCA 4IJRA 5I3GA 3AHTA 4XAYA 4GZIA 3A13A 3H6OA 4D6JA 3U3HA 4DVOA 3CPGA 3VI2A 3OVRA 3C3UA 4JY9A 3MVTA 2CU0A 4PTVA 4D6IA 2VM8A 1FDZA 2VZTA 2XIMA 3FSUA 3TWAA 4B2DA 4LF1A 4M7TA 4C6NA 5G2HA 3IJIA 5D38A 3UJEA 1XLMA 2IMRA 3W76A 1G1YA 3GK0A 4IWWA 4P7LA 5LHFA 4NJJA 1WQ5A 4Z1AA 3UERA 4U5IA 4L65A 1R3RA 2WZHA 5LNUA 3IARA 3MCNA 4GY0A 2B7QA 3WK3A 4IL0A 6REQA 1R46A 2BTMA 3MT1A 2A4AA 1KO0A 1QWGA 1REQA 4MNLA 3EA2A 4QJ5B 1P0DA 3MTWA 1T0OA 4J1OA 2PLKA 3EYPA 1C8VA 4GGBA 4G5DA 3EB4A 1OCBA 4IIHA 4L5ZA 4AEOA 3VNKA 4AF0A 3V3WA 5E9XA 5GPRA 4DYKA 5HWMA 1HUVA 1GT8A 1EYWA 3W07A 4Q8PA 1XQLA 1LYXA 3UXKA 3UCCA 4XD6A 4LALA 1N8IA 4AEFA 4JIQA 4Q4KA 3WBYA 4UWMA 1CGWA 2YW4A 1XL9A 1OFAA 4OT7A 1J0YA 5DMNA 2I9UA 1IGSA 4I8YA 2ZZ7A 3E0IA 4Q8VA 5HJLA 3NQ7A 3IJLA 2ZUMA 3UXDA 2BV9A 4JIEA 3RMEA 2FB2A 1UQZA 2W27A 1ADDA 4ONVA 4AY1A 1CW2A 4O12A 3VDBA 1PDYA 4N4QA 3HN3A 1DYSA 3GHSA 3OVPA 3BCDA 4IICA 1J6OA 4L4LA 2GUUA 3R5EA 3NNTA 4BHYA 3H8AA 5I3KA 3YPIA 1Q6FA 4I3GA 3U4AA 3MJYA 4NIRA 3DN5A 3SGZA 5I06A 3ALFA 1OBAA 2OSWA 3KOYA 3DX5A 3H21A 1CB7B 4O1EA 3ZVHA 3WQGA 3BJTA 2VFEA 1XIDA 2E6AA 2O0TA 2Z1XA 2IQDA 5CLTA 4O4WA 2WJDA 2C18A 4K7VA 5HWJA 5K9XA 4F2TA 2QNEA 4A3HA 4DUXA 5TQLA 3MC5A 2PWUA 4EPDC 1TFVA 3QV8A 2BY3A 3B0PA 3F2CA 3S6DA 4GI8A 4ZOBA 5E9AA 5IM51 2QPXA 3EDFA 2E28A 1TVNA 5JBFA 5A6KA 1W6TA 2DEPA 1ZAJA 1EIXA 4CGTA 3SCRA 3STCA 1ZP4A 2E1DA 3EOLA 1MUWA 1UWQA 1IXNA 1A50A 3FJ6A 3PZQA 3KX6A 4DWSA 2W79A 1E1FA 1IT7A 4BI6A 1U1JA 4JHOA 4QS6A 3IUDA 4RCXA 1V0LA 1DQUA 2NUYA 2A7PA 2QZRA 1H3GA 3AMDA 3BQ5A 1Z8AA 4HPGA 4DXKA 1JIBA 3KS5A 3HJEA 3OHMB 2F84A 3REQA 1R47A 3LS9A 2OEKA 2DZVA 4MLJA 4Q7IA 3CWHA 1EO5A 1H7NA 1JPKA 1C8QA 4NZCA 1JR1A 2VQUA 1GPFA 1LOQA 3RLHA 1XRTA 3STPA 1XLDA 3KEHA 4DEFA 4MZ1A 2DZPA 2D3NA 4O10A 1BKSA 1D7KA 3ABZA 4LRTA 1UMYA 1E1CA 2NUWA 4C91A 3FY1A 5IRPA 4QE5A 3WMLA 3ARVA 1DPMA 1QW7A 3ZFHA 3NXLA 2WSPA 2YZRA 2J74A 1FXQA 4H2HA 3QPYA 3AUOA 1OFBA 1WXZA 3V0UA 3NXFA 4HD5A 3TYBA 1JZ7A 3WLKX 4BQ2A 4GIEA 3PZMA 4AU0A 4AZIA 1F3EA 4HHMA 3H4GA 3O6AA 3LM3A 3LA4A 3MYPA 1RXOB 3D3FA 2Q3RA 3VGDA 4B2DD 2VO5A 1GHSA 4P8UA 3WQCA 4PUDA 3D6NA 3CUZA 5AHEA 2AGTA 3AXXA 4OQVA 4TTGA 3BAYA 2YCJA 3G8RA 3UVIA 4WCJA 1RUSA 2J4GA 1EXBA 1E3XA 1FXPA 1A5KC 1O7AA 5KZEA 3PUDA 1QI5A 2DPEA 2H3BA 5A6SA 2YBTA 2PZNA 1KXQA 5ABTA 2JQXA 3CAKA 1UR3M 5DEZA 4F0RA 2ZCGA 1VFTA 5MF5A 4FLSA 2WKLA 3WZ0E 1EF3A 3FDGA 3AO0A 4BKNA 4ADUA 2VRQA 1J11A 3EDEA 3N3TA 5AHNA 1BEUA 3PZNA 1JFXA 4EVZA 1V3HA 3TZFA 3HQOA 2CLHA 1JPMA 3DG6A 5G2IA 1UPPA 4DZAA 2CNCA 5FI8A 4GVGA 4PRTA 2OG9A 2OZ8A 2O56A 4YIWA 1SMAA 2FMOA 3PUGA 5A2BA 1J01A 4NP7A 3QR3A 3T2OA 4AD3A 4IMDA 1VFLA 4LVBA 3P82A 2GUBA 1H60A 4PUUA 3UWVA 1Z48A 4H8NA 3FYPA 2PRMA 1OFOA 1PKLA 3QC3A 1PIIA 5KMYA 4YYCA 4D6FA 4NAEA 4Q4RA 4DJFA 2W66A 3ATZA 3EX6A 4O1DA 3S2JA 4S3BA 5HUPA 4IMCA 1SW7A 4E5TA 3EX1A 1EDGA 4A8IA 2EEXA 1JZ5A 1AW1A 4YTQA 1GPWA 4JYFA 1V3LA 3WK0A 4UUIA 1CX9A 3LX9A 4O1AA 2ICSA 4XSMA 1XLCA 3N9KA 2V2DA 4EIVA 4IIEA 3TJXA 2F8QA 1O12A 1W5OA 2QIIA 4RZBA 4ZQNA 1MQQA 3DFPA 5C54A 1Q85A 3F5LA 4MGGA 5I03A 3BL3A 4NHVA 1QNRA 2NV2A 2IPJA 3ABXA 3C2YA 2GVYA 1EF2A 1HL8A 2CXEA 3LHUA 1XH2A 1A3WA 4ATWA 3QLLA 3MUXA 1YNPA 2DZSA 1E6ZA 3N2BA 3WNNA 4BI5A 3RR1A 4O16A 2EJAA 1K03A 1V93A 2AL2B 3HFTA 4M6QA 4KESA 5I7GA 2PGFA 3SB0A 3SCPA 4R33A 2VYOA 1XCXA 4BF5A 4V27A 1K02A 4AUBA 3S2CA 2FPYA 3BTNA 1AQHA 1E70M 3PZUA 2CHRA 1JPIA 2YIHA 5JIWA 3SCVA 2VGIA 1H7PA 3ZWSA 1OF6A 3OG3A 1V08A 3N11A 2HS6A 2VOMA 2ISSA 4RDYA 4DELA 1XIMA 2BDQA 3W38A 1O5KA 5AYYA 1Y5VA 2E9LA 3L4TA 2BGQA 4QTGA 4GFSA 3CYJA 3WNLA 4JKMA 2VFIA 3JUGA 1JYNA 1X97A 1UHVA 2C6QA 4UBPC 4A35A 2WMIB 1XIEA 3ZO9A 3URBA 1XC6A 5CPLA 1Z44A 2QS8A 4JTRA 4RZ4A 3LEPA 4IPPA 3CB3A 2EQDA 4B90A 4WOQA 2W63A 1R9XA 5E70A 8CGTA 3ITLA 3M0LA 3CQIA 2P50A 4A2RA 2WHJA 4UCFA 4L6HA 1UP2A 3C3NA 4PBFA 3LTSA 4QDMA 1OX6A 8TIMA 3W01A 1QBAA 1XSKA 4HMDA 1E1EA 2GQ8A 3TTOA 1MI3A 4WHBA 3LRKA 4JFSA 4KRZA 3E12A 1SW0A 3WD2A 2GVLA 3KTSA 4LOCA 3IUIA 2WCAA 1YE4A 1QPOA 1X7FA 2PD5A 1QJWA 2WC7A 5AB3A 4ZCWA 4FP1A 3I4EA 3F1QA 2QJJA 5EMMA 1VENA 5M3WA 4XAFA 2SFPA 1C29A 3VIKA 3GVVA 3K4AA 5AHLA 1L6YA 2OGYA 3K13A 3UCQA 5GJPA 4DYEA 3EEGA 1TIWA 4E8CA 5LXEA 1VBGA 3NZGA 1ZBCA 4LBRA 4C65A 3GTHA 4WJ8A 1POJA 1R2TA 1TJRA 2A6LA 1YBQB 3RPDA 1KV5A 4KF1A 3UWEA 2WNQA 4Q8QA 2A1YA 2J9ZA 1VPXA 1GYMA 3S2NA 2P53A 3GG0A 7ENLA 1MSSA 1LJYA 3GG8A 1S2TA 2J27A 4N9CA 1EB3A 4JQ2A 1VHNA 2PC8A 3FAWA 1V02A 1C9WA 1TTIA 1TMHA 4LUSA 4LEFA 2ONEA 4MFDA 2WSRA 4Y9MA 1ALDA 5CZSA 2XN1A 6XIMA 1IZCA 4BI7A 3OHIA 4NT0A 3MVIA 4XZNX 3STFA 7PTDA 2ZXQA 4W8LA 1WAUA 4LBUA 4B5WA 3WDJA 1NP0A 1R2SA 3T0AA 1VP5A 1B4EA 5AOUA 1UMLA 2J7DA 2VFHA 4IX2A 3TEVA 4BQ5A 1A80A 2WHLA 4AQLA 4XBKA 1Q2RA 1FWCC 1OD0A 4OUIA 3CPRA 1QNPA 1AMKA 1TVLA 1AL7A 3F4VA 3Q45A 2EXOA 1X38A 3RR4A 3ARXA 4AWUA 2OEJA 3BJSA 5F4XA 5I3IA 3GM8A 1SR0A 2CBJA 3LQLA 6CGTA 3AZTA 1MQRA 1CCWB 2ZX9A 3PTKA 2GK1A 1FWBC 4UTTC 1O4UA 1XUUA 1JZ2A 4CEXC 5LGZA 4ROPA 2HQAA 1O5XA 1RK6A 1ZS2A 2JF6A 5TNVA 3KBMA 3BGGA 1SSGA 1PO9A 1AUSL 4XO7A 4NX0A 5BROA 1NFPA 4EK7A 1T99A 1UD6A 4CLMA 1P5BA 3GTFA 4L9XA 3VGFA 5CSUA 3W37A 1UJPA 4Q8UA 2O55A 1TUFA 4JICA 1Q6OA 1E9YB 2Z1SA 5LA1A 3RLGA 4OJYA 3UR2A 3NDZA 3SUWA 3UR7A 4H9UA 2PDUA 1DJHA 2XIQA 9CGTA 3W7NA 1EX5A 1QI4A 5FAGA 5AKQA 3GSMA 1TIMA 4KH2A 3W7DA 3ANUA 3C4UA 3LBOA 1FP8A 4J3ZA 5F2MA 3ZS4A 1VJZA 3SO7A 1ISZA 2FQIA 4XBSA 3CZGA 1GZ1A 3VIFA 4ZB2A 1MVYA 4LUIA 3B97A 5AECA 3SCSA 4B4HA 3A4WA 2D69A 4IQJA 4GNVA 3ID7A 4UQBA 3HB9A 3S46A 4HZMA 3B8DA 4FOJA 1RZMA 3LD5A 1DWAM 2W67A 2GVJA 5H8PA 3WFLA 3BG3A 3B9OA 3Q94A 1UH2A 3LMZA 2ZZ3A 5M5DA 1EH9A 3BMXA 3W22A 2ATSA 4GMEA 3KWXA 3W7GA 1XXXA 1FHVA 4NZJA 4QJ1A 2CKRA 2BX7A 4D6HA 4GISA 3AHYA 4O4VA 4RX0A 3C2RA 3UJSA 9XIAA 3TLQA 1RQHA 1W3TA 4RLIA 8RUCA 3WD3A 1HL2A 1R6WA 4AWEA 4L1WA 5CAHA 3TR9A 3IIPA 2AMXA 1NDZA 1KM2A 1OEPA 4MZ8A 1MW0A 4O0QA 1R87A 4D6DA 3G1VA 5BXSA 1I4NA 2FZBA 4J40A 4Q8OA 4G7EA 2DUXA 3O0FA 5BRPA 1RSCA 4IG2A 2PB1A 4ADTA 1GW9A 4L4MA 5IFTA 1US0A 4IPLA 2Y8UA 3WEMA 3IVTA 1JCMP 3SY5A 3RJYA 3LBMA 3RUBL 2DZBA 3JU2A 1Q6CA 2GQ3A 2G50A 5DCBA 3MS8A 3NCOA 4LV4A 5D05A 3ABOA 1QNSA 4R7OA 4PA8A 4TTUA 1OF8A 3QXBA 4AD0A 1S5MA 2JKPA 1EQPA 4AYSA 4C6OA 3SADA 3P0WA 3BVJA 2ZRZA 1OM0A 1AD1A 4UXDA 4OZOA 3THCA 1VRDA 1ITXA 4GYKA 4MAZA 3SZ8A 1K8XA 1TWIA 1KCXA 3W3OA 5AFDA 1OABA 3W00A 3NSNA 3VOHA 2ZXDA 3GE7A 4JTKA 4TX8A 3TFXA 5FF4A 4EF9A 3OYZA 5I3HA 1W1YA 2RHGA 5PTDA 3G6LA 3KL3A 2PRLA 4HN4A 1EJWC 2Z1VA 1XLGA 2YXXA 4H01A 5CPTA 2NQHA 1B3YA 3COTA 1VBUA 2DSZA 3QY8A 2XYLA 3KM8A 3PFMA 2BXZA 3ABRA 3K4DA 3FXGA 1UH4A 3USZA 3H26A 1G0CA 4AVOA 5DCDA 3KCLA 2CKSA 3UU0A 1H49A 1XYBA 3N6HA 3MCMA 5FIPA 4AXNA 4H6EA 4QITA 1ONXA 2XIBA 4PUJA 4Y9NA 1E4NA 4MWAA 2YCIX 1R0MA 1JQVA 3IJQA 3MSDA 2ZDRA 3KLLA 2NQLA 3DYMA 4ATLA 3HM7A 3CQJA 3V0TA 2YW3A 4NYUA 2DIKA 3TTSA 2Q09A 1DQXA 1UOZA 4GA8A 2JEPA 1EXPA 1C92A 3AICA 4V28A 2PWGA 3UCDA 1XBXA 2YPIA 3PZTA 1B3ZA 4ES4A 3PC0A 3TFCA 1KM3A 1ZJHA 4JQ1A 1GQKA 4G7EB 1XGDA 2R1KA 4YHGA 2WNZA 1WA3A 1S2AA 2ZXAA 5JQ9A 2ACUA 4Y7EA 3GHTA 4OBRA 2NX9A 4UR9A 3WUEA 4J3XA 3WLMA 5ABHA 4ZVJA 1S5NA 2Z6JA 1JQXA 1NQKA 1I0BA 2GK1B 3FVMA 1KM5A 1UPMB 5AC4A 1FWIC 2YLAA 3W2MA 4DF1A 2BVYA 1HZYA 2DVTA 2G5WA 1JRBA 4AYGA 2J7GA 4DXXA 3VIPA 3TUUA 2BFGA 1ESWA 1PZ3A 5JVLA 4S2BA 1QOQA 3UY7A 3FJLA 3SFWA 2AKMA 2C1IA 4BK9A 3M0YA 4ZBCA 3RX2A 2Z1BA 1C7SA 4K39A 3VOIA 3WQFA 2QAPA 3LPPA 1Q6DA 2OX4A 3AXKA 1IT0A 1UZHA 3D5HA 3VTRA 4WKFA 4JBRA 4KW2A 3UNDA 4ZE5A 2WSQA 3KBJA 4K6AA 3FYYA 2F2KA 5E6YA 5C55A 3VNDA 1EL3A 3BXWA 4LAZA 5HULA 3MW7A 3VFCA 2GDUA 3QM3A 4YU1A 3WJZA 1U83A 1LDCA 3VUSA 1V77A 1W1A1 1FBAA 4PTWA 3NQVA 1A47A 4ZQCA 2DV0A 2IXVA 4HZ6A 1R30A 1QASA 4Q8NA 3M7WA 2D23A 2WC3A 3RXZA 3NJ3A 1DJIA 3AXIA 3W1QA 5CCZA 1K8YA 3CQKA 4O1FA 3UJRA 3DU0A 1UKOA 4HCHA 3V5OA 3W25A 3N6QA 3W6YA 4L1XA 1EJ7L 3C2VA 4J28A 4N9BA 4WR3A 1QTWA 5B7ZA 1A5MC 3M4HA 4GVFA 1VIZA 2P1FA 3IIXA 3C2OA 2VFFA 1TPVA 3LSBA 1VH7A 2FDSA 5DY2A 3S1VA 5CQ1A 4BF9A 1J79A 3Q4DA 4FMVA 2J8TA 1QHZA 3ARQA 3BOXA 5D4YA 3NPUA 1G67A 1WOAA 1RPKA 3K8LA 1KCKA 4ZFMA 2Z2AA 4PODA 1JRCA 3OP2A 1OINA 5CZ0A 2OEMA 4WY0F 3MBDA 2BXVA 4XX6A 5FEWA 3QYQA 2FHFA 3TCSA 1VPYA 1ZSXA 2YYUA 2YL6A 3P60A 4D1IA 2FZMA 4E0CA 3VXGA 5LA2A 3WDHA 3K8KA 2PC4A 1JNDA 3CUIA 2E9MA 2J6XA 3WNOA 2VEMA 4K8EA 4DO6A 1DXEA 3HV8A 4XVEA 3TIMA 5CKSA 3WD0A 3RLVA 1XQKA 4LNYA 4I9AA 2FZ9A 4B3ZA 2WM0A 1DL3A 1JUBA 1EZWA 2C0HA 1GZJA 4C6EA 3M0XA 4HSHA 4X3ZA 4I9JA 1VR6A 2F38A 3R25A 4E3VA 4BY3A 3SCNA 5KITA 1UC4A 4M3PA 2VVSA 2C1GA 2RJHA 2RDTA 4FOUA 1H7OA 4A6GA 4FXJA 1RQBA 3FSTA 1JYXA 5XIAA 1EO7A 4UFIA 2IUZA 4C5ZA 1TE1A 4U3AA 3CHVA 2DT2A 3GDLA 1XDJA 3QSTA 2G37A 1TPWA 1CENA 3WDRA 2E5CA 2CYGA 1FVPA 2QW5A 3E49A 1GCYA 3LBCA 1XH1A 3VC5A 1KTNA 2YXOA 2HBVA 3GU9A 1A5UA 1Q7QA 4PTNA 4AWSA 3BLDA 1HL9A 2EGZA 1VIWA 1V6YA 1KXHA 1JCLA 1CWYA 4S3GA 1ZHAA 1XD1A 3GG1A 1YW1A 2XWEA 1BG9A 4HCLA 1OC6A 3CWNA 1WBHA 1CTNA 3M0KA 1IEQA 3AHXA 3P7YA 1V02E 1U1UA 4PN2A 3PBMA 1B1YA 2PMQA 3T9PA 1PDZA 3U2OA 3SRFA 4PMJA 2QKFA 2HK0A 1DTUA 1K8ZA 2EG7A 4GUJA 3S0CA 3Q2DA 2VEKA 2EG6A 5LGXA 2YSWA 2G0WA 4WD0A 4AG0A 3ONCA 2NVAA 4ACZB 3STEA 1MUMA 3NPWA 5HQMA 1UROA 1A3HA 2YA2A 2VUYA 4OBTA 5BRBA 5CC3A 1MWOA 3G1FA 4E38A 4E2BA 4IISA 4KERA 2HBXA 1NAL1 1B3OA 3ZVIA 3PZVA 1ADOA 2V3DA 4JQ3A 4GYJA 4YLWA 3NZPA 2DJXA 4O0ZA 3PZ9A 3PS7A 2VC7A 4H6RA 3RAOA 2JGYA 4CNPA 4WLCA 2TAAA 4N2YA 2G3FA 1C93A 4DXVA 1HKWA 4S3JA 4DLFA 5FF3A 3BLLA 2I5QA 2IS7A 3N2CA 3VIHA 1R3VA 1E6PA 4GKLA 1JFHA 3CH0A 4W7WA 1HKIA 3MMUA 3CAQA 1HJQA 2HJPA 3R58A 3OPSA 4I9TA 5K4ZA 3APGA 3GIPA 1RLDA 4JTUA 3CZLA 3W88A 2XDFA 1W2VA 4ZGYA 2LLEA 3C0LA 1JUKA 4GLEA 2RAGA 3OYXA 1FCUA 1PWLA 5C71A 1VFOA 3T8QA 1UA3A 2Y2WA 2B0MA 1QPKA 3F7JA 5G4HC 4HCDA 3H12A 3NGJA 2FJKA 5EMJA 1OX4B 5F1UA 1FWFC 3R12A 2NUXA 3IGSA 4S3EA 3DFYA 1I75A 2VWSA 1W9UA 1NM9A 1JCJA 1QI2A 3CZJA 4RKAA 3OEXA 1EC8A 4WRHA 5CH9A 2XFWA 4O28A 1XYFA 4L9ZA 1QI0A 1W56A 2OFJA 4NNBA 4ZB0A 3NQMA 5C9XA 4YMZA 2I56A 2X7VA 4PCFA 1PBGA 3OVGA 2KZHA 4L6OA 2VFDA 3DG3A 2FGLA 1B54A 3LUTA 2EG8A 4YVPA 4IMEA 4J3TA 4PMXA 1BVNP 4CEUC 2HNHA 1XLEA 1QO2A 3II1A 1E1CB 2C19A 4OKDA 4FSAA 2YXGA 4EACA 3BCFA 4PMDA 1XC4A 1ISXA 1AG1O 4O13A 1JNEA 1L2QA 4YS1A 3T05A 3JRKA 1HJUA 3SY1A 4ERGA 4US5D 2G41A 1Z6KA 4A3RA 2JFEX 3EPOA 4REQB 1JCNA 1X1OA 3N04A 3S42A 5XIMA 3UZWA 4IFRA 1V6VA 2RDXA 2XPKA 1WX0A 1Q4WA 2VEPA 1KTBA 4S23A 2H9AA 2DZXA 2FB3A 1Z7AA 4MIMA 4CQ9A 3GAKA 4UQAA 3QGAC 2VD8A 1TV8A 2FLIA 5CG0A 1OSEA 5A2AA 5D04C 4UFMA 1VKFA 5I78A 4CCDA 3O63A 2PDHA 3QOKA 3VA8A 1QDSA 3GKAA 3ONBA 2PGEA 1DHPA 4N6FA 5I23A 2HSAA 1VLWA 1ICQA 4IMFA 4A3YA 4Z1DA 1ECQA 3PZOA 4C1LA 4UTUA 3N73A 1PKYA 4GIAA 3T8LA 2UY5A 1Y7VA 4GQ0A 4GYPC 3MY9A 3L21A 4LFYA 5HNTA 1QMLA 2YDQA 3HURA 3TLLA 3G1HA 5KTLA 4I5RA 3RO8A 2BNJA 3TAKA 2O9OA 4S3CA 3S4TA 3VKAA 2ODOA 4LYQA 4WDWA 2OPJA 4NSBA 4PEEA 1JZ8A 1XIHA 1UWUA 1PTDA 2Y7FA 4U31A 4DJDC 4MHBA 5F2LA 3G5EA 4AZGA 4EXAA 1JPHA 1JD9A 3LRMA 3N2TA 3O2LA 4UB9A 1LWIA 4O1CA 3PTDA 5D03A 3L5AA 2CC0A 2D3LA 3DC0A 3A47A 3TJIA 4YHEA 5HUOA 1A5LC 4MYAA 3G1SA 1Q5MA 4FLRA 3B8SA 1GOIA 2J79A 3R2GA 5IBXA 3PG8A 4S39A 3ARRA 3PG9A 1MXGA 1N8WA 1SO5A 1TWDA 4W87A 2JE8A 1V6XA 2VNCA 3PJTA 3B9AA 4W84A 3C0SA 5F4WA 3W7JA 3FW6A 3P61A 3WNKA 2A3LA 3QW4B 4PMOA 4P7OA 1VRXA 3ZJKA 3KVKA 4FZIA 3VNLA 1P4CA 1DP0A 3SUSA 2YFOA 1KM6A 2AAAA 2VGGA 1E4MM 3OZOA 4QRNA 3QR0A 1K9FA 4JY8A 3G77A 3E0VA 2TPSA 3DHUA 1XR2A 3WD4A 2YBUA 3DOPA 1XLBA 2ISVA 3NPVA 3VCRA 3SQLA 3UEQA 5H91A 3UZYA 2TODA 1EWEA 2OLHA 2Z7GA 4X61A 2C16A 1DBTA 2WMFA 4GG9A 3N1AA 3TSBA 1GEQA 1E43A 4QSHA 1J10A 1T7LA 3MBFA 1TPDA 2FVLA 3AXHA 2PDGA 1P1XA 4GPNA 1L6SA 2DZTA 2WQDA 1UUOA 3WCZA 1LZOA 1DJWA 4C90A 4HYWA 4JIPA 2OYLA 4P61A 2JKEA 1YDOA 5D9OA 1KA9F 2AMGA 3A4JA 4LY4A 4OU1A 4X2PA 1HGYA 2KX9A 4D8LA 1E9LA 3IJ9A 3IK2A 3NQ6A 5BXTA 1K6AA 3SQMA 3CHCA 3QJAA 2OSXA 1L8NA 4RJEA 3DAQA 1CGVA 3OU8A 1FWDC 1EC7A 1RP9A 4CCEA 1DJXA 2PDWA 3VO0A 1H1NA 2GVGA 5I0DA 1JGIA 3D0CA 2GQAA 2W9MA 5EBAA 5BXRA 2C13A 2CZVA 3VZYA 2XH7A 1UZDA 2BGNE 3CUHA 4IP5A 1S1PA 4EKJA 4HK6A 3VC6A 1W37A 3C2EA 4OTKA 3LNPA 1GZGA 3TYZA 4US5A 3U0HA 1XRVA 3ENLA 3CV6A 2AKZA 3QHMA 2V6AA 1XGZA 2XJ7A 3N18A 1C90A 3U9IA 1G9HA 4JFUA 4D2JA 2UY2A 1C91A 4CNSA 1V4YA 4GRSA 5A95A 1TCDA 3F2DA 4XIMA 5CAKA 1U2YA 4MWAD 5CPOA 2Y8VA 1JDCA 5CPSA 3KE0A 1ZY9A 3DERA 4UC5A 3SRHA 3HG2A 2WM1A 1J5SA 2Z7KA 3VKKA 4WXYA 4D8ZA 3N2OA 2YCLA 3RX4A 1NY1A 4IPNB 4TXEA 4WIWA 3RITA 3VGBA 2OSYA 2XFRA 4KFPA 2QCEA 3OTRA 1NP2A 5LIKX 1ENUA 4O52A 4JIIX 2WKGA 5J04A 2I14A 3NDOA 7TAAA 2WXDM 3BMWA 1F74A 4GH3A 1JDFA 4UOJA 3VYLA 4XZMX 2WPGA 5FL1A 2XGIA 3PWGA 4PUMA 4E4PA 1OJXA 1VS1A 1E5JA 3EXSA 5A2CA 1DWHM 1OIFA 3AWOA 4OVXA 4BWLC 1EHAA 2AQOA 2WVVA 2BVTA 2PP1A 3C6CA 1E55A 4MY9A 1BD0A 2HXTA 1B90A 3KL0A 2CLLA 2PPGA 4TMBA 4IHCA 2HNEA 3GDBA 1MZRA 4FLQA 2ABBA 2QJMA 3WL0A 3HOJA 3KHJA 5A69A 1WKEA 2JGQA 1TZ7A 3R8GA 3HQNA 3MZ2A 2X1IA 3W7CA 1LTDA 1TV4A 1NVMA 4KIRA 3PPGA 3NQCA 4HOWA 4RE4A 1Q63A 1RR2A 3LHYA 5DN1A 3KBVA 6TIMA 4JTQA 1E15A 2IKGA 2Q8ZA 2XN0A 5FEXA 3V75A 2VDHA 3AALA 4GJIA 4Y6GA 1ZNNA 4RDZA 3L7RA 1TMQA 1GW1A 5F2GA 1OC7A 3EEZA 1KV8A 1V51A 1VLIA 2FMNA 2QMJA 1YRRA 1XIGA 5JIPA 4AX6A 3I10A 2QDGA 4QROA 2GWNA 1GQIA 3KBNA 3NSMA 3GLCA 2ZADA 4J5NA 2WHMA 2ZC8A 5H8MA 1HG3A 5TAOA 3E0WA 5U7SA 4URIA 4U4MA 3LQGA 1WXJA 4Z2LA 2VKZG 2NLIA 3VFLA 4HA4A 4GO8A 4HJFA 4QP0A 3IIZA 1O5RA 3EB2A 1LOLA 3W85A 2CERA 3RJXA 2Q01A 2YCKX 3MP4A 3EXRA 1CXKA 3ABSA 3DYOA 1E6NA 2J47A 5I07A 2CEQA 4B5UA 2ZOXA 1EP1A 2DSVA 1IXPA 5LIWX 4W5ZA 5BOOA 4NZ5A 4JTFA 4W9TA 3EA1A 4J3VA 2QDHA 3H22A 1DIDA 4GVIA 2QPUA 2OT0A 4LBSA 5CPNA 3U5UA 3GXMA 4C6BA 4B5VA 1D3HA 3GTNA 2OMAA 2VR2A 1P6WA 1H4PA 3EWBX 2WBGA 4OGZA 4PTMA 3VCNA 3OGVA 4P8WA 5K9CA 2OLSA 1AZ2A 4DZHA 3FKKA 1UIOA 4H00A 3QZ6A 4OWGA 3I7QA 1UD4A 2DSWA 3GIQA 2RUSA 1TX0A 1S46A 5EGRA 4P8VA 3WJSA 2X09A 3WL1A 1GWJA 4ZTYA 3DBNA 2GUYA 3HBLA 4AZHA 4CQ8A 1A0EA 4JCLA 1OT2A 2DVUA 1I6NA 4Z0JA 3PBWA 5A6BA 5E5CA 1NTHA 1RCOB 2XISA 3KZPA 4GQBA 4AW7A 1ZJIA 1ME9A 3WDIA 2A5HA 5HBFA 4N0RA 3NL3A 3EWUA 2ESCA 4GABA 2PF8A 4HHPA 1VBHA 3T2PA 4F0HA 1R3TA 1HQTA 2WLYA 3ITYA 3V7PA 3DESA 2W6RA 2V68A 1JVNA 1J96A 4E8DA 4ICNA 5CBBA 2VDGA 3LTYA 1UW9A 3H24A 3OLDA 3UWUA 5EU9A 2BY1A 3VD3A 5HK4A 1Q6EA 5C9UA 4DYJA 5HJYA 3QBUA 5J8LA 1K9DA 3CUFA 5DXXA 2B7NA 2Z0IA 3SGGA 1UJQA 3IRDA 5B7YA 3TW6A 2E77A 1NFGA 1ZJBA 3W4RA 1IE7C 4AHOA 5FCZA 2BSLA 4ZEPA 1Q66A 5C9ZA 3ZJ6A 1BWVA 3T4CA 4DO4A 3ZR5A 4HA1A 2DT0A 3NWRA 2R94A 3UG4A 4E2VA 3TXVA 1A5BA 3L4WA 5ECUA 3POHA 4YVVA 3H54A 1R7AA 1E3ZA 2CESA 2IXUA 3RU8X 3QGVA 1CXIA 3N29A 2BVWA 4IQDA 2EPLX 4BZYA 1HJSA 2NT0A 1J0ZA 1CXLA 1NWSA 5ABGA 2W92A 5MKGB 4FA3A 3NZQA 3P6LA 3S5ZA 3AJXA 2ZDSA 4HOZA 3W84A 4XZHA 2IKIA 4FXFA 3INPA 1RJQA 4I7UA 3T09A 4KRUA 4KS0A 4C6PA 4U3CA 3ZJ7A 1EUAA 2XIOA 3AOFA 1IXOA 2ZKMX 2PDIA 3PPHA 4GBUA 2WMKA 1X98A 4KFNA 1JAEA 2VZUA 3JR2A 1LQAA 3VPLA 2BLEA 2PDLA 2Z26A 4YPJA 1HGWA 2DUZA 5GJMA 1FWNA 5M1TA 3BH4A 1XUZA 1Q4NX 5HNNA 2OU4A 3VD5A 3L67A 2BZNA 3MUIA 4JN6A 4MNMA 5G1MA 2W61A 1YKWA 3DKLA 3BW4A 2ZUNA 2WANA 3W1NA 5E0KA 3SRKA 4O57A 3S9YA 1KCLA 2CLIA 4MKVA 3PK7A 4LV9A 2A3HA 5F2IA 3JS3A 3L12A 4XTIA 3FYOA 4KEVA 1Z32X 3IRSA 2VTFA 3AIBA 3GNRA 5JBEA 1MFVA 2BASA 4HK5A 1LLOA 4JEJA 1GONA 3N14A 2V8ZA 5HXMA 2C91A 1WZMA 4XIAA 2IKJA 2W0UA 3ZLGA 4IIFA 3SSJA 1DE6A 2QLYA 1L6FA 3V1PA 3GW3A 5DRCA 4MPKA 1EFZA 1UWRA 4MJZA 2AL1A 4IP7A 4S3FA 3GNPA 1BGAA 3RCYA 1TV5A 3G0UA 1K4HA 2ISWA 3W1PA 1W31A 1K3UA 3B4YA 2UY4A 3ELFA 3R1ZA 3AIVA 5HA7A 1ZRQA 4AC7C 3PR2A 3W27A 2NV1A 1J9YA 4GGHA 3UG8A 4JTTA 4XSLA 5BWAA 4JYEA 2FH8A 5AN7A 1TG7A 4JX5A 1Q45A 3TV8A 3SGUA 3WIJA 1XYLA 3GYEA 1GVSA 2E9BA 5LIYX 1IEWA 3QTGA 7ODCA 3ERPA 5EFFA 3AMCA 3A23A 4JTDA 4ROQA 2ZRYA 3BAKA 1F4HA 1YDYA 4ZOCA 1NOUA 1JF6A 1CLVA 4LCQA 5F4SA 3IGXA 4L1GA 3DGBA 3RM9A 1DJNA 3W02A 3WQ4A 2ZC1A 3GVQA 3CMFA 5D8ZA 4F66A 1A5AA 4IMGA 3QW3A 1RJRA 3PUEA 1KGXA 2WKJA 2D0GA 3W75A 3B03A 3TONA 4CCZA 2P3EA 1RH9A 3HF3A 3RG6A 1BYAA 1M41A 4H6QA 2GDQA 2ZA3A 4N9DA 4POCA 2NSXA 4R9XA 3E3HA 1XLAA 3FHQA 4LJ3A 3BLOA 3ARSA 3ZIZA 3MO4A 2QDEA 1WOBA 1UR1A 3O6DA 3VNIA 1M3UA 3FDKA 1NIUA 3VE9A 3G2GA 3LYEA 1EWDA 2C15A 3WF4A 5T8GA 3IPWA 1QUMA 3CBWA 4AIBA 1C9DA 1S38A 1KXTA 1OCNA 2WSYA 2VC5A 2A3CA 3ARYA 3HMJG 4HP5A 1X6UA 3ITGA 4YXGA 3AJ7A 3LN3A 3OIHA 4LVFA 2ZVIA 5BU6A 3ZR4A 4AD4A 1NSJA 4HPHA 2I17A 3BG5A 2ZRUA 2V63A 1TPH1 2CHNA 1BFNA 2CLPA 2XG9A 2FH6A 3W2JA 4AISA 3M44A 4PUWA 3WLLA 4GQGA 2OXNA 2WHKA 1G94A 3OBEA 3B8IA 3P74A 3MI3A 2QF8A 4E4FA 4RW5A 2O9TA 1SFJA 4N4PA 1TV2A 1ME7A 1FWGC 3EB3A 4XD3A 4C1KA 1VJSA 1V0MA 2PODA 1RD6A 3GDRA 4I5UA 3VZXA 1WDSA 3QMSA 4O15A 2OGJA 2XSBA 3LHTA 4CKQA 1PTGA 3QSRA 1Q2SA 5CZJA 4D6EA 1W54A 2INFA 2BODX 2WNWA 4GFIA 1EJSC 3ATYA 3ARWA 3AZSA 1TTPA 3UETA 4X60A 3RCNA 3PBYA 2YB4A 2Q8LA 1B5TA 3M5XA 2TMDA 3NEHA 3BV7A 1JDAA 4TOQA 2BOFX 4IT1A 1X6NA 2PBOA 3ZWTA 1CECA 1ZQ5A 3SN0A 3F4NA 4MF4A 1W1ZA 2R1LA 4S38A 4JFWA 3UGRA 3L0KA 4M82A 3ZT5A 1JGMA 3VK5A 1TTQA 4FXRA 5JH1A 3A21A 4Q6JA 3KXQA 2VR4A 1KBKA 3G3DA 3BSGA 5IXEA 2V9DA 5REQA 1UA7A 2E68A 1V5XA 1TCMA 4WXZA 2QR6A 3DFNA 3QH2A 1OD8A 3G1XA 4GQQA 1GOQA 3HGJA 4C7FA 5AHFA 3MWCA 3QMTA 2AQVA 1PHQA 3QPZA 3GC2A 1W3KA 3S6TA 1E73M 4H9TA 1FWHC 2G95A 1EJXC 5JH2A 3ICJA 3PFRA 3CMJA 5HATA 3G8EA 1M53A 5FSDC 3HFYA 2J9YA 4LX4A 5HDRA 2E0PA 1HVQA 5FJRA 4NXSA 1KKOA 4M80A 5TIMA 3LCFA 1F8IA 4ADSA 2HVOA 3RPMA 5D9NA 3MWAA 3T08A 2V69A 2O9RA 1CEOA 1FKWA 1UR0A 2E8YA 2HROA 2Y5JA 3H23A 4NJGA 3UZZA 1QCWA 1X6LA 1LLZA 4IIDA 3MHFA 3CB8A 4MB3A 3QV7A 1GG1A 2QQ6A 2PDFA 4HGXA 4CD6A 3MI2A 3L0NA 4AZCB 3CH9A 1RCXB 3LCIA 5GVJA 2J78A 3DFHA 3U2CA 1YPXA 5DFAA 1XW8A 3SEPA 3WDPP 3VDHA 3WLSA 2CLEA 5EFDA 2OZTA 2R24A 4AC1X 2ZZ4A 1WXYA 2C7FA 4JOMA 3WBAA 1UBPC 4IJCA 3I3BA 3QQ0A 4GE8A 2CZDA 4XAGA 5A1AA 1MEHA 2BWGA 3T07A 4ALDA 3TN5A 2CZEA 4WDTA 2IQTA 3EZ4A 4IXXA 4U2ZA 3SI9A 4M6VA 3GR8A 1B3VA 2X2GA 1PHWA 4U33A 2R14A 1OG6A 4W89A 4DBUA 4QG6A 5HPCA 2EBNA 1TV7A 1DORA 3LERA 1XX1A 1I0DA 3SM0A 5LNRA 2JALA 2GPTA 2J77A 2WMHA 2ZX5A 2PCQA 2G3IA 3KS6A 2CLOA 5EPDA 3W53A 2BP1A 1M03A 4PCNA 1OWQA 3NOYA 3NQEA 4ASTA 1ZJAA 3S1GA 3XISA 4QNWA 1PX3A 1A0CA 4IL2A 2FVKA 3LI0A 4R34A 3ARZA 5FOOA 2GDVA 2V0TA 1O1ZA 2VI0A 1O66A 3N19B 2JIEA 3DI1A 3UYIA 3WF0A 2VCCA 4QE4A 1MQPA 2QDDA 3MUZ1 3WQVA 2DDXA 4W8BA 2V81A 2D73A 5AYXA 1MXDA 1AL8A 3EOSA 1NWTA 1F3TA 3SIZA 1ONWA 4GUIA 4WY0B 3VD9A 2ZE3A 3PJWA 1JCTA 3BICA 1EOMA 2PDPA 3T2QA 2P5NA 2YCLB 3EKLA 4O50A 3UW6A 1EJRC 4JIRA 1I2OA 4JNYA 3ISIX 3NAVA 3CMGA 3GXNA 1TWZA 3C0QA 3SUUA 5ENLA 4PBEA 1WE5A 4A22A 3KOXA 1ML1A 5BRQA 3T55A 4KWOA 2G4JA 3GX9A 5DBUA 3O16A 4ZR8A 4M1BA 2PUZA 4UTTA 1OHLA 3IGHX 1AJ0A 2BY2A 3L2IA 3O8AA 1TA3A 5FL0A 5CGQA 3VOJA 2OTDA 3A4AA 1GKRA 3EXTA 2JKAA 1A4MA 4OBSA 5RUBA 2J75A 4DLMA 4MUPA 3SUTA 2DY3A 1GOXA 4K68A 4K37A 1MDLA 2Y61A 2OKOA 5HQEA 5FEPA 2H3DA 4DO7A 3VM7A 1XDLA 4RK8A 5BNKA 3LPOA 3PM6A 4YYFA 4RUBA 5I5RA 2NXGA 1XLKA 1LROA 1C7TA 4BFAA 1PKMA 3ECQA 1E5NA 3PZGA 3CGTA 1P48A 1F3WA 3A9IA 2NT1A 4J3SA 1B9ZA 5BWFA 3AS3A 4LH8A 1H5VA 5BYWA 3EX4A 4QG9A 3M0JA 3PSWA 4JXCA 1SO4A 3LY0A 5E6ZA 3NQ8A 3BW2A 3WBXA 2ZICA 2HPMA 1XCFA 1WUFA 3FNDA 4C1NA 3N17A 4XVDA 1UC5A 1PKNA 2FZDA 3NQBA 3L9CA 4HNUA 3F4CA 1HP5A 1QPRA 4S3DA 1XYAA 1OADA 7A3HA 1H7WA 3A5FA 4UFJA 1LCOA 4H1ZA 2CLKA 3TTEA 1YXYA 4PEKA 3SUVA 2DU2A 4EE9A 3HU7A 2CIPA 4EWJA 4AFYA 3I3DA 1R38A 4I5XA 4RDWA 4OECA 3ZM8A 2GGHA 4DPPA 4DZIA 1XBZA 2PCEA 3ZMRA 3FJNA 3O06A 2R1NA 1XKYA 3QKEA 1HKVA 1YTDA 4DHGA 3AIRA 4FAMA 2QCHA 3BSMA 4C6IA 3EOEA 3UP8A 5DCEA 4QXIA 2Q6ZA 3UD6A 4LCRA 2QMKA 4RE2A 4Z08A 1V3MA 3CV7A 4J4KA 2GLKA 3IANA 2OZ3A 4MYXA 3SCWA 2J7EA 3AUJA 3BSHA 2EJ1A 2ZQ0A 4CN4A 1G4PA 3IJDA 4Z2GA 4LVDA 5CPMA 2ACQA 3PWAA 2GJNA 1XGEA 2REQA 2OQHA 2Y62A 1M01A 3A12A 4MUZA 4IH3A 2YB1A 3VIJA 4G6CA 4J35A 3GRIA 2OLAA 4MJ2A 3T0BA 4AB4A 1DTNA 3CZKA 2GYIA 4TV6A 2RGMA 5A8PA 2QPSA 3EOUA 3BDKA 4HN8A 3DC8A 3L5MA 1FQ0A 4TX6A 3W24A 4QSFA 1NQ6A 3G1DA 4PFHA 4NF7A 5IDZA 1PUDA 4IOTA 3PSVA 1KNWA 4H3DA 4I6KA 1W9XA 2YBVA 1L8PA 1R9ZA 1Q6QA 3VE7A 3RMJA 1LWJA 1G01A 1EDQA 1IEXA 4JTEA 4A8NA 4ZL1A 1DWIM 4LSBA 3TK7A 1K9TA 2YL8A 3KTXA 4CNTA 3E2VA 1IIGA 5TD4A 4TVCA 1BF2A 4CU6A 1X8CA 1YNYA 4XUYA 1GKPA 3WEZA 4LEQA 3FJ4A 4AZ5A 4GZJA 4INFA 2DH2A 2V5CA 4OE7A 3M46A 5A8OA 4DY1A 4YTTA 2OOGA 2XH2A 1FWWA 1UP0A 4WDXA 1E71M 3KOZA 1R85A 1WBJA 2HEJA 3MKKA 1PX4A 4HNNA 3GTIA 4GXWA 1M7XA 1YXCA 2QVNA 4ML9A 5HMEA 3AFBA 4WQ6A 3C0JA 3V5FA 1VCFA 1J6PA 3WQOA 3WO8A 4NRSA 1S3HA 1JG9A 5ABFB 4B9ZA 2ZRXA 1F61A 2J8GA 3KBWA 3W81A 2JK2A 2G8ZA 2BXYA 1J0IA 3QVQA 2PGRA 1E72M 3KOFA 4AY8A 1P1MA 2FPTA 2I9EA 4IJBA 2ZRVA 3KW3A 3L4ZA 4ATDA 2XGZA 2H9AB 1DQWA 1QW8A 1NFBA 4O18A 2O7SA 2PP3A 4ENLA 1SR9A 2NQJA 1DOSA 4LVGA 6TAAA 4GYFA 3NO1A 2BB0A 2J8FA 4REQA 4TQTA 3P5YA 4GVHA 3U7BA 8A3HA 3PAOA 1GNXA 1A5SA 5I79A 3P0XA 1W9DM 2PTDA 1SJBA 3HPAA 5A6MA 1DE5A 5I6SA 5JU6A 5K7JA 1OK6A 4NZ1A 2E5DA 1LL7A 1P0NA 3I4KA 2J13A 5FJTA 5LNVA 2Z29A 4LAOA 1A5OC 1OGBA 4IIGA 5KETA 3EPMA 3G6MA 4PZVA 3L4XA 3P67A 4GIRA 1KFJA 3SN4A 2DFAA 4H9ZA 4FK9A 1HJXA 1O94A 1GVIA 4PE8A 2P88A 4RW3A 1NDWA 3GD6A 3VIOA 3ZOAA 2E6DA 5AYIA 3UZ5A 3GNXA 4HZ8A 4MY1A 3E0LA 3OLEA 5I2UA 2NZLA 3BLPX 6XIAA 4Q4PA 1WZAA 1OCJA 1QXLA 4KBXA 4GJJA 2NX3A 4AXKA 4LYKA 1IT8A 2VEFA 3FS2A 4JS3A 3SRDA 2QUTA 1WUEA 3V1HA 2PS2A 1RVGA 5I77A 1ZCCA 3QKZA 4AMCA 1BXBA 4UNIA 3GO2A 3GXIA 3M5VA 1XINA 2HCVA 3A22A 1VFSA 2V3EA 4C6CA 5CPQA 4GH1A 3F2BA 1JZ3A 1F6YA 1LRTA 1VB9A 2VZOA 5ABFA 2WCSA 4G7FA 1SSDA 4O54A 1S2UA 1WDDA 4ZENA 5LHEA 3CIXA 2VX7A 1QFEA 1WZLA 2VFGA 3SCTA 4W86A 1XIBA 4M1RA 3BMVA 4H41A 2AGKA 3JVAA 1FHDA 4XAPA 2QHAA 4Q3MA 4U10A 3UZXA 3W83A 2XTKA 2HE8A 5C5YA 5BMXA 5I09A 1W17A 1W8SA 1W5MA 1ZL1A 1T6MA 3LGDA 2QUVA 4WSKA 3TYDA 4QM1A 4JNZA 4K8GA 1FHLA 2X1RA 3EWYA 1D8CA 3E5PA 1B0IA 3VKCA 4FNRA 3VD7A 5EMLA 3M0MA 1NDYA 1GYLA 1NELA 3T0DA 1XJBA 1V03A 4KGLA 4F9JA 3LDVA 2DP3A 1QO5A 5F1VA 4ACZA 4KCUA 4LCSA 1S39A 2E1WA 5CC5A 3KLKA 2V30A 3W82A 1SQ7A 1EPXA 2V3FA 1GVYA 1OG0A 2Y89A 5CBJA 5IOBA 3BURA 3MQTA 3LRLA 4HTBA 2OB3A 1UG6A 2C14A 4GD0A 3TN6A 3QHNA 3P14A 2ZX7A 5KSWA 3NEVA 1MNZA 5HMDA 2KAUC 2PSNA 4C7DA 3BW3A 1EGZA 4NZ3A 2REQB 5BMWA 4HU8A 3DDMA 4U5KA 1KR1A 2QAFA 3UWQA 1SO3A 4B4FA 3REQB 1CNVA 4MZYA 2Z1KA 3DFTA 1C3FA 1UR2A 3BV4A 2EPHA 2IW0A 1TRIA 3W6LA 2WO5A 1YQ2A 3S83A 2FTWA 2FFCA 3WLIA 4ZSTA 1Y65A 1BLIA 3CXOA 2OOFA 1KFWA 3ARTA 2NQZA 4NX5A 1H50A 3U48A 4LRSA 5GJNA 1NJJA 5AVNA 4IGNA 3WLTA 1XISA 1B9BA 1PZ1A 1XICA 2PDYA 1VHCA 4JTCA 4XG1A 3KZSA 1DWJM 3WENA 4ERAA 1EDTA 5A6LA 1RBAA 4PL2A 1WDWA 1JCXA 3TQ0A 4XB3A 4GWEA 2PDQA 4F79A 3RCMA 2Y63A 3W7MA 1KFEA 4QAWA 1HXJA 2HV5A 1GQLA 2WMGA 3ZVHB 4UZSA 1XIJA 4KKXA 4FOKA 4DJDD 4Q7NA 2Y1HA 2O9PA 4GC3A 3CL6A 4G9PA 3S3GA 1IV8A 1B57A 3DH7A 1J0HA 1TWSA 1PL9A 1P43A 4TX9A 1KBLA 1AVAA 2ZIDA 3MU7A 4EPBC 3URAA 2VDIA 4UQ9A 3M43A 4JTJA 1Q6LA 2VT0A 2P10A 3L5LA 1J8VA 4AAJA 4L80A 2FZNA 3DXIA 3N4FA 3M0ZA 4XBJA 3PULA 4FX7A 4S2CA 4W93A 1G4EA 4AH7A 1Q8AA 2R8WA 3LHZA 5LYRA 3HG5A 3P8IA 1G5AA 4UTJA 2QCMA 3CS2A 3V18A 4TR9A 1BYDA 1LRNA 5KZDA 3O1NA 2D2OA 1NDVA 2J7BA 8XIAA 1FCBA 1VZWA 1UD8A 3R0UA 1GHRA 4GC4A 1AQFA 3KP1A 1XDMA 3MSYA 2OYKA 1OC5A 4LUYA 2ZVRA 1HVXA 3B06A 3PB2A 3MSRA 2VEGA 3HMCA 3T4WA 1W1VA 1UWTA 1Q7MA 3NOEA 4PMYA 2W62A 6A3HA 1R3YA 1AZ1A 1V8EA 2XIIA 1JF5A 4LB4A 1K77A 4UQDA 2VJXA 2P76A 1AQMA 4ORMA 3S9ZA 3NIYA 4DJDA 2HVNA 3FA4A 5I3FA 2HVMA 3H2FA 1AH4A 3GC5A 3POCA 1SO6A 4BEQA 1U30A 3WELA 3RILA 5CC6A 3WJWA 3MP5A 4Z2KA 3NL2A 1UKPA 5BW6A 1Z41A 1O6IA 1W8GA 2P0IA 4I90A 4PMQA 4XZLX 4N02A 1SZRA 1DEDA 3W23A 2WBKA 4DF2A 2RKXA 1QRQA 4FNSA 2Q8XA 3MJMA 3EPNA 1MDRA 3MMDA 2G3NA 3QY7A 1SJDA 5CSYA 5HR7A 1YIXA 4PTXA 4LYPA 3KFTA 1G69A 3TDFA 4KQNA 1CDGA 1V0KA 4AIOA 4HMNA 5M03A 1IZJA 1E0UA 3GZ3A 4HMEA 3W1XA 4ZO6A 4J9JA 2ZA1A 2Y6ZA 2EHHA 3GFYA 3N9RA 3F03K 2INZA 4H9XA 4WVXA 1H51A 1DWGM 2Y4SA 1T40A 1S1RA 3CAVA 2NW0A 3GXFA 1W3LA 2YCEA 3WH5A 3XINA 2B31A 2VZSA 1PIFA 3S2LA 4NJIA 2ZUSA 4QCFA 2WZIA 1MW1A 2E25A 3T6CA 1DKWA 2J7HA 4NI3A 4E2DA 2ANUA 3MP3A 1V0NA 4K36A 3L2MA 1NEYA 3P81A 3AYTA 4JEQA 3BLIA 1PIGA 1JPDX 1DHKA 4J7RA 4GCAA 1RK5A 1I2QA 1BWLA 4KCWA 4MNJA 3DHFA 2QULA 1HNYA 2BHUA 4CQDA 4ILSA 3TJLA 3ZYZA 3I6TA 3PAJA 3WQWA 1TQXA 1L2UA 1GQJA 3FIGA 4MSSA 3CIWA 2PWFA 3E74A 2E09A 4CQBA 3NL6A 4K2SA 2BGSA 4EPEC 4OOUA 2V2CA 1GJUA 3G3MA 2QCLA 1KWKA 3S6OA 1OGGA 3ALGA 1FRBA 5C2GA 2WLZA 4JTGA 3UG5A 4LS1A 1HT6A 3TROA 4AVFA 3OBKA 1M6JA 7XIMA 2FKPA 4TU1A 3FAXA 1PAMA 3M5YA 2PAJA 1SUXA 3GXPA 4C5YA 3D3AA 3MKVA 4D6GA 1UASA 3K8MA 3TW9A 2CWXA 1XSIA 4LY8A 2OWWA 4KWUA 2ZZ5A 3NYZA 2Z24A 1W1IE 1ME8A 2VC6A 1PEZA 3FKRA 1XLIA 3PBUA 4HKPA 4B3LA 1PZ0A 3LB0A 1Z69A 1GK8A 4ZXLA 3UBPC 1KM1A 3AIUA 1B2YA 4C6FA 4IFOA 1IWAA 1ISYA 1W3HA 1YDVA 4ECLA 2XM2A 4NY2A 4GBDA 1DIKA 3K1GA 1GUVA 3LCHA 1FDYA 5AC7A 3T81A 3W28A 4S3AA 2YA1A 3SJ3A 1TWWA 2CBVA 4P7QA 4O1BA 1L9WA 4JDBA 2FIQA 4RR4A 4HNVA 1P0BA 1GVFA 3K2GA 2GOUA 3WUGA 3CUXA 3DIPA 2XWDA 4GUFA 3TQVA 1J5TA 2XUCA 3FXYA 4DWSB 4GI4A 2V2HA 1CT5A 1N7KA 4GYPA 3CZ8A 1MEIA 1HW6A 2VELA 4FIQA 5D2VA 4BJHA 3QC0A 1BWKA 1SM9A 1YTEA 3TYUA 5FJPA 3R43A 1C8XA 1UR8A 2HK1A 4MNKA 2H90A 4FR1A 1TZZA 2VGBA 4MKSA 4XQ6A 1TX2A 2OQLA 2FTYA 3RNDA 4DRSA 1LP6A 3PPCA 4PMRA 3QV6A 2YL5A 4Q8WA 4Q4MA 1HX0A 4MOZA 4A29A 2ZTJA 3EDJA 3WK2A 2YFNA 3WFAA 4IG2B 3DECA 2PGWA 4H7VA 1E6SM 5FF0A 4H83A 3TTYA 2YX0A 3O6CA 4GZEA 1F2JA 1EJVC 4PCPA 4MWAE 3IGUA 3U57A 3LNMA 3WKZA 2GSJA 4F0KA 1UZ4A 1BYCA 1E0WA 3QV9A 4MJMA 1NOFA 4KT2A 1WCGA 3HO8A 4IZGA 3UJFA 4F48A 1KLYA 4FHAA 4JHZA 1VEMA 1JXJA 3NVDA 2PTZA 4WSJA 3PP7A 3GH4A 5IHSA 4BA0A 3MB9A 1LT8A 4X9SA 2V38A 3JZUA 4JTSA 2PDMA 4F0LA 3H4XA 3ME3A 4UQCA 1XIFA 1WB0A 3W74A 1UUMA 1TA3B 3WLJA 1P7TA 1DXIA 7REQB 1PE1A 3E2RA 1BQGA 3G0SA 3VABA 1ISVA 1OB0A 2C1HA 3B9DA 1ZPTA 3UXIA 3VKJA 1XCWA 3FN9A 3WQ8A 1SVDA 4AF0B 1D8WA 1QU4A 3TYCA 3CIVA 1BHGA 2VURA 2VZVA 1ITQA 3HQPA 2GGIA 4H2CA 3KP0A 1TPFA 2PF0A 2IPGA 5DO8A 4CVUA 4MY8A 4Q4QA 1QVBA 1FWEC 4PMUA 1A5CA 1TJ0A 4MPQA 1XPGA 3WNPA 4PULA 1FUYA 3I3EA 1JI2A 2YJQA 4HZ7A 3VVGA 4JQAA 2D0HA 3M0VA 1RAKA 4WY0A 4IGHA 2NWSA 4PFMA 3BLFA 1SZGA 3TN4A 1F8MA 3UWZA 3QRHA 1YE6A 2Z25A 4A8RA 1RHCA 4I9MA 4TMCA 1IQ8A 4GX8A 3KWSA 1WPCA 3AC0A 3HGSA 3MCOA 1JYWA 4PB5A 1H61A 1QNVA 1FCQA 3VKDA 3TQKA 2ZXBA 3N4AA 3TR2A 1US3A 2BVDA 4NUWA 5AVHA 1PB0A 4QDWA 1SMDA 2VQTA 3LCWA 2XH4A 1Q6RA 2E3ZA 3NO3A 4TVDA 1MRAA 1O68A 2X7WA 1FTXA 3GHUA 3V36A 5G4EA 3WBWA 3WQPA 2J7FA 4W85A 3C8FA 4V1XA 2EPNA 1XSJA 3L0GA 2ADAA 3TQPA 3VMNA 3VUPA 2CPUA 2EO7A 3FEQA 3EX2A 3HA1A 2OWXA 1GTEA 3PBVA 3H70A 3LPFA 3TOYA 4F3HA 1QNOA 1TE6A 5CBIA 3W7LA 3DFSA 4HIBA 4AZBA 1E6XM 2DZUA 1F76A 3WLOA 3ZT7A 3PB0A 1XLHA 1N2VA 2Q3OA 2WYSA 4QLKA 3W2LA 4JTAA 2GQ9A 1UP3A 2YLLA 4ZQMA 1M7PA 1PPIA 4XZIA 4KWSA 4K7YA 4UTIA 4JD4A 1QHOA 3VMPA 4PB4A 3OZMA 1JUEA 3ANVA 1VJIA 3DEQA 2QJNA 1I60A 4R53A 1TO3A 1VPQA 1OVDA 3WLQA 3CV2A 2VHLA 2C0AA 3CK5A 4QE1A 5AYZA 1LWHA 2INEA 4DNMA 3VD4A 1OFRA 4IUOA 4NRRA 3FFSA 3GVRA 3RU6A 2CWNA 3FK4A 4MB5A 5A6JA 2Z27A 1BAGA 4L6DA 3NG3A 4FEZA 5C0QA 3AI0A 1QW9A 2OO6A 2ZE0A 1DJQA 4IP4A 1SYTA 3UGVA 1HJWA 3OB8A 5MKGA 1F07A 4M0XA 3WF2A 2RDWA 3WEOA 1XS2A 2RH9A 3ITVA 4WUIA 5FJJA 2FGBA 4Q33A 2E4TA 1TYGA 3E38A 4H8VA 4TO8A 2YYTA 5AHIA 4PMVA 5C6MA 2CLMA 1UD2A 1GORA 1YMYA 3PWIA 1EHNA 5DMYA 1FH7A 2RDUA 1CZ1A 3UG3A 3S1WA 4NNCA 1WKDA 5IHRA 1X96A 1R9YA 2FTPA 3ES7A 1RCQA 3LCXA 3DHDA 3T0TA 4ZQOA 1DV7A 4QS5A 5I00A 5KZ6A 4K1GA 3I6RA 2OYMA 1Y5WA 1BTCA 1F6PA 1UBSA 1E4LA 4RNIA 2OWCA 1JAKA 3IIVA 1YDNA 4PC8A 8XIMA 4YWIA 5LA0A 1E51A 3FEMA 1QT1A 1U5VA 1IIHA 3BWWA 3E02A 3KOWA 2QV4A 1PYFA 1RD5A 4R5EA 2DZWA 3EKZA 3DFQA 3M9YA 3THAA 3TA9A 4PUNA 1IYXA 1Z89A 3E2SA 2FZ8A 2JF7A 4K38A 3J7HA 5EY5A 3PVFA 2J62A 4FR6A 2A85A 2WMIA 3P80A 3M41A 3FGCB 3GFXA 3QFEA 2O7QA 3O9NA 5AZ0A 4DBEA 5DLCA 4J2MA 1ZAHA 2Y5SA 5A6AA 4ZFCA 6PTDA 2QJIA 3TOPA 4DNHA 2ATMA 1FA2A 2I1OA 1WDQA 3MUAA 3I65A 1H11A 3GC4A 4ZZ9A 2CITA 3THQA 2XINA 4NVTA 5E93A 3GHRA 2JBMA 1TSIA 2QVHA 5IFPA 4JN8A 2AOSA 5CC7A 3H2MA 3ZSTA 2ZRWA 3Q67A 4UNLA 5LNSA 1PVNA 4IMAA 2E6YA 3L4YA 2CBUA 5BZAA 3BC9A 3SBFA 1D3GA 4DWSD 2CETA 3K4WA 1IHIA 3SCOA 3CC1A 5K3VA 3RYSA 1CXHA 3R89A 1CIUA 4S1FA 1RP8A 4RZ6A 2AL2A 3VMOA 5DMMA 3JZEA 3MUCA 2C3ZA 4FPSA 3IUHA 2PZ0A 5DMLA 4LT9A 3WNMA 4ZMGA 3GDMA 2V5JA 1EEXA 4LAKA 3W73A 2ZZ1A 3UT0A 1G7VA 1W9PA 1XG3A 2NX1A 2CFFA 4F0SA 3W6MA 4H6KA 3VNJA 1I1XA 1LBFA 5C7HA 4MM1A 3W7PA 3UFYA 1SGJA 5EMKA 4KRTA 3W2UA 1R3QA 4RPPA 1PWMA 5EKYA 3N15A 2NXIA 3CLMA 1K7FA 4QR6A 5AC5A 3WH9A 3BO9A 3FA5A 3N4EA 2P0OA 2WZEA 3AMGA 2JEQA 3VGGA 1M9HA 1PXGA 1LF1A 1XLJA 5I02A 1KFKA 1KRMA 1R2RA 4Y8EA 2E6FA 1GVOA 3WK1A 2VD9A 2WCGA 2XVKA 1FP9A 5FAJA 3O6YX 4FF7A 4RZ5A 4LNCA 4L61A 3GKFA 1U1HA 4PH6A 1MYRA 1EGVA 1HKJA 1D2KA 2YA0A 4GNJA 1ITUA 3M6YA 1KQZA 1E0VA 3CL8A 1UOKA 4AHPA 3TC7A 3EDDA 2ZBTA 1ZLPA 2XVNA 4MG4A 4QEEA 4V1YA 1TJPA 3TMQA 1RA0A 1W3IA 4M6UA 3UY8A 4MDOA 4HNTA 4L9YA 1LG2A 1XRSA 1JCYA 3LZ3A 4N7QA 1LRQA 3KVMA 1EC9A 4HYVA 3WLRA 3GB6A 3ITCA 1LQ0A 3CU2A 1HN1A 1QI3A 2GJXA 4MVAA 2QUNA 3CL7A 1KXVA 3TXZA 2Z1WA 3I68A 3NZ1A 1TPC1 5A3HA 3WJYA 1CYGA 3N34A 2UWFA 3OQEA 1BQCA 3AZRA 4H19A 1G7UA 2XH0A 4NAFA 3CV1A 3H7RA 4HNOA 5CGTA 3W0KA 4DJED 1R5YA 2Y24A 3TE9A 1EYEA 3QPEA 3AMKA 5DY3A 5G4WA 1EBHA 3GW0A 4XZWA 1VEOA 2VL4A 3B0UX 2AAMA 4MDPA 3WLHA 3PTQA 3VDAA 2OX1A 3QQ1A 4WX2A 4O14A 3I7SA 3GR7A 2RFGA 3B8WA 3DYPA 5EMUA 4QJ3B 2ZTKA 2J25A 3TZNA 3RIKA 3GFZA 1BXNA 1KCZA 3RGTA 5FKYA 3BAXA 3MPGA 3RK8A 3EOOA 1M68A 3W87A 4JAWA 1Y0EA 5C9WA 1YPFA 4DWDA 5HMFA 1GGOA 1ZFJA 3ORWA 3ZQ9A 4CNUA 1KKRA 1FH9A 1ONRA 2BOGX 3AYSA 1HFBA 4NXKA 4GY7A 2IQ0A 4Q8MA 1PX8A 4E2OA 4EANA 2ZWYA 2X8RA 2QCNA 2FFIA 3M64A 3OQ8A 4B5XA 2G4FA 1H7RA 3VZZA 2ZWZA 5HPOA 1EX1A 2DT1A 2ALDA 4XD5A 3IV3A 2QCFA 5J5RA 1WKFA 3NPXA 3NZRA 3LSCA 4LS2A 3NGFA 4LVAA 4GHRA 2B7PA 3GQYA 4PBGA 3W7OA 3P8JA 4DIAA 4GXPA 1SU5A 2QJHA 3LOTA 4RE0A 3MZNA 3TMLA 1LOSA 3UXLA 1E9ZB 4AIUA 4K3ZA 3MV11 1BXCA 4XO6A 4L4PA 3HPFA 2XVPA 3PN8A 3PNZA 2ISDA 3TH6A 1TVPA 4DN1A 4N6EA 3LCLA 5HOSA 1P6BA 3TKFA 1ICSA 3OO2A 4EXQA 3LU2A 3O0KA 4IPIA 1OFQA 3IWPA 4MB4A 4HK7A 3AROA 3DCPA 4YTSA 5C2XA 1QHPA 1ISWA 3ZLFA 4X9YA 1WNOA 3H2AA 2WMJA 2X1TA 2FGZA 4D9PA 3M0HA 4NILA 1T5AA 3M0IA 2A6NA 4C6MA 4QNEA 3IV8A 2F9RA 2VP8A 3NO5A 1AJZA 4Q4OA 4EX4A 1BYBA 2PBGA 3BZGA 4Y2WA 2DGAA 1LLWA 1QOPA 5TF0A 4F0MA 1YEYA 1RBOB 3LGGA 2V5BA 2VCBA 3BGAA 3G18A 1ZUAX 3BCJA 4RXFA 4UTHA 1GOOA 3PJUA 3WQDA 1I2NA 4KEMA 2ZX6A 1XF0A 3LHVA 4LWWA 3VX1A 4M51A 1V6TA 2I57A 1QK2A 3RO6A 3MDUA 4O8RA 3PANA 4AHQA 4IXHA 1S2WA 4PRRA 4ZOEA 3S8HA 2DH3A 3MUY1 4D1JA 2X0SA 4UOQA 1A5NC 3SSZA 2J66A 3G24A 1EPVA 3VNZA 1RY8A 3I7RA 5A8NA 1RJPA 4LXFA 3APTA 5HAOA 3R13A 5GNXA 4C7GA 4EP8C 4MWAB 4KMQA 4LS0A 3S47A 1O1HA 2PP0A 3WLNA 5T9BG 4UZUA 3N2XA 3S5OA 2JIWA 4HSNA 5C9RA 3CAWA 4GUGA 5H6HA 1TB3A 1HKKA 1XKJA 4DZ5A 4PTDA 3DI0A 4DM1A 1P7TB 3A3WA 3EKGA 2OKTA 3R79A 4HNCA 3PJXA 1V7YA 3W9ZA 3L4UA 3GNDA 3VOFA 4H04A 2A3AA 2HRWA 3SQSA 4HOXA 2IPWA 3O3RA 3F4WA 2ZUTA 2QJGA 1JZ4A 4JZ5A 1AW5A 4H9YA 4RV3A 4QLJA 1J2WA 2Z00A 4AX7A 4LC8A 3SN1A 4MWAC 1CXFA 3OVQA 1KBBA 4Q22A 5L9FA 1I9CB 5E0CA 2PRHA 1U22A 3DZ1A 3SY8A 3IJ6A 4QQ3A 3EMZA 5HQLA 4JHMA 4HA3A 3JW7A 1MW3A 2GJLA 5CZTA 4M5PA 1J0JA 2QEZA 2Z28A 1CLXA 1ELSA 2WW5A 1VCVA 4XV0A 2WB5A 1REQB 3TYAA 3GU1A 1GJPA 2CCRA 6REQB 3NM3A 2DJLA 2VX4A 4QIUA 1TV3A 3UPBA 3G0XA 3LXCA 3E1F1 4Z1CA 3HJZA 1V6UA 2P8BA 3UF9A 5C70A 3THUA 4MADA 4LTSA 2PEVA 4U2YA 3ABQA 1JL8A 5F7UA 1FH8A 4TV5A 4DBSA 1W91A 1VFHA 1GYNA 2A21A 1OQFA 4ZO8A 1ZAIA 5FF7A 3KRSA 1WAWA 3MYOA 1N82A 4G2DA 3UESA 3ES8A 3A4XA 4HHLA 1P6CA 4JFTA 2PDKA 3BARA 1XWYA 2CW6A 3EWDA 3N3MA 4Z2IA 1XPYA 3AIWA 3NQAA 4DJEC 2XIJA 4XKYB 1J12A 4F9DA 2F6XA 1A53A 2CZ5A 5EB8A 3SFKA 4GCXA 3PY2A 4LYRA 2VX5A 3L65A 2NQ5A 3OBAA 1WKYA 3WN6A 3HG3A 1F6KA 3LENA 2WVVB 3W7KA 9RUBA 3AYRA 1L6WA 4AD5A 3A6OA 3B9NA 3OA5A 5TBOA 4UTKA 2ZUWA 1NOWA 1O5QA 1EQCA 1WDRA 3RRAA 3E2QA 2A79A 1UWSA 3W86A 1NU5A 3MMWA 1VFUA 4ZODA 3QEZA 1TJ1A 1LBLA 4UCGA 5BCAA 4EXBA 2WSKA 4G56A 1D9EA 3B3DA 1X39A 4H8HA 1DIOA 1PZ2A 2PDNA 3C56A 1POKA 1T96A 3H7VA 2QCDB 1F7BA 1TUXA 1BVWA 4LF2A 1UH3A 1H2JA 2VRJA 3GNNA 4X63A 1W1TA 3GDTA 3MI6A 1XRFA 3WH8A 4MMWA 4O8AA 5IDIA 4FNUA 2W4XA 1UKSA 1KB3A 4GIYA 4M56A 1N55A 4GI6A 4QHRA 1IF2A 1EP2A 1P0KA 4LQ1A 4JYDA 3N12A 4RV8A 5LIXX 1A4LA 1KQYA 1UYQA 3TP4A 4RPQA 1CGTA 1EIBA 4EF8A 2HE5A 1AK5A 5H1WA 4CU7A 1OT1A 3OGRA 4P5UA 1YX1A 3QF0A 1BRLA 1EOKA 2C71A 2X1SA 4ZO9A 1HTIA 4OHQA 2BS9A 3T7VA 3BLEA 3ZSSA 3EWXA 1UIPA 5A8MA 2F7FA 2WK2A 1JYVA 3B04A 3SECA 5K2ZA 4UR8A 1HO4A 2D2GA 1GKQA 3L66A 2OJPA 4Z2JA 1GEHA 4LW7A 3H2CA 1G6CA 1K1DA 3Q58A 4H7ZA 4M8UA 4ZQPA 2G96A 1XHGA 4JN7A 4CVWA 3LG3A 3WG6A 3ITTA 2V5DA 4WK9A 3VOCA 3U8GA 1BKHA 2NSOA 3RLUA 4GO9A 1D7FA 4KEZA 1XIIA 3LV6A 5U4NA 3G1RA 2GJPA 4RDVA 4KFOA 3NYDA 4I8DA 1US2A 5DBTA 4RNHA 4HQVA 4LUSB 4YTUA 3BAWA 3TSMA 2ON3A 3MANA 1E0XA 4GI9A 4IPJA 3CASA 4G1NA 4ORIA 3N13A 2W3ZA 4L56A 3BOFA 5LNWA 2IKHA 4WKHA 2MNRA 1VC4A 1EKOA 4KPLA 3R4IA 1VBJA 1VYRA 3QZAA 4PYSA 4Z1YA 3T40A 4W7UA 1ZCOA 1W2PA 3L68A 3EAUA 3C2FA 2PWEA 5CGMA 3KRUA 2V67A 1W5PA 4M81A 4W88A 3LLDA 3AISA 4G1KA 4MAVA 5DQPA 1VGAA 5C8BB 3HPZA 2PD9A 2X2YA 3LCGA 1BTMA 3LI1A 3TA6A 1ZB5A 4B16A 2CBIA 3DBPA 3PPFA 4M7SA 3AWNA 2WAGA 3VU2A 3P62A 1EJUC 3HGRA 5FACA 4C6DA 4R9OA 4E6MA 5GQBA 3WFZA 3URNA 3CTTA 5BOEA 4QG8A 2R1MA 1R8LA 4O0KA 3PTMA 3K1DA 2QYGA 1KLZA 2RJGA 3MHGA 3PUOA 4CD8A 5K4XA 2EF9A 3VILA 4MFEA 3IJ8A 4XZBA 1M04A 3UQNA 2OZ0A 4LAMA 1VCGA 3BQ6A 1U5JA 3OZYA 4ZOAA 2PWDA 4BQ4A 2VRKA 3SIMA 1AW2A 1S5WA 4DF0A 2PDCA 4KWWA 3S1XA 3CZEA 3KAOA 4GQRA 3UWWA 2X05A 1SW3A 3BAIA 2EKGA 1IEIA 3L4VA 4IX0A 4DI8A 5FD0A 1BGGA 3KCOA 4EOUA 1H5YA 2BBFA 3AHZA 3A3XA 4JTHA 3C5QA 2ZFAA 2AQWA 4H8UA 2DIJA 1I2PA 4QGCA 1TPUA 5I3DA 1A49A 3NQDA 1FDJA 3R0KA 5EL1A 2OO0A 3ZLHA 2PWVA 1KW1A 4JGDA 5A8GA 5FF2A 4HVXA 4AWTA 4RNJA 5D32A 4KGJA 4IF2A 5CLWA 3F4DA 4US6A 4C6JA 1C8YA 3CUJA 3NDYA 4DJFC 2H8XA 3GBEA 2HZGA 3WH6A 3GVGA 3WD1A 1ZGDA 1ECEA 3W72A 1FWTA 1VYSX 1JDDA 2V3GA 2P8CA 1SJCA 3CNYA 1DIEA 5K9DA 4QX4A 4BWLA 2TYSA 4HB7A 3LK6A 4G8TA 2WZMA 5GNZA 3U5YA 3EWZA 3H55A 3H2EA 3M5ZA 4UQEA 3AS1A 1OYAA 1PS9A 3FOKA 2EPMX 4MTVA 3TVAA 4NL1A 1OGSA 1A3XA 3XIMA 2XFFA 4DAIA 2QV5A 2WV8A 2Y70A 2J7CA 4JQ4A 1K6WA 5XINA 3B0XA 3Q37A 2RGLA 3LLFA 1IGWA 1V3IA 1DVJA 4UR7A 3AAMA 4AD1A 2DQWA 5JBDA 1IZKA 3ZT6A 1U5HA 4Q32A 2Z2BA 2I16A 2GGEA 1W1PA 1AH3A 3TNOA 4GJ1A 3N2MA 5T91A 2DQXA 1RBLA 1ODZA 3LXAA 5KEZA 1XYZA 2GJRA 3KUMA 4HU3A 4EPKA 3B0VC 2PTWA 4UTLA 3SJNA 2DW7A 3V16A 4LUTB 2Q02A 1LBMA 2R6OA 4JR5A 4N9EA 3C61A 5SWUA 3M47A 4D8AA 4B92A 1QOXA 1ZBVA 4IFKB 3RN6A 4FLOA 3VCCA 1BSLA 4ZO7A 2D20A 4PCSA 2VEIA 5LSMA 1E56A 1XD0A 1AH0A 1AFSA 1QPQA 3IAPA 2GVEA 4L4OA 1CB2A 4HMCA 3AMLA 1LUCA 4B3KA 1LM1A 3WYZA 2DSUA 2NVDA 4DJEA 1Y8BA 4IUGA 1ZU8A 2WPBA 3CHEA 1ICPA 2Y7EA 9XIMA 2QXWA 1KRAC 3V0SA 3UR8A 5CXPA 2MANA 3KDNA 2R9RA 3EBVA 2GGJA 3QY6A 3EGJA 3TC3A 3R6IA 2OQYA 1KBIA 3A64A 1JEZA 2A7RA 3UA4A 4WZHA 3E96A 3GR4A 3DFOA 1OX4A 1ZBKA 2E7FA 5MHBA 3ZXWA 1ZBWA 1VFMA 4GACA 4DI9A 4JNMA 5LKYA 1G4TA 2FDMA 4S3KA 2XFYA 5CG7A 3DHPA 4LGXA 3GTXA 5DXYA 3VKBA 3ZR6A 4BCEA 2CLFA 5A6BD 3AXMA 3KRBA 3B0YA 1LQ2A 3BLKA 3NM1A 4UNKA 3TX9A 3EMCA 4ZB5A 3STGA 4K1WA 4FNQA 3HGOA 5M2FX 3BOLA 5BOFA 2PDXA 2PU1A 3G22A 4EAYA 4IQLA 3I6EA 4UFKA 3WSUA 4DPQA 1EA9C 3V35A 1YLVA 2D1ZA 3ITXA 1GVRA 1OY0A 2PDJA 4B5TA 2F61A 4KETA 1HP4A 2V5LA 5GNYA 2XGBA 1Z3NA 4HYRA 4I7VA 4KCVA 5BU9A 2H6RA 1F9CA 3IEBA 1DWFM 1SZFA 1CGUA 3UA3A 1LUCB 3BE7A 1VEPA 3W7IA 2X0HA 1KRCC 4UTWC 3RDKA 5DT5A 1XLLA 3PNUA 2I7GA 1AJ2A 1W32A 1K4GA 2QCDA 4PCTA 2WC4A 4XWUA 3IK4A 4X22A 4FB7A 1TRDA 3CT7A 2XZ9A 1FWRA 4JX6A 2PLCA 3HV9A 4HTYA 3USBA 3GAYA 4FS9A 2ABAA 4AMAA 4BQ3A 5A8QA 5D2WA 1FOBA 4LUTA 2VMFA 1IR1A 1RY0A 2XVLA 2PURA 4O17A 4FF5A 2MUCA 1YHTA 2Z6IA 4Q8TA 1IWPA 4J2PA 2FHCA 3DG7A 2ZZ6A 2DT3A 1HF6A 1DJGA 2B81A 1OZMA 2V82A 4CNNA 3CQHA 4FI4A 4H9MA 1ZZMA 3NL5A 3M1ZA 1SJAA 2GL5A 3U2ZA 1QPNA 2E67A 2WVSA 3GBDA 3R11A 4Y9OA 1T8XA 1AODA 2XVGA 3IVSA 2VOTA 5CSSA 1EGMA 5EYWA 3LPGA 3NSXA 2ZX8A 5CJNA 5A5WA 1EEPA 2ZUVA 3CHFA 4R27A 2J88A 3GG7A 3VAVA 5CJ5A 4GOAA 2POTA 4B5SA 1SPQA 1W3JA 3S5NA 1E0TA 4R7JA 3RRXA 3BK0A 2X41A 2DVXA 5CEWA 3U4FA 4X2RA 1L0PA 3C52A 2X0YA 4V2XA 4PMZA 4OV4A 5EMYA 4WKAA 1W0MA 2L5HA 1UD3A 3BGJA 1UR9A 4Q7BA 1F5ZA 2J9XA 2HS8A 5H8UA 3UNTA 3TN3A 4TUFA 3M07A 3R7MA 3MSGA 1V3KA 3OGSA 1YADA 3U2EA 4A3UA 4D72A 3NQFA 2PDBA 4C1NB 2DZAA 4PSPA 4UIOA 4A8LA 4HHHA 3NQ2A 4W5UA 2ISFA 1YXDA 2XN2A 1XBVA 4P2VA 4ACYA 4YCOA 4OUEA 2XSXA 1UWAA 1LL4A 1VBRA 5DANA 2C8NA 2XSAA 4FX6M 3GUGA 3H7UA 1S2VA 5D9PA 2UY3A 4XKMA 2Y0FA 1H1ZA 4PR4A 1TPB1 1GTHA 3MMTA 1FX6A 4LU0A 4ML4A 3ARPA 3CHDA 2BY0A 3VDGA 1I45A 2E40A 4QJ4B 2XU2A 4DBWA 5AC6A 3F5KA 1VF8A 2BG5A 2HMCA 3K30A 4B15A 3UWYA 1YPIA 2V5KA 3IIOA 2D2HA 3HTWA 4NJHA 4F2BA 3WY1A 4MKNA 4W8AA 5AZ1A 1IEVA 1RLCL 1OFPA 2QF7A 3VIIA 4ICCX 1WP6A 4A05A 2ALRA 5FJIA 1K70A 2XHYA 3CUGA 1YYAA 3VOGA 5HMSA 4OV9A 2P3ZA 4IIBA 1UWIA 1XLFA 2E5BA 3OW1A 4HA0A 1K9EA 2D2JA 2WVTA 3TSDA 2ACRA 2Q71A 4Q4SA 4JKLA 4P7RA 3SCUA 4IM4A 2A0NA 3H4WA 4J27A 4DUWA 5AYBA 4I6VA 4A21A 2WWDA 4R85A 2OR2A 1J4EA 4RNFA 5DF0A 4JIHA 2Y5EA 5LZLA 4NNAA 3Q65A 3LTPA 4Y9PA 3H53A 1QNQA 4DJFD 2GZXA 2YGYA 2VENA 2OELA 4R3UA 1F3XA 4LUJA 3WH7A 1OZQA 3MA8A 1UB3A 2E8ZA 1TPEA 3A9BA 2VC9A 3SR7A 3KCJA 2F2HA 1KBJA 3H2NA 3WBEA 5HINA 1TQJA 4UMBA 4Z1BA 1GOWA 4CD5A 3FHAA 3NVTA 2DSKA 3VIMA 1H0GA 2VX6A 5HANA 2NVCA 1M7JA 4NU7A