1R3WA

Uroporphyrinogen decarboxylase y164f mutant in complex with coproporphyrinogen-iii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTFMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen Decarboxylase
publication title Structural basis for tetrapyrrole coordination by uroporphyrinogen decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 126
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1r3wA00
1R3WA 3PPHA 4L5ZA 4L61A 1YPXA 1JPIA 4L6HA 3GW0A 3BQ6A 3GW3A 3GVVA 3PPCA 4ZR8A 1R3VA 3GVRA 3GVQA 4ZTYA 1R3TA 4ZTXA 4EXQA 1T7LA 2Q6ZA 1R3YA 2INFA 3BQ5A 4QQUA 4L65A 2NQ5A 3PPFA 1UROA 3PPGA 4L64A 1XR2A 3GVWA 1J93A 1R3QA 3L7RA 1XPGA 1JPHA 4AY8A 1U1UA 2Q71A 1U22A 1U1JA 3T0CA 3RPDA 1U1HA 4L6OA 1R3SA 3CYVA 4AY7A 1JPKA 1XDJA 4WSHA 1R3RA 2EJAA
chains in the Genus database with same CATH superfamily
1A5NC 3CASA 2VGFA 1Y5VA 1E43A 3TV8A 4A05A 4P7OA 4RL3A 4Q4OA 1E1EA 1HGWA 1TVLA 1WB0A 3CWNA 1S2CA 4O1AA 4K8GA 1DP0A 1HKKA 1EF3A 3A4JA 1KGWA 3AXMA 4V2XA 3ANVA 1S2AA 2XIJA 4LUYA 1DWIM 1TIWA 3GNRA 4Y96A 3EPOA 4HOZA 1V3MA 4QE1A 1QW7A 5HJXA 2ANUA 1V4YA 4PTDA 1LF1A 3UWWA 3SGGA 3TIMA 1VBUA 2ABAA 1LBLA 4JYEA 5BWFA 2IPWA 4AZCA 4LUSB 4WVXA 3L0GA 3LPOA 2FB2A 3B03A 3IJ9A 4IZGA 1HF6A 5LIYX 5EMMA 2EPLX 3W7RA 3EEZA 2QMJA 2V5DA 2DJXA 1K9DA 1F2JA 2FKPA 3RITA 3E0WA 2BHYA 5DXXA 3W24A 3W2UA 2VDGA 3SCTA 4OHQA 4O54A 1TWWA 3B8SA 1DWGM 1D7FA 2ZZ6A 2IUZA 3PNUA 1TELA 3AWNA 1LDCA 3APYA 1NDYA 4YYFA 1XIGA 1Q8AA 2BSLA 3KL3A 2BHZA 3RRXA 2QEZA 3W88A 1W9UA 3M5VA 4YTSA 2V82A 2DUXA 4J3XA 1J0KA 4MVAA 3MSYA 4IQLA 3G1AA 3T2PA 3G1YA 4S3AA 2QPXA 3V36A 3NCOA 1B2YA 5XINA 4L80A 5D05A 4HN4A 2PDWA 2XH4A 1XIJA 3SIZA 3TTOA 4TMBA 3NM3A 1A3XA 1OABA 1E6ZA 4S3GA 3VK5A 2G0WA 3EXTA 1VP5A 1GCYA 3WUBA 5EMLA 1T0OA 3LXCA 4RXGA 2FMOA 3EYPA 4J9JA 3WDQA 4GWEA 4V15A 3W1AA 4W9TA 1PJ9A 1KM2A 3TLLA 3RUBL 4UR8A 1I2QA 2HPIA 3CGTA 3F7JA 2FMNA 1ONEA 4UNLA 3ZQ9A 2GOKA 3AXHA 4O1BA 4H2CA 3WL1A 2PBGA 3KVLA 5D33A 3CQ0A 4MM1A 5C9RA 1UIPA 2XSAA 3OLDA 4JNYA 4DJDC 1HNYA 3BAXA 4KWVA 1Y8BA 3EA2A 1SR0A 2FFIA 1AD4A 3CHCA 4GJ1A 2V5LA 1R3VA 5U4NA 1ZCOA 1T7LA 1UA3A 4RLIA 6ENLA 3VD5A 3RMJA 1LORA 1A0EA 2OMAA 4RPPA 2J7FA 3G77A 2E68A 1KCKA 4O4VA 4EK7A 3Q2DA 1KA9F 4LJ3A 2XVNA 1QNPA 3GXDA 4IIGA 2ADAA 3T4CA 1BF6A 1QW8A 1GKQA 1HT6A 4GQ0A 1KM4A 1SZGA 2REQA 5I3IA 1TKKA 3CWHA 1JZ6A 4UXDA 3D3FA 2CHNA 3NZGA 3N2BA 4DAIA 3T78A 3K4DA 4LBUA 3ZFHA 2PFHA 4BJHA 4N4QA 2XGIA 4BR1A 3L9CA 1GOQA 4KKXA 2X8RA 1IWPA 1ZFJA 2CETA 2WCAA 1OB0A 3ENLA 5F1UA 4PMRA 1EJWC 2WNQA 3W07A 3A6OA 3GXPA 5A2BA 2XIOA 2J74A 4ZQOA 3UYCA 3F5KA 3HM7A 3QFEA 4CN4A 3R58A 5I0DA 1XYLA 4N6EA 1L8PA 4ROQA 4C60A 2YCLB 2ZE0A 4Y9MA 3QV6A 4X0NA 5E9XA 2E5CA 2CXEA 3E2SA 3OW1A 4H4IA 4Q8NA 4QEHA 1QCWA 4UTWC 1X6NA 1KTBA 6CGTA 2AQWA 4ZODA 2D73A 5FJJA 2NWRA 2BVWA 1E6NA 3KAOA 2EPKX 1VD6A 1S2UA 2A21A 1A50A 5HWNA 8XIMA 4M6QA 4AMAA 1ZL1A 3DFHA 2Y62A 3C2YA 1R30A 3DU0A 2PLJA 1ZBCA 3MMDA 1KCXA 3NQAA 5IHRA 1KCZA 4CNUA 3IK2A 4LRSA 1VFOA 3WJYA 2WBKA 4Y7EA 3VIGA 2PPGA 3FYOA 4DJEA 4DRSA 3LCFA 1ZP3A 4HBKA 1AODA 5HXMA 3VC5A 3T55A 3OEXA 3UG8A 2W63A 3SGUA 1DHPA 3W53A 4ZA0A 4I7VA 4REQB 2ZBTA 1WA3A 3KVMA 1W31A 5U7SA 3MY9A 3LCGA 3V7PA 1KQZA 4B16A 2XGZA 3WLJA 1NFGA 3S8HA 2Q8XA 3R8RA 1X1NA 4O11A 4L6OA 1OX5A 1SM9A 3IEBA 1Q6RA 1JPIA 2R82A 1XINA 1JAKA 2Y8UA 3AYTA 4RDYA 3P67A 4M56A 2BXYA 1B30A 1XR2A 3I6EA 4H7ZA 1V08A 4QBXA 2WSRA 3QRHA 3MSDA 1OFEA 5BMWA 2EKGA 2Q01A 5ABHA 1E4IA 4FNPA 4MPKA 3SBFA 1AMKA 2CPUA 2P10A 1SFTA 1R86A 4BQ5A 4NUWA 2YL8A 5LSMA 3B9NA 4JYFA 1NQKA 3URQA 1W56A 1UQZA 3CU2A 2FZ8A 4N9EA 3RHGA 1ODUA 1W5OA 1L0PA 2ISSA 3OYXA 1HGYA 1FWCC 2EF9A 3BTNA 3BLPX 1DXIA 1NDVA 4ASTA 2C91A 2UY4A 2JF6A 2GQ3A 5EMYA 4GUGA 1KW1A 5D9OA 5JIPA 1PWLA 3E0VA 4M24A 1VHCA 1DHKA 3LQGA 3UD6A 4GI8A 3Q67A 3OTRA 1QPQA 1KRAC 3N2OA 5A6JA 1VHNA 4ADUA 4ZBCA 3RM9A 3ARYA 3HGSA 1YMYA 1NELA 3AWOA 4F0SA 3BURA 1R38A 1AK5A 2BBFA 9XIMA 3GFYA 2PDUA 5HNRA 5K9DA 4B3LA 3MV11 3EOSA 1DWJM 1Q6FA 3ZT7A 3EPNA 3CQHA 3W7JA 1F61A 3DFSA 3PB2A 5AHIA 3P62A 4M5PA 3W87A 3NO5A 1S5TA 3LMZA 4LAUA 4NZ5A 1NOUA 5HMEA 3DG6A 3IIOA 1HVXA 4A3YA 3S5SA 5CSSA 1S5VA 4Z2JA 4GY0A 3OOQA 5LGZA 1QNSA 1KKRA 3MSRA 3WLRA 1VLIA 1PYFA 4ZE5A 3EWBX 1Q7ZA 3AIEA 3ARPA 2XG9A 2ZA2A 4NZJA 4AF0A 1SSDA 3RU8X 2PDGA 4C91A 2CIPA 4UQ9A 5DT5A 1K9EA 3JZUA 3R6IA 1LWHA 3ITLA 2FTPA 2A4AA 1HVQA 3U6WA 2PZNA 1CI1A 3U9IA 5ABFA 3UGRA 4JD4A 4C90A 2DFAA 2OSXA 4M3PA 2J78A 3C56A 4A3RA 1E51A 2W4XA 2CLOA 3QPEA 4AZ5A 2Z29A 4WGXA 4IGHA 1XFBA 3WNKA 3VOFA 5T91A 1J11A 4CNPA 4AXKA 4CEXC 2NT1A 2V9DA 1LQ0A 1TVPA 1ECQA 1I2OA 3RX4A 1JI2A 3NXLA 1D7KA 2DVUA 3W85A 4RCXA 2WKGA 3M5YA 5J5DA 1ZQ5A 3NGJA 3VNDA 2OG9A 1LRQA 1W3JA 1IYXA 3WFLA 1J12A 3SM0A 3CUHA 2HZGA 2AL2A 1L2UA 1JFHA 3L2IA 3I10A 4JX5A 3ERPA 4ILSA 3BAYA 3GO2A 4KRUA 1KNWA 3WQVA 1GYLA 1PKYA 1QATA 4OOZA 4NP7A 3KP1A 3VIJA 2D20A 3PPCA 1AZ1A 3ZZ1A 3BW3A 3KWSA 1DOSA 1BKHA 4JIPA 4UTIA 4EXBA 3CL8A 4TTGA 2C79A 3W86A 4LAKA 4XO7A 4OT7A 1LROA 4LCRA 3CWOX 3A5VA 1QPOA 4NZFA 4AFYA 1Q2RA 3WDPP 4CQAA 1KXHA 3Q37A 1J2BA 3C3NA 1C8XA 2GDUA 2VFDA 3ITCA 2E0PA 5HMSA 2FB3A 3T2OA 1EDTA 1EHAA 2ZX5A 3XISA 5G5IA 2WQPA 4ZE4A 4DJDD 3RK8A 4PCFA 4UTMA 3ABSA 3GH7A 2WKJA 4IQEA 1JCTA 2FVLA 3GDLA 3GVGA 3OIXA 2VENA 2FFCA 1FDJA 3UVAA 3FDKA 1ALDA 3TWAA 3KBJA 1GEQA 4PUUA 2PGEA 1Q8JA 3UA3A 4GHRA 1Y7VA 1PKLA 1EP2A 1B3VA 4E4FA 1CXLA 4RZBA 1B0IA 1I6NA 4TIMA 3CH9A 8A3HA 1KBLA 4NF7A 2V0TA 2NZLA 4PMQA 4DZIA 4F0HA 4FP1A 4HMDA 4PL2A 2OQYA 3Q4DA 3NZRA 1VYPX 4IFKB 2DVXA 4BZYA 4FEZA 3L2MA 2BDQA 4JFUA 4OTKA 1B5TA 4FHAA 4BEQA 3A12A 4HTBA 1XYAA 1YNPA 3C5QA 1HO4A 3HG4A 3NSNA 1BYBA 1WYIA 2WJFA 3V3WA 2Y7DA 4H00A 3BCJA 2QUUA 5F2MA 4Q8TA 3NZ1A 3SURA 4HU3A 5GNXA 5IXEA 2PTZA 1EWDA 4FNRA 3QMRA 4XX6A 3KS5A 2OKOA 2DVTA 1ZHAA 2R1LA 4JN6A 3PZGA 2OOFA 3TA6A 3C52A 1C9WA 5AECA 2YR1A 4Q7IA 5RUBA 5ECUA 2YX0A 3ABOA 1DQUA 3SR7A 4B15A 1IWAA 3VGDA 1GVEA 3E0FA 3FN9A 2GGEA 5D8WA 3TJIA 1FTXA 3ABRA 1KM0A 3CPGA 2F2KA 1EJVC 3DKJA 1C93A 2P76A 2VX4A 4QJ3B 3G24A 3CAQA 1A80A 1UKQA 4Z0SA 2H6RA 3GHUA 3THQA 4V1XA 1CGTA 3IIZA 3RLGA 1O1ZA 4EPBC 1F3TA 2VI0A 4YU1A 2DSKA 3ARZA 1J93A 4LYRA 6XIAA 3CT7A 3FVDA 3H8AA 2ZRWA 4EPKA 1KTNA 4US5D 3N9RA 1K7FA 1LL7A 1UW9A 2E77A 3WH9A 1CXEA 4AYSA 3LTSA 4I5UA 1VYRA 1QO2A 3PB0A 3ME3A 4ICMA 4M1BA 1GOKA 3QF0A 1IE7C 5IRPA 2ZYFA 4D6EA 2Z27A 4X2PA 1RCOB 2QJIA 1E6RA 1W2PA 3QOMA 1W3NA 1NQ6A 4JFTA 2PUZA 1JNEA 3AHZA 5DCEA 4ES4A 1NP0A 2OQLA 1VPXA 3W1RA 2PB1A 3OVQA 4CQDA 1YADA 2A3HA 2RJGA 2IQTA 2QAPA 1TVNA 1W6TA 4ZFMA 3BQ6A 2V5BA 4LWWA 3W27A 3R12A 3SI9A 4N42A 1AL7A 4IIBA 3ARVA 4GH3A 9RUBA 2P5NA 2V8ZA 1DJNA 1FWRA 3NIYA 1VFSA 3FA3A 4C6BA 3MZNA 4IFOA 1Q4WA 3QR1A 2O9RA 2UY3A 3FVMA 3SRHA 3ARRA 5BOEA 5F4SA 1QK2A 1VFUA 1V0MA 1UR4A 1XH2A 2NXIA 3OVRA 3G2GA 4X63A 2BVTA 5DMYA 1XLFA 1KXTA 3UJSA 5D8ZA 1MDLA 3TU9A 3LRLA 4KBXA 4Z42C 1QI2A 4JFVA 1RQHA 3EA1A 5CXPA 4L64A 1W3LA 4L1WA 4PMNA 1YDOA 4ACZB 3CK5A 4HIBA 3TJ4A 1ME8A 2XIBA 3FLUA 3R8GA 1TQJA 1XLKA 3CUXA 1VYSX 3GNPA 1PZ2A 3OJGA 4C1LA 3W3OA 3WD0A 2QVNA 3BLLA 1FH7A 1NWSA 1RHCA 4LF1A 1XUZA 2ZKMX 4IUGA 4GKTA 1XLLA 4R5EA 5I77A 1CW2A 4WEVX 4IGSA 4JTEA 3E0IA 4G1KA 1R3YA 2VZSA 3QMTA 3K4AA 1RLDA 3GDKA 3KBSA 3H54A 3W7IA 2J6XA 1W1A1 3T0BA 1IV8A 2E1WA 5JIWA 3CQJA 4CNOA 3PSWA 5I3DA 1W91A 1MSSA 1JDAA 3M7WA 4QSHA 1EX5A 3LOTA 3TQVA 4GYKA 2QDHA 1ZY9A 1E4NA 2DH2A 5H8PA 2ZUTA 1W8GA 1BSIA 5KETA 2WAGA 4XQ6A 3M0JA 1WXJA 3MI2A 3OQ8A 4NZ1A 4WUIA 4L61A 1V7AA 4I8DA 4AXNA 4LAMA 4S2CA 3OHIA 5AB3A 1UR8A 5D2VA 2ZDRA 2Z2BA 4BA0A 2WZHA 1LYXA 1YTKA 2IPFA 2XH0A 1JNDA 4MZ1A 4O1FA 2A7RA 4K8EA 3OZYA 3I6RA 4M8UA 4XUYA 3TYBA 3WUFA 3GC2A 3K13A 1A5AA 1RAKA 3T8QA 1R3WA 4HJWA 2WWCA 4LB3A 4NNBA 1F6PA 2GSHA 4PRWA 4KIRA 4UOJA 3VZYA 5CBBA 5A8NA 4JY9A 4UCFA 4F2UA 3P81A 5EMKA 4K36A 2R91A 4AMCA 4OGZA 3A3WA 1F4HA 1JYWA 2Q09A 2Y5SA 2ZUSA 3B4YA 3H7VA 4KS0A 3SFWA 2R8WA 4B92A 4TVCA 3VOCA 4ML4A 1YNYA 3WH5A 3M0KA 4GFIA 1UWUA 3ARSA 5CPLA 1FKWA 3B0YA 3KTXA 2X09A 4V28A 1TREA 1NSJA 1XPYA 1YXCA 1W0MA 1H7WA 1H0IA 3GDRA 5AKQA 1WPCA 2HE8A 4GUJA 3AALA 3LRMA 4F2BA 3SQMA 1SJDA 4CGTA 1K4HA 3BPWA 1QPKA 2YA2A 3LN3A 3O05A 2VRJA 2X7WA 1H63A 1OC6A 3WDHA 1FXQA 4PMZA 2BY1A 3TTEA 4F3HA 4UC5A 1IQ8A 3C0JA 3HQ1A 1M41A 5K7JA 3KVJA 2Z2AA 5LZLA 1FP9A 1J6PA 3M0LA 4X9SA 4D6IA 1BLIA 3WF2A 5F2LA 4XSLA 1UC4A 4C7GA 5EMJA 4G56A 2P0OA 3U7BA 4B5SA 4UR7A 4DEFA 5HMFA 1BWVA 4DNMA 4JN8A 5CKSA 2FJUB 1EF2A 4GH1A 1Q45A 2YL6A 2GJRA 1NWRA 2O56A 4LSBA 1YPIA 4LBSA 3DBPA 5BXRA 1AW1A 6REQA 3CZKA 3H21A 3KZSA 2E6DA 1EL3A 2PDQA 4RDWA 1YPFA 1NIUA 4UWMA 5M03A 1JCMP 4K39A 1J10A 2PDBA 3NQVA 3FJNA 4MDPA 3VFCA 3V1HA 3C8FA 2DT1A 1E55A 2XSBA 3B06A 5TAOA 3U8GA 4DJFA 1RA0A 1CENA 4MY8A 2QW5A 4D6GA 2OT1A 3G0SA 3U5UA 2VURA 4MUZA 3TZNA 4GC3A 4QM1A 1BXCA 2ZUMA 3PZUA 4JQ4A 4BF9A 3L68A 1K8ZA 3OODA 4DLMA 2G3FA 3EB4A 3VCRA 4K38A 1QNQA 1MUWA 2O9PA 4L6DA 2HK1A 1BKSA 2WNWA 5CCZA 2YW4A 2XN1A 3TK7A 4HNVA 3EX1A 4AY1A 2BS9A 3TTYA 1LCOA 1DTUA 5CG0A 4IP4A 1V6UA 3R7MA 4JHZA 2ACQA 4ZSTA 2OVLA 2PU0A 3VUSA 3ZWTA 3A9BA 2TPSA 3W6LA 3IJLA 4NZCA 3UPMA 4JTJA 3MJMA 1E4LA 2ZDSA 5CC3A 2QCCA 3N73A 3CV7A 4ACYA 4W7UA 3NVTA 1P1XA 2PP1A 3GU1A 4BF5A 3MBFA 1T96A 5E6ZA 4FX7A 4ZOBA 2VZUA 4WD0A 1LOQA 4GJJA 3IPWA 3EWZA 4YJ5A 2D3NA 5LIXX 4DBEA 1UQYA 1SUXA 1KBBA 2VGIA 1FVPA 1PV8A 3BJSA 3WNMA 1N8WA 5EU9A 2H90A 4OKDA 2JKAA 3H2MA 2PWUA 3T1GA 3CNYA 4RE4A 4RK8A 1LOSA 3ABZA 3UBPC 4ZQRA 4XWUA 4RE2A 4J5NA 2CLEA 5AN7A 1IF2A 3UJ2A 1G69A 5FJRA 2BGNE 3MCOA 4J1OA 5K3VA 4S3FA 1T40A 1KFJA 5HANA 5JXQA 2BLEA 1HIZA 1DWFM 1KFCA 3NQ8A 3CO8A 3WQEA 4PRRA 4G1NA 1WX0A 2WM1A 3IJDA 5HBFA 4PRTA 1PDYA 3O8AA 1I0DA 4GI9A 3GSMA 1XLEA 3GE7A 1RR2A 2VO5A 4DWSB 5LNRA 4O19A 4Z08A 3FW6A 3A5FA 2VZVA 4I9TA 4YIWA 4MB5A 2YBTA 1XISA 4HK7A 4PFHA 2MANA 3PY2A 4QDMA 4M29A 2CU0A 3GBDA 2PA6A 2PWVA 3SW6A 4L1XA 4DO7A 4HA3A 2F7FA 4PA8A 4P8VA 3M0ZA 3P5YA 5CPNA 1ZAIA 2CBIA 3QTGA 1XLGA 3C4UA 1FWTA 3QHNA 3WCZA 3UWYA 3DYPA 2RFGA 1XG3A 4L9ZA 4EOUA 4KRZA 3OA5A 3QMSA 4LVFA 2QUMA 4DN1A 1DWHM 4XAGA 4H8VA 2BV9A 2GJXA 3PNZA 3ZR4A 3FSUA 2ALRA 2VC5A 4C7DA 1QI3A 3HV9A 4B9ZA 3WIJA 4O18A 1I0BA 3EA3A 4DXVA 1GQIA 1E0WA 1FHVA 4GNJA 1EB3A 3GIQA 4DELA 1UG6A 1MQRA 3MUIA 1ZBWA 4PR4A 3OHMB 4LW7A 1QWKA 4GY7A 2QJJA 3ZM8A 2A3AA 1S5MA 4GNVA 2HPMA 1UR0A 5M5DA 4EF9A 1HG3A 4YCPA 2VQUA 5FEXA 1KKOA 1YW1A 1CCWB 1MO0A 4UMBA 1EC9A 3FXYA 3PC0A 3E2QA 3H4WA 3VNKA 1KRMA 4WK9A 4HVXA 4QISA 3CV2A 4S3KA 5TIMA 1C7TA 3ZXWA 4TV6A 3BWWA 1POKA 1KFKA 1QTWA 4N9DA 4FF5A 3G22A 2PD9A 2PLMA 3KL5A 1BQCA 2PE4A 3CBWA 3FA5A 1YBQB 3AISA 4Q8QA 1IT8A 5PTDA 3P93A 5CLTA 4N6FA 1U1JA 1H50A 1XC6A 2X1RA 2HVNA 4GZJA 1KV8A 3CPRA 4FS9A 3I65A 3KDOA 2XHYA 1SYTA 1UZ1A 1VENA 3ZLHA 2IKJA 3BAWA 5ECVA 3MMTA 3FCPA 5FSDC 4A8LA 4UNKA 1OFBA 3OP2A 5C9ZA 4HNUA 1XLCA 2YB4A 3M0HA 2DJLA 3WF0A 1T6MA 1R9XA 1GOMA 1OX6A 3OLEA 4XZBA 4Z17A 4MUPA 2C18A 3D6NA 4YHEA 4D2JA 3TEVA 4K7YA 3G3MA 2PWDA 1ICPA 4F48A 2ISDA 4ZSUA 4D8ZA 4DUVA 1JZ8A 3ALFA 1HQTA 2VELA 1HW6A 5CZKA 3TUUA 1QHPA 2YDQA 3MKVA 4EKJA 4ALDA 1OF8A 1EJTC 4NYYA 3NA8A 3NEHA 2H3BA 1F7BA 2W0UA 4YN5A 4LRTA 1ZJIA 3WK0A 5A6BD 4J35A 1F05A 5G2HA 1MNZA 2H8XA 3PZ9A 2NVCA 2QQ6A 3PG8A 1OCJA 2GPTA 2ZOXA 4WY0F 5KTLA 3VZXA 3DAQA 2C0HA 3MJYA 1CPUA 1OHLA 4HGXA 1DEDA 3LG3A 4L5ZA 1Y0EA 1JUBA 1FWJC 1CGYA 4MDOA 3UJRA 2FZBA 3G1VA 4H41A 1QASA 4DYJA 4HZ7A 4BI7A 2QF8A 4UMAA 1JPDX 1QNOA 1OFAA 3PZMA 1B3ZA 3BG5A 1ISXA 4NYUA 3T8LA 1RCXB 3FS2A 5A6SA 2VR5A 4J3SA 2TAAA 5DY3A 3VO0A 4NI8A 3LGEA 4MADA 2BHUA 2J9ZA 3MSGA 3PTKA 4IP5A 3IUIA 2W79A 1MRAA 3GQYA 3ZR6A 1C9DA 4ZTXA 5J8LA 2IKGA 1HZYA 1S2WA 4IP7A 5HPOA 1FWAC 1UCWA 3V16A 1IXOA 3N4FA 3M07A 5C2XA 5KSWA 2E9MA 4Z0JA 4B90A 2Z28A 1EC8A 5GNYA 3RCYA 4RV3A 3TNBA 3E1F1 1UR1A 3AC0A 4B4FA 3RPMA 5EFDA 3S0CA 1MUMA 3CZLA 1IR1A 3WMCA 2JIWA 3R25A 1XYZA 1MEIA 2V6AA 1XGZA 4J3WA 2FDMA 1SZEA 3GNDA 4E6MA 4FLQA 1HJVA 4S2BA 1UZ4A 1IEQA 3IGSA 3GKFA 1GVOA 2DSVA 4A2RA 1I75A 2VC6A 2V2CA 4PUJA 5ABTA 4PE8A 1ZALA 1E1CB 1SJBA 3TTSA 3L5LA 3OYZA 1DV7A 3RRAA 3AXXA 5LKYA 1XICA 4XVDA 2JGQA 3U5YA 4XZHA 3DECA 2WNZA 4LPCA 4G7FA 4L4PA 3MC5A 3MCMA 1G9HA 2Z1KA 2BWGA 3RCMA 3GUGA 3AZSA 3DBNA 3W9ZA 4DAFA 1W17A 1ZB5A 3JRKA 1C92A 3UPBA 2QGHA 3CTLA 3W82A 4GO9A 5HUPA 1A47A 1W1YA 2CYGA 3NYZA 3HPZA 4JTRA 2HBXA 4GYJA 3CYJA 5HNTA 2H9AA 1WAWA 4WGHA 3HJZA 4CCCA 2JF7A 4HA0A 5AYBA 4HMCA 5G1MA 4AZGA 2PC4A 4E3TA 1UH3A 2DZXA 1QI5A 1SZRA 1Q2SA 2ZCGA 5REQB 1X8CA 1UJQA 1EUAA 2CHOA 1MVYA 3GNOA 3RM8A 2DZBA 4I5RA 1BXNA 4KFPA 1GK8A 3WEZA 1E56A 2VC9A 1JUKA 1IWBA 1UBSA 4KGJA 3I7QA 4MWAA 1ZPTA 3EWUA 2DW6A 5XIMA 3O6AA 1OC7A 7A3HA 2DGAA 1Z69A 2G3MA 3ZSTA 1W9DM 3OLIA 1OC5A 1TJRA 2XINA 4AB4A 1DL3A 3FIGA 3QR0A 1YDNA 3RJXA 1DIEA 2WZIA 4XD5A 4C6MA 3I3BA 1TPUA 2ZC1A 5CBJA 2EO7A 4H9ZA 4J3VA 5DFAA 4FOUA 4KWSA 5LNVA 4Y9OA 1AQ0A 2NSOA 4W5UA 4H9XA 4QAIA 4YHGA 2PDHA 3TYZA 1PSCA 1TZZA 1OFQA 3SCQA 5CGMA 3VIOA 3VIPA 1XS2A 2I56A 3S1UA 2DIEA 3CHEA 1XSJA 5I3KA 4XD6A 1Q6CA 4BF7A 2NUXA 4CCDA 4UNIA 2D1ZA 2HXUA 3NQCA 2V67A 4QCEA 4TUFA 4YWSA 3UXKA 1ZU8A 3WLIA 1N55A 2WMGA 5HJYA 1R3TA 1RZMA 2Y63A 1H7XA 5DT7A 5FESA 1H60A 3K30A 3PBYA 4K7VA 1RPKA 1L2QA 1ECEA 4A21A 4GBUA 3ITGA 2C1GA 4ICNA 4L6HA 4Q4QA 1OCQA 5JH2A 3QY6A 3KHJA 2OWXA 2XZ7A 3HTWA 2Y61A 3B8UA 4D6HA 3TJLA 4EIVA 3KCLA 1RSCA 1AVAA 3FXGA 4W88A 4POCA 1GTHA 4C6EA 3ZJKA 3FJ4A 1MW1A 1EOMA 3SY1A 4MKSA 4I6KA 4DIAA 4F9DA 1UPPA 5E5CA 4E4UA 3V0TA 3BH4A 4O4WA 1H7RA 3QSRA 5FF3A 2ASHA 2HSAA 1BWKA 3WNPA 3W28A 1JF5A 2CW6A 2PTXA 4XKYB 2X0HA 4YTRA 4UTFA 3XINA 3NSXA 4B3KA 5G2IA 2JBMA 3PPFA 2WC3A 2X0YA 1K3UA 5AYIA 2A3BA 1LM1A 1WUFA 3GHRA 1ONRA 4H7VA 4JTCA 2FVMA 3AIUA 4KCUA 3WQCA 2V3GA 3PPHA 3S4TA 3WBEA 3BV7A 3VKCA 3B9AA 2ZTJA 3WENA 2HRWA 3H2OA 2QDGA 3GRIA 1ZNNA 5AYZA 2ZX8A 5FA5A 1E0TA 3EPMA 4DO5A 3N2CA 1BQGA 3SSJA 3UF9A 4J40A 4KCVA 1W3KA 3TN3A 3NURA 1UB3A 4ATLA 4AH7A 2E09A 4DI8A 2Z7GA 2HNEA 2YBVA 4NRRA 4ZTYA 3P3BA 2VHLA 3T44A 1GVRA 1GUVA 1OM0A 4GGHA 1E73M 1NDWA 3KWXA 2G97A 4CU8A 1JCYA 4DWDA 1Q6DA 3QC3A 2ZZ2A 2PTWA 5F4XA 2OLSA 2DIKA 5HA7A 3VKAA 2QKFA 4PFMA 1V8EA 1Y65A 3OU8A 2PLCA 3SCWA 2WPBA 3UERA 3B0VC 1QBAA 4D6DA 2INEA 2PF0A 4XAPA 3SCVA 5H1WA 4C6PA 3VD3A 4XAYA 2F6UA 3G18A 2OLHA 1H0GA 1PCKA 2QCDA 3NDOA 4WDUA 4EF8A 3C8NA 3MV01 3POHA 3WBYA 1RBLA 2WJEA 1J0YA 2C13A 2Z1XA 3ZMRA 4AD0A 1E6PA 3FEMA 1CB2A 1EBGA 2Q3RA 3VOHA 4Q6XA 3CAKA 1HUVA 1PBGA 1OFRA 3GXTA 4J3TA 2YCLA 2G96A 1PTAA 2UY2A 3AIVA 3STGA 2DZUA 5I2UA 5LYRA 2DU2A 4LX4A 4WCJA 2YLAA 2J27A 3T0DA 2YZ5A 5H8UA 3CO4A 1HKVA 5DF0A 1K8XA 2RGMA 4YVPA 3AYVA 2DW7A 1NWUA 3VIKA 2I9EA 3OG3A 3L4YA 3GXNA 1LTDA 5CJMA 3W1XA 2BP1A 4A8RA 3MCNA 4LU0A 1W37A 2VFHA 3VGFA 3IACA 4F0KA 4PMXA 1LLWA 3QSTA 1VH7A 3BAIA 4MOZA 5HJLA 5K4XA 3AYSA 4GRSA 4G7EB 4HPJA 3LHVA 1GG1A 4UQDA 3RDKA 4CKQA 4Z1DA 4OIFA 1EBHA 3GDMA 1CLKA 4H6KA 4M6UA 2HWGA 3D46A 2YDSA 5DELA 1RY8A 3LK6A 1GOXA 1ADDA 2BY2A 2BY0A 1YTDA 5HUOA 1PCWA 2BVDA 3A23A 1TMQA 4Q8MA 2RDUA 1ISYA 2FTYA 3LPPA 3VU2A 1UKOA 3EXSA 1OFOA 2TRSA 2INFA 3IJIA 3B9EA 3UR2A 1DXFA 5DRIA 2W3ZA 1WP6A 1KCLA 1VR6A 2TODA 3L5AA 2XU2A 6ALDA 4DJEC 4A35A 3VX0A 1JQVA 1YXYA 2OELA 2R1PA 1H3GA 2VOTA 2NX9A 1VFHA 1RH9A 4JTUA 2NQLA 5I79A 4R34A 4L65A 2X0SA 3L0KA 4JR5A 4WDXA 5TD4A 4HYWA 1O95A 3A4WA 1XDMA 2G50A 1A5BA 3L4XA 2YFOA 3W70A 1EX1A 1TUXA 3CV1A 4JNMA 3CUFA 5I3GA 2PD5A 4TX8A 3M64A 3WN6A 1W1ZA 1VIZA 2Z1BA 4J3UA 3U2CA 4KMQA 3D3AA 3M41A 4WJXA 3IJ8A 2HNHA 1TYGA 3WQWA 5E0CA 2C16A 2IKHA 3L4WA 1GGOA 4H19A 4JCLA 5EBUA 5F4WA 4NVTA 3OA3A 3ZS4A 2J62A 4AZCB 4C7FA 2NX3A 5KZEA 1XLHA 3EX6A 5DO8A 3A13A 1FFRA 2I1OA 5AZ0A 1MQPA 2F2HA 2POTA 3HB9A 4JQ2A 1KR1A 1CGXA 1NF7A 4IPJA 2V30A 4CD7A 4IPNB 4QQ3A 1LL6A 3NPWA 4F0RA 2DSWA 1F3EA 4KEZA 2BGSA 3HFYA 1O6IA 1XP3A 1QI4A 2XVPA 2CITA 3G8RA 3U48A 4HOXA 3UPWA 4HOWA 2XUCA 4R27A 1SFSA 2YYTA 3N18A 3F4CA 1G4SA 3NEVA 2FPVA 2Z1SA 1C3FA 1LLOA 2MNRA 3BSGA 3ES7A 4O1CA 3A24A 1CLVA 3QV8A 4Q7NA 4ZQNA 5BROA 4ML9A 4WSHA 3BAKA 2E6FA 2FPTA 4GIRA 4XK2A 4W5ZA 1LG1A 5FD0A 1VPYA 1KB3A 3P8IA 3H2EA 2J66A 5A6AA 4BWLC 2W61A 3PAJA 2XVLA 2Y7FA 4LEQA 2DQWA 1J0HA 1P4CA 4QS6A 3PTMA 5IFPA 1CNVA 2V5CA 4D9PA 3T6CA 2TSYA 1RVKA 3SIMA 3SCPA 1WDSA 2JEQA 2L5HA 3CXOA 4DXKA 3BLOA 1WO2A 1XG4A 1V0LA 5FL0A 2EQDA 2HCVA 4F40A 4GQRA 3AS2A 5AYYA 3BVJA 2DZTA 1U5VA 4JIIX 4PCNA 1R2RA 3WLSA 1EO7A 2PTYA 1JIBA 4GZEA 3B8IA 3W2KA 2ATSA 4AEOA 3HN3A 2J77A 2EG6A 3KTCA 1P6CA 3SUWA 4DZAA 4JX6A 1V6VA 3W75A 2VD9A 2BODX 4KWWA 3OBKA 5D2XA 3MDWA 2JKPA 2P3ZA 3HG5A 1NU5A 3FK4A 1NFPA 2PDKA 1YX1A 2OPJA 4R7WA 3UESA 1MMFA 4RV8A 4JKLA 3W1MA 3B0UX 3VKKA 1CECA 2QCHA 4NG3A 1UA7A 3NPVA 4HZ8A 5FIPA 3CIWA 4IMDA 2QV5A 3TE9A 3H53A 3UNTA 3LZ5A 3VMOA 1H5VA 3DYMA 4N02A 3VIHA 4MYXA 2CWNA 1UWQA 1JZ4A 4PB4A 2GGHA 2EJ1A 3IGHX 3MUY1 1ADOA 3EMQA 3QH2A 1QHOA 4QEEA 1AJ2A 5DEZA 3IUHA 5KINA 2VRKA 1Q6QA 2RDWA 1QAPA 4TVDA 1POJA 1PKNA 2XVKA 1EGVA 4L9YA 1KM6A 1E6XM 1UD5A 2RH9A 5H91A 1JGMA 4RJEA 2C1HA 3VKBA 4IQJA 4D1IA 1JCXA 3T40A 4PTNA 2X2YA 3I3DA 1BYAA 4S3CA 1S39A 4XZIA 4ZR8A 2FHBA 3MZ2A 3BMVA 1O5QA 2QLYA 3BOFA 4UTWA 4GYPA 4G8TA 3H2NA 3GWQA 3MI6A 2EG8A 1T5AA 1XFCA 1QW9A 3EDDA 2D0HA 3VNZA 1KBIA 4RZ5A 4MB4A 2OO0A 3LSCA 4CD8A 1S5NA 2ATMA 3O6DA 3K46A 4P5UA 4U4MA 1EIBA 1DPMA 4WXZA 4O52A 3H4GA 3H23A 2AL1A 1ITQA 1XD0A 4LCSA 3ZJ8A 1UD6A 2CKSA 4PUNA 3V4BA 3WYZA 4JKMA 3W1LA 3KP0A 4ATDA 3RPTA 4CD5A 4G9PA 1J0IA 2YZRA 4QGCA 1G67A 2ZXBA 1VRXA 1CXFA 3C0QA 3B3DA 1DTNA 1A3WA 1J0ZA 2VFIA 4Q6JA 1ME7A 2A3EA 5ABGA 3WQFA 3WZ0E 3PBUA 1NF0A 1U22A 1EQPA 4IT1A 2JFEX 1R47A 3W84A 3AU6A 4D71A 3LX9A 3WK1A 2LLEA 2XM2A 5A8OA 5D2TA 4YLWA 4AWEA 1W3HA 1OG0A 1P6BA 2QS8A 3LB0A 3EDJA 2WSQA 1DJQA 1TV7A 4IQDA 3W22A 3EKZA 1M3UA 3GG0A 3UY7A 1C90A 3HBLA 2O4QA 1P5BA 4AZ6A 3PZVA 1Q4NX 2QZRA 2UWFA 4NJIA 1SFLA 3VNJA 4O16A 4LALA 3THUA 1D3GA 1R6WA 3GTIA 2HDJA 1PVNA 3TP4A 3IUDA 1KGUA 5LIUX 3T42A 1AQFA 4ADSA 4IPPA 4IXHA 3QBUA 4ZFCA 3WFZA 1KGXA 1H51A 1UC5A 1EYWA 1V6YA 1XCFA 2A6LA 2XIIA 1UUQA 3B97A 4QITA 1B54A 4NX5A 5BW6A 1K77A 1R3QA 3HFTA 4GCAA 3D0CA 1W9XA 4Q4KA 2C7FA 1SQ7A 4W4QA 1QFEA 3UZZA 3O6CA 1K4GA 1I45A 2PAJA 1UD3A 3SB0A 2A7PA 1VC4A 3CQKA 3FNDA 3KOFA 4OV4A 3WQOA 2VR4A 4UTTA 4Q4MA 2WHKA 3PWIA 1TSIA 4DJED 4HHHA 3UCCA 4LYQA 4K1WA 4LANA 1PWMA 1R8LA 1WZAA 2WVTA 3AHYA 5F2GA 3WFAA 1OT1A 4ZL1A 3GNXA 1MZHA 3VVGA 1BFNA 3TW9A 3N3MA 1NARA 4TQTA 2A2IA 4TOQA 2R24A 5D2WA 4DI9A 3O1NA 3WBAA 3W01A 4NJKA 1JFXA 5AC8A 3HG3A 2YYUA 1H61A 3SRDA 4IIHA 1OT2A 1TQXA 4N7QA 1Z42A 4NQ1A 4JHMA 4HNCA 5DMLA 4U3AA 3U2ZA 2PMQA 2ESCA 2ZUWA 2BNJA 8CGTA 3VD7A 5IDZA 1XRSA 1AW5A 2CHRA 4GC4A 2P1FA 3BXWA 3SECA 3W71A 3F03K 4LAOA 4R9XA 3SQLA 3WQPA 4C6DA 1WKFA 3UCQA 3SFKA 2MUCA 2XIMA 5AHLA 2FLIA 1NM9A 4PBFA 5GPRA 1T8QA 4MZ8A 1JYXA 3VD4A 1OCNA 2QAFA 2DY3A 3QY7A 5BU9A 3TYEA 2P8BA 2ZFAA 1JDEA 3VOGA 2R6OA 4AF0B 2GVJA 2ZZ4A 2GWGA 5A6KA 1HN1A 2G4JA 4Q8OA 3AIQA 2OCZA 2NX1A 3BSHA 3THCA 2E5BA 1Q7MA 3O0KA 4FZIA 1UHVA 4FB7A 1XBYA 3FJ6A 4FA3A 2PRLA 4XBSA 1E40A 4GIYA 1FWDC 2QJHA 1WDWA 3ZR5A 4FMVA 4DBUA 3H22A 5JQ9A 1HTIA 3N25A 4FLOA 4MB3A 3GVVA 1TR1A 4QE5A 5A2CA 4XV0A 4LUJA 3D47A 1AZ2A 2W92A 4Q3MA 2VZTA 4O0QA 4WDWA 5EBAA 3GG7A 1RK6A 3S5OA 1K70A 3N3TA 2J9YA 3CT2A 2NQ5A 5FJIA 4DLFA 2A3LA 3A3XA 2C3ZA 3DXIA 1M65A 3KS6A 4D8AA 4HCHA 3AHTA 3ANUA 1G4PA 4D1JA 4EPEC 2ZRYA 3GH5A 4Y9AA 1WXZA 2AAAA 3FKKA 1CXIA 4C6NA 4IIDA 1B31A 3M16A 3POCA 5KZMA 4HSNA 2BASA 3AOFA 3AIRA 2ZC8A 1EJSC 4EWND 5G1YA 1XV8A 4ZGYA 4NIRA 5EYWA 1RA5A 1ZP4A 4R7OA 1W1B1 4I9AA 4O12A 4J3ZA 4OUEA 3UZWA 3WH6A 3BZGA 1P43A 2Q8LA 1F9CA 1PUDA 1UIOA 3NL2A 3TXZA 3AMGA 5LNUA 1XUUA 4G2DA 4HHLA 3DENA 3UG4A 5T26A 2V63A 4WJ8A 3W37A 5HQMA 3R10A 2WV8A 4FSAA 1Z8AA 4UZSA 3USBA 4NXKA 4CQCA 5H8MA 3WD3A 1NTHA 1X97A 2ZX9A 1K9FA 3RFAA 2NLYA 3GAKA 4LV4A 4FAMA 1HJUA 4LY4A 3W2MA 3I7RA 1ML1A 3EOUA 3MUZ1 3KFTA 3QTPA 1QNRA 3MO4A 2QJNA 1FWWA 4HYVA 4JZ5A 4R88A 3WDRA 5CGQA 5FJPA 1A4LA 1TV3A 3KOYA 3AHXA 3ITXA 4HPNA 5AFDA 2GUUA 1AA1B 5KZDA 4AC1X 1UH2A 3KLKA 4LTSA 1GKRA 5HR6A 2ONEA 3ZVIA 1EA9C 2WVSA 3KOXA 3RO6A 3DC8A 1BRLA 3VDAA 4WOQA 4MPQA 4XSMA 1T41A 3WLQA 2Z7KA 2VTFA 3L67A 1E15A 1TWSA 1FFQA 1Z7AA 3O07A 5E70A 2PDCA 1XQKA 4R7JA 4Q4SA 1W9BM 4CVUA 1NAL1 4KEUA 3W7HA 1LP6A 4QJ5B 4WR3A 2ZZ7A 2ACRA 3PZNA 3WF1A 3HJEA 1X8FA 2XWEA 5CAKA 4K8HA 4EAMA 3VXGA 4P7QA 3A4XA 3MWCA 2VXNA 1DJHA 2VKZG 4DJFC 3CYVA 4C65A 1EJUC 3UVIA 3HPSA 1P0EA 2ZUUA 1WKDA 2WJDA 3M0MA 2IPJA 3S2MA 1UUMA 5F2IA 2DZAA 3AICA 1KTCA 2VR2A 1B4EA 2NT0A 3ZWSA 1GWJA 4EVZA 3NAVA 3LS9A 4Z2IA 2X42A 1ELSA 4FXSA 5JBDA 3WSUA 4H7CA 4Q8VA 1G7UA 1VLWA 1QWGA 1EFZA 2ZRUA 1WOAA 4JFWA 3LLDA 3Q94A 1P48A 4H9MA 4K37A 1HL9A 4OECA 2WKLA 4E4PA 1QHZA 4MIMA 1VRDA 3AO0A 1PTGA 3KTSA 3M0IA 3UFYA 1GZGA 1H1YA 3A47A 2OJPA 2OGYA 3P7YA 2RJHA 5AZ1A 1XWYA 3PN8A 2GVGA 1M7OA 2WZMA 1JCJA 3CC1A 2YCIX 3M4HA 4D72A 2A79A 3DIPA 1UWSA 3N17A 2Y88A 3B0PA 3GFZA 3AS1A 4B2DA 2W66A 3AJ7A 2CLHA 1RP8A 3NR0A 1U83A 3WX7A 1RBAA 4M6VA 2GK1A 1FX6A 1LRNA 1QPRA 1BXBA 1R87A 1TPDA 3NQ7A 3N34A 4PODA 1NOFA 3P74A 5DCDA 1FDYA 2XZ9A 3CJPA 1MQQA 5FF2A 5E0KA 3TTQA 5MKGA 1R7AA 1LWJA 4BQ3A 2VEIA 1W9PA 2ZRVA 4DM2A 1VJSA 1LUCA 3MYPA 4NRSA 4DWSA 3BK0A 3NG3A 1E9LA 1ZAHA 2OQHA 1SZNA 1XXXA 3K2GA 3LLXA 1W3IA 2OU4A 3BO9A 5HNNA 3GW0A 4W86A 3ZT5A 4H8HA 1X98A 4JXCA 1EIXA 2Z26A 1XIMA 3G0XA 4FIQA 2OXNA 1SGJA 1ZBKA 2ODOA 2VEPA 3RLVA 1L9WA 2ZTKA 1I9CB 2PGFA 4F2TA 4BKNA 2TYSA 5MF5A 2YXXA 2BMBA 3TOPA 4PTVA 4JL2A 1US3A 2PEVA 3PUGA 2VX5A 4UQEA 2V2DA 2F61A 3LU2A 1HJWA 1UASA 3GY1A 1F76A 3GKAA 4JNZA 3JW7A 1DWAM 4IX0A 2J7BA 1SZFA 1GVFA 2W5FA 1U2YA 4JTLA 1GVYA 4KF1A 3S2NA 4J2PA 3W7OA 1B3OA 1EC7A 5ENLA 2W91A 4DBDA 3R5EA 3QZEA 2QYGA 1JUEA 3AZTA 1ZJBA 4R85A 3QW4B 4B5WA 4AIOA 2FIQA 3O63A 3WLMA 3GW3A 3TXVA 2B7QA 1KQYA 2YXOA 2ZUVA 3I3EA 1YEYA 1QUMA 3G1SA 1N8IA 3KE0A 1EWEA 2XFRA 6TIMA 1WZMA 3CL6A 1D3CA 4FLRA 1A5KC 4GVIA 1A3HA 5A8GA 2EKCA 4KWOA 3T7VA 4H6QA 2VFGA 1BYCA 3CUGA 4P8UA 1YXDA 4U28A 4PTXA 4S3EA 1H62A 3M43A 2PGRA 4W85A 1ITUA 2VUYA 3DI1A 6TAAA 4UCGA 4DBSA 2EG7A 4A8NA 1VJIA 3BC9A 3CZJA 4FNQA 3N14A 1EGZA 4DF2A 1J5TA 3WQDA 3VE7A 1EKOA 1EGMA 4ERAA 3WK2A 1NOWA 2CESA 5JBFA 1H1NA 4QLJA 4XB3A 4GFSA 4FOKA 4NILA 2GLKA 3O3RA 4TU1A 1W1TA 3KBVA 3CMFA 3ALGA 1EYEA 1C7SA 4ZB0A 2GUYA 1AUSL 3NO1A 4O1EA 4AY8A 3K8KA 3TAOA 5A8QA 4A2SA 1VFTA 4UTJA 4GKLA 2VNCA 2ZA3A 3NM1A 3PF3A 2V3EA 3TAKA 3FGCA 4U3CA 4YMZA 3RAOA 1CGUA 4XZWA 2BOGX 4AD1A 1MYRA 4KEVA 5JBEA 3CL7A 1HO1A 3C2OA 1TTQA 1P6WA 2JALA 2OO6A 3R94A 3I7SA 2WLZA 3MW7A 3II1A 3RPDA 4RE0A 3NVDA 2HMCA 3R1ZA 3XIMA 2Y89A 4RNIA 2AMXA 4JTGA 3IGUA 3UNDA 1ITXA 3B9DA 3EB3A 1NWTA 4WKFA 3BE7A 3CMGA 3GDBA 4PMYA 1FXPA 5CC6A 1XYMA 3R0DA 3FSTA 1V03A 2HE5A 1V79A 1S2VA 4KT2A 1BEUA 3IAQA 2VX7A 4IGMA 1FOBA 1AW2A 4QNEA 1FWEC 1ZCCA 4YTQA 1X7FA 4O13A 1WOBA 3PHAA 4F0LA 3MHUA 3MWAA 2EXOA 4BI5A 5I07A 3PZIA 2HXTA 3GYEA 3PG9A 2AKMA 3F4NA 4INFA 2XFWA 1LOLA 2WHMA 3L4VA 1SPQA 3LNMA 2HQAA 3EKGA 3SGZA 3VMPA 1M9HA 4JPGA 4Z1CA 4M0XA 4GUIA 2Y7GA 5LA2A 4I90A 2NWSA 1GEHA 3DDMA 1OADA 2D69A 2NXGA 4GCXA 4RUBA 4W7WA 5GJPA 2C19A 1EHNA 2PRMA 3M6YA 3UG3A 3S1VA 4LS2A 4QDWA 3WJXA 4HZ6A 2O55A 5AY7A 1C8YA 3N2TA 1FWBC 3W2JA 1E5NA 3TSBA 3UU0A 1E70M 2C8NA 3QQ1A 4GVFA 3L4ZA 1C8VA 1TUFA 3SUUA 2Q8ZA 3TQPA 2Y7EA 3ATZA 4DJFD 2FGZA 1ZGDA 2OKTA 4GXWA 4QLKA 4ZEPA 4PUMA 1L6FA 1G6CA 2Z6IA 1R9YA 4U33A 2Q3OA 1X39A 1BSLA 1K7EA 2QNEA 3BL3A 1BF2A 3C61A 3KXQA 1H09A 2P53A 2D23A 2YIHA 3LY0A 3PZTA 3M47A 1TV2A 1E1CA 4XG1A 1AQMA 2D3LA 3F4DA 3K1DA 3LPGA 4OE7A 5K4ZA 3N1AA 1WDRA 3FX4A 2OSYA 1A0CA 1C91A 3VM5A 3V1PA 1AL8A 4QG8A 3WLKX 3UXAA 2YLLA 1TFVA 3HQPA 4CU6A 2HBVA 2J8TA 1OIFA 3A3HA 1VQTA 3N6HA 1XDLA 2RDTA 4JN7A 1UP2A 2Z1WA 4H9VA 2WW5A 5A94A 1TPB1 5M1TA 4GJIA 1Z89A 4M1RA 3UWQA 2NV2A 1XX1A 4O10A 3A4AA 4DY1A 2CBJA 2Y4SA 4OU1A 2NVAA 5C5YA 9XIAA 3WMLA 1OCBA 4HKPA 4RR4A 2XN2A 4BHYA 2YJQA 4HCLA 2WSYA 4MTVA 2B0MA 4WY0B 4HYRA 3M9YA 1EJ7L 2GJNA 4WKAA 4A8IA 1FWSA 5DANA 3WH8A 1YTEA 5GJNA 4NKCA 2GOUA 1DIDA 3SADA 5I09A 2AOSA 3CAWA 4XUGA 1PDZA 4IMAA 3BAJA 5BXSA 4IJBA 3EB2A 2GJXB 4DO4A 2DZPA 4RPQA 4U2ZA 5C2CA 1FKXA 1GZJA 2OODA 3PBWA 1UZDA 4QSFA 1KR0A 3W1UA 4F9JA 2OZTA 1TWZA 4HZMA 3AMKA 4B3ZA 4ATWA 1F6YA 2P88A 2WYSA 3IJ7A 3GYCA 4PCSA 3S6DA 3KX6A 3TW7A 2OWWA 3A21A 1O12A 3MVIA 1TCMA 4AZ7A 1PPIA 5A8PA 4MWAC 3TYCA 2OFJA 4EWJA 4Z2KA 2IQ0A 1IXQA 3P0WA 2NVDA 1YPXA 4JIEA 3QGAC 1OF6A 4NI3A 1FY6A 2YA1A 1XIBA 1YDYA 1WUEA 3DFTA 3MT1A 4CQBA 2BVYA 4AHPA 1W32A 3T0CA 2QPUA 4ZOCA 4Q8UA 1JCNA 2RUSA 3FAXA 4OV9A 5GQBA 2GJPA 3F2DA 2EJAA 3G6MA 1UR9A 4J2MA 2VEFA 3DESA 1RK5A 3W7PA 3RIKA 4ZZ9A 2VEMA 4KCWA 4FNSA 3SO7A 3WMSA 4LVAA 3UZ5A 2J75A 1V6TA 2RKXA 2CFFA 3N04A 4GQQA 3T08A 4GXMA 4B5XA 3RM4A 3ONBA 4C6JA 2DV0A 5HR7A 1TX0A 1XKYA 2E6YA 1B3WA 1P0BA 3BANA 4H04A 3SUVA 3GX9A 3TLQA 1EXBA 1RLCL 4DYKA 3WQGA 3L21A 2X1UA 3RO8A 1S1PA 2VMFA 5HMDA 5AC7A 3S47A 4JX4A 5AHFA 3URBA 3CHDA 2JQXA 2CZDA 1QBBA 4CD4A 3TCEA 3WBWA 4IMEA 1RQEA 1GHRA 1QT1A 4LY8A 2PS2A 3MPGA 1V93A 5TBOA 3WQ4A 1N7KA 2PU1A 1QRQA 2XDFA 5IOBA 4LC8A 3THDA 1EPVA 1E9IA 3LUTA 2GGJA 1FCBA 3QR3A 2D0GA 4PB5A 2WVVA 1UWAA 4QG9A 2AGKA 5D9MA 3W38A 2PC8A 2YL5A 2CLKA 1BVWA 3ATYA 1RXOB 3IARA 4Q32A 3CZEA 4LGXA 3AIWA 4FX8A 3ARTA 1DQXA 1ONWA 2OYLA 1CBGA 3OLGA 3UY8A 3NDZA 2E1DA 3GIYA 2ZXAA 4I9MA 2D2HA 2VDIA 4F0MA 4QAWA 1XRTA 2FZDA 2DZWA 1SJAA 1XM3A 3PZQA 4O17A 2O4MA 1QMLA 3RR4A 2VCAA 1JZ2A 2AAMA 3S83A 4EPDC 3N4EA 4IJCA 2DUAA 1H7NA 2WO5A 3WJSA 4JDBA 1XD1A 3H4XA 1A0DA 1KM3A 3S46A 1LRTA 1WKEA 2UZ9A 1XLAA 3H70A 1V02E 2J7HA 4BFAA 2G3NA 1A49A 1GT8A 1EDGA 5H2ZA 1QJWA 1OFPA 4UUIA 2PCQA 4ZVJA 1JXKA 4HU4A 3NO3A 4Y6GA 4PL1A 2BGQA 1R85A 1I2NA 1OZQA 3A9IA 5I7GA 3V35A 5B7ZA 3GK0A 4M7SA 3EZ4A 4ECLA 2D24A 1XLDA 1EUNA 4G7EA 3QPZA 3W72A 4GYFA 1WQ5A 3BICA 4URIA 1LG2A 2QJGA 2VWSA 3GZAA 1MDRA 4DPQA 4EXAA 4JEQA 4JFSA 2BZNA 4RZ4A 3ID7A 2GYIA 5MHBA 4CUCA 3OPSA 2X05A 1K02A 2PLKA 3W1TA 2VGGA 2C15A 3HMCA 4DQWA 1TJ1A 3NWRA 4AIUA 4Q8WA 3SCOA 1XBVA 2PBOA 4H9YA 3DCPA 1OWQA 3OIHA 7ODCA 4IGNA 1P1MA 1Q85A 2RGLA 3COTA 4JTQA 3MMUA 2P8CA 4LVDA 3V5CA 1E5JA 4JTDA 3EOOA 4X61A 3QGVA 5LXEA 3BLDA 3VNYA 3W00A 3EKLA 5C9XA 4XISA 4D8LA 4E3VA 3J7HA 4N9BA 5LA0A 4GY1A 1TV8A 1JR1A 2H9AB 4GXPA 2ON3A 3S5YA 2ICSA 3NQGA 2QJMA 4U31A 5HAOA 4DO6A 1W2VA 4PBGA 2I5IA 3MQTA 3C2EA 1K6AA 3QN3A 5EY5A 2NV1A 4PUEA 1O1HA 3R43A 4WSJA 4GVGA 2DDXA 5CPTA 3W7KA 1J8VA 2J7DA 2IXVA 3V5FA 1EXPA 4R33A 3W0KA 3EDFA 1XCXA 3H12A 4AISA 2PDLA 1EO5A 4DNHA 1GNXA 1O5KA 4NAEA 4HB7A 1V3JA 2CBVA 2ZVRA 4IXXA 3C86A 1Z32X 4X3ZA 1OK6A 4HN8A 1ICSA 3AUJA 4MWAB 4ERGA 5DCBA 1OFDA 2FQIA 5HDRA 3WD2A 4FR6A 3LCIA 3QQ0A 4BI6A 1N8FA 1F74A 4LVGA 3GXIA 1CXKA 2YB1A 4IJRA 1AQHA 1X96A 2ZQ0A 4AZIA 3UXIA 4KQNA 1NFBA 1J01A 1V51A 4XIMA 3PJXA 1HJXA 1GVQA 3AXKA 3GIPA 1ESWA 4CEUC 4NJJA 1M6JA 1Z41A 4GISA 3RR1A 2GQAA 3LHTA 1KLYA 2R1NA 3PWAA 2FTWA 4OOUA 1XIFA 2AQVA 3UXDA 4Y9NA 3TQ0A 4AZBA 1NVMA 1GQNA 3W25A 2V3DA 3E96A 1QU4A 5M3WA 1ZZMA 3TFCA 4GX8A 1GTEA 1ITCA 2QT3A 5A8MA 5KZ6A 1X6UA 3KBNA 1WDQA 2HS8A 1YIXA 1HL8A 4P7RA 3T81A 5CPSA 4YVXA 4QIUA 1JD9A 4UQCA 2QR6A 1AJ0A 4LUTA 3E02A 4MZYA 3WLOA 4OJYA 2CNCA 3B04A 3FEQA 4WF7A 1SW7A 2O7SA 2YFNA 4UFJA 4MWAD 3ZLFA 1WBHA 1SU5A 3G8EA 4NAFB 1MW2A 1TZ9A 4GBDA 3MBDA 4O57A 1TV5A 3W7EA 4C1NB 2I57A 1ONXA 3HGJA 1Q6OA 1QOQA 4YTUA 4AIEA 1W9VA 2Y2WA 7CGTA 4O50A 2ZRXA 2J25A 1YYAA 3NQMA 4X22A 3EWWA 1O5XA 3MTWA 3LRKA 1P7TB 3W73A 2Z6JA 2Q02A 4MF4A 1IXNA 3G1RA 2ALDA 1QOPA 4MNMA 5HQEA 4RDZA 9CGTA 1CX9A 1YE6A 7XIMA 3EOLA 1HFBA 3U7VA 3W74A 3LGDA 5FAJA 2O7QA 3KUMA 4AC7C 2X41A 4B5NA 3PUOA 3VPLA 3E0LA 2A5HA 4RDVA 1BGGA 2J88A 4ZENA 4Y2WA 2GJLA 1DJIA 4MJ4A 3TQKA 1E72M 2EEXA 3B9OA 1KWKA 4KETA 2GWNA 3AFBA 4HHPA 4H6RA 4U2YA 3HPXA 1J0JA 1JYNA 1M53A 1SO6A 2WHLA 3LBOA 3BMWA 1MRQA 5CAHA 2NQ9A 3DKLA 1T8XA 4MNLA 5HWJA 3TFXA 2Z00A 3PFMA 5A1AA 3QQWA 3UCDA 3ZJ7A 4O14A 4BQ4A 3L2LA 3LLFA 3ELFA 1FH9A 5D32A 1B9ZA 1I2RA 1MFUA 4HU8A 4FI4A 1H2JA 3N29A 3TZFA 2QCDB 4AUBA 4IIFA 1XIIA 4AHQA 2QUTA 2VM8A 4CNSA 1RJQA 3VDGA 3IVUA 2FH8A 3OZPA 4Q4RA 4DUXA 3NYDA 1I1WA 2QPSA 4LNCA 1EEXA 4RX0A 3GBEA 5LIKX 3EX2A 4IM4A 3AS0A 3SY8A 1GJWA 1VIWA 5EGRA 2XGBA 4G6CA 3TVAA 3ZVHB 2RHGA 2WQDA 4AW7A 4GYPC 4UFIA 5E6YA 3DH7A 3V5OA 3GDTA 5HATA 4QXIA 1Z48A 4KCTA 1IEXA 1G7VA 5DN1A 1GPWA 1GORA 3S1XA 1H49A 5CPQA 3NL5A 5L6UA 3SRFA 3KBWA 4XD3A 3UZYA 2VC7A 3OGRA 4CD6A 3SN0A 7REQA 2DORA 5FEZA 3HPFA 2G3IA 3W7NA 1BTCA 2ZADA 5DMNA 1CXHA 1DXEA 1GW1A 1ZLPA 3LENA 1LT7A 5CZTA 5HK4A 4F4RA 5L9FA 4KFNA 2CLPA 3WLTA 4M82A 3W7LA 1W3TA 3ZSSA 1XDJA 4JTAA 4Z1BA 2W67A 1MXGA 5C9UA 2DEPA 1E6SM 3PS7A 4QJ1A 6PTDA 1SO3A 3HQNA 3T05A 4Z1AA 7TIMA 4OZOA 1JULA 4QG6A 4AEFA 4TO8A 4AZHA 5BRQA 4PYSA 3MO7A 5BNKA 3IRDA 3SEPA 4PMDA 5C7VA 1UBPC 3TSMA 1W1IE 3ARUA 2J8GA 4P2VA 1WNOA 2HJPA 4WDTA 1UMYA 4JICA 3C2RA 2OSWA 3A22A 3W2LA 2JEPA 2DSZA 1CGVA 4AWTA 2FVKA 4FNTA 1OVDA 3PTDA 3QHMA 3BLIA 1CYGA 2YPIA 5D37A 1IEVA 3KLLA 4O0KA 5A6TC 2UY5A 1U33A 1JJKA 2VCBA 3GXFA 1Z6KA 4JKKA 4J7RA 3MP4A 3IV8A 2CEQA 1PE1A 4ZXLA 4ZCWA 3W1QA 3VNMA 4PMOA 1TMLA 2XH7A 3KDNA 4OBSA 1DKWA 4QJ4B 1XHGA 1B1YA 2G5WA 1VS1A 5CBIA 5A5WA 3RLUA 2CZ5A 3UJEA 2DZSA 5KEZA 1HJSA 4GLEA 4H3DA 5I5RA 3FHQA 3NL6A 1UROA 1R7OA 3EWXA 3WH7A 1L6SA 1TWDA 3WL0A 2NW0A 5JMUA 3LMYA 4A3UA 3KVKA 2HVOA 4JOMA 5BOFA 5HPCA 2KZHA 2PODA 1N82A 3PFRA 4NY2A 2Z25A 2P0IA 4I9JA 1TRIA 2ZUNA 5BYWA 3CHFA 1UKSA 1FWHC 1TR9A 2PCEA 3B8DA 1F07A 2SFPA 2FZ9A 3FYPA 1J2WA 1ZJAA 3OGSA 1V5XA 3F5LA 4BWLA 1E0UA 4GQGA 1PO9A 1WAUA 1QK0A 1O60A 2GUBA 2E25A 1KXQA 1DBTA 1E4MM 2VEKA 4KESA 4UTTC 5I78A 4PCTA 1GQJA 1ZUAX 3R13A 3OZMA 5DY2A 5EB8A 4LFYA 3WKZA 4QCFA 3P2VA 2XSXA 3W7QA 3AMDA 3UXLA 5IBXA 1XYBA 4IG2B 1F4AA 4ZO8A 2WCGA 1Z44A 1Q63A 1ZRQA 1ZSXA 3EXRA 1IEWA 1JDFA 3C6CA 3QM3A 4UTHA 3VIFA 1JGIA 2ZX7A 4KRTA 3DGBA 3W76A 3E3HA 4C5ZA 3JVAA 3T9PA 1IGSA 4ORMA 5CG7A 5DRCA 4C6IA 4QP0A 2CC0A 4DM1A 3EEGA 3O6YX 2ZRZA 2QCMA 1OG6A 2H3DA 4L1GA 3DFPA 2GQ9A 1K6WA 1OD0A 3IK4A 4W93A 4KERA 1FCUA 3NQEA 2ZWYA 2B7PA 5T9BG 3N4AA 2VL4A 5AC6A 2PDFA 1YRRA 1JI1A 2A85A 4MHBA 3I4KA 3UGVA 3QW3A 5FJUA 1XIHA 2ZZ3A 4JQAA 4MNJA 4TTUA 1IIGA 1PL9A 4H8NA 1I1XA 1XPGA 2F8QA 4HTYA 3LTYA 4XKMA 3MUXA 4GVHA 3S5ZA 4TXEA 2YSWA 4TX9A 1PYMA 2UV8G 3NFUA 2WHJA 3LCWA 1MW0A 3MUCA 4O15A 5GNZA 3NTYA 3PJUA 1TG7A 2FHCA 3LHUA 5CSUA 3L4TA 1QNVA 5D4YA 3NZPA 2QUNA 3JZEA 3KZPA 3G1HA 3EWYA 1H4PA 5I00A 4GI6A 4S3JA 4Q8PA 2EPHA 1NP2A 1RBOB 5BRBA 1XIDA 4HPHA 1R5YA 3O16A 3P82A 4RNJA 1R9ZA 3REQB 5TNVA 1H11A 3EDKA 4ENLA 1L6WA 3E74A 1V77A 4XZ9A 5G4WA 3N15A 1R3SA 3IV3A 3APTA 4UFKA 3STCA 4I3GA 3U4FA 1W5MA 4DVOA 4HNTA 2OYKA 2YXGA 2RAGA 5C8BB 4OBRA 3C2VA 4GMEA 3MKKA 3OO2A 2TMDA 1DJYA 2Y1HA 4NX0A 4C6OA 4DYEA 3CZGA 3M7SA 4TV5A 4GUHA 2WMIB 3TOYA 3VI2A 1XSKA 2FHFA 1XIEA 4HCDA 5BOOA 4FO4A 1KWGA 2X7VA 1HL2A 3VX1A 1RD6A 3RCNA 2O0TA 1NEYA 2QCNA 2PZ0A 1REQB 2A0NA 5C9WA 3MB9A 2VP8A 3HQOA 5I3JA 3TYDA 4PEKA 2VFEA 1XLIA 1LL4A 3N6JA 5FF0A 4I6VA 1XF0A 4LUSA 2PWHA 1GKPA 4HPXA 4MY9A 4KGLA 4IMCA 1SSGA 3AMLA 1QVBA 1DIOA 3Q58A 1A5CA 5JH1A 3DUGA 5LXXA 3TC6A 4RXFA 3FV9A 1TPWA 2BXZA 3LERA 2GSEA 4AVFA 1HX0A 1AH4A 4DUWA 1VGAA 4JDYA 3OB8A 3W83A 2XPKA 1M5WA 2V68A 2DUZA 5I24A 3L66A 1E3XA 3AU2A 1FP8A 2QIWA 2WC7A 4XZLX 4ONVA 1EPXA 1K8YA 5T9CE 2YL9A 4PEEA 1QR7A 4JTTA 2ACSA 4IISA 4EP8C 4C6CA 2Y85A 1FH8A 1AJZA 4ZQCA 2ISWA 4H9TA 2WNNA 4CNNA 3KOWA 3W7GA 3TN4A 1V3IA 3DFOA 1KD0A 2YW3A 4FXRA 4M19A 2CLLA 5GVJA 1V3LA 2I17A 2PDXA 5D03A 1F8MA 4P7NA 4E0CA 4FR1A 1Z9AA 2UBPC 2B7OA 4HJFA 4XAZA 2OGJA 1GG0A 2BB0A 3TCSA 3EOEA 2G4FA 3PVFA 4UIOA 4QFUA 3L7RA 3G5EA 1F3XA 1XLMA 1RUSA 2DP3A 3TDFA 3W7DA 1D8CA 1LWIA 4Z1YA 2QCFA 3DYOA 2P3EA 2Y8KA 1BPLB 2AKZA 2WK2A 4AD2A 1A53A 3UQNA 3WO8A 3ZO9A 1JF6A 4DUOA 4PCPA 3TX9A 2QHAA 3VOIA 3UG5A 2XFYA 4OFCA 4E2OA 2VDHA 1UWRA 4P7LA 2XISA 4GINA 1K03A 4M7TA 3WNLA 1X38A 1S38A 1QO5A 1KRBC 5I23A 1LBMA 4IIEA 3H7UA 4MNKA 2J79A 4QX4A 3U2OA 4HSOA 3E49A 3U2EA 3VAVA 4Q7BA 3DHFA 2QCGA 4DB7A 1DYSA 2CLMA 3LXAA 2NSXA 1XCWA 3N12A 3PSVA 1OGGA 1K1DA 2OYMA 4GI4A 3WEOA 3NQ2A 4FLSA 4JTIA 1XJBA 5M2FX 5CLWA 4XZNX 5D2YA 1S1RA 3PR2A 4AX6A 1FRBA 1J96A 1QOXA 4GPNA 2PURA 1PEZA 3GTHA 1XC4A 1M7JA 1KM1A 1MNSA 2VD8A 4PUDA 1B90A 3OBAA 3CUJA 4PTWA 4S38A 3MP3A 4LAZA 3S1WA 3TYAA 4KEMA 2XYLA 1H41A 5LNWA 2E3ZA 3TROA 2FDSA 5DQPA 3HIJA 1VPQA 2HV5A 2QF7A 1ZBVA 4PZVA 5AHNA 4ERIA 1IIHA 4XVEA 3I4EA 2NV9A 4JS3A 3DEQA 3PJWA 3NZQA 3ZJ6A 3OGVA 3B8TA 3BZJA 3G0UA 1O66A 1DE6A 3EAUA 2Z24A 5FEWA 3AI0A 2YCEA 2PWFA 1O4UA 4L4OA 3UR8A 5E93A 4EE9A 4ZO9A 3NJ3A 3TR9A 4KIEA 3N11A 3PBMA 5LGXA 4QS5A 3S1GA 2XN0A 3N2XA 1TA3B 1IZCA 3ICJA 5CPMA 4XZMX 5CZ0A 1IZJA 3AIBA 4CVWA 4N9CA 1SR9A 4HA4A 8RUCA 3GUWA 5I02A 2R9RA 5BRPA 4MG4A 3EGJA 4MKNA 3SDOA 1DE5A 4DWSC 2PDIA 3QC0A 2CBUA 1XSIA 1XYFA 4IFRA 1J5SA 4EX4A 5AHEA 2CCRA 5H6HA 5G4EA 1PZ3A 3SCSA 5FL1A 1UUOA 3VABA 2WMKA 1ISZA 4REQA 3WMBA 4TVUA 3ZIZA 5E9AA 4NZ4A 7PTDA 5I03A 1YNQA 2WANA 3JS3A 3GB6A 1V3KA 3BARA 4K6AA 3M0YA 3AJXA 2GGIA 5D9NA 4ZQPA 5F1VA 3DX5A 1W8SA 5A95A 4JGDA 4U5IA 1UOZA 3BSMA 3LCHA 5D04C 2Y8VA 1UD4A 2GZXA 2C0AA 4A3HA 4D6FA 4JL1A 1WBJA 4TX6A 3VZZA 3RG6A 1EQCA 2D0FA 3B0XA 1M01A 3RN6A 3S6TA 4KFOA 5CGTA 2WM0A 4A3QA 1CGWA 1O5RA 1OX4B 3VILA 2DPEA 1VBRA 3R8HA 4KPLA 4E2BA 4US6A 3K8LA 2ISFA 3OQEA 3E38A 2W27A 2IXUA 1BGAA 3W1NA 1T99A 4K2SA 4WRHA 5DXYA 1G0CA 1JD7A 5LIWX 1UWTA 4O53A 1M03A 4NT0A 1VB9A 2NXHA 2ZE3A 2YGYA 5BWAA 5FKYA 3IVTA 4GABA 4AD5A 1UJPA 4L7ZA 3KCOA 2A7NA 1GW9A 1VAHA 1PB0A 3LEPA 4AWSA 1XRVA 4HMEA 2JK2A 2FZMA 4IPLA 3AAMA 5CZJA 3VKJA 3CIXA 2NLIA 4QLLA 2XWDA 3P80A 2E9BA 1Q6EA 5E09A 4H6EA 3TMLA 4WJEA 1KFLA 3MHFA 2ZA1A 2I7GA 3E6EA 4GK8A 2XTKA 3L12A 3KM8A 2VJXA 3LNPA 4GO8A 4LT9A 3LHWA 4GD0A 3QOKA 1V3HA 3ITVA 3LM3A 1KV5A 3U3HA 2YDAA 1GJPA 3UWEA 4UTKA 2B31A 3BJTA 3PWGA 2O9OA 5IHSA 3LGGA 3RX3A 4UTLA 4Z2LA 4DF0A 3USZA 1XGEA 1IZKA 5IFTA 2EPNA 3IS4A 2QDDA 1K8CA 5I3HA 3VFLA 3BLKA 3UW6A 3TYUA 3HA1A 2NQJA 2GDQA 1CDGA 4LV9A 1KM5A 1UD8A 1GHSA 3DFNA 2GL5A 1BRLB 5J5RA 1US2A 4W7VA 5DX7A 4CQ9A 1OYAA 4MMWA 2W6RA 2QULA 3LBCA 4RZ6A 1IR2A 1EZ2A 2PWGA 1PHQA 2XFFA 1FUYA 1A5UA 2CKRA 4ZB2A 3UWZA 3M5XA 3BGAA 1J18A 4DJDA 1ISWA 4I5XA 1U5HA 2WSPA 3FJLA 3VIMA 3SCRA 3WQ8A 4Q22A 1Q6LA 4D6CA 1EEPA 3LI1A 3NQ6A 1TJPA 5G4HC 2F6XA 1BVZA 3RNDA 4A6GA 2BXVA 4H9UA 3QV7A 1V0NA 2B7NA 4CU7A 4V1YA 2QDEA 1FWIC 5CC5A 3RYSA 2IPGA 3R4IA 2QVHA 1XLJA 1FCQA 1F6KA 3OBEA 3QYSA 1P0NA 2I5QA 2IW0A 3CM4A 4WQ6A 1GZ1A 4LOCA 5CZSA 5AHMA 2I14A 1MXSA 4K1GA 2X30A 4AD4A 1VF8A 3IJ6A 4Y90A 3NL3A 4P8XA 5LHEA 1TIMA 5EMUA 4S3BA 3NOEA 5B80A 1OD8A 3WQ6A 1DJZA 3T07A 1JEZA 3E9AA 1Q65A 3LM7A 1FHLA 5BCAA 3RU6A 1BVNP 3CPUA 3KEHA 1PHWA 2H8ZA 1JDCA 1JYVA 4AU0A 3NXFA 4RW3A 1WE5A 1WKYA 2FGBA 4JTKA 3VKDA 3WNNA 3GFXA 1KO0A 5EPDA 1ICQA 5HWMA 3W23A 5HNUA 3AROA 2REQB 2J7CA 1EOKA 1D3HA 2QV4A 4LH8A 1PX4A 4IPIA 4HA1A 3RXZA 1D9EA 1E3ZA 3IJQA 1Y5WA 3LZ3A 3UJFA 4NASA 3WY1A 4FNUA 5AVHA 1DJXA 1B3XA 3LQLA 4R3UA 4ZB5A 4DXXA 3L5MA 1W1PA 3F5JA 4QRNA 3WUGA 1NY1A 1TJ0A 1UP0A 2OZ3A 1VCVA 3APGA 3W81A 4MFDA 4PH6A 2GK1B 2XM1A 4X0VA 3TWBA 1TX2A 4UB9A 3LA4A 3SCNA 3FKRA 4QROA 3IVSA 3LPFA 1F5ZA 4LYPA 2OZ0A 1NJJA 4K3ZA 5MKGB 1XL9A 4GX9A 3VUPA 3URAA 1LUCB 2HTMA 3W6MA 1J4EA 3DG3A 4JHOA 5LA1A 1KXVA 1H1ZA 3FFSA 2OX4A 2OOGA 4JCMA 3UT0A 4FK9A 4US5A 2PGWA 4QQUA 3LDVA 3LTPA 3CIVA 2Y70A 4WY0A 3O15A 2E7FA 3TKFA 1JPMA 3FY1A 4IFKA 1KLZA 1AMYA 3IIVA 1YE4A 3QZAA 1UR3M 4WHBA 2CXGA 4FX6M 1GYNA 2ZVIA 3B40A 3Q45A 5E0FA 1RJPA 3C3UA 2J8FA 1R2TA 3T4WA 2E8YA 2PDJA 3PTQA 3R0UA 5A6LA 1KFEA 3S3GA 1MUCA 3GR4A 1TRDA 2F38A 3HF3A 2IKIA 4JTHA 4NL1A 1JXJA 4C6KA 2FH6A 3T09A 3ARWA 2QCEA 1JG9A 2DSUA 4NU7A 1ISVA 4Q33A 4AVNA 3JR2A 3ZYZA 4F8XA 3GNNA 4B2DD 4IICA 3WLPA 4W8LA 4LQ1A 4PMJA 4GIEA 1OGSA 3TJXA 3BCFA 1JRBA 3P6LA 7TAAA 3WD4A 3HGOA 1H7PA 1L6GA 2V2HA 3Q65A 5FEPA 2RDXA 1EH9A 1C8QA 4XTDA 3N2MA 1M04A 2G41A 4RNFA 1PZ1A 2V3FA 1TZ7A 1TPEA 3GC4A 4DWSD 3SAZA 1CZ1A 1Q6GA 3LCXA 3CQIA 3AMCA 3AZRA 3TNOA 4TR9A 4YS1A 3S2LA 1SO5A 5FF4A 4IH3A 1NDZA 1EDQA 1THFD 3TN5A 1VKFA 3GH4A 3GR7A 1SW3A 3C2FA 3NSMA 2FPYA 3IWPA 2WMFA 2PRHA 2EGZA 5T8GA 4XIAA 1I8JA 1UKPA 2E6AA 2J4GA 4AHOA 1IXPA 3W6YA 4E8GA 1RP9A 1W5PA 4H01A 4MGGA 3O06A 3CZ8A 3CUIA 3IGXA 1PZ0A 1OK4A 1CEOA 1TPH1 2HVMA 3RMEA 2ACUA 5I06A 3HMJG 2VOMA 3SJNA 2DIJA 1XH0A 2INZA 4W8AA 3UZJA 3MUAA 1TCDA 3URNA 1UH4A 1NH6A 4P61A 2QIIA 4CLMA 5XIAA 2WOQA 2WJZA 4YWIA 4AD3A 2X1TA 4XO6A 3PM6A 3GAYA 3ITTA 3SN1A 4J28A 1YHTA 3ISIX 3AYRA 2GGGA 3RX2A 1R46A 3WDJA 2O92A 4L9XA 4PUKA 3WEMA 3FGCB 1ODZA 1J6OA 1R0MA 4LS0A 4ACZA 1OYBA 1S46A 5C6MA 1XGDA 3ECQA 5CSYA 1RPXA 1UMLA 1Q7QA 4GUFA 1GVSA 4V33A 4H8UA 3EMZA 3WLHA 1O94A 4UOZA 1FA2A 3ZT6A 3ARXA 2GSJA 3S2JA 3TH6A 1PIFA 4JTSA 3WLLA 3EBVA 1UP3A 3ITYA 1XBZA 3QY8A 4DF1A 2NUWA 1S3HA 3NQBA 1OIMA 1VCFA 1TTJA 3QPYA 3R11A 4GE8A 4IHCA 4DPPA 2ZZ5A 3OVPA 4IL0A 3W02A 4HNOA 4HSHA 2C1IA 3TC7A 5AC4A 4M6PA 4YTTA 4KWUA 4H2HA 2WLYA 4X9YA 3BJFA 3MHGA 3VOJA 5ABFB 4QTGA 2PTDA 2G3JA 1GONA 4PSRA 2VVNA 3GS6A 3MANA 4A4AA 4TMCA 5BXPA 3MYOA 4S39A 1WXYA 4FXFA 7ENLA 2YBUA 3TMQA 2WCSA 3TA9A 2A1YA 3WNOA 4GOAA 3LV6A 1PX3A 2QXWA 3LXBA 3G1DA 4QNWA 2Z1VA 4ZOAA 5CPOA 3TSDA 1W5QA 3QFWA 1KC7A 4BEUA 2IQDA 3GTNA 5DBTA 2EHHA 5CSRA 2OZ8A 3PANA 1OBAA 2ZIDA 4HU0A 1W5NA 2J7GA 4M80A 2OWCA 3KBMA 1BHGA 1G01A 1ZAJA 2AL2B 3F1QA 3VYLA 3L4UA 4BK9A 1WZLA 5CJNA 3W7MA 1AH0A 3PUDA 3W26A 3IIXA 1U1HA 4YNGA 3OZOA 4AG0A 3L0NA 4AWUA 1Z3NA 3KCJA 1LZOA 2V81A 3UYIA 3E12A 2F9RA 1O7AA 1OGBA 3AXIA 3VGGA 3CLMA 3UWVA 4NJHA 4WOZA 4O28A 4MY1A 5K2ZA 1VFMA 3DC0A 2BG5A 4J27A 3VIIA 1R2SA 3B8VA 3SJ3A 1AH3A 4MWAE 2P50A 3M44A 2AQOA 2E67A 4HK5A 3GXMA 4AX7A 2HK0A 4MKVA 5FACA 3VC6A 3NNTA 3HO8A 4MAVA 2CZEA 1OY0A 1X7IA 5IDIA 3OG2A 3S42A 3WK3A 1TJ2A 1IT7A 3N19B 1ZJHA 4LB4A 3WJWA 1E9ZB 3MDUA 3U57A 3GD6A 2VUNA 1JAEA 3NQFA 1HKIA 2PDMA 1FWGC 2DH3A 3UA4A 3IIPA 3F4VA 4JAWA 1GOIA 3O0FA 4U10A 4W8BA 4IWWA 3RLHA 1HP4A 3V18A 4WXYA 4K68A 4KH2A 1JL8A 5DBUA 1OINA 3P0XA 4ZO7A 8TIMA 2C71A 4GZIA 4EANA 2VYOA 3H55A 1BWLA 4B9YA 3MP5A 2XVGA 2E28A 3WBXA 4QR6A 4UZUA 1GQLA 4BQ2A 3EMCA 3O7UA 1UOKA 3H6OA 1AG1O 4J4KA 5HQLA 2A6NA 4CCEA 2WXDM 3NOYA 2CLFA 1UPMB 3R2GA 3HGRA 4WSKA 2CZFA 1JRCA 3BW4A 1BTMA 1GOWA 3WF4A 4IMGA 1TE6A 1E71M 2BTMA 3B05A 4YCOA 3GM8A 2PF8A 3AQUA 3KW3A 2Q71A 4M51A 3R89A 2E5DA 1BD0A 4YXGA 4JEJA 3S9ZA 1G4TA 1PIIA 1LQ2A 2IS7A 1VBHA 2PSNA 1MZRA 2JIEA 3KRBA 3VCNA 1JZ7A 4UMCA 1OEPA 5BU6A 3RGTA 3S2CA 4Q4PA 1SMDA 2I9UA 5C55A 1Q13A 4I7WA 1H5YA 3QLLA 3N9KA 3KRSA 3BCDA 4LS1A 4H1ZA 2D2GA 1UYQA 1F3WA 2J7EA 2V5KA 2O9TA 2ISVA 2PI6A 4GG9A 3LHZA 1IEIA 1CTNA 1RD5A 1WCGA 3VGBA 3TC3A 4Z2HA 1FDZA 4IX2A 1XBXA 1EP1A 4BY3A 3L65A 2GVYA 5B7YA 3LV5A 1M7XA 5J04A 5HINA 4DZ5A 3SRKA 4HNLA 3MU7A 3VM7A 5CEWA 4X2RA 1SVDA 1S2TA 3PPGA 2NQZA 1B9BA 4RNHA 2Y6ZA 3B4UA 2WB5A 3EWDA 1JDDA 1TV4A 4S3DA 4BCEA 5BXTA 2JE8A 4LVBA 3TN6A 4Y8EA 4LC6A 3V0UA 2DT3A 1SO4A 4NAFA 2JKEA 1ENUA 1HKWA 3GG1A 5C71A 4C1NA 3LCLA 3DZ1A 3YPIA 1DORA 3QGKC 3FDGA 2OT0A 2OB3A 3LHYA 3JUGA 4GQBA 5TQLA 2E9LA 3VINA 4H83A 3T0AA 3K4WA 2E4TA 1XKJA 4HMNA 2R14A 1P7TA 3H2FA 4OVXA 4MLJA 3PK7A 3R79A 3RJYA 4Z2GA 1B57A 1DJGA 3SY5A 1JPHA 5A69A 4JQ3A 2PP3A 3STPA 2OEJA 2YDRA 4C1KA 4AEEA 2FYMA 4IMFA 3GHSA 5LNSA 5G1TA 3QEZA 2BFGA 2GFTA 3P60A 2I5GA 2GDVA 4OBTA 1KRCC 3FYYA 1L8NA 1WDDA 4JYDA 3KHDA 4ZMGA 4LUIA 1ADSA 2WVVB 3K5XA 2G37A 3BG9A 1UWIA 4PB3A 1H7OA 1GPFA 4A22A 4IF2A 5BMXA 3WQ5A 3T0TA 3F4WA 4CQ8A 4MSSA 1X1OA 2E8ZA 1FCVA 1KBJA 4N4PA 5FAGA 4AVOA 3S5NA 3EX3A 2PDPA 5A3HA 1A5SA 1U1UA 3BLEA 2KAUC 4WKHA 4HHMA 3VNLA 5EFFA 3M5ZA 4AQLA 1R3RA 4F66A 2ZWZA 4AIBA 2WZEA 2XIQA 3P61A 3A64A 1F8IA 5FJOA 4XD4A 5FCZA 4PBEA 3MMWA 3SN4A 5TF0A 1XRFA 3FOKA 4I8YA 4I7UA 2D2OA 2EPOA 1DJWA 2D22A 3PUEA 1QDSA 2AGTA 2ZXQA 3CEPA 3PBVA 3HOJA 3QVQA 3VDHA 3QHOA 3L23A 3BLFA 4LF2A 2PWEA 4EAYA 2PDYA 5EKYA 3NGFA 3CAVA 4WX2A 3ZVHA 1M1BA 4E38A 4DBWA 3K8MA 1DQWA 5C54A 4FPSA 1B3YA 3STEA 1L6YA 4YYCA 3VE9A 3ZLGA 3P8JA 2YCKX 3VTRA 1ZENA 4P8WA 1EJXC 1VEPA 4L4LA 1OZMA 3GVRA 4OQVA 3VGHA 2Q6ZA 5HULA 2W62A 1FHDA 2BY3A 3HV8A 5HOSA 3GG8A 3MA8A 1JZ5A 3QXBA 5D30A 1GVIA 4ICCX 4NNCA 4UR9A 5D09A 1MWOA 5A6BA 1CLXA 2NUYA 4EXQA 2BOFX 1Q3NA 2AMGA 2Z4GA 5FSEC 4UQAA 1FBAA 1VBGA 3LBMA 3VD9A 1YBQA 1TTPA 3CV6A 1CWYA 2Z0IA 2CZVA 1GQKA 1DVJA 3VCCA 3WJZA 3EWCA 3BOXA 4YVVA 2WBGA 2WC4A 3IAPA 3MKCA 1A5LC 4PMVA 1RV8A 4ZXOA 1IT0A 3QKEA 5C70A 1E0XA 1XI3A 1GYMA 1LBFA 3ABQA 5JUVA 2VCCA 2HEJA 3GU9A 4HQVA 4C6FA 2X1SA 1V6WA 5JU6A 4B5TA 3KRZA 1GJUA 3W2NA 3D5HA 3O2LA 5AVNA 5K9CA 4S23A 4CCZA 4UFHA 2VWTA 4O1DA 3GR8A 4JY8A 1XW8A 1P0KA 4O8AA 3GU2A 2OEMA 6REQB 4PMUA 4NAEB 3DHUA 5CJ5A 5I6SA 2FZNA 1XH1A 3NDYA 4LEFA 5K9XA 3FA4A 3CS2A 2YKKA 1A5MC 1PIGA 3R0KA 3UETA 3GVWA 3LYEA 2Y0FA 3S9IA 4FF7A 2WZTA 3LI0A 2G8ZA 1XQLA 1TE1A 3ANYA 4LYKA 4GIAA 3P14A 4B5VA 3CLWA 4MJ2A 4LNYA 3GTXA 1Q66A 4PN2A 4MLRA 1I60A 2X40A 4MFEA 1XLBA 1JCLA 3W7CA 3W4RA 3UZXA 3CEUA 4B4HA 1FWFC 5FJTA 1XYCA 1TB3A 2J6VA 1UR2A 2ZX6A 4A29A 3BOLA 3M0VA 3DI0A 2QMKA 2CWXA 3N6QA 1TWIA 4UQBA 4PSPA 1V7YA 4BS0A 1MW3A 4N2YA 2IMRA 1G4EA 5M17A 1S5WA 1OYCA 6XIMA 2J9XA 4PULA 4E2DA 1BYDA 3CUZA 2VRQA 4IG2A 4JIHA 2C6QA 4MB1A