1R4AA

Crystal structure of gtp-bound adp-ribosylation factor like protein 1 (arl1) and grip domain of golgin245 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
165
Chain Sequence
REMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTPSEMANALGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 1
publication title Structural basis for recruitment of GRIP domain golgin-245 by small GTPase Arl1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 52
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r4aA00
1E2IA 4FXPA 3L8ZA 3EASA 5K8UA 2W2TA 3VKGA 5L3RA 1FNMA 1Z6YA 1CR4A 2OXCA 2PMKA 3HYTA 4V0KA 1RFLA 4HZIA 1DADA 2AR7A 1G8HA 721PA 2F43B 4B3GA 5DO9A 1N5IA 3QPVA 4MYCA 1UDWA 1F2TA 2ZYTX 3NBXX 4PFSA 4A8JA 4B47A 1TNDA 1NP6A 3HU1A 4M9XA 3JVUA 4C0QC 1OW3B 4B2IA 1EXMA 3RDPA 1RZ3A 1HYQA 3GFPA 3QVVA 3PVSA 3QBTA 5B2ZA 3U61B 1GTVA 5E7IA 3LRPA 3TVDA 2P65A 1TU3A 2KI5A 4GSYA 4ILEA 4AYXA 5KDOA 1UDXA 3K0CC 1VCNA 2OHFA 4HUQA 4BGDA 2QRNA 1EX7A 3DOFA 2Z83A 1VYUA 3U2QA 1CJVC 3TSOA 1EGAA 3GJ5A 3X1WA 2FG5A 4UNPA 1OXTA 1DAEA 2JLQA 4JKIA 3AF0A 4LWZA 4ZDJA 5JWRA 2P6RA 1DTSA 1N5KA 4LHYA 4MKHA 3QPUA 3SJCA 4EFMA 2JLYA 2OUKA 1E4VA 2CEAA 1NVWQ 3B82A 4A2PA 3SJAA 1RVDA 1KHTA 3TAHA 4G5QA 1M7GA 4CF7A 2WTUA 2ERYA 2GK7A 3CR8A 3DMNA 4D6PA 4ITRC 2F9MA 3GLGE 1HT2E 4L8GA 3B7GA 4NCNA 4Q9JA 1LTQA 2Z6VA 5DLQC 3RWOA 1Q1EA 3T06B 4O25A 3OZXA 4I1UA 3PCRB 5DI3B 1JB1A 3VKHA 4CVNA 4JL5A 3B13B 2ZSFA 3SQWA 5C4MA 2QRZA 5DH9A 4DLSA 2ZTSA 4LOAA 1UADA 1S9DA 4M2LA 4DT1A 1E0AA 4A0RA 5KUTA 1U94A 3ZVMA 1E99A 2ODEA 4G1UC 4G5SA 1NY5A 4Q4LA 3LWNA 3A37A 3TQCA 4B43A 4BZQA 2ANCA 1BH2A 4WXRA 2ZR9A 3SBDA 3PUZA 3ADBA 2BM1A 2OAP1 2QP9X 4TSFA 3VU9A 1G16A 3W8NA 2EFDB 2ZJOA 1U0JA 3LA6A 3DMDA 2J59A 4HATA 4DDVA 5FL7D 3IBGA 4NHOA 1XEXB 1G18A 1IXZA 2CJWA 2ZI4A 2PZFA 1OXUA 1Z2AA 3W5JA 1E9AA 5L3SA 2EWVA 1PV4A 1J90A 3K1JA 4LYAA 2IWRA 1XRJA 4PHGA 5G3YA 2VRWA 3IPXA 3NTUA 4IVQA 3WNDA 2F1RA 3ZJYA 1UAAA 1AQUA 4QFMA 4DLXA 3AVVA 2PBRA 1YQTA 2V1XA 4B75A 1VKJA 4PHFA 2GXSA 3FHOA 1MH1A 4HDOB 5D3QA 3K0CA 2CHVA 4RCZA 1E9DA 5ELXA 3I3SR 1XCGB 3X1XA 3BH6A 1O87A 4IXNA 1XTKA 4Q7LA 5TY0A 4BRWA 1KDRA 4L4UA 4RD4A 3RS3A 1XMJA 1CLUA 2ZI7A 4NBSA 4LJAA 1J7KA 4UNNA 2BWJA 3SHFA 4D4JA 5KSYA 2W0SA 2BEJA 2P3SA 1XBTA 1II9A 2EFGA 4JIMA 4UJ5A 3C5HA 1KK0A 4DC9A 4FMCF 2BEKA 2DWPA 5GJBA 4KLZA 1S4QA 1Z5ZA 4KFUA 3B60A 4EQ6B 1N2CE 2QGZA 1K6MA 3T1VA 3PEUA 4A6XA 2FEOA 3TW8B 3LV8A 1U98A 2WIAA 1W7AA 2Q6TA 1XCMA 3AGQA 1JJ7A 3BFXA 1AK2A 5JECA 4D0GA 5K8LA 4JZKA 2RB4A 2ZVQX 4B6EA 2A5FA 2O8EA 5TDHA 3EZFA 2ZUDA 3BRWD 3KTAA 4TQUS 4BFUA 1W5SA 2L0XA 4PQRA 3KQLA 1XB2A 2NO6A 4BFWA 4CEJA 4HAXA 3CKLA 3IEVA 4GBMA 3BFKA 4WXPA 4II7A 1LW7A 2WIBA 3A1TA 1R0XA 1G7RA 4UQOA 1GSIA 4RD1A 2QL6A 1OXSC 3TKLA 3SYLA 3A1VA 3HU3A 2YWFA 3SR0A 2UKDA 3B9QA 1NJGA 1VHTA 1KJZA 3E70C 3CRRA 2WJYA 1IHUA 2GJAA 3MWLA 1XEFA 2XTNA 5DIFA 4OYHA 4TLBA 2FPLA 2IUSA 2BCGY 1JQLB 3QKRB 1QHNA 5FTKA 4A0HA 3PUVA 3SEAA 4F7WA 4U02A 4LHZA 2ZSDA 1IN4A 3AVTA 3K53A 4JSYA 3D8BA 3RS0A 2GDJA 1K8RA 4Q9HA 4P4TA 2GZDA 421PA 5AK0A 1II8B 2R6DA 2OO7A 1O3YA 4C7OA 2J0QA 4G5RA 1DAMA 2OZEA 3NDPA 1FTNA 1E3MA 1QBKC 3K70D 4KI0A 2W58A 3I8XA 4NCIA 1COWA 4A4DA 4EPTA 3FMPB 5F9HA 1G5TA 2KJQA 4LCBA 4IOKA 2QPOA 4H1VA 2GEDA 2ERXA 1X8JA 2VHCA 4KCGA 1F60A 4PZYA 3W8RA 3ZZUA 5FUWA 5DN6A 5IRCD 3RVBA 4U7DA 2GILA 3PV0A 1Z0FA 5SZIA 2ZQ5A 1OH5A 1FPMA 3QUSA 5EE9A 2XTZA 2QPAA 3QNUA 3NHBA 3SOPA 4ASUA 1W0JA 4GNKA 1CTQA 2DFKB 2WKRA 4JVSB 1W1WA 2ZS9A 1YR6A 2HXSA 4P0TA 4BFXA 5EZ6B 5TARA 5LD2B 4Z1MA 2H18A 4YDHB 3VQTA 521PA 4JS0A 2WHXA 3A1SA 3NHAA 2JGNA 4JVNA 4V0LA 3GD7A 1P2VA 1SULA 2EU8A 2FX3A 3CPEA 3EIEA 2QAGB 4POAA 4RZ2A 4G01B 1GOTA 1KOFA 1I4TD 2GESA 5E7MA 5D3MB 4KITB 2QE7A 4L9WA 2XZOA 1Q3TA 4IOJA 4DEXA 3EPKA 2YC2C 2GK6A 3L43A 1Q3HA 5JZVA 1N0UA 3A1UA 3KKPA 4JLBA 4MH0R 3QY0A 1E2LA 1OKKD 5EXTA 1JXOA 1E2PA 3OEEA 4NTZA 1HA3A 1ZU5A 1IOZA 3RLFA 1QHSA 2VHQA 3BH0A 2XEXA 4RD0A 1P5ZB 1OIWA 2HYDA 2OSBA 2AHOA 3NBZC 1RC8A 2IHYA 1Z63A 3RSLA 4TSFD 3CIOA 5FUVA 4HDQB 3TSZA 1OXVA 4AI6A 3NH9A 3BD9A 5CB8A 2IF2A 4H1UA 1TUEA 3U7FB 2PMDA 4DCUA 1KY3A 4AURA 4FMDB 1JJVA 4LJ9A 2G88A 1IBRA 3NDBB 3EIHA 1SXJD 3NKVA 3E2IA 2OLKA 1JR3A 1E2DA 5KTYA 1MRNA 2O8CA 3AQ4A 2BMEA 3WP0A 1SXJB 2QROA 4MRVA 1ONBA 3Q7QA 1DEKA 1FTSA 5J5CA 3AVYA 3M1IA 2OILA 4EKDA 4GI7A 2PJRA 1H8HA 2FE4A 1KAOA 3LX5A 2AFHE 2IL1A 3U7GA 4R9UC 1AKYA 4X8HA 5EP4A 3EA0A 4GDFA 2ZI9A 2C9OA 2A5JA 4QJ5A 4ZDIA 2B6HA 3Q5EA 2WV9A 3Q8XB 2ZAMA 2VHTA 4ZKEA 1JBKA 3PEVA 4JLPA 3PUXA 4KJZA 3ASZA 5GVRA 3QIAA 3V00A 4TMZA 1OFUX 2JEOA 5JMTA 5J40A 5F2EA 4ACAA 3RAPR 1YRBA 2QPTA 1Z83A 3THXA 5LB4A 3GLHA 4DZZA 3TH5A 3B1YA 3QOFA 1UBFA 1IXRC 1S0UA 1ZUIA 1HQYE 1XXHA 1UBCA 3U7EB 1KNXA 1TAGA 4M1MA 2IC5A 1SVKA 1VIAA 3A4MA 1YZTA 2JJ2A 3KJIA 4DRZA 3B1WA 1QF9A 4HLQB 4LV8B 2ZROA 3CO5A 4Q9IA 2BM0A 2ZI3A 1US8B 2AKAB 4HUTA 3THWA 4MKFA 5JJIA 2BJVA 4BFYA 4F91B 1ZUNB 4Z51A 3GCGA 5JHHB 2RGNC 3TBKA 4RFSB 4TTQA 2WJJA 1JR3E 3C4JA 1T6NA 1FX0A 1XTRA 4C0BA 1GRQA 4HEJA 4PSKA 4K81B 3K0SA 4IKEA 1D8TA 1KSGA 2R6CA 3K9NA 1QHXA 1OIXA 3T34A 4KVAA 4QG7A 1W46A 2MSCB 4Q5IA 4FCWA 2VP0A 1E2EA 3W3AA 4PC7A 3BAFA 4DDUA 4JLVA 2F6RA 1ZD9A 1AZTA 1SHZA 1T91A 3LNCA 3AV0B 3P26A 2QT0A 4EAQA 3WBJA 2IXEA 4FI3C 2F43A 4LJYA 1D2MA 1KK3A 1S96A 2OCAA 2XNDD 3E1SA 5DE3A 4BRUA 8OHMA 1ZU4A 1NKTA 2FEMA 1W48A 4B44A 4WW0A 1GWNA 4B76A 5FH9A 5DHAA 3AKYA 4NYMR 1Z0KA 3GLHE 1TQDA 5HKKA 1CS4C 4AYWA 4X8LA 1D6JA 4B3DA 1COWD 3W3ZB 3MCAA 4TYQA 2QP4A 3JZAA 1H8EA 3DM5A 4OQXA 4D80A 3QJYA 4DDWA 1XXHE 1G8YA 3KJGA 4YMSA 1EFCA 2YZ2A 4CYMA 1TF2A 3L0OA 1ZM7A 5DN6D 1KKLA 3G0HA 3CX7A 1XTJA 4XJXA 4IRUB 1AA9A 2IYWA 3RWMB 3U5ZB 2O8DB 3AF2A 3QF7A 4QBHA 1W0JD 2B21A 4YQFA 1WRBA 4QHYA 1Z07A 2YOHA 4IFBA 3DKPA 4DIEA 4KFTA 1ZD1A 4NMMA 2G83A 3ONWA 3RABA 2ZU6A 2P6UA 4C0HA 2OM2A 2YOFA 4TLAA 2OBLA 3N70A 3NG1A 5BN5A 1UJ2A 3UMSA 2AK3A 2C03A 1Q1ZA 4LHWA 2F1JA 3GJ8A 3GFTA 4NYMQ 1W47A 3P1JA 4BLQA 1OPXA 1T3SA 1PUIA 3H84A 1QRAA 4PC1A 3KKMA 5H68A 2OESA 4CEHB 1E2JA 1Z28A 4TZ0A 4Q4AB 2CXXA 2QE7D 3P4YA 1U9IC 2YOGA 3IUYA 4JJKA 5DI3A 3R9WA 1U81A 2X77A 4DBLC 3IHWA 1TF7A 3PFIA 4TTPA 4DCTA 1PJRA 4ESHA 3OEED 4ZPXA 1A4RA 4FMDF 2R65A 4ZDWA 4LYFA 1FOEB 4Q9KA 3Q7PA 2ORIA 1LV7A 1Z08A 2LCFA 3SQXA 1BOFA 1G5RA 2NG1A 2BBTA 3OEHA 4B33A 1CULC 3IDQA 2NZ8A 1L7VC 5IDVA 3C5CA 4OJKA 3P27A 1Q57A 3LD9A 4Q9LA 2ZAOA 3TAUA 3IEUA 2CBZA 1XEXA 3WNCA 2CHQA 3ZVRA 1S1CA 2QI9C 4Q01A 3C41J 5JI2E 4XWKA 5CK4A 1KMHB 3T15A 1SQ5A 4YMTA 4C4PA 5AUPB 1S9HA 3D31A 3B1ZA 2JA1A 1TEVA 1JI0A 4JYBA 4Q48A 4A6PA 4ZI2A 1UFQA 3H4MA 2GF0A 4HB2A 2O0KA 4P4UA 4NKRA 3W6NA 1E1QD 1VG0B 4A0FA 1P60A 1H8HD 1R0ZA 4JT4A 2A7QA 4LDJA 3TNFA 5FI1B 1VG8A 5J4HA 4DB4A 2ONKA 5AJXA 2WWWA 2EYQA 2RGEA 4A8JC 1MO6A 1M34E 1M7BA 5K8IA 4QKQA 2D2EA 3WHKA 2ORVA 1LVGA 3K70C 3PUWA 2HYIC 4F92B 1HURA 1Q22A 1SVMA 2W83A 4MRSA 2J3EA 4QNMA 4URYR 1GRRA 3CZPA 1GL9B 2IT1A 2G9NA 1QZXA 2BBWA 3TJZA 4R2IA 1P75A 3LLUA 3SC3A 3ZZTA 5JCPA 3PR1A 2O5VA 4XTCS 1EWRA 2FPKA 5IK2A 3DKVA 2AN9A 1UPTA 4CEIB 1IQPA 2C95A 2R6FA 1BMFA 1DELA 1A1VA 3R7WB 1G7TA 2BOVA 2F1HA 2WMOB 2A2ZA 1JQJC 4DCNA 1YJ5A 4PO1A 1ZCAA 2JJ2D 2ZIAA 4I81A 3IILA 1J70A 2Q9AA 3BORA 4W5JA 4FMBB 5DYIA 3SNHA 2RGBA 4BWYA 3ZD6A 1GNPA 2WWGA 2GCPA 3ZYCA 1YR8A 5AUOB 3FMIA 3DZDA 4TL8A 2FU5C 1JR6A 1G3MA 2XOKA 1GITA 2QTFA 4HB4A 4CT4B 2GXAA 4JJZA 3VNUA 2B92A 5B58C 1ANKA 4PAOA 4C0LA 2DB3A 4I4LA 2WAYA 1HT1E 3THYB 1Q20A 4QOSA 1X8KA 2R2AA 1TQ2A 3JVVA 3MUFA 4HZUB 4OI1A 2JLUA 3LY5A 1XZQA 1ZNYA 2CVHA 4ACBA 1G8PA 3BE4A 4HLDA 4RY2A 2DR3A 5CB6A 5SZJA 2NO0A 5JEDA 4BE7B 1CXZA 2I3BA 2ZYWX 5EZ5A 4AKHA 3U3OA 2DFTA 3QEJA 3QKRA 2CNWD 1P7CA 5AUNB 4DUGA 3EX7C 1G1MA 2YNMA 3W6PA 4BFSA 5EE5B 5EE1A 2GVDC 3X2SA 1T8TA 4O2LA 5H1YA 2QENA 3EAQA 2XZLA 1AJEA 2BV3A 1II8A 2FGKA 3CX6A 3I8SA 4Q1BA 4QNRA 2NO7A 1IN7A 3MMPA 2FA9A 4FWTA 1CJMA 2CL7X 4QBGB 1V5WA 4JLMA 4PO8A 3QXCA 5HR5A 3ECCA 5HKKD 5KYKA 2IS6A 4PQFA 1E69A 5EQTA 4IXMA 1OLOA 1H8ED 2ZSEA 1IXSB 1GG2A 1W2GA 2FFAA 2WPDA 3AUYA 4C0AC 4DEYA 1G7CA 1AIPA 5KSZA 3I5YA 5EP2A 4AYTA 4TL6A 3VR1A 1JAIA 4JVMA 3AP2A 1KSJA 3WXMA 3BOSA 3FKQA 4IDNA 3WRXC 1Q44A 2QMUA 4M1WA 2BMDA 2D7CA 3I73A 4IVPA 3J81k 4BEBA 2VYFA 2YWGA 3LH5A 4NZYA 1B23P 1G6OA 1XMIA 2Z43A 1EFHA 3A36A 3CPHA 4RD3A 1UBGA 2IYRA 2XJ4A 5JSZB 3MWYW 3A1WA 1KK1A 2V54A 4B3CA 2GHIA 5TV2A 1XWIA 4Q7JB 2WMNB 5J4LA 3NC1C 3Q72A 1SVLA 1SKYB 2QAGA 3MD0A 1E9FA 4Q00A 1S2MA 2QN6A 3AF4A 3KDSE 1W44A 5FPTA 1SGWA 4QHSA 1QG2A 2CL0X 5FOSA 4GZLA 1RJ9B 2J7PD 4MGKR 3TRFA 621PA 4ZDKA 4R98A 3SYNA 4BZPA 2DFLA 1BYUA 1FP7A 1K5DA 2WWXA 2H57A 1OYWA 1FMJA 2AK2A 1QHHB 4XSHA 5SZKB 5TMPA 4CRWB 2A5DA 4EDHA 2J0SA 3HU2A 3LO5A 4RZXA 4OI4A 5F3WB 4MDEA 5FTLA 3EPJA 2VP4A 5JCZA 1OKKA 2GZAA 1YR9A 4M21A 4UNRA 1CRQA 4FIDA 5CYOA 3B1VA 1P2TA 3WY9A 5JEEA 2IS4A 1A2BA 4V0NA 5EUMA 3OEHD 2QU8A 4KODA 1ZIOA 2AD1A 4DVGA 1TF5A 4N1AA 1R2QA 4R7ZA 1FZQA 2IYLD 1OSNA 4MGYR 2DHRA 2QM7A 3LBNA 1WBBA 4EFNA 2PX0A 4BPBA 3GJ6A 3KKOA 2H17A 3SN6A 2HXYA 4DXAA 3K09A 4C30A 3TK1A 1IY2A 2ZRBA 4DLRA 4TL7A 2G0NA 2VTKA 1S1MA 1SXJA 5A0FA 3RS5A 4AKIA 3WNBA 4O3MA 1A5TA 2GBLA 4KYIB 3WBKA 2DWQA 4DSNA 5EP3A 3AP1A 2C9CA 4MYTA 4XSGA 3BB3A 2WJVA 1G3IA 5LB2A 3AGPA 1Q1BA 1XMVA 2ZRIA 2NMVA 3FB4A 1WE2A 1GL6A 1KDTA 2VEDA 1W36B 2IYXA 2QQ0A 1XDBA 2ZRDA 4AK9A 4A2QA 1GVNB 1KI4A 1P9RA 1Z3IX 2MSDB 4GP7A 2PEYA 4Q03A 4B48A 3MG9A 5FFMA 2VP2A 2GJ8A 1K5GA 2G6BA 3FVQA 3OE7D 1KJYA 2MSEB 2O0JA 3CLVA 2P2LA 2VPPA 2F55A 2EFCB 4L5BA 4X8OA 5FBLB 5FBVB 5IK2D 4ERNA 2O8FB 1NRJB 1E98A 2JLXA 4F4IA 1ZC4A 4KLNA 4W9MC 5JJLA 1J2JA 1G17A 1BMFD 5EXXA 5KDLA 1VECA 2FZLA 3TR0A 3GP8A 3TIFA 5CYPA 4Q1CA 3KB2A 4PPQA 1ZW6A 1E32A 1SVIA 4WVFA 1NMXA 4F93B 5JWOA 4KXFB 1US8A 1E9EA 2R6GA 3WYGA 1TX4B 4LJ8A 4WZ6A 2ZUCA 5AJWA 2XOKD 1L4YA 1AN0A 4HSEA 4JYCA 1F2UB 4GOKA 1C1YA 3VFDA 3IQWA 1GIAA 2IYUA 3VR3A 4H9GA 4RFSA 4QL3A 4LGMA 1X86B 2I1VB 3DHWC 4IDHA 3VKWA 2Q9BA 4S2EA 4QGGA 2DBYA 4E07A 3UPUA 1FUKA 2G0TA 2H1LA 2I4IA 3KB1A 1SXJE 4OL0A 2ZRGA 2QBYB 1RYFA 4AC9A 2QT1A 3EARA 1EFRD 1MO4A 2HT1A 3K0FB 1KSFX 5DGXA 2GJKA 3UANA 4DUGD 1F3OA 1J99A 2KBEA 3KXIA 1GRNA 2BKUA 2AXNA 3AM1A 2NPIA 1YVDA 4MQBA 1P2SA 3HR7A 2HCBA 1E2MA 5FUXA 3QPWA 4PSAA 2BKEA 2HEIA 5AJVB 3U6KA 3U4QB 4HAYA 3WMGA 3B8HA 2G3YA 2ZETA 4LYJA 1ZINA 5E95A 2XNDA 4ARZB 3AP3A 3UATA 2JJ1A 2XZPA 3R9IA 1PLLA 1KNQA 3AVPA 3GMTA 5JS7A 5CLLA 4NP6A 2WPDD 3GLGB 2PLFA 3U44B 3EZ9A 4TYNA 4TLCA 1CR0A 2P5TB 2BJWA 1DAKA 2V6JA 4TLDA 1D5CA 4Z54A 3OIUA 1XPRA 1EK0A 4IOMA 3JZMA 2DFNA 1IAQA 4C2TA 2WSSD 2GXUA 1T0HB 2VP6A 3CRQA 4GOXA 4CIDA 1NLYA 3IGFA 5HZHA 1TPZA 2KE5A 4V02A 1AQYA 1GUAA 5L3VA 2FFBA 1JEDA 2W00A 2VL7A 1NKSA 4PAMA 2ZJ8A 3I32A 1DG1G 3QG1A 4IDPA 4IJMA 4A9AA 4JL8A 1YE8A 3BB4A 1DAFA 3QI2A 4ZIRB 2QGNA 2GZHA 5DNYB 3B5JA 3QVUA 1N6KA 4B35A 3L0PA 3N2IA 1HE8B 1AGRA 4U00A 5B57C 3KX2A 4A92A 2J1LA 4Q4AA 1VPLA 2WAXA 4BECA 2H7VA 1EG7A 2OV2A 3HP1A 2JLZA 3EA5A 5EP1A 3REFA 2J5XA 4YMVA 3SYKA 2LKDA 2F1IA 2G1KA 1W4BA 1E4YA 3IO3A 3MWKA 2W2XA 3UWOA 2DPXA 1ZAKA 4RZUA 2D62A 2QMEA 1DAGA 3CF6R 2GAAA 1CJTC 1RRFA 1UKEA 1YZKA 2MMCA 4RCYA 3MWJA 4E09A 3T12A 4XIGS 3QKUA 2BBSA 1F48A 2BDTA 5J4YA 2QORA 3HR8A 3KFVA 3UWKA 4DSUA 2GWHA 1UM8A 2F3TA 2VA8A 3SDZA 4C0KA 4R71A 4URXR 1Y3AA 2C5LA 3BFVA 4M1KA 1KMHA 5LDDC 3ND9A 5DYGA 2KBFA 1ESMA 1VTKA 1NSTA 4B74A 1M8PA 3C16C 1KTVA 4IEEA 2VBCA 3CUEF 5CDFA 1XNJA 2CMKA 1V43A 1T3HA 3RS2A 3TR5A 3D3QA 5H8WA 5FR2A 2NQ2C 4B2PA 4LBZA 4G3XA 3RNLA 1YR7A 4A1FA 2KWIA 4L16A 3AF3A 1N6RA 1E1QA 2OFWA 3IHLA 4F38A 1MO5A 1XD9A 1DAHA 3MFYA 4KU4A 1G6HA 2QP3A 4LV6A 4LSGA 3FPAA 1N6IA 3UK6A 1GZSA 2EFEB 3QF4A 2RHMA 3QSYA 2GKSA 3AF1A 1N25A 1ZIPA 3B2EA 4PSVA 3VR4A 2QSZA 3QXHA 3UMRA 2FOLA 5G3ZA 1G20E 2WWIA 2ZYVX 3VR6A 4US2R 1G9XA 1UKVY 2CJWB 4N3NA 1N6LA 2FV8A 2OCBA 5F9FA 1R8SA 3HPRA 4ABYA 2X2FA 4CEIA 2UZ3A 1TQ6A 5FOVA 1WQ1R 4RKEA 3R7WA 4E22A 3TW4A 3OIVA 2ZEJA 4TWZA 3IKJA 4LJ4A 3O47A 4LY6A 3FFAA 1C9KA 4OKSA 2CCJA 3KKQA 4E03A 1KYIA 4KSCA 1YZQA 2TMKA 4KVGA 2C96A 3ZVLA 121PA 2DYKA 2JATA 3LXXA 3RRNA 2Q21A 3AVQA 4FD2A 2D7DA 2ZR7A 2NTYC 2Q3FA 3CBQA 3AKDA 4UNQA 2J45A 2WKPA 4N0DA 5BYKA 2I1QA 3THYA 2IS2A 3O8BA 2O0HA 1WXQA 3DEFA 5CM9C 2W2VA 4HZUA 4MYUA 1TQ4A 1N5JA 3PJRA 1ZM4A 3EC1A 1LS6A 5CDFE 1LNZA 2FNAA 5L3QB 3WRYC 2IEZA 1E96A 3ZQ6A 3THOA 3X1DA 4BLRA 4O2RA 3U3KA 4LJ7A 1KMQA 4DCSA 2YJTD 4PX9A 3KQNA 3GLFB 2WWHA 3QE0A 4ZI3A 3FOZA 1CRPA 3A4NA 3C8UA 1R4AA 1Z22A 1WCV1 1P72A 4M9QA 3SU8A 3G5UA 1E6CA 4ESVA 1GNRA 1HQCA 3CR7A 2CNWA 1QG4A 5TXGA 2V6IA 5FPSA 4A2WA 2PZGA 3AKEA 2ZRKA 3I5XA 2AWOA 1IY1A 1DVRA 2HJGA 2OT3B 3T5DA 4PHTA 4EPVA 1TUIA 4M1YA 2D4HA 4MGIR 5FR1A 3U7HB 1JEEA 4B2LA 2JJ1D 3TUIC 2YVUA 1GKIA 2ZSBA 1RRCA 4C0SA 3TUZC 1ZNXA 3AB3A 4M8NE 2AD5A 4N0EA 3R8FA 3EC2A 2W6IA 1JAHA 2ODNA 4C0JA 4ZV4A 3CF0A 1PVOA 4I1VA 5SZHB 2WJHA 3KUCA 1W0KA 1ZNZA 3HJNA 2P6NA 2Q0HA 4BLOA 2VP5A 3KQKA 1P9WA 3X1YA 2P67A 4LRWA 5BWMA 4W7SA 2ZREA 4TTRA 5BXQC 4KBFA 4PXAA 4P31A 1U0HC 2C9YA 4XD7A 1VHLA 1YKSA 1MT0A 2H5EA 4NPHA 2V1UA 1GILA 4IDQA 2YWEA 5JSZA 2XB2A 5JJKA 4DCVA 2OXRA 4PTLA 4C7OB 1WDTA 2A78A 4KBGA 1TMKA 3WHLA 3LFUA 1ODFA 4HI0E 3L2OB 3GLIB 1KI1A 3LQRA 4EPYA 5HCNA 2XNSA 3AVUA 3TE6A 1X6VA 3BH7A 2HUPA 1X8LA 1RJ9A 4AD8A 3NEJA 4GMDA 1SVOA 2ZM5A 1XJ0A 2CDNA 4Q1AA 3RANA 4LYHA 1G8FA 3OFND 5JI3E 2BBOA 4XH9B 2VHUA 2J0VA 2J7PA 3C7KA 3UG7A 4I1SA 5C46F 1NIJA 1QHHA 5FBWB 3OIWA 3LQQA 1P2UA 4NYJR 1AZSC 1NMZA 2ANBA 2ORWA 3L0SA 3PQCA 1J8YF 4M53A 3T1OA 1NVUQ 3EWSA 3SS8A 4BASA 1Z29A 2W0MA 2QNRA 4AIIA 1GAJA 3N5CA 4BEJA 2GF9A 1G64A 3QQ5A 2OBMA 1NLZA 5KPJA 1KI7A 5KDDA 4RJLA 2WSMA 4XTRA 3PXGA 3S1AB 3VNVA 1JXMA 1NN5A 2J41A 2V7QA 4MRRA 1G291 2NGRA 5EUQB 2FGJA 3IBYA 1BKDR 4V03A 2Q9CA 4TMVA 3U6BA 2Q3HA 4EPWA 3EZ7A 3TMKA 2PEZA 5HE8A 2KSQA 3VMFA 5C2JB 3G82C 5FL3A 2XGJA 4J0QA 1GDDA 2DY1A 3O8DA 4QRHA 3L8YA 3Q9LA 3VR2A 3QENA 4LC1A 5CJPA 3RRZA 2QTVB 3P4XA 5FOXA 4NYJQ 1G3RA 3ZH9B 5EXSA 1ZNWA 1KO5A 2IYZA 4HAUA 4M22A 3WP1B 4NDZA 1G7SA 4YONB 3VAAA 2PJZA 1W36C 3BJIC 3K9GA 4D4MA 1M2OB 5FTMA 3TQFA 1OV4A 3LBHA 1HUQA 1SKYE 4V0OA 2Z0MA 4LJ5A 1Z6XA 3DVLA 4CDGA 3KXKA 5CM8B 2ZJ2A 1KDPA 1RIFA 1KK2A 4URWR 1T5IA 2YYZA 1LF0A 2GRJA 4ZCIA 2AKYA 1S3GA 2QM8A 3OE7A 2OFXA 3T5GA 4LV5B 1Z6TA 2CCGA 3AKCA 5FOWA 2O8FA 1OT3A 3PIRA 5C4GB 3UXMA 4CT5A 2JJ8A 2R44A 2BCJQ 2OAQ1 1YZGA 5EXPA 1VYTA 3W6OA 4OI0A 1U8YA 4EQ6A 1KKMA 3GJ4A 3ZIAA 2A30A 2N46A 1OIVA 2FH5B 3KKNA 2RGCA 3GJ3A 5LD2C 1NF3A 2Z4SA 2ZUBA 3MJRA 4WZBE 3ZDQA 4Q66C 2PT7A 1NI3A 1KJWA 4MUAA 4W5WA 5FUYA 1H65A 3QKTA 1F2UA 3DO6A 4NH0A 1KI8A 2QAGC 1P9NA 2WICA 3FHCB 4WOPA 4B73A 1E9CA 1X1SA 4DHEA 3LDAA 5G41A 3VX4A 3MAAC 1C4OA 2RGAA 1E2HA 1SVWA 3M4YA 3P20A 4IOLA 4QGHA 3ADCA 2XAUA 2NPFA 4HLCA 1G19A 3K0AB 1KGDA 3K0EA 2QBYA 5CK5A 2H92A 3MLEA 2JDIA 1RE0A 3EZ6A 1YU9A 1NSFA 3GEIA 2ZYUX 5KU1A 3L0IB 4FW9A 2CE2X 5BQ5A 5JFGA 1P6XA 1Z8FA 4MGZR 1EFRA 3IO5A 3CH5A 2B7CA 4TMTA 1XPOA 3VX3A 2ODWA 1P4SA 1TL7C 3Q85A 1G8GA 3O8CA 2VSXA 1W4CA 3CZQA 1E2QA 5DI9A 1N0WA 5HZKA 4UNSA 1NY6A 1D2EA 1R8QA 3BGWA 2C78A 5AJZA 1VIYA 3IIJA 4OHZA 3U4QA 4KFRA 4M0LA 2V4ZA 2A5YB 1KY2A 1PLKA 4Q4JB 4ARZA 1D9XA 5KHOC 1XTSA 1NN1A 3B9PA 1W2HA 2P0EA 2B8WA 3CF2A 4PC3A 3K09C 1R0YA 2XSZD 2W6JA 2CLCX 2ODBA 2JLSA 3ND8A 4EPRA 2W6ID 3U44A 5JLJA 1SXJC 4OJQA 4TYYA 2GBLC 3CONA 3FKSA 3OHMA 4URVR 1W0KD 2FJUA 2PZEA 3BB1A 4KO8A 5BN3A 1DE0A 3I4LA 3WMEA 1MRSA 2CLDX 2JIZD 1RRGA 4EFLA 2X8AA 3NIBA 4Q1FA 1R6BX 4D81A 1MABB 3E5HA 1ZUHA 5FBRB 1M74A 3RYTC 4D26A 2H8KA 2HLDA 2IWHA 2NZJA 3OIYA 4LK2A 4XD7D 2WSSA 2ZJYA 2DCUA 1AM4D 3FWYA 4JBXA 5K8TA 1CP2A 3A6PC 1DPFA 4JLOA 2WOOA 4RVCA 2Y8EA 1N5LA 2MMGA 2REOA 1EESA 1QHIA 4ZIRA 1IN6A 4IW3B 2IEYA 2XB4A 1SKQA 4M1SA 2OCPA 1S8FA 2Z5FA 2O8BB 1XEWX 2E1RA 5CITA 4JL6A 3ADDA 2F7SA 4XVQA 3LW8A 1R5NA 3K9HA 1VDZA 2BMJA 1NBMA 1TU4A 1P62B 4RSGA 2BHRA 1CF4A 3MJHA 1Z0DA 5D3MA 2QY9A 2GXQA 3QXSA 2ONJA 4A82A 1W4RA 3EG5A 4URZR 1OXXK 5EE0A 4QHTA 2C99A 1KI6B 1MKYA 1RKBA 1MOZA 5KPDA 2ZSAA 4M1OA 4Q4HB 1LF5A 3CNLA 4LHVA 3C15C 4Z8YA 3GJ7A 3EXAA 1G4AE 1ZYUA 1F6BA 3ADKA 1W4AA 4MDFA 4B32A 5JBQA 3I62A 1NMYA 1NIPA 1IJFA 3A8TA 1XD2B 3FYHA 1FL9A 2G1JA 1T8UA 3NBYC 3W34A 4M9ZA 1Z6AA 3RS7A 3F0TA 5KNDA 1NVVR 1NG1A 2ZE5A 3R8CA 2V7QD 1CKEA 1XMSA 4Q1EA 3CX8A 4AKEA 1HTWA 4P4SB 4DLUA 4MRNA 5IT5A 1W5TA 2IYQA 1KI2A 1GFIA 2OFOA 3I1FA 4YMWA 2BIFA 3GJXC 1XEWY 4JLJA 3Q3JB 4MKIA 4GZMA 4ZKDA 3GEEA 1FMLA 2WWYA 4P3YA 4TMXA 4DIDA 5KSOA 2X19A 4A0GA 3AEZA 3TLXA 5UKDA 5E4FA 1X3SA 1AS3A 3ETLA 4YMUA 4PANA 3T1TA 5HTKA 5GADl 3GPLA 1I2MA 1ELOA 2HV8A 2ZRAA 2RHDA 2CK3A 2ZRHA 4PO9A 3BIFA 1E1RA 1HY3A 5DISB 3ZLJA 2P5SA 1G5PA 1DG3A 2YWHA 2FFQA 2VF7A 3SFZA 1HV8A 2C77A 2J9RA 3IIMA 1W36D 1M1YE 1AS2A 3IIKA 3KXLA 4GT1A 4JLAA 3M0EA 4M9SA 4DSOA 4PAQA 2C98A 4LUCA 4MYHA 1OHHA 2R8RA 1HEIA 3RRMA 1G21E 1NVVQ 4DLZA 1NBME 1G3QA 4PPNA 5DSZA 4DLTA 3H2YA 2X1VA 5CIWA 1WF3A 2QAJA 4FINA 3ICQB 3BBPA 2D74A 4XWAA 2ZI5A 3BS4A 1X1RA 5KOYA 3NBFA 4UXJA 2CHGA 4NONA 1P3JA 3KJHA 2JLWA 2B8TA 4Q1DA 3SZRA 1VMAA 3CNOA 3IPYA 1XTIA 3ZIAD 4RKFA 1GKUB 2GCOB 2WZQA 5CJ2A 4GP6A 4D82A 3BK7A 2BC9A 3BERA 3EIQA 2GNOA 4G5OA 4AG5A 5GJCA 4Q18A 1DBSA 2AX4A 1BIFA 2ZVPX 2AL7A 1ETUA 1Y63A 1UKYA 2IXFA 3EWAA 2R62A 3T1QA 4OK6A 5JS8A 4S35A 4C2UA 2IF0A 2VSFA 1XPUA 1CR2A 3ZGXA 3ZVNA 4MUBA 4XVUA 2GCNA 3WYAA 2VO1A 1UKZA 4R2HA 3KQHA 4AY2A 1XFAA 5L3QA 4RD6A 3X1ZA 3U60B 4GMXA 2JDID 4M4SA 3V4FA 2IUUA 4OK3A 4I1OA 1VG9B 4TZ6A 1NVXQ 1GL7A 2D3WA 3GLFA 2V3CC 2RCNA 4F4JA 4ZO4A 3UKDA 4OQMA 5L8VA 3RSOA 2XXAB 4IFEA 5E3HA 3BC1A 1UBEA 1Z6GA 1XTQA 1L2TA 2YINC 2ZITA 3T35A 1OF1A 4TYWA 4QXAA 5IHPA 3IQXA 1NJFA 4JBYA 3W90A 4AG6A 1R7RA 3SJBA 5E7JA 4XWOA 1KO1A 5FBQB 4PZZA 3I61A 1FFHA 1HE1C 1E2GA 2N1BA 2REXB 2WOJA 4EJSB 1DS6A 5JRZA 3PG5A 2QMOA 2FPMA 2JLVA 4FCVA 1IONA 4OQLA 4JT2A 2W6JD 2OG2A 2QSYA 4WIAA 1XX6A 1RPZA 3B1XA 2WVJA 4JBWA 2IXGA 2NIPA 2K5UA 2GA8A 2ZJAA 3CNNA 3FKSD 4P33A 2J0UB 2WM9B 3FMFA 4TMKA 4B6FA 3QKSB 1NNEA 4WA7A 5J47A 2IHBA 1KIMA 1Q21A 1ZM9A 4D0NA 1KZ7B 1KO8A 4DLYA 3W5IA 1RW4A 4Z8XA 2BMFA 2NOAA 4RD2A 2C2HA 3B6EA 4FCTA 2HLDD 3RRYA 2ZI6A 4MITA 2CE7A 1ZBDA 4DDTA 1HH4A 1QVAA 4DJTA 4US0R 4TL9A 2O8DA 1OFIA 4OI2A 4W5HA 1DOAA 3KZ1E 1VYVA 3VTKA 4CW7A 4EPXA 4WAUA 2WBLC 3TGPA 4QM6A 4BFVA 3GQBA 4YDSA 1Z0AA 1RYHA 1WMSA 3GLIA 3RC8A 1BS1A 3FMOB 4FWIB 1A82A 5FI0B 2A3RA 2FSHA 1G4UR 2PT5A 1IY0A 1F2TB 1OE0A 3PEYA 4QM7A 4YXWA 2ZANA 2PX3A 4JKYA 1E9BA 1N6PA 4A8JB 5CLQA 2V8OA 3K70B 2IS1A 3GLFE 1NBMD 4HLUC 1W49A 4D0LB 1S3SA 1Z47A 2FWRA 4BFZA 4NCKA 1EFUA 2FSIA 3QXXA 1U2RA 3CH4B 1IJEA 3LVQE 2IBMA 4TT3A 5GJWC 4CEHA 2E9SA 2EW1A 1Q1QA 2QA5A 1U0LA 1ZJ6A 3L82B 3U3RA 1A2KC 1OH6A 4KSBA 2ECKA 3OFNA 1ZCBA 3U3MA 1R5BA 2AFIE 1E9RA 3VR5A 4JLDA 3N2EA 1LY1A 4HUQB 1WA5A 1SZPA 1L8QA 2XITA 3F5FA 1OH8A 3R9XA 1WP9A 1NG9A 5B30A 1OB2A 2IYTA 4UXHA 3DL0A 3DPUA 3FHTA 4HAZA 1XD8A 3CM0A 1FNNA 2AWNA 2SHKA 3BXZA 3QXJA 2ZS8A 3R20A 3VHLB 3S1AA 2DWOA 4Q21A 2D2FA 4OHWA 1WBDA 4KYUA 1XJCA 4NU0A 1YZNA 3LAWA 3A58B 5AUQA 5AJYA 3RHFA 4DLVA 5FOTA 1KZGB 2GVZC 5ANRB 5AWFC 3V9PA 4AKGA 2A5GA 1PUJA 4ZCMA 1TEXA 1E9SA 1OFHA 4KHZA 4Y0AA 6Q21A 4DSTA 1VCOA 1FQJA 2ATVA 3CW2A 2XJ9A 3LX8A 2FF7A 4UJ3A 2CK3D 2JLRA 1GM5A 4GPTA 4TN1A 1E1RD 1EFTA 4DT1B 5JHGB 1B0UA 5G53C 2YKGA 2VSOA 1E2KA 3GLIE 2UVQA 4XOIA 1LB1B 3CPJB 1M7HA 3NVAA 2B7BA 4WBSA 3K9LA 2VF8A 3DM9B 1JPJA 1N3BA 3FDIA 5KNCA 3FTQA 1OHHD 2ZE8A 1DAIA 4B3XA 2HT6A 3CWZA 3SJZA 2QQEA 3VU9B 2EWWA 3KFXA 2A9KA 4IEIA 3EPHA 3AUXA 1N6NA 1XJQA 3CRW1 4OK5A 5A4JA 3KQUA 4YLGA 3QBVA 4GOJA 2EVWX 3NH6A 3CRMA 1YZLA 1Z0IA 2GAOA 5TB5A 5BW8A 5L3SB 1ZP6A 4BZXA 3FE2A 1ZVQA 1QHYA 4HLUA 2GETA 1AGPA 4IVRA 3WMFA 4US1R 1QVRA 3RC3A 3NEYA 4NCJA 4QJ3A 1L4UA 4U5XA 4QC2A 1IN8A 4E5UA 5GVSA 1R5OA 1U8AA 2YC4C 2YHSA 1N6OA 1T9HA 1E2NA 2GJSA 1ESNA 3LVRE 4HB0A 2RMKA 4V0MA 4LZZA 3NXSA 5J4VA 1Z06A 3MSXA 4ZCLA 3TUJC 1ZRHA 1A7JA 1U90A 1XF9A 4BLSA 3NWJA 1M6NA 4FN5A 4IDOA 1UF9A 3ZS8A 2IX3A 3AH8A 1AKEA 2CL6X 3K0AA 4PQYA 1CBUA 4JSTA 5GJVC 3REGA 4GRAA 3SE0A 3B78A 2GJ9A 1SVSA 2FDCA 1WB9A 4HAWA 1NLFA 1NN3A 4B3BA 1EX6A 5HCIA 5G40A 2ZE6A 1E94E 1G3UA 2HDNB 2C8VA 4MA4A 4OQNA 5FTJA 2RGGA 2QZ4A 3KUDA 4TQAA 4I99A 5EJEA 1P61B 1R10A 3NC0C 1II0A 4LC0A 2IUTA 2IYYA 3HPQA 3OAAA 4X8MA 1KDOA 4MKGA 5FOUA 2AXPA 2IYVA 1YZUA 3UMFA 2KB0A 2O8EB 1D9ZA 1EWQA 1KAGA 1CJKC 3KTAB 4LPSA 2Z4RA 5KO2A 2OEPA 2QUZA 4Q4JA 4HDCA 5HPYB 1D2NA 3C14C 5HE9A 2ZRPA 3AVXA 2V55B 4LJ6A 4CEJB 4UXIA 1E79A 3PUYA 4LPKA 4Q7MB 5JRJA 2XSZA 1Z2CA 3H1TA 1E0SA 2HCJB 3LXRA 3KJEA 4URUR 4NE2A 3UIEA 2XTMA 5JWHA 1NL3A 4TQ9A 3OESA 1MABA 3EZ2A 1U8ZA 2EFHB 1KI3A 2H16A 3D6TB 3CB4A 1QDEA 2F9LA 3WYFA 2VIIA 3TSWA 4JMPA 4PC2A 3FFBA 2JIZA 2ZS7A 4KV9A 1ZC3A 2RAPA 3MGCA 4JVLA 4M1TA 4ON9A 5B64A 3PEWA 4V0ME 2ZRMA 2VP9A 1Q12A 1XU4A 2GTPA 1G41A 2J7KA 3EPLA 1RRPA 1XP8A 2OCYC 3I72A 4EUNA 1KO7A 2REBA 2WJIA 5FTNA 2BVNA 3CWQA 2ZXUA 4OHXA 2PCLA 2O8BA 2WJGA 1E2FA 1KI9A 5TVKA 4BUJA 2WWFA 1P73A 4YXWD 821PA 5FPHA 3RS4A 1I2DA 4QBIA 4GL2A 4B34A 1JNYA 1BYIA 2ATXA 1LS1A 2ZRLA 1FUUA 4Q47A 4QBFA 4Q19A 4BLPA 3HWSA 4TT3D 4NL4H 1TTTA 3ZD7A 4G5GA 1KI6A 2OBNA 1CR1A 4C9BA 3PENA 3MRSA 2JAQA 4Q4HA 3DZ8A 5LPNA 3T61A 3TVTA 4ASUD 2VLIA 1N0VC 4NCHA 1QHGA 4L9SA 5C1BA 4PC6A 4A36A 4C3ZA 4Z1MD 1J8MF 4DB2A 1DO2A 1XD2A 2CVFA 2RGDA 2X2EA 2N42A 1T4GA 3LW7A 1DARA 4PHHA 3SFVA 3W9YA 3AVOA 1MO3A 3ZZ0A 1CU1A 2G77B 2CCKA 1PLJA 4OHYA 2ZJBA 1GKYA 2LWIA 3ZS9A 5C18A 4HAVA 4JLKA 4PR0A 2R6AA 4P4SA 1ZM3A 2IK8A 1R0WA 3VHXA 3O8RA 1FQKA 1XCPA 2QMHA 5A5GA 4PPFA 4DWJA 2RGNA 3CRVA 2LKCA 4B3FX 2ZU0C 3D7MA 1F5NA 4NYIR 4UKDA 2O52A 3SI7A 2IA5A 3DOEA 3GFOA 2Q3MA 2QEQA 2R9VA 2PCJA 4EIWA 1OJLA 1SHKA 4JLNA 4PPGA 1CIPA 4D25A 4PZLA 4CZ2A 3HYRA 4LBVA 4EJSC 2ZRFA 4O0MA 2VH5R 3I92A 1XZPA 4BLTA 3OF5A 4BFTA 2D06A 2E87A 1I4DD 1KSHA 1OYYA 2JASA 3A4LA 3BWDD 4YC7A 4KFSA 4WZAE 2PLRA 2JCSA 4OQFA 3Q5DA 4QGAA 2NO9A 1NN0A 2EYUA 1JALA 1ZM2A 3PITA 1JECA 1T0JB 221PA 4A15A 1VG1A 4D4LA 4Y0VA 2OLJA 3ICEA 4LBWA 5CIQA 1JR3D 5FL7A 1GNQA 1IM2A 2EQBA 4IHQA 2RH5A 2FSGA 5P21A 2WKQA 5M04A 2PH1A 1BO6A 1VCMA 4NYIQ 3DDCA 4B71A 5FPKA 3GJ0A 1Q0UA 2GEUA 3HDTA 4LX0A 1KO4A 1U99A 1Z0JA 1PZNA 4BQSA 5KNBA 2O8CB 2GCOA 3P32A 1VCIA 2GEVA 2ZRJA 1CJUC 2ASEA 4LHXA 4TMWA 4L15A 5H70A 2ZRNA 4TLEA 4D4KA 1MR3F 1TADA 3ZQJA 1UEIA 1OFTA 1DO0A 1MV5A 2IW3A 2V9PA 1YRAA 1E0KA 5J4KA 5EE3A 4Q7KA 4OHVA 1IN5A 2FN4A 3QF4B 5LBIA 3F3YA 2XX3A 3EW9A 1FP6A 2ZRCA 5BYJA 2CLSA 2FZ4A 3K8YA 3KL4A 1UEJA 3LLMA 3F8TA 3H0KA 5KSPA 4Q02A 2QG6A 3U3JA 5DHFA 2F3RA 2HF9A 3GEHA 4DLWA 2IYSA 4GFDA 4F4CA 2ZR0A 3QEOA 1I4LD 2FSFA 4OBEA 1AS0A 4D2IA 2FMXA 3THXB 3GLHB 3M6AA 4CGZA 3FGNA 4HYYA 4QJ4A 3QG5A 5FPYA 3UG6A 2RGXA 1U9IA 2XXAA 3K0FA 4DKXA 2ZE7A 1XXHB 3SBEA 3V4RA 1OH7A 1LFDB 1GP2A 5BN4A 4RZ3A 3OAAD 5AR1A 4AWXA 4QGFA 2J87A 2ZJZA 1CEEA 2ZPTX 3ASYA 3B85A 2YV5A 5F98A 1OB5A 1T3LA 2FFHA 2J46A 5IF9A 4FMCB 2OE2A 4EJSA 2HJVA 3H86A 1E0JA 2HF8A 3THWB 2PL3A 3SHWA 4MRPA 2UZIR 2ZJ5A 1E79D 3LBIA 4G0NA 4XVRA 4TYPA 2VQSA 2NO1A 4KAXA 2RKOA 1N6HA 1FX0B 2J0UA 4LBYA 3QKSA 4P32A 1YHNA 2VHJA 3GLGA 2QTHA 3AVWA 2C04A 1FW6A 4HB3A 1JPNA 4K46A 1T5LA 1ZMXA 4K8OA 4LI0A 4RFVA 1ZD8A
chains in the Genus database with same CATH superfamily
1E2IA 5CTAA 2NZYA 4FXPA 4U6NA 3KSDO 1XKTA 3BSYA 1V5FA 3VKGA 2OWEA 3O73A 1F51E 5JZMA 5E38A 4W8HA 2PMKA 4UM8B 1LK5A 3T38A 3HYTA 5KJFA 1GTZA 2CY0A 3EIWA 4HFJA 4V0KA 2GHRA 4LDPA 1G8HA 2P9TA 3CEJA 4RY0A 5AVUA 3I6IA 4B3GA 3H5OA 1OVGA 1O95A 1X7ZA 2IV2X 4O8ZA 1PHRA 3R6GA 5ICMA 2GD1O 4NDNE 3AOEA 3IOEA 3VGPA 4FZJA 5GONA 3QTTA 4NBTA 2DBRA 4RK4A 2CFTA 4M9XA 4N8EA 3JYHA 1JS1X 4C0QC 4Z3KA 4PNHA 1EXMA 3NEPX 1WUYA 2F3QA 2WP8J 3GFPA 3K5HA 3OA0A 3QBTA 5EKXA 5B2ZA 3L1JA 4XX0B 4UFOA 5BSRA 1QS0B 2X1LA 4BUZA 2C8JA 3G2KA 4PYRA 1V5GA 2W2LA 3SKXA 3A6EA 2K6GA 4QA9A 4DBLE 5KDOA 4RPKA 4WASA 1NTRA 3DOCA 4BGDA 2QRNA 2WJAA 3KOUA 1WJGA 2V7GA 2Z83A 1P6UA 1VYUA 1MAAA 4UAUA 2JJQA 3AIOA 3NBAA 2OOKA 3GJ5A 3H9JA 3TSOA 3X1WA 2FG5A 4CV2A 4UNPA 3SM3A 2H2AA 3GXOA 3KB8A 4IJVA 4LWZA 1EPUA 4WQMA 1BU8A 3NRJA 4NV3A 4NAVA 1DTSA 2KM1A 4LHYA 3SJCA 3QPUA 4MMYB 4RGYA 3D9QX 4U2KA 1J09A 2OUKA 4FEAA 3RKRA 4MQEA 1E4VA 2CEAA 2HIAA 4QO7A 4UBLA 4Y6SA 4UZSA 3SJAA 3DUFA 4FQ8A 1RCFA 1VJDA 3BZUA 2ERYA 3FUXA 4D6PA 3EGXB 4ITRC 5HRUA 3B7GA 1IJBA 5BYAA 1X9HA 4Q9JA 4E11A 2QTMA 1L9XA 4IO0A 3RWOA 3TTSA 1U7ZA 3NKLA 2DSNA 5MGNA 2G9QA 4QLOA 2AUNA 1DJOA 1IHOA 2B5VA 1JDSA 1U0EA 2ZOSA 3KQMA 3OZXA 4I1UA 5AI5A 1NVFA 5DI3B 3V1NA 1CUVA 1KBZA 3B13B 3M6FA 4H7HA 5JIBA 4HWPA 3KUXA 3FDZB 3LQ1A 1M2KA 3VDXA 2JHAA 1UADA 2DKOA 4GX0A 2RHOA 1ITZA 3HKBA 2C0CA 4PZ9A 5DHTA 4G1UC 1JIXA 4F6RA 2UXBB 2Z8YM 1A9ZA 3GGCA 4HDRB 3A37A 4B43A 1H6BA 2E37A 4YR9A 5FPQA 2ANCA 5HJEA 5K20A 4F11A 4HC4A 2MDTA 1TZBA 1J8VA 3SBDA 3VUEA 1B3BA 4CHGA 1KYWA 1OBFO 4CKCA 3J7AC 1U4NA 4JAVC 4YRKA 1QBGA 2ZJOA 4GL4A 3DBIA 3LA6A 5HWSA 3E8SA 5BVGB 2WZBA 1I3KA 4JQZA 4DDVA 3IBGA 2OHXA 3MS2A 1T6XA 3R7SA 2DY0A 3RV4A 3LUHA 3ZDYB 3QE4A 4D9NA 5DT2A 1FDUA 1Z38A 4XI9A 3T3GA 7MDHA 2H8GA 1HDZA 3O4RA 2EWVA 1J90A 3K1JA 4BQPA 4LYAA 4H6PA 4N3GA 4CF6A 1BX1A 1SZDA 1SM4A 1XALA 1Y6QA 4JUFA 1YBAA 3DDHA 1SUCA 5JROA 1A4UA 2XYHA 2EZ8A 1SHUX 4HVLA 3UHAA 4ZVLA 5JNLA 3ZJYA 1UAAA 2WDPA 3OZIA 2X3FA 1UDRA 2Q9UA 3QUQA 1YQTA 3AVVA 2QN8A 4RMJA 1VKJA 2VJMB 1YCHA 3N2KB 1C9JA 1EXVA 3FHOA 4IUYA 2XUFA 1J0CA 1PT7A 2J5QA 1LCIA 1D0IA 4ALKA 4N7BA 5CGZA 1XCGB 3NU1A 5GM2A 1HKUA 1AVTA 2F1KA 4Q7LA 2EX1A 2Q8QA 4EOGA 1PRYA 1PP4A 2PV0A 6AT1A 2IZZA 3L0YA 3RS3A 5HIAA 1MC1A 2ZI7A 2BT4A 4NBSA 4CM4B 3BGDA 1J7KA 3OQBA 4X7RA 2JNWA 3WWCA 3FMVA 1QX3A 1ZUWA 1II9A 4UJ5A 5EQJB 3UFBA 4C78A 1CNMA 4DC9A 4PCLA 1ATZA 4FMCF 1EDBA 1MT3A 3M3HA 1BHSA 3T1HB 3QJGA 4EQ6B 3PGMA 4BWFB 4YJGB 4YK7A 4PN3A 3WFJA 3ELYA 1UBSB 2GM3A 2Q6TA 3IAEA 4FGJA 5JO0A 3AGQA 2GN0A 1JJ7A 5JECA 1HSZA 4D0GA 4BEWA 2RB4A 1I94B 2DKNA 1G2OA 1L5WA 4B6EA 2A5FA 2C0QA 1O97D 3N5KA 1P0IA 1TB4A 1Y8AA 4BFUA 2L0XA 4O4JF 5AW0A 2PKXA 1D2CA 2NO6A 3CA8A 3O2JA 1U0FA 2WUEA 2JVKA 4O0LA 4HAXA 3VO1A 4CEJA 5A71A 5I9IA 2AOTB 2HHJA 4J2TA 3PIIA 3KTDA 4BVHA 1C3OB 3GGJA 3HUUA 4O8CA 4MUMA 1GGHA 4IO1A 5EFZA 2QL6A 4HRAA 4X95A 3TKLA 1VA4A 3I0MA 4NMWA 4FEEA 2PRSA 3A1VA 3SYLA 4DNQA 1AUPA 1HT0A 1NI4B 2H07A 2FUEA 4NOMA 3EVGA 1NJGA 3O92A 1LDGA 2IPNA 1C4XA 2BHSA 3DAPA 1PZMA 1XFDA 1E1CA 1IHUA 3MWLA 3E9CA 4R8LA 4UMEA 4EL5A 2A59A 1Y7LA 1JFFA 2XMCA 3W2HA 2IODA 2H7XA 2EBWA 4NCAA 1JQLB 3WISA 3VI4B 4AS3A 4LZOA 4EGJA 3UAWA 1CY2A 3VU1A 1ORIA 1JFLA 2X6TA 1H23A 3UC5A 4J43A 4LHZA 2PAFA 4MLCA 4ZTZB 4JSYA 3D8BA 2VJDA 4FXOA 4G24A 5IEBA 2CVQA 1E6KA 1Y3BE 2FPRA 3HKCA 1E7WA 2GZDA 2GRAA 3DFMA 3PI6A 4C6TB 1II8B 1IWOA 4G1MB 2BONA 4G5RA 3IERA 2CW5A 6PFKA 2PMWB 5E6RA 2WJ3A 1GLGA 1REQB 4MWSA 2VNSA 5D1HA 1E3MA 5EQFA 3I8XA 4NCIA 2O2YA 1COWA 2QN1A 3E9RA 3EN0A 2UZ1B 3HRHA 2ZKLA 1GARA 3NB0A 4A4DA 5F9HA 1CDDA 4MUXA 2P1DA 4B31A 5JH7B 2PD6A 3F5SA 2ERXA 5DSXA 2VHCA 1XELA 2Y3IA 5BSMA 3MTBA 4C4XA 5JALA 2C20A 1JEQA 3G6WA 4GG1A 3TX2A 3W8RA 3ZZUA 5DN6A 4QU9A 4GI3A 1NJ2A 2BKLA 3RVBA 3IUNA 1MOSA 2YQZA 2X13A 3PV0A 4G0ZA 5F7OA 1H9CA 4E31A 5C1OA 3QUSA 1CETA 3FXAA 2XTZA 3HUDA 3NHBA 4Q1VA 1ZXXA 1W0JA 3SOPA 3ZWAA 2ALJA 2GPWA 2HAEA 4GZ3A 2VDWB 3L8DA 1YJCA 1FS6A 4RE5A 1DFHA 5FA5A 3WTBA 1KEVA 4X7PA 4BO5A 2I2DA 4BX9A 1YR6A 4BRZA 1J0AA 5EC8A 1QC5B 3KUUA 5EZ6B 2H18A 2MINB 3WJ1A 3FYUA 3O5AA 3UV3A 4KG7A 1X13A 1VKNA 4L02A 4LG1A 2W6NA 4C4TA 2YCLA 1B6SA 1KWKA 4OU4A 3JQFC 1C29B 3UCXA 3BWEA 3CPEA 4DJEC 3DJFA 3HLYA 3P2IA 4G01B 1YZFA 1F6WA 1I4EB 5BQ3A 1R74A 1WKVA 3IRVA 4IQGA 4ZEVA 4KQFA 3OLQA 1U2PA 4YJ3B 4B8YA 4ANFA 2DX7A 4WINA 1VSBA 4NS4A 2XUJA 3LWDA 4HJXA 2HQRA 3WLJA 2EOAA 2GK6A 3L43A 1DX6A 3A1UA 4JLBA 2JC3A 1I10A 3FR8A 4JXXA 5EXTA 3OEEA 4NTZA 3DZKA 1D1QA 2HV9A 3RLFA 5C8DA 2E4UA 4MUKA 1OYVA 1L6IA 1RTTA 4IVNA 4L0DA 4RD0A 4N03A 3N86A 4BO9A 3QVOA 2C84A 2OSBA 1M2OA 4J0KA 1NASA 4B3TB 2XUAA 4H08A 2I9KA 3KVRA 1TQHA 3BXGA 3LUPA 5TQ0B 2XMDA 5FUVA 1R18A 3RQIA 1O6CA 2W6QA 2XQJA 2F9FA 1J6UA 3MQFA 2IHTA 1J0EA 2AOXA 4BNVA 4DCMA 4DGQA 1CZLA 1GFZA 4JC8A 4DHWA 3COYA 4HCJA 5CYGA 5K6AA 1Z35A 1Y4ZA 3H5RA 1I4OA 1ND6A 1TT5A 1WXEA 3E3AA 3NKVA 4UCFA 2OLKA 3A3YA 3EVTA 5T6BA 4LCJA 1JWAB 5EZSA 1ODLA 3JARA 5CVEA 1GA1A 1VLVA 2BFCB 3WJ7A 2H4YA 3OU6A 4X97A 5J5VA 2ES4A 4MRVA 4ZICA 2VZ8A 1XG5A 4CKEA 1CRZA 3Q7QA 2NNWB 1Y3HA 2PNFA 1FTSA 1Z4PX 2YR0A 4C3OB 2MWMA 2OILA 5EIAA 2I4OA 3IEKA 1EP1B 1KAOA 1WZUA 2FE4A 3DB1A 4EYGA 2IL1A 5DM60 3U7GA 4PINA 4X8HA 3HFJA 4HBGA 3KKKA 5L7WA 4GDFA 2QJFA 3DTYA 2DUNA 5B6PA 1EEXB 2A5JA 3LGXA 4KOAA 2HMWA 1ISJA 1VXOA 3Q5EA 5FUQA 3ZDDA 2O5RA 2ZAMA 3UMMA 4MKRA 4JLPA 1LV8A 5GVRA 3V00A 4WN9A 3QIAA 3ESYA 3Q15C 1OFUX 2NZWA 5HUQA 5J40A 5GINE 1IZ0A 1ZL0A 1IZ7A 4IV8A 3L8CA 5LXTA 4WCVA 5JEDA 4RTLA 3GRCA 1GCGA 5LB4A 1K2WA 2ZRQA 4ME6A 3EDCA 3TH5A 4DZZA 4BX0A 1IXRC 4B8ZA 3L4KA 4NJEA 1HQYE 2J4FA 4M49A 4G8BA 2HIGA 2OORC 5A5EA 3K9CA 1I3MA 1J21A 1XXHA 1ZH6A 2W90A 5EZYB 1KNXA 4MR7A 4R1PA 4RVHA 4N5LA 4DJDC 1EAYA 2W2MA 4BB9A 2JAWA 2I0FA 3BCRA 3HJGA 1VIAA 3A4MA 3C6MA 2JJ2A 1OI7A 5LQSA 4DRZA 1QSGA 1WV1A 2ZYSA 2YUIA 3B1WA 2EJTA 4HLQB 1X38A 5ALZA 1QYRA 3VPXA 2AMFA 3CO5A 2ZSIA 4ZHQB 3KJNA 5I7HA 1YULA 1US8B 2AKAB 4HUTA 1OLUB 3OOWA 2YTZA 1I1QB 1AKMA 5JJIA 3UOAB 3NRBA 1ZUNB 1TGVA 2VDJA 2YXPX 2WTAA 3TLGB 1QH8B 4DV0B 1QPZA 2GYWA 1VP3A 1MGOA 5TS3A 1HTTA 2H4XA 2X0IA 3GT3A 4RFSB 4TTQA 3TBKA 1GTMA 4E2XA 5IABA 5FRDA 5HUJA 1PWHA 4O3FA 1XTRA 2P4UA 4C0BA 4N39A 1XQXA 4RAQA 3UENA 3IXLA 4K81B 3I5UA 4PG6A 4L27A 1MQ8B 5JYBA 4MYSA 4H35A 3V7UA 3K9NA 4FIZA 2IPMA 3EIXA 4WJKB 3RTGA 3T34A 1ZCFA 2AUTA 4QG7A 4J29A 4OXXA 3T9BA 4Q5IA 4HQKA 3OQNA 2VP0A 1DWPA 3NM6B 1MDFA 4CE6A 1ZH2A 2F6RA 2VPIA 3N7UA 1AZTA 2EL9A 4JLVA 1IWBB 3T7IA 5GM1A 5JH7F 3QPDA 3OM8A 4O2AF 3WBJA 2F43A 1J1IA 1D2MA 4LRTB 3ZDFA 3E23A 1N5OX 1BQ3A 2Z08A 4WGGA 1GWNA 2QRKA 1MJGM 4B76A 3QWHA 3VZSA 4NDAA 4PAGA 5LKRA 2PGXA 1U04A 1DKPA 4G37A 4QOJA 2F2TA 4YHBA 2BRUC 2HPVA 5KVCA 3IUSA 1VE7A 3Q10A 3WX0A 2R4TA 2PVCA 3L49A 3OCYA 2C7BA 1PK8A 4RCVA 5HUHA 3NHZA 2VJBA 4BVKA 2YZ2A 4TRMA 4CYMA 1SC3A 3LT1A 1O0CA 5AVQA 5ENZA 6CHYA 5IJWA 4RA9A 2XODA 5F2NA 1UQTA 1SB9A 3JXEA 4MHTA 3RWBA 3R6WA 4IRUB 3I30X 2O8DB 5HMLA 4QD3A 3SX0A 3QF7A 4YJ3F 5D7BA 1K4MA 1WRBA 3I9OA 1L4MA 2YOHA 3R6DA 4OAQA 5DCWA 1ZD1A 2DFPA 1IBLB 2G83A 1RLIA 5JVDA 1AGXA 2ZU6A 2P6UA 4S1OA 2QPLA 2OM2A 4L8VA 5F78A 5ESDA 2R7LA 3CEHA 5BPHA 2EW8A 3GPBA 4LHWA 4MVJP 1IHPA 2Q5QA 4NYMQ 4B4UA 4C87A 2HBZA 4I1RA 4LTNA 1H2HA 3TOZA 3OTHA 1YS1X 1OPXA 2ACWA 4BLQA 3T41A 3H84A 1OAKA 2BDUA 3AB7A 4CLEA 3I39X 4CEHB 4OOEA 1Z28A 4Q4AB 1A98A 2YOGA 4U6SA 4WBNF 1K6JA 1U9CA 1KU6A 3CSDA 3IPRA 4BKPA 4FW8A 4G0PA 2G70A 2XUIA 4TTPA 5F77A 2E82A 3G49A 3HDHA 1P1RA 1ZHHA 3WYNA 2JFFA 2R86A 2X0NA 5KJ6A 3GI1A 1L3BA 2QTBA 4ZDWA 1UBOS 2BLNA 1FOEB 3DKKA 1L4NA 4ZALA 1MVNA 2ORIA 1LV7A 4CLOA 2LCFA 1GR1A 3H19A 2NG1A 1G5RA 1PJCA 2BBTA 2HRDA 4HPWA 4ID9A 3AR4A 1UPBA 4OKNA 4U7HA 1FJHA 1RXYA 1QGED 4MULA 3D3EA 1C30A 2NXCA 4LXQA 1DQSA 3H4IA 3KRTA 5CFQA 3TECE 1WL8A 3ND6A 5IDQA 1H93A 2HJRA 3Q7TA 3P8ZA 3ZNOA 4BBJA 1XKXA 4E33A 3IURA 1RAAA 4JWTA 2JARA 4PGMA 1KMHB 1JHVA 2H9AA 3TQSA 3RK0A 3SSMA 4B6RA 4DCJA 4DFDA 3B1ZA 3OO0A 2AEMA 1JI0A 1YAHA 3HWWA 3JQBC 4Q48A 4I2VA 1C8KA 1ORRA 3JYQA 4FE7A 3H3FA 3OPYB 1P1BA 1SU4A 3B20A 3DP7A 4NKRA 3W6NA 2J07A 2IZ0A 4IDEA 3O8NA 5EYPB 4NJMB 3D7SA 4RVSA 1VG8A 2QE6A 3WRWA 4DY4A 5J4HA 2ONKA 3DL4A 3PKZA 3BF8A 4CN9A 5M3BA 3UY4A 1J0DA 2RGEA 2VXOA 3S44A 5KTPA 4QOHA 2C2BA 4EI2A 3MLBA 1LVGA 2GN4A 3R3VA 4BVAA 4D9BA 1Q22A 4PLZA 4F92B 2V7TA 3R7LA 5LL6P 1T8PA 1LLCA 1DCMA 4TROA 1OILA 3OX1A 3PP8A 5JBNA 2I62A 3G0CA 4IQFA 4XJTA 3X1KA 1AUXA 3LF1A 3LECA 2J32A 3M4JA 5CFMA 3I9V1 4ESOA 4CFYA 3UV6A 4R2IA 5K6RA 4ZHQF 1Z7BA 2BGJA 3SZLA 3ZZTA 4HS4A 1APBA 4NV0A 3EEFA 2O5VA 4XTCS 3GZTB 1EWRA 1PR1A 1DBPA 1QIGA 2AN9A 2GZSA 5HEKA 3NUZA 3TPFA 1GA6A 1YZYA 1JYEA 2C95A 1JQKA 2PTGA 2R6FA 3VBCA 3PQFA 1Y5IA 3R7WB 4HQFA 2LGJA 2O4CA 3L1HA 2A2ZA 3P0RA 3NM5A 4X93A 5HS6A 5KQLA 4YO7A 2QQGA 1IXKA 1Q0LA 2PRIA 5AIBA 1AZWA 4GUAA 5DYIA 3AM3A 3IIEA 3RFCA 3SNHA 3K6SA 2RGBA 4DM3A 1P39A 1U8CB 2R25B 2C9ZA 2GEBA 5AUOB 5A0TA 3LRXA 1D4OA 2I2AA 2FU5C 4I0WB 1ESCA 3KQWA 2XOKA 3I53A 2GXAA 4EW1A 2B92A 1JHOA 3E4DA 4HF7A 4LFAB 3DYBA 4PAOA 4C0LA 1W5AA 3THYB 4XWWA 3FBGA 5KYUB 4QQKA 4F5ZA 1GTRA 3JVVA 3IXMA 3MUFA 4FDTA 5E6UA 2JLUA 3CNBA 1XZQA 2D1FA 2CVHA 3STXA 3JWHA 4J94A 4R40A 3EOZA 3ISJA 2YWRA 2JFGA 4HQ0A 4RY2A 4ZEXA 5CB6A 5MF6A 2IXDA 3A6DA 4B4DA 1DQPA 2I3BA 2OV1A 5DPMA 2AOWA 3QVXA 4ND7A 5CB4A 4QIHA 2VP3A 3QEJA 2VYND 5JAQA 2VAVA 5HZGA 3RSHA 1YS6A 1T2UA 4G07A 2CXNA 4QWMA 2OV8A 5EE5B 3O3OB 2E4AA 1IQ0A 1VJCA 5T8KC 2OKCA 4O2LA 4LKRA 3FTPA 5H1YA 3WBBA 1XNRB 1BWRA 2CHEA 2PGIA 3VPHA 1ZR4A 3P45A 4QNRA 3RYHA 5BSWA 5IKMA 4DLBA 4FWTA 3L9XA 4DA7A 3ESDA 3QVTA 4QBGB 4P4GA 2QD3A 5D5PA 3B2QA 3F6CA 1BMTA 3QXCA 2O6LA 4BQFA 5AJTA 2DH6A 4TKLA 4P3XA 5EQTA 1FLAA 1E63A 1OLOA 2RGUA 5EKUA 1GG2A 3AUYA 4C0AC 1V9SA 1E60A 2HA7A 2NADA 3IOMA 4GBED 4B3SB 1WCWA 2MYNA 4RSMA 5BR8B 4BMVA 2XF8A 1HWYA 1DBRA 4HEQA 1G8KA 2AZDA 3ROMA 2IDJA 4IDNA 4ZARA 2QMUA 4FD3A 4JX9A 4D9IA 3I73A 4BNFA 4IVPA 2PFKA 4MVJM 1NX6A 5JDCA 2VYFA 1N5RA 5C81A 2B78A 2O54A 1B23P 4LXYA 4RK5A 4DQVA 3LUBA 2D8AA 4UHFA 5LZ4A 1A76A 2HMAA 1QRTA 2LE0A 4CTNA 3AEKA 7REQB 1UXKA 4F1KA 4FP9A 2JGDB 2XRFA 3MWYW 2CLMB 4CMGA 5IJ9A 3RVRA 3AXSA 3LOQA 3O4FA 3EGVA 4B7CA 3R3XA 4WGFA 3T3DA 1XWIA 3D59A 4XGIA 3AK4A 3NC1C 5G0UA 1EQ2A 1SKYB 1SVLA 2QAGA 3ASVA 1SO8A 3QELB 1NBIA 4GXQA 4IM7A 2OCDA 4AJ1A 5H59A 1KFCB 1GSHA 4U0JA 5FPTA 1W87A 1FVOA 3SBOA 5K51A 5KI6A 3SYMA 5H9WA 1WW8A 2BHTA 5FF9A 1Z5VA 2FWPA 3NJ4A 3SYNA 1U3FA 3BL8A 4LC9A 1LFAA 1K88A 3EXEA 1G42A 1HL7A 2JIQA 4OGWA 3KG2A 2Y1DA 3ZNPA 1I1OA 1OYWA 1FMJA 2D1YA 5IVPA 3ZHZA 2BFBB 5TMPA 4CRWB 1A9XB 1YNOA 1YC5A 4EDHA 2JFVA 3T3NA 1GG8A 1EVJA 3HU2A 4HTFB 3LO5A 1VOTA 4OI4A 4RZXA 3ZWQA 4MDEA 5F3WB 2VDOB 3CY6A 3N3AC 4PM4A 4PY2A 3X2FA 1YR9A 2R84A 4FIDA 5CYOA 1XZLA 1P2TA 1IH8A 3PPYA 3WY9A 3Q8MA 1KF0A 2IS4A 2OV4A 3IQHX 2IEIA 2LIVA 1E1DA 4PRYA 3SIPA 3G7NA 5CBPA 1JA0A 1WX1A 4DVGA 4N76A 1RLTA 1JHPA 2O14A 2WILA 2CLEB 3RC2A 4FNGA 1MX3A 4WXHA 5BRJA 2IYLD 1TPYA 1WNTA 1B15A 5HCUA 5JNUA 2DHEA 3FNRA 3SHOA 3FNEA 4R05A 1KE1A 2PX0A 3JQQA 3VZBA 3GJ6A 3TLCA 4DC0A 1MW8X 3QOWA 4WEOA 5SYMA 1QZTA 4QU0A 3ED1A 3ZY6A 5J3JA 3HXOA 4MQ5A 2JW5A 3UJ3X 1L8XA 1H0SA 3I4FA 5FV7A 4DLRA 4HRXA 1FYWA 3C6ZA 3I9JA 3FCOA 1HR0B 2IELA 4Q7EA 3UA3A 1ZK1A 1I0IA 3CFYA 4KYIB 3WBKA 1J2UA 3WL8A 2DWQA 2Z6AA 4IIJA 4MYTA 1QXSA 2J09A 3I9LA 1I7NA 1RP1A 3FY4A 4XSGA 2QSJA 2BSQA 5JSKA 5LB2A 1Q1BA 2WDZA 4W8GA 1KE2A 5JAUA 2FFJA 3O4VA 3W04A 1SZCA 1IOVA 4GX5A 2YJ5A 4TVKA 4YJKA 1GL6A 1UOEA 1UP6A 1ZCJA 2K2QB 3FPSA 2CMDA 2IYXA 4UDYX 4K9OA 2QQ0A 4H6VA 4X1YA 1W36B 1ND5A 3PQ6A 4LGVA 2EF1A 1Z3IX 1P9RA 2MSDB 4GP7A 2X6QA 4MPDA 4W8OA 4X1IA 4YASA 5FPPA 2NP6A 3M9XA 3QVKA 4D02A 3AR2A 1TEHA 2GJ8A 2NTNA 2NSJA 3FVQA 3FWHA 3PDHA 2BGKA 4RETA 4RIFA 5CDHA 5ALFA 4RZHA 1EE1A 3P9ZA 1L7QA 2C3UA 3JQ9A 4JNCA 1S2NA 4AJPA 2WU0A 5U4QA 3HVIA 2EFCB 3E61A 3PQ4A 1LI4A 3OUZA 4X8OA 1Y8CA 5FBLB 3ABOB 4E08A 1U7HA 2OCGA 1VIVA 2O4UX 3H5IA 3QOXA 3OLVA 3ST7A 5FAXA 4AM8A 4PZ0A 3DTVA 1BMFD 1DTWB 3OH8A 2WM8A 4R1QA 1RRVA 4UD6A 3OJXA 4ZVPA 3H4VA 2AJCA 5EWJB 3RSZA 3DCNA 4UHKA 1LZKA 2YHIB 4L6CA 2JKZA 1E32A 4FYKA 1VL5A 4G81A 4D5EA 1SVIA 4F93B 2ZG6A 4Z6KA 2EGHA 1NONA 1YB1A 1E9EA 1TX4B 4LJ8A 3WK9A 4J4BA 1RMTA 3T7RA 3VV2A 2ZUCA 3TG8A 2PS0A 4JBGA 2NZ2A 1C1YA 3R23A 1GIAA 5KTOA 1Y7HA 3F6EX 1YVRA 4H9GA 4BLVA 2Y1CA 4LAFA 3DHWC 2I1VB 2HHAA 4QTTB 3T9EA 4B1FA 2Q1SA 4S2EA 4Y2HA 4BCCA 4POOA 2SKCA 1CQIA 3ZU5A 1KTIA 4QVIA 3OUTA 2C57A 2I4IA 2HCFA 2IHKA 1J49A 2PM8A 1IB6A 3AJ9A 2WFMA 4O29A 3SQMA 1G59A 3JWJA 2B4AA 1TMGE 3EARA 1EFRD 3AU8A 1CHNA 4YS6A 4WKPA 2CDRA 1W30A 3RYFA 1XP5A 3AXTA 3KQOA 1R6DA 3MN1A 1ZA1A 2C1ZA 2E48A 2BUAA 2GJKA 1U5BB 4IAOA 4OOFA 4QT0A 2UYOA 3CC8A 3HYCA 5G0SA 1TYAE 4DUGD 3NBKA 4HGYA 2G4VA 2AXNA 3EF0A 1MB4A 3ZKWB 4C43A 4C20A 1PU2A 4GE0A 1ISHA 3ZCVA 1FC0A 3KLOA 2PX2A 3O93A 4GH5A 2AEFA 2NUBA 4KWCA 3QPWA 4W82A 3G2MA 4PSDA 3WGNA 4YV7A 5LNK6 3KU4A 3W7AA 1GR0A 1TA0A 5B7NA 1A8SA 2W48A 3BRCA 3BRQA 3R0JA 3AJDA 2RB5A 4HAYA 3KJFA 1ZI9A 1LTHR 4WUVA 2O2XA 1ZINA 3UAVA 4ARZB 1RXVA 1W6UA 3E58A 3D1JA 3I9V6 3R9IA 2HBQA 3V1YA 9GPBA 1EJBA 1RZRA 1KNQA 4FNAA 1WY5A 1L1FA 1ZVKA 3AETB 4I4IA 1BA2A 4NP6A 1YIDA 2WPDD 4CBVA 3GLGB 2Z56A 4TYNA 4TLCA 2ZSKA 2BJWA 1DAKA 3M70A 2QR2A 2R8EA 2WMDA 1K4YA 3WB9A 1BE1A 1TM3E 4Z54A 3S8YA 2DFNA 2AOUA 2ZYAA 4L4ZA 2WSSD 2GXUA 3ENVA 2VP6A 5DW0A 1I5EA 5T41A 4CM8B 1NLYA 3N8GA 4KUHA 3KOZA 2H9IA 3QUCA 2C5AA 4C6RA 4PV7A 4DR6B 2KE5A 1MQAA 2OHVA 3M4XA 3CKKA 1E3JA 1P4GA 4TTAA 2HA0A 1JEDA 2P77A 3PDUA 2HA3A 5DBIA 5C9ZA 3QI7A 2Q4RA 2XBMA 2ZJ8A 4A9AA 3BXHA 3DYVA 2Z9BA 4Y18A 4MV1A 3CB2A 2FF5A 3BB4A 2VYQA 2GBGA 2XA2A 3DBRA 3OLXA 4Y7DA 5T67A 2QGNA 2I6TA 5MFPA 3HCOA 1BSVA 2TYSB 3K6JA 4ALJA 4C08A 4CTJA 5HP4A 4YAKA 1INLA 4B4WA 2Z4TA 1EVZA 4I3HA 1HE8B 3A25A 3E18A 3MTIA 1AGRA 2ODPA 4L8YA 3PFKA 2J1LA 1DIOB 4Q3KA 2WAXA 4B87A 1NPDA 1D7OA 1J97A 1EG7A 2H7VA 4ARUA 2I8AA 1BMQA 2JLZA 4FHGA 5EP1A 3RPEA 3OFVA 1YKGA 2IEDA 2LKDA 2G1KA 3CHYA 1W4BA 3IO3A 3VVBA 4RVGA 3U7QB 3S2ZA 3NBUA 3UWOA 1C80A 2DPXA 5TPWA 4BP8A 2Q5EA 3UJNA 2H0RA 2QIPA 4NFHA 1T4BA 5DOZA 1DC3A 4LDNA 4ZVOA 1DAGA 1H69A 1RPNA 1CJTC 4E09A 1T8SA 3AONB 3KKZA 3QLVA 3QKWA 1GT91 4BFZA 4JB8A 3EG9A 1Z7GA 2ZJ0A 4PVCA 2Y77A 5H3HA 5BURA 4KQIA 1FF9A 1F5SA 5J4YA 4E4YA 1VSQA 4LZLA 2ZJ4A 3IBSA 4HGQA 3UWKA 1FUIA 1AHHA 2WABA 1VZ3A 1XRLA 3K20A 3SDZA 2VHEA 1TA9A 1Y3AA 5LP6F 1M2GA 1UFRA 4HNAA 4BGEA 3V7WA 4I9HA 4G0QA 3AR9A 1DINA 3H3XA 4R41A 4EYEA 5FBHA 2ZUTA 3PNQA 4LYEA 2C7GA 1ESMA 1RR6A 1VTKA 3HZRA 4NOLA 1NSTA 5DFAA 5F73A 3WSTA 1ZS9A 4L51A 4WK0B 1A9QA 1OGYA 4F9EA 2Q1XA 3G7UA 5K3BA 3IDSA 5CDFA 4RYLA 2YVAA 1XC7A 3PJDA 5JC1A 3VISA 4A03A 1EGMB 1G8SA 5KOJB 5JAHA 3BXEA 3A4IA 3TM5A 5H8WA 2NQ2C 4B2PA 3DCIA 3NV9A 2ILVA 4O2BB 3RNLA 1C1DB 2W5UA 3RGWS 1K97A 1QV7A 4L16A 2C94A 2NTEA 2DWCA 2OFWA 3OO1A 1XA4A 2G5CA 1JV2B 1XD9A 3PQDA 4EAAA 5FOQA 3MFYA 4KU4A 3G3EA 4KGXA 1G6HA 2FLVA 2QP3A 3DD5A 4LSGA 5IAGA 1D07A 3IUEA 3STVA 2OHJA 1N6IA 2XMQA 1H0RA 3QF4A 1S3FA 2E2WA 1E7SA 5A4AA 1TEZA 4PSVA 1ML3A 4UREA 4X41A 4EO7A 5IT4A 5KHAA 2R00A 1G20E 4JDUA 4US2R 1EX9A 3FRJA 5L6MB 1UKVY 1SKMA 1EUDA 3IVGA 4MO2A 2VCYA 4E1AA 2FV8A 6GPBA 1DQZA 4G6ZA 1R8SA 3AFNA 4O4HB 3LXUX 2UZ3A 4DXDA 2PR7A 2OGSA 1GN9A 1TQ6A 2QTNA 1WQ1R 4RKEA 3WB2A 1WBJB 2O19A 2SCUB 3IKJA 4MI3A 4D43A 2JAPA 2BDEA 2I4TA 3FFAA 3CNHA 3JYNA 3PE3A 2VCEA 3QW4B 4K05A 3B5EA 3WGYA 4G2TA 4F7DA 3NCHA 3NV7A 2OO3A 3SIWA 5AO9A 4M3NA 5EKTA 4Y9TA 3N0TA 2Q21A 1EFPB 3GCXA 4FD2A 2D7DA 3X1JA 4ZYUA 1X80B 1V8OA 4JLWA 1MG0A 4DLKA 4ER5A 1ULTA 4K28A 3L01A 4N0DA 2X3YA 1X74A 2OV3A 2EAUA 4LRQA 3X43A 4JJIA 5C8VA 4PCAA 5DWDA 2GKGA 2B20A 4YEDA 3NWEA 2L2QA 4R8MA 4TKUA 1XZGA 3DEFA 5CM9C 4RYDA 2DF8A 4HZUA 3U4HA 4BC1A 4R8SA 1DC4A 1CUWA 1ZM4A 1LS6A 4X61A 3IBTA 1P8JA 3OURA 3AR6A 2FNAA 4XYGA 4ZJYA 2AE2A 4XM2A 3GEMA 4BMDA 4UTVA 4BLRA 4O2RA 5K03A 4LWPA 1FX1A 4MVJE 2J6CA 3DS8A 4DCSA 4PLYA 2E3JA 3EGOA 3QJ5A 3HC7A 4PWYA 2CV0A 1TUBB 2OM6A 2PLWA 2P41A 4EHLA 5A4KA 1JFTA 4FM9A 3AR3A 3UFXA 1B41A 1DAPA 1WCV1 5DTMA 3SU8A 3GT7A 3TW6A 2B3TA 3G5UA 2IXBA 4BVGA 4DQLA 4ESVA 1GNRA 2QLNA 4PXSA 1UZAA 4B7AA 3VRHA 3EH1A 4C88A 2ZYHA 3K5IA 2Q5CA 3MYYA 5FPSA 2GFIA 5LQUA 3SQDA 1BCRB 4YJHB 3FROA 2QW8A 4OFZA 2NAPA 1CUJA 3T5DA 1A8UA 5JFOA 3BM5A 2WV7A 4J0CA 2NNLD 2JD2A 1KH1A 4WSOA 2TSYB 1FIUA 4PE5B 3U7HB 5JJ5A 1UXHA 4B2LA 2JJ1D 2XI4A 1GKIA 2VDMB 2YVUA 4GI1A 1Z5NA 2FB9A 3AB3A 3MGGA 4ZD6A 2ZCJA 3SX4A 1JAHA 1JAYA 1GGFA 2WTEA 2LZ0A 3BJRA 1UBLS 3BIOA 3AEYA 2B8JA 1BCSA 2CMFA 1HO3A 1BROA 2QAIA 1NM5C 2QV0A 1JQEA 3FF4A 1FFCA 2VF2A 3TDKA 3HFSA 2P91A 3JQRA 3KEMA 4KQ2A 1KARA 4FBGA 4PXAA 4RV5A 1VPWA 2DXIA 4HDSB 2JHCA 4D45A 1SUDA 2XECA 4M7OA 4ADSG 4WKGA 1MT0A 1VRVA 4IYJA 2B35A 4DMHA 2NQ8A 4QPNA 1CVIA 1NUPA 4RENA 2H5EA 2WM2A 3DA8A 1GILA 5I51A 1YTUA 2XB2A 1UIMA 1D1SA 4INZA 1QK3A 1E1YA 2C2WA 1D1TA 2JPDA 2OXRA 3AM5A 3BG5A 3SEZA 3UGQA 3QXGA 3SHVA 2HH9A 1UMBA 2J3MA 2QRPA 3LFUA 4FZRA 5HKBA 3KDAA 5IFLA 5E6RB 1KI1A 2PANA 3LQRA 2YCBA 2HTFA 3B89A 4RDXA 3TE6A 2PGAA 2PZBA 3ZWWA 2BR4A 3EA4A 4HWTA 4Z9YA 4AMBA 3IVMA 1TC1A 2B6NA 2Y1KA 4RK0A 4AD8A 4GMDA 3P96A 2WIGA 2CDNA 2QVYX 3AI7A 3CGWA 3X1MA 4LYHA 1N77A 3OFND 1DRKA 1FSZA 4LRSB 5I47A 1FS5A 4Z7NB 4CJXA 3C7KA 2J0VA 3D4BA 4XXHA 1EI9A 4P7GA 1T5TA 1NIJA 3DBOB 3O8QA 1LH0A 4IH4A 5FBWB 3S6JA 3RSSA 2BR3A 1U0NA 4NYJR 2GHTA 2ANBA 3E84A 3L0SA 2V7PA 3MRVA 3PQCA 3T1OA 2RHGB 3WRYA 3LPDA 3ICWA 4R2LA 1ZI6A 1Z4NA 1D1PA 1H2RS 4R1NA 4BEJA 3D4PA 4DE5A 4EKEA 5E2AA 4HN9A 2AC4A 5A5FA 4WKOA 1XCJA 2GPSA 4IPTA 5JCOC 3FYUB 4L4XA 3UCFA 5DSTA 1NW6A 3QUTA 3HMKA 3SQLA 3WLEA 4FHFA 3U4MA 2G7ZA 3ONDA 4ZQGA 1NPTO 3G0OA 2NGRA 2OBBA 1XCOA 3DR5A 2WWVD 1QDUA 2OP1A 2AYYA 2FP4A 4QDZA 2QVZX 1OUMA 1EP9A 2O2GA 1QTIA 3KSUA 3QGMA 3D7KA 4EPWA 4LOKA 1ZO8A 3TMKA 3VYSB 4JI0B 5FO1A 2PEZA 2YXBA 2QMQA 5C2JB 4IIYA 2DY1A 3O8DA 4QRHA 3IMKA 3K73O 4OXKA 2YNMC 1NAIA 3AHCA 4LC1A 3CF4A 3EH2A 5FOXA 3G2OA 2BGNA 4TQGA 4ZXFA 3UJCA 1G3RA 2JFWA 5LVAA 1IDN1 3G9UA 4UUOA 1B8VA 4BP1A 4HAUA 2VH1A 3DT8A 1B8OA 1LLFA 1G7SA 4NDZA 1F17A 3RI3A 1WUIS 1S7GA