1R4AA

Crystal structure of gtp-bound adp-ribosylation factor like protein 1 (arl1) and grip domain of golgin245 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
165
Chain Sequence
b'REMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTPSEMANALGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 1
publication title Structural basis for recruitment of GRIP domain golgin-245 by small GTPase Arl1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 52
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r4aA00
1LFDB 8OHMA 1D5CA 2NPIA 2PT7A 2ATXA 5AR1A 2NPFA 3KJGA 3HJNA 4OQMA 3SYNA 1HEIA 2AKYA 2WPDD 4GRAA 4CGZA 3SR0A 2IXFA 1II8B 4C0AC 2J0UA 2JLYA 1XF9A 1QHIA 2ZR9A 1N6KA 4QG7A 3AGQA 2IEZA 3K0EA 2W2TA 2GF9A 1Z83A 3TIFA 5A5GA 2CMKA 2FJUA 1TX4B 4JSYA 2BBTA 1XJ0A 2FGKA 2X8AA 4OKSA 1KTVA 3F5FA 5FL7A 1VCNA 4DHEA 2ZIAA 5F9FA 5H1YA 2YV5A 2TMKA 5DHFA 2GF0A 2ZRHA 2V7QA 3UWOA 1F2TA 3DL0A 3K53A 3ICEA 3OAAD 1Z6GA 4ITRC 2PZEA 2Q3HA 4AKHA 2IBMA 2OE2A 3MWKA 3SJBA 3UWKA 1N3BA 4R2HA 2QRZA 3RWMB 4B33A 3IHWA 2WTUA 4FCWA 5AK0A 2WJGA 4UXHA 5KHOC 2QT0A 4E03A 1Z6XA 1JAIA 1Q21A 2QN6A 3OE7A 3EA5A 1R5BA 4V03A 3UANA 1SKYE 1FQJA 1RFLA 3M1IA 5SZIA 1V43A 3I1FA 2XXAB 1OF1A 4B44A 1LF0A 4X8OA 3GMTA 2XNDD 2VQSA 4X8MA 1QG4A 5JWRA 3LVRE 1PLKA 3D8BA 2Q3FA 3LX5A 2ANBA 2WM9B 5F9HA 3WNCA 1IXSB 4G1UC 4G5GA 2NQ2C 4B43A 1AKYA 3IO5A 4QNMA 2GILA 2IYTA 4LBVA 4EPYA 3ADDA 1E79A 1ZINA 4EJSA 4TZ0A 2RH5A 4JSTA 4TLEA 3EASA 5KTYA 3L82B 3BS4A 3V4FA 1R2QA 1TQDA 4HZIA 1GRNA 3GCGA 5J4LA 3WP1B 2ODWA 3U7EB 4MYTA 1JR6A 3I5YA 3BJIC 2ZRPA 3AP1A 5SZJA 1SHKA 4U02A 2V55B 1IXZA 5EE1A 4KITB 4D2IA 4TYNA 4D25A 5H8WA 4I81A 4PQFA 1KI2A 3PXGA 4D26A 5C4MA 3C7KA 3AUYA 1VCOA 4NYJQ 3QKUA 4DEXA 3CPHA 1XMIA 2YINC 2HXSA 3LBNA 3VR4A 4EDHA 2ZM5A 4PO9A 1XBTA 3B1XA 4Q18A 1P2TA 2ERYA 4BZQA 3QSYA 3W8RA 4DWJA 1NG1A 2ZSDA 1E9DA 2JCSA 1FOEB 1DEKA 4W5HA 2O5VA 4EUNA 1BS1A 1A7JA 3LQQA 3GLHB 2DB3A 1QZXA 4LJ5A 3LV8A 4XH9B 5JJLA 2R62A 3KKNA 4B2LA 4EPVA 2GEUA 4M1MA 5EXTA 2W58A 2XTNA 4IEEA 4D0GA 5JSZB 1UAAA 4OQXA 3NHAA 1CXZA 2VF7A 3P4YA 4PHHA 3R8CA 5CK4A 4CW7A 3PENA 2BEKA 4IXMA 1E2IA 3DHWC 3CUEF 4DCSA 4MA4A 3KKQA 1GL9B 3B9PA 5KDOA 5L3VA 1MO4A 5CB6A 2WMNB 1F2UA 4M1OA 1QHYA 2PMKA 2YKGA 2JDID 4C2TA 3TRFA 4RD4A 1FUKA 1LS1A 1P2SA 1XTIA 2F6RA 3ADCA 4KLZA 4KO8A 3U3JA 4A8JC 4JS0A 3FMPB 4NDZA 3PUYA 5D3MA 1EWRA 1E9RA 1U94A 3IGFA 2ZJOA 3ZS8A 2QP3A 4MGIR 3U4QA 3C15C 3EPKA 4AWXA 1L7VC 3ZIAA 1R10A 4NCHA 2QNRA 3RRYA 3HYRA 1XJCA 3P32A 4UNPA 4V0MA 2SHKA 2FA9A 4L4UA 4RSGA 4M4SA 4EAQA 1W2GA 5E7MA 4PPNA 2EYUA 4GZMA 2QMUA 3Q7PA 1Q1EA 2FFQA 1AKEA 3ZVMA 2A78A 5JI3E 2PH1A 4GSYA 3ZVLA 3EWAA 2R2AA 1G7TA 1E0AA 2IW3A 3A4NA 3NXSA 1O3YA 3GJ4A 4F91B 5DNYB 3NWJA 3IIMA 4QGGA 3LBHA 3MGCA 4OHYA 1G8YA 1XX6A 2CE2X 4PSAA 3ZVRA 1NN0A 1TEXA 3F0TA 4P31A 1E1QA 3DMNA 3T35A 1G5RA 2GXSA 2XZPA 2FH5B 3IO3A 1Z6TA 2WJHA 2J9RA 1OB2A 4GOXA 4CT5A 3FOZA 4XOIA 4URZR 1QHSA 4MGZR 1ZCAA 4RZXA 1TAGA 5FUVA 4JVSB 5FL7D 4FINA 3CX8A 4TLCA 3HR7A 2ZU6A 4Z54A 4F7WA 2IWHA 1TQ6A 5CLQA 4ZO4A 2QL6A 1P75A 1YQTA 1X3SA 2B21A 3U7FB 2QBYB 2IYWA 1QHHA 4LHXA 5HKKD 3IPYA 1KSJA 4WBSA 2G9NA 2OZEA 3U3MA 2FPMA 3DKVA 1XXHB 3QVUA 4Z8YA 2ZRKA 1MV5A 3A37A 4RY2A 5FOXA 1RYHA 4DLTA 2J0UB 5K8LA 5IK2D 2PZGA 4HUQA 4URVR 1SHZA 1T8TA 1WP9A 4UKDA 2WSSA 1OXUA 2Z43A 4PR0A 3W5IA 3QPVA 4AG6A 5FPKA 3OEED 4DDWA 3TQCA 3AVPA 3IQWA 4TL8A 5DYGA 4B3DA 5JEDA 4F92B 1YZTA 3VFDA 1F2TB 1Z06A 3ZS9A 2FFBA 3LXXA 4OJKA 3X1XA 3REFA 1YR9A 4JLDA 2YVUA 2CVHA 1NVUQ 1OYYA 1BYUA 3P1JA 2Q9BA 1A2KC 1CULC 3THOA 2XX3A 4LWZA 4WXPA 4C0KA 4URXR 1Q20A 4TLAA 2ASEA 2OFWA 2V9PA 1YE8A 2GZAA 1E79D 1H8ED 221PA 2GJAA 2CLSA 3AH8A 1KO7A 4QHSA 3UMSA 4D80A 1NSFA 2IF0A 3VKHA 2VYFA 4IOKA 1W44A 5DLQC 4I1SA 4MYHA 2WWXA 2FNAA 4BLSA 1EESA 2GK7A 4RZ3A 1VYTA 2XTZA 1II0A 2CEAA 4NYMR 3WP0A 1KGDA 1GOTA 3K8YA 2O8DA 3MCAA 2JLSA 1PJRA 4J0QA 4ZIRB 2MMCA 3W6PA 2LWIA 4ESVA 1N6LA 4PO8A 4TT3A 2ZI5A 4TQ9A 1J8YF 3QBVA 4US2R 3EZ7A 2NO9A 5FPYA 4I1OA 4EJSB 4BFWA 2GDJA 3RWOA 1IN4A 4AK9A 1U0LA 3JZAA 3GLGA 2EFDB 4LY6A 1XMVA 3K0AB 4P4TA 4ZCIA 1UBGA 4NHOA 2CNWD 4P4SA 4URYR 1K6MA 1G7SA 1NLYA 1FP6A 2BHRA 3EIHA 5KNBA 1P4SA 1S8FA 2GEVA 3K0SA 4C3ZA 5KUTA 5JS8A 4F93B 2JAQA 4JBYA 1MOZA 2ZI6A 1WBBA 1OHHD 5DE3A 4MRPA 4FD2A 3CX7A 4Q01A 2REXB 1IONA 4C30A 1Z63A 4KSBA 2ZU0C 1T5LA 2W6JD 4BLTA 1WB9A 2F1HA 1HV8A 3GJ8A 2OG2A 2YC4C 1E0SA 1S96A 3EZ6A 1UPTA 1D9XA 3N5CA 4L16A 4DDUA 1E0KA 1OH6A 1FX0A 4ESHA 2QTFA 3EIQA 2J7KA 3R9IA 2XJ4A 2ATVA 3IEUA 3W5JA 1OKKA 2G1KA 3R9WA 4B2PA 4OHVA 4D4LA 4W9MC 1S1MA 2ZE5A 2WVJA 3I3SR 1AGRA 3GLIA 1DAHA 2FZLA 3BK7A 4YC7A 3KQHA 2ONKA 2GVZC 4K8OA 4PQRA 3VTKA 3R9XA 2BJVA 1AN0A 1D2EA 5E4FA 2OCBA 2PX3A 1F2UB 3QKRB 4I4LA 1DVRA 2C9OA 2E9SA 3B1WA 1NVWQ 3KB1A 1XTJA 2O8EA 3QVVA 1UBEA 2NMVA 3QY0A 1DAMA 3H86A 2ZVQX 3I32A 1ZBDA 4QJ4A 1SKQA 4R9UC 1CLUA 2BMFA 3U3KA 1LVGA 3L0SA 2WIAA 3U4QB 1T3LA 5GVSA 1E1QD 1W36C 2J41A 3O8BA 1ZU5A 2VEDA 3KB2A 4MRSA 1KI4A 2CCJA 3ZZTA 1XD9A 3T1QA 3PITA 5CDFE 1N0WA 2J1LA 3F8TA 4JIMA 2IUTA 1DADA 1ZW6A 2X19A 5DH9A 3R7WB 3SBDA 5J4YA 721PA 1WCV1 2D7DA 3MD0A 4LHWA 1Z29A 1R5NA 1G5PA 1KI6B 2YOFA 4A6XA 2ZYWX 3CW2A 4MQBA 2XNSA 2LKCA 4HLQB 5B58C 3KZ1E 1CR4A 5BN4A 4AKGA 2QAGA 4DDTA 4JT2A 4LPKA 3K9LA 3WNDA 1R8QA 2BOVA 1J2JA 2QPTA 1UKYA 4V0NA 5TMPA 1X1SA 1WF3A 3GJ3A 1T91A 4RD6A 4AYWA 1A82A 1F5NA 1UF9A 1IN7A 3WMGA 2ZYTX 2OAP1 1E99A 3FKQA 4EFNA 1E2HA 2FEMA 2JJ1A 5EXPA 3K0FB 3LDAA 1AM4D 2IYZA 1J90A 5TVKA 2QUZA 2ZAMA 3ND9A 3TUIC 4DSTA 4B3CA 1AIPA 4NH0A 3TE6A 1NP6A 4JVMA 1M2OB 2H17A 4DIDA 1N0VC 4M9SA 3I73A 2KBEA 1E9CA 1QHHB 4KFTA 4TTPA 3O8DA 4UNQA 2V54A 3CR8A 4C0BA 1E96A 2A2ZA 4QBIA 2OCAA 5L3SA 2VF8A 1TQ4A 3TSOA 5JFGA 2WMOB 1KDPA 3CH5A 1LV7A 4RFVA 3LW8A 4HUQB 3U44A 2JIZD 3PEWA 2DCUA 1GDDA 2WPDA 3U61B 2ECKA 2NO6A 1YZKA 1ZM9A 5DIFA 3WYGA 2NOAA 1W0KA 2WJIA 1S4QA 2C2HA 4FMCB 2KJQA 1AK2A 3RANA 3CNLA 3ZD7A 2F3RA 2WIBA 4OJQA 3QF4A 4GMXA 1YR7A 2VBCA 2HLDD 3BERA 4R7ZA 4RCYA 2GXAA 4LK2A 1Z0IA 2FN4A 5J4VA 1Q3TA 4C0LA 5AJXA 3ONWA 1Z0DA 2BWJA 4B73A 1DTSA 1ZM2A 3SQWA 1CU1A 3OHMA 4M9ZA 2R6FA 5FBQB 4Q4HA 4B35A 2R6CA 4PPQA 2GXQA 1Q1ZA 3KXKA 4JLAA 4WAUA 4F4JA 4A0HA 4HZUA 4YXWA 3AVXA 3T5GA 1OV4A 4A36A 2IYSA 2YWGA 2YZ2A 1EX6A 1N5IA 2CK3D 5AJWA 3UMFA 1W4RA 2D06A 3W3AA 4URWR 4CVNA 3T1VA 4W5WA 4UJ5A 1IJFA 3WHKA 2OEPA 2P6NA 4DBLC 2O8DB 1PLLA 3ZQ6A 2NIPA 5LBIA 4TSFA 1M74A 5EE5B 2Q21A 1NN3A 3BE4A 4N0DA 4TTQA 4CT4B 2GJSA 3B1VA 2PJRA 4OI2A 4KBFA 2IS4A 1OIWA 3GLFA 1S2MA 3KJHA 5CYOA 3AVWA 4MYCA 2V3CC 4M53A 3OESA 4UXJA 4M8NE 3I8XA 1AGPA 2J45A 2LCFA 1BOFA 2C95A 2QE7D 1ODFA 2QI9C 3OIVA 4HLCA 1L4UA 2VHUA 2WKRA 2WSMA 4D4JA 1Y3AA 2CHGA 5KDLA 4JLMA 2JGNA 2OT3B 2WJJA 1Z5ZA 1M7BA 3HPQA 1OKKD 2BIFA 4RKFA 4QHTA 4YONB 821PA 5DGXA 4LUCA 1RRPA 1CP2A 1TNDA 3ECCA 2FGJA 2QP4A 3AF1A 2CL0X 4TMVA 1G8HA 3LBIA 4D4KA 1W48A 2GEDA 1NI3A 4IFEA 5HPYB 3IBYA 3O8RA 4NYIR 1NF3A 3QUSA 4Z51A 3B2EA 5FH9A 2HF8A 4B34A 4HB4A 3G0HA 1LW7A 1E6CA 1JPNA 5DISB 3VR5A 4MH0R 3UPUA 4M21A 4YMVA 2OBLA 4LHYA 1XEWX 2N1BA 2OLJA 1FX0B 3B78A 1JJVA 4OK3A 2ORVA 3NBFA 4EPXA 1VHTA 3V00A 4NBSA 2NO7A 1MH1A 1QRAA 1F60A 2RHMA 1JB1A 1L8QA 3ZH9B 2GHIA 1DS6A 5JHGB 2W6ID 3NIBA 3VR6A 4UNRA 2ZE7A 3GJXC 3GLIB 3TR0A 3MFYA 3AVOA 3EC1A 1MO3A 2QMOA 1U0HC 3PFIA 2A30A 4V0KA 2B92A 1FMLA 4NPHA 3HU2A 4OHZA 5L3QB 4MGYR 4W5JA 4JJKA 2OFOA 3CRQA 3W9YA 5JEEA 4P3YA 2ZS8A 2RGNC 2PBRA 2O8EB 2QMHA 3B82A 3UG7A 4DCTA 4LZZA 4Q21A 4F4CA 1NMZA 3FE2A 2WWGA 1NG9A 4HEJA 2ERXA 4ZDIA 4P33A 2JDIA 1DBSA 1KY2A 4R98A 1QF9A 2YWEA 1XP8A 3OEHD 1BMFD 3R20A 1CR1A 4X8HA 5EZ6B 4MRRA 1P7CA 4F38A 1KSHA 2ZJYA 3RS2A 1GKYA 2GAAA 1EX7A 2MSCB 3VKWA 5KDDA 4LCBA 1X6VA 1A5TA 3MJHA 3EPLA 3CX6A 2IX3A 3FDIA 3THWB 1ZVQA 4OHWA 1ZCBA 1NLZA 3W8NA 1R0XA 4BASA 3MWYW 3EC2A 3D31A 3NEYA 4RD3A 5AUOB 2H8KA 2ZJ8A 3BRWD 1EFRD 3OZXA 5JJIA 2ZANA 3MAAC 1G21E 4UXIA 4D4MA 3QXSA 1N0UA 2D2FA 1GTVA 2ZTSA 3LXRA 5LDDC 1OH7A 3TBKA 5JZVA 1BO6A 1GIAA 3SYLA 4BQSA 1TF5A 3HPRA 2BC9A 1NY6A 4NTZA 5ANRB 4C7OB 2IS2A 1IY1A 1G8PA 1W0KD 1E9SA 4RD1A 3HR8A 4FMDB 3VMFA 4C0HA 3K1JA 1WMSA 3GQBA 3LWNA 2UZIR 4NZYA 5FBVB 1EFTA 3QBTA 3AM1A 3IHLA 1CIPA 1GFIA 1T0HB 1VKJA 3CZQA 5B2ZA 3W90A 3HU1A 3BFKA 2IYVA 4L15A 2ZRDA 4XWKA 5L3SB 3CB4A 3OIYA 4HI0E 1G20E 1RIFA 2C8VA 1KSFX 4P4UA 1YHNA 5FUXA 3QENA 5F2EA 4YXWD 5HKKA 3WYFA 3TK1A 5J4KA 3U44B 2GCNA 1G8FA 3WRXC 2ZPTX 1RJ9A 1U8ZA 3GLHE 2R6DA 4PTLA 4HLUC 4ASUD 1OXXK 5IK2A 1GNQA 3HDTA 3CR7A 2FSFA 4KLNA 5CLLA 2IHYA 3OEEA 2O0KA 4A6PA 4TSFD 1KK2A 2F43A 2IT1A 1OIXA 4LV5B 4W7SA 3SHWA 4OL0A 3ICQB 3PUWA 4CF7A 4RJLA 3RS3A 4Q4HB 5EP1A 2FDCA 1FL9A 1P5ZB 2NO1A 3Q9LA 3T12A 2WJVA 2VH5R 2N42A 3Q5DA 3RDPA 1AZTA 3NH6A 4B6EA 5P21A 1NN1A 1KI1A 2B7CA 3K0CC 4OQLA 5FL3A 1UBCA 1Z0FA 2EU8A 1GILA 1GKIA 2RCNA 2C78A 1H8EA 1UKEA 3QI2A 4ZCLA 4A9AA 2D62A 1W0JD 2DY1A 3VU9A 4CEJA 2YOGA 2ZSFA 4AD8A 2X2EA 3D6TB 3FYHA 4ZCMA 1T8UA 3F3YA 4ARZA 2ZR7A 2RKOA 4TTRA 2QAJA 1RPZA 1KHTA 1YRBA 1NL3A 2QPOA 3GLFB 3DDCA 1T3HA 5J4HA 1CRQA 4B3GA 4XTRA 2V1XA 2P5SA 2ZEJA 5IDVA 2ZUBA 3SE0A 4PSVA 4H9GA 2QSZA 4AC9A 3BH6A 3BIFA 3TH5A 4M2LA 1XMSA 4PC6A 2O52A 4DJTA 1AS3A 1I4LD 5H68A 4YQFA 1J8MF 5DI3A 1KI7A 4HAUA 1FNNA 1RKBA 2CVFA 2CNWA 4LC0A 2OUKA 2H7VA 4A8JA 1DG3A 2NZ8A 3A36A 4IOLA 5TDHA 1KDRA 2AN9A 5FTLA 4TYQA 1OHHA 1XD2A 2GBLA 3DOEA 2P2LA 1VIYA 421PA 2ZI3A 1VG8A 3IKJA 1SXJC 5GJVC 3ZLJA 2H92A 1LNZA 2W6JA 2WOJA 4IFBA 2J59A 4FWIB 1B23P 2EW1A 1P3JA 4XD7D 2FF7A 4DLUA 1FTSA 5FTKA 1MKYA 2HCJB 3NBXX 4JJZA 5AJZA 3EZFA 4IKEA 4RZ2A 2O8BA 4GT1A 1XXHE 1Z08A 1N6NA 4TMWA 5AUNB 2ZR0A 2DFKB 1UEJA 4O2RA 5L8VA 2AKAB 1KZGB 4Q03A 2AWNA 1N6RA 3VNVA 1Q3HA 1WE2A 3BD9A 3DOFA 4BE7B 1X86B 1FQKA 3FWYA 1M6NA 1RRFA 3PUXA 3Q85A 3THYA 4B75A 3H2YA 1EFHA 2IS6A 4IOMA 1MABA 4P32A 5GVRA 1ZNXA 2MSDB 4PC1A 1C1YA 1OFHA 4Q47A 4PX9A 2QRNA 2QTHA 3BORA 2GK6A 4NL4H 3CONA 3NH9A 4IRUB 2OXCA 4US0R 5JCPA 5TARA 4IJMA 3TW8B 3BB1A 4QXAA 3R8FA 2RMKA 3NC0C 4PHFA 4QGAA 4TMXA 2D7CA 1AJEA 3M0EA 5EUMA 1W5TA 2XZLA 2QG6A 2PLRA 1W36D 2Z4RA 4HDOB 3ADKA 3CNOA 4G01B 4QC2A 5BN3A 3VR3A 1HTWA 4YMWA 3RYTC 2NZJA 4OK5A 4M1SA 1G291 1C9KA 1OXSC 4KJZA 3LQRA 1D2NA 4Q1FA 3VX3A 1E2NA 5F3WB 2F1RA 5KNDA 2ZE8A 5FOUA 3C16C 5KPJA 3CZPA 2DFLA 3EAQA 2HEIA 1HH4A 1X8LA 1Z8FA 1HY3A 2QPAA 4DSNA 3CIOA 4ZKDA 4DIEA 2W83A 4OHXA 3JVUA 3PG5A 4LHZA 2XB2A 1AQUA 521PA 4BEJA 1G6OA 1N5LA 1P9RA 2OBMA 3TJZA 1OB5A 1WA5A 1SXJE 1XB2A 3VX4A 3LD9A 4B74A 2QQ0A 1G19A 1NIPA 3RABA 3SJZA 2KI5A 2IUSA 2I4IA 1R0YA 4IW3B 2G6BA 1NBME 2FSGA 4Q4AA 1KDTA 2YHSA 2GWHA 3NDBB 1FUUA 4LYFA 4TLBA 1SGWA 1IOZA 3AF0A 2F3TA 4Q9IA 1NNEA 1FZQA 2VP4A 1QBKC 2ORIA 3HYTA 2H5EA 2V4ZA 3L0PA 4K46A 1WXQA 3ZD6A 4IDNA 3VQTA 1KJYA 2EFHB 4TMTA 1SVOA 3EX7C 2D2EA 2WWHA 2FFHA 1COWD 2A5YB 1W1WA 3PEYA 3U6KA 3B85A 4O0MA 1RJ9B 5H70A 4POAA 4BFVA 2BMDA 1T4GA 1FFHA 1Z47A 1DO0A 1M7HA 1ZM7A 1T6NA 1NLFA 4AURA 2ZE6A 1VDZA 2JIZA 2ZVPX 3LW7A 5DSZA 4TQAA 4ZI3A 1VYVA 4MUBA 4GBMA 3WHLA 1ZM4A 1RE0A 2F43B 4TL6A 4LGMA 4JLNA 4E07A 1E2DA 2B8WA 3B8HA 1M34E 1OIVA 2ZRBA 4QBFA 5HCNA 4OQFA 3KQUA 2BDTA 2HLDA 2KE5A 4KFSA 2Z6VA 4C0QC 5LPNA 4YMSA 5JBQA 2GNOA 2O8FA 1P9WA 2GZDA 3VR1A 2BV3A 3AVTA 1D2MA 2AXNA 2H18A 1Y63A 2WBLC 2QZ4A 1SXJD 2WAYA 4Q9KA 2VHTA 1MT0A 4HB0A 1FPMA 1N5KA 3TMKA 2VHCA 3EW9A 2J0SA 2VO1A 5FOSA 1NBMD 4EFMA 1CJUC 3VU9B 4CEJB 1GL6A 3EA0A 1GRQA 2CK3A 2BM1A 1FP7A 1HE8B 3DM9B 4ARZB 3RVBA 3OIWA 1U90A 4V0ME 3QG1A 2ZITA 3LA6A 2V1UA 2A7QA 4JBXA 5C18A 4LJ8A 2YOHA 1KJZA 3GJ5A 4KYUA 5FPSA 3RS7A 2HJGA 2P67A 2VP0A 3K9GA 3BGWA 3K70C 1YZGA 4LJYA 3SI7A 2VIIA 1QHNA 1CR0A 1J99A 1U8YA 3BWDD 1XFAA 3B5JA 2CXXA 3SJAA 3V4RA 1N6PA 1XU4A 1WQ1R 2YYZA 2JATA 5K8UA 2F9MA 4JVLA 4LJ6A 5DI3B 2G1JA 3KJEA 2QE7A 4Q1BA 2OO7A 4JZKA 5EXSA 4YLGA 4LJ4A 1U8AA 1JALA 4GFDA 4MGKR 3IEVA 4ERNA 2K5UA 3O47A 3C14C 3THXA 3PV0A 4B32A 3B13B 4F4IA 5JHHB 5G40A 1XRJA 1Z0KA 4A8JB 2WHXA 3U7GA 4JLKA 3PEVA 4BLPA 5KPDA 2IA5A 4I1UA 4QGHA 4XVQA 4A82A 5SZKB 4E22A 1US8A 4IDOA 3AKEA 1DOAA 2HT1A 2GTPA 4NMMA 4EPRA 2ZXUA 3P27A 2V8OA 1HA3A 1HYQA 3K09C 4WIAA 5GJWC 1KY3A 3X1WA 2ZRIA 2REBA 3SEAA 4Q1DA 4LBZA 4KVAA 3H0KA 4RZUA 5CM9C 3EPHA 4YMUA 5FUWA 3TQFA 1KI8A 3MG9A 3TSWA 1V5WA 2MSEB 3AVUA 4DSUA 2QEQA 1MRSA 4BRUA 1BH2A 3SQXA 5HZHA 2IS1A 2BKEA 1N6IA 1IBRA 2DR3A 2BCGY 2HUPA 3VHXA 5D3MB 3QQ5A 3L0OA 3IUYA 1RZ3A 4X8LA 1E9BA 1DAFA 5KYKA 3FFBA 1OXVA 3MWJA 2W6IA 2QY9A 1CEEA 2ZJZA 4HB2A 3THYB 1DAIA 3AKYA 1F48A 1NKSA 1MABB 5TY0A 1W5SA 4DUGA 4KCGA 2PCJA 2IHBA 3CF0A 4FCTA 3ZZUA 2ZYVX 2AWOA 4A4DA 4Q9JA 3TW4A 4CZ2A 2WICA 3I92A 2AR7A 4KXFB 3A6PC 1JEEA 2CLDX 4YMTA 1IAQA 2H57A 1TU3A 2BMEA 1YRAA 3KX2A 2R65A 4NU0A 4NCJA 4RFSA 2AFIE 4M1WA 3TR5A 3FMOB 2Y8EA 2BVNA 1VG1A 1N5JA 1E4VA 2G0NA 1ANKA 3NDPA 4Q7MB 2WWYA 121PA 3U2QA 2OCYC 3A58B 4H1UA 4XJXA 5FBLB 1GM5A 4QOSA 1W46A 1I2MA 2VSFA 1ONBA 3FTQA 3OEHA 1BMFA 1U2RA 2JJ2D 3KFXA 1J7KA 1Z28A 4FMBB 3AGPA 5JI2E 2REOA 4IHQA 1KO8A 1DAKA 2W0SA 1W4BA 1IY0A 2L0XA 2P6UA 2QQEA 2ZS7A 1Z3IX 3LO5A 3CPEA 5CYPA 3VKGA 2P6RA 1I2DA 3LAWA 4BFSA 1XTRA 3Q72A 1EFRA 2DFNA 3CO5A 4RD2A 2DYKA 3QPUA 3A1UA 1K5DA 1ZIOA 4L9WA 4PANA 4TL9A 2VRWA 4JBWA 5KOYA 1E2FA 1DAEA 2WKPA 2GESA 3FB4A 4PO1A 1N6OA 1DPFA 1W49A 2OESA 4XTCS 2IWRA 3W6NA 2GCPA 3A1TA 3GD7A 1E32A 1E4YA 2HDNB 2HXYA 2J7PD 4TMZA 1XCGB 2EFEB 4L8GA 4Z1MD 2KBFA 5CB8A 4IVRA 5AWFC 3EG5A 3PVSA 4WZ6A 1PUIA 2I1VB 3SYKA 3LLMA 4NCIA 1KNQA 1KK3A 1X8KA 4H1VA 3CNNA 2UKDA 3KUCA 3B6EA 4HAWA 4PQYA 2CL6X 3WYAA 3ASYA 2IYXA 3A8TA 2Q6TA 4HLDA 5KSYA 4BZPA 4DLZA 1G17A 3K70D 4MKHA 1IQPA 2P5TB 1D9ZA 1P73A 4WOPA 1CJKC 2F9LA 2VPPA 3A4LA 3LH5A 1XEFA 3T34A 4JLVA 1E0JA 1U0JA 2XAUA 3LY5A 3RRNA 1J70A 2EWWA 2OM2A 2QMEA 4LBYA 2VLIA 4ASUA 3GLIE 2B8TA 2CBZA 4R71A 2OV2A 2IL1A 1E9EA 1M1YE 1UFQA 1DE0A 2ZRAA 1IY2A 2B7BA 2DWPA 3P20A 5FTNA 3GJ7A 3PJRA 4EPWA 4LV8B 1NVVQ 1Q44A 2Q3MA 2RAPA 5FR1A 1TTTA 4ABYA 1NMXA 3JVVA 1JBKA 3KTAA 1JNYA 3QXCA 621PA 3L2OB 1E9FA 3SFVA 2BBSA 5TB5A 3IILA 2W2XA 3GEHA 3T15A 1GG2A 1LB1B 5FPTA 4UQOA 3ZGXA 3U5ZB 3GLGB 3NG1A 1YZLA 2ZJ2A 2OSBA 1R0ZA 1RYFA 4P4SB 2IK8A 2ORWA 3E5HA 4WXRA 3SJCA 4A2WA 4PC3A 5FOWA 4Q7LA 4BFYA 1W0JA 2J0QA 4CEHA 4US1R 2VSOA 3HP1A 5D3QA 3TAUA 1G64A 2NO0A 4QM7A 2FZ4A 5BQ5A 1HT2E 3RC3A 2RGGA 1OW3B 2FPLA 2ZJ5A 3NKVA 4A92A 1R7RA 2ODNA 4DCUA 1DG1G 2ZSBA 5HCIA 5KSPA 4Q9HA 4IDHA 4KV9A 4Q4JA 5BWMA 1VPLA 2CJWA 3KJIA 4PPFA 3FPAA 1G41A 3A1WA 3KKPA 3U3RA 2VHJA 2ZUCA 1R5OA 3KFVA 4PC7A 4D0LB 2QSYA 3FHOA 4C2UA 4TL7A 2RGNA 2FE4A 5EP3A 4S35A 3THXB 4WA7A 4MKFA 3GLHA 2OFXA 2GKSA 2EFCB 4HATA 4HUTA 3AF4A 1OT3A 2KSQA 2ZAOA 1O87A 3I5XA 5TXGA 2G0TA 3W6OA 4QKQA 3SNHA 5HR5A 4FWTA 4MKIA 2AD5A 1YZQA 4DUGD 1VG0B 1NIJA 1AS0A 4TQUS 5EE3A 5J40A 3RHFA 3A1SA 1G9XA 4ZDKA 3REGA 5B64A 3C5CA 1E98A 4ACBA 1OFUX 3RS4A 5FTMA 2LKDA 2KB0A 4Q00A 1GAJA 1IM2A 1BYIA 1E1RD 2A9KA 4G5OA 4I99A 1W4CA 3WXMA 3NBZC 3PQCA 4XD7A 4HAVA 3AEZA 2NTYC 1YVDA 2YNMA 5E7IA 1XEWY 5E3HA 2ONJA 1E2EA 3I72A 2FV8A 5EXXA 2W00A 3KQLA 3MUFA 4U00A 2WWWA 1G1MA 1NY5A 2NGRA 4BRWA 2JLUA 3KQKA 2FOLA 2GJ8A 3U3OA 4B6FA 5GADl 5KU1A 6Q21A 1ZP6A 5JLJA 4C4PA 1KJWA 2AX4A 4PC2A 1TUIA 1OPXA 2GJ9A 1UKZA 4RFSB 1SVMA 4KU4A 3NVAA 1XTQA 1W7AA 4D6PA 1VECA 3FKSD 2QAGB 1HUQA 4A2QA 1ZUNB 1SZPA 1VCMA 5G41A 1Q12A 4I1VA 5J47A 5AJVB 4ACAA 4XVRA 1RVDA 4B48A 3QG5A 1B0UA 2QM7A 3PUVA 4OI0A 5FR2A 2DBYA 3FGNA 4GNKA 3HU3A 4PPGA 4HAXA 3QIAA 3UMRA 4HLUA 1CRPA 1SVSA 3CRW1 2E87A 1P6XA 2R8RA 3D3QA 3GLFE 4TYPA 3MRSA 5A0FA 1NKTA 4CEIA 3W34A 2FSHA 1YU9A 1JQJC 1IHUA 1G3IA 2EWVA 1Z0JA 4EQ6A 4AY2A 4LDJA 3AF3A 1DAGA 1U9IC 5AJYA 4KFRA 1TUEA 2F7SA 3VAAA 3SDZA 2FSIA 2QBYA 3L0IB 3I61A 5FBWB 5JRJA 3IDQA 3QXXA 3DM5A 5JMTA 2CE7A 2IXEA 3AVYA 2VA8A 1XXHA 2ZRJA 3CF6R 1GNRA 3RAPR 3RC8A 3EPJA 3L43A 4Z8XA 2JASA 3GEIA 3BB4A 3KUDA 1ESMA 1T9HA 3K0CA 2F55A 1VIAA 1ZRHA 1JR3E 3NBYC 4EPTA 4FW9A 5DO9A 3SFZA 2IYLD 2PL3A 4DSOA 3TVDA 2J0VA 4Q5IA 2RGCA 3QF4B 4B3FX 3ZJYA 1ZUIA 1FNMA 4M0LA 3ZYCA 3BBPA 3MLEA 3CWQA 3CBQA 2GA8A 5FFMA 1XMJA 2CDNA 2IF2A 2Z5FA 3U6BA 3N70A 4JKIA 4HZUB 4OBEA 1IN6A 1KOFA 1COWA 4G0NA 3WMEA 3RS0A 2JLXA 3EXAA 1CJMA 3GJ6A 2QT1A 5AUQA 2V6JA 4JL6A 2J3EA 4PAOA 2RB4A 2E1RA 4QFMA 2QORA 4YDHB 4HSEA 1HQCA 4WZBE 1D8TA 4KFUA 5DN6D 5HTKA 1KIMA 5G3ZA 3UG6A 1OFTA 3PUZA 1W2HA 4PAMA 2WZQA 4FCVA 1U81A 4ZIRA 3KTAB 1P72A 2BBOA 4MRVA 2P0EA 1IJEA 2QU8A 4PAQA 1EGAA 3BH0A 1TU4A 4UNNA 2F1JA 5KSZA 4L5BA 3OFND 3KKMA 3TSZA 1DELA 1OLOA 3RRZA 1Q1QA 3V9PA 1SXJA 1UADA 2RGXA 1NRJB 1KDOA 3K0AA 1UBFA 1XZQA 3SN6A 3ADBA 1CJTC 1NBMA 4CEHB 1JR3D 3BC1A 2AHOA 2OHFA 3QOFA 1FMJA 2GRJA 2AK2A 3MWLA 2RHDA 3TUJC 4BECA 4IXNA 2ZRFA 4U7DA 2GXUA 2ZREA 1QHXA 4JVNA 4LYJA 4BLOA 4TYWA 2VP6A 4PSKA 3SBEA 3SS8A 4Q4JB 4DZZA 2G83A 4DRZA 5KSOA 2C03A 2C04A 2CJWB 2PEZA 4EJSC 1XNJA 2XTMA 4LSGA 2CL7X 4QL3A 4B3BA 1Q0UA 4N0EA 4N3NA 3EARA 4A0RA 5BXQC 5DI9A 3B1YA 4XWAA 4AKEA 1KK0A 4MDFA 3QXJA 2JLRA 1G16A 1MR3F 1ZD1A 3CF2A 3DZ8A 3I8SA 1ZMXA 4OYHA 4ON9A 3WBKA 1R8SA 4XSGA 2EQBA 1KAGA 2ZETA 5G3YA 5GJCA 2RGDA 1UJ2A 1R4AA 5FUYA 1LF5A 4Y0AA 3UK6A 1G3MA 4DDVA 4GDFA 1GWNA 2QA5A 4GOKA 1EWQA 5LD2B 1SKYB 2BM0A 4NONA 2C77A 4GP7A 1G5TA 1EG7A 3W3ZB 3O8CA 2FMXA 1EFCA 1XDBA 4EIWA 1UEIA 1ZIPA 4Y0VA 2VP9A 4HYYA 3QKRA 4II7A 4DEYA 2IYRA 3QKSA 1AA9A 4LHVA 3ZVNA 4DCNA 1PVOA 4WW0A 3NHBA 1OYWA 4IOJA 1TEVA 1G3QA 5EE0A 4JLBA 2VL7A 3FMIA 4V0OA 5GJBA 4U5XA 2XOKA 5EUQB 3Q3JB 1ZC3A 1S1CA 2OBNA 1Q57A 1Z0AA 2GBLC 5M04A 1S3GA 1P9NA 4G5SA 3ZDQA 4AKIA 3J81k 1SVKA 5LB2A 1G8GA 2B6HA 2D74A 3DEFA 1ZJ6A 3U7HB 5C46F 1KMHA 2BEJA 2OLKA 3FVQA 2YJTD 4L9SA 3U60B 2XGJA 1YJ5A 4QJ3A 1ZU4A 4NYJR 1RRCA 3DKPA 2WAXA 4M22A 1LY1A 1UDWA 3R7WA 2EVWX 2R6AA 4OI4A 2GZHA 2C98A 3TAHA 2JLQA 1KI6A 2FPKA 4NYMQ 3X2SA 5B30A 3TKLA 3LRPA 3DPUA 1QHGA 3NTUA 2X1VA 3DMDA 1CS4C 1LS6A 4MDEA 4D81A 3KKOA 2OXRA 1N2CE 3A1VA 5FOTA 3H4MA 5K8IA 4AI6A 2QM8A 2JLVA 1XWIA 4Q02A 2BJWA 3IPXA 4O2LA 3TVTA 4JL8A 3RRMA 5JRZA 4LJ9A 3K0FA 1G6HA 4B47A 2ODEA 5FTJA 1HQYE 2JJ2A 1U98A 5KO2A 4CEIB 3I4LA 1GUAA 1GNPA 4IVQA 4EQ6B 2DPXA 3M6AA 2YWFA 3FMFA 2V7QD 2J46A 2RGEA 2PX0A 4E5UA 4UJ3A 3WY9A 1VMAA 3PCRB 4NKRA 1TF2A 5UKDA 1UM8A 1Z6AA 1ELOA 2XZOA 3GEEA 1E2LA 1R6BX 3AVVA 1ZYUA 2RGAA 4DKXA 2OILA 4Q19A 4DVGA 1ZNZA 1ZD8A 4TZ6A 2W2VA 3OE7D 5C4GB 4URUR 2JA1A 4CDGA 1UDXA 5BYKA 4GP6A 2QP9X 2ZRMA 2IXGA 2O8CA 5HE9A 1NSTA 4PHGA 3BAFA 4GOJA 2J7PA 1A1VA 2FX3A 5CITA 5CDFA 4ZV4A 4Z1MA 2N46A 4KHZA 3CLVA 4JLJA 1GP2A 1I4DD 1F3OA 2R44A 4KODA 2PEYA 2VHQA 2DFTA 3ND8A 4JL5A 2O0HA 4BUJA 3KXIA 4E09A 2DWQA 3RS5A 3VR2A 1IXRC 2O0JA 1TF7A 2HYDA 4GI7A 1PUJA 1WRBA 2VSXA 2ZRCA 2HV8A 2ZYUX 1E2MA 4XVUA 2PZFA 2PMDA 4HB3A 4WZAE 1KO4A 4M1TA 2FG5A 4LV6A 1VHLA 2HT6A 4QGFA 1A2BA 4OQNA 4PXAA 4FMCF 1S9HA 4M9QA 2GVDC 2JJ8A 2QGZA 3QXHA 1HE1C 3NEJA 2D4HA 2R6GA 2XSZA 4JYBA 1KK1A 4V02A 4D82A 4DLVA 1M8PA 4Q7JB 3TUZC 3SC3A 3AKCA 3X1YA 2UVQA 2EFGA 3FHTA 4HAZA 4A0FA 5IF9A 1A4RA 2F1IA 2C9YA 4MKGA 1XJQA 1G18A 3RSLA 1W47A 2GJKA 4EFLA 1NJFA 1CTQA 1SVIA 2G77B 4PZZA 1L4YA 5C1BA 2ZRLA 4GZLA 4TMKA 3AP2A 3Q5EA 3QPWA 4KI0A 1UKVY 2GCOA 4OK6A 1KI9A 1SXJB 3AUXA 1T3SA 2P65A 2QROA 3T1TA 5F98A 3MSXA 3WBJA 4EKDA 1XEXA 3K09A 3P26A 3KQNA 3A4MA 1OSNA 4FIDA 1GSIA 4HAYA 1CJVC 1JQLB 1P61B 3N2IA 4KAXA 5IRCD 3GPLA 2HCBA 2IYUA 2D3WA 1XPUA 1ZD9A 1LTQA 2PT5A 1MRNA 3C41J 1E69A 1GRRA 1P60A 2GAOA 1S0UA 4MUAA 4PZLA 1G3UA 4S2EA 3QE0A 1XD2B 1HT1E 4ILEA 4BFUA 2ZI7A 5CIWA 4B71A 1C4OA 1XD8A 2XEXA 4BZXA 2CHVA 4DT1A 3AF2A 4JKYA 4LX0A 1CF4A 4DC9A 2JLWA 1G4UR 4IVPA 2Q9AA 4Q66C 1JPJA 5BW8A 2XOKD 1KNXA 2A3RA 4Q1EA 5EP4A 2O8BB 2V6IA 3TGPA 4LBWA 3UXMA 1YR8A 5DYIA 3ZIAD 3MJRA 5FBRB 2AL7A 4JMPA 2WWIA 3MMPA 5FOVA 4BFTA 1YZNA 4CRWB 5K8TA 2WJYA 3IIKA 2OAQ1 3OF5A 1SVWA 2FWRA 2MMGA 4D0NA 1XZPA 2C5LA 2H1LA 3ASZA 4Q7KA 3BFXA 4PHTA 4LPSA 1NMYA 4ZKEA 2QGNA 3QKSB 1NN5A 5L3QA 3FFAA 2WV9A 4XSHA 3QJYA 2VP2A 3E2IA 4A2PA 1RC8A 2ZROA 3H84A 2J5XA 4QBGB 5JWHA 4RVCA 1JEDA 2HF9A 1E1RA 3T61A 5AUPB 4NCKA 4JLOA 1HURA 1RRGA 1S3SA 1XTSA 3RSOA 2CCKA 2ZJBA 3G5UA 1L2TA 4IEIA 1KMHB 2Z0MA 2GETA 1ZC4A 2AXPA 3G82C 2X2FA 3T06B 5HE8A 5CM8B 3Q8XB 3VNUA 1KAOA 1FW6A 5G53C 1SVLA 3NC1C 1QVRA 3AV0B 4LOAA 1WDTA 4Q1CA 1MO5A 2PJZA 5CJ2A 1U99A 1IN5A 1TL7C 4DLWA 3SU8A 3THWA 4G5QA 4DLSA 4A1FA 3CM0A 5LB4A 1JXMA 3AP3A 1Q1BA 1GL7A 3S1AA 1OFIA 3FKSA 1Z2CA 4KVGA 1VG9B 1H8HA 3GLGE 3BOSA 5J5CA 3QEOA 3SOPA 4A0GA 3QKTA 1TADA 1TPZA 3JZMA 2CHQA 5FI1B 4TYYA 2WSSD 4Q4AB 2P3SA 2XJ9A 2VP5A 4LJ7A 4LI0A 4C7OA 2AFHE 4PFSA 4Q4LA 1II8A 3CH4B 4ZPXA 2ZJAA 4M1KA 4BWYA 5EJEA 4G3XA 1XTKA 1KSGA 4DLRA 1E2PA 5BN5A 2XB4A 3UKDA 2IC5A 1PLJA 1H65A 2QAGC 3GFTA 1CR2A 3D7MA 3WNBA 1ZM3A 2ZSEA 2JLZA 3GP8A 2A5GA 4DXAA 1EXMA 1K8RA 3ETLA 1KI3A 2X77A 2DWOA 5EQTA 3EZ9A 4HDCA 4IDQA 1G4AE 5JWOA 4NYIQ 5FPHA 1P2UA 3LNCA 3PEUA 5JJKA 1NJGA 3AVQA 1ZNYA 2NG1A 3DZDA 3E1SA 4Q9LA 5CK5A 4BFZA 4RD0A 3L8YA 4BGDA 4C0SA 3AB3A 3EWSA 1OH8A 2O8CB 2ZRNA 3X1ZA 1OE0A 3OIUA 4QNRA 2ZSAA 2XSZD 2ZUDA 1Q22A 4FMDF 4DB4A 5ELXA 3RLFA 2FEOA 3Q7QA 3N2EA 2YC2C 3CRVA 4KYIB 3K9HA 1AQYA 1FTNA 1T5IA 2XXAA 4IDPA 3SHFA 1PV4A 3CPJB 4TT3D 1ZUHA 3OAAA 4MYUA 4OI1A 2YWHA 4MRNA 2O8FB 1G7RA 1MO6A 4FXPA 4ZDJA 1F6BA 1JXOA 2BCJQ 3ZQJA 2IUUA 4NCNA 4YDSA 1DO2A 1G7CA 4RCZA 3BH7A 3RNLA 3K70B 5HZKA 2AK3A 1XCMA 4MITA 2I1QA 1YZUA 4KBGA 3LVQE 4BFXA 3FHCB 5CIQA 3QNUA 5EP2A 3IIJA 2ODBA 1AZSC 4NP6A 2ZRGA 4A15A 3T1OA 4AIIA 2ZQ5A 1Z07A 2IEYA 3C8UA 4LYAA 4QM6A 4C0JA 2QTVB 5DN6A 4AYTA 5EZ5A 3PIRA 3L8ZA 1QDEA 4O3MA 2AD1A 4CIDA 2FU5C 1KZ7B 2XNDA 3E70C 1XPOA 4AG5A 2Z83A 5KNCA 3GJ0A 3B7GA 4JYCA 4LJAA 3UIEA 2OCPA 2WWFA 1WBDA 1OH5A 1GZSA 2GCOB 4GPTA 4TWZA 5DHAA 4LRWA 1QVAA 4JT4A 1KO1A 1T0JB 3OFNA 1XEXB 1P2VA 2R9VA 5JS7A 2C96A 1X1RA 3CWZA 4ZI2A 3C4JA 1E3MA 1YKSA 2G88A 4K81B 1IN8A 4N1AA 3KXLA 4KSCA 4LYHA 4FN5A 1KO5A 3X1DA 4AYXA 5IHPA 3DO6A 1RW4A 1E94E 2ANCA 3LLUA 2H16A 1JI0A 4V0LA 3B1ZA 1I4TD 1JR3A 2BKUA 4DLXA 5JECA 4B3XA 1S9DA 2EYQA 4HDQB 3KDSE 1G3RA 4DCVA 3UATA 5JSZA 1W36B 1VTKA 2ZS9A 2UZ3A 1EK0A 1US8B 1N25A 3GFPA 4B76A 2BBWA 1GVNB 4BPBA 2XITA 4UNSA 1XPRA 3QEJA 1KKMA 2Q9CA 1E2JA 3IQXA 1SULA 5TV2A 5B57C 3BB3A 3P4XA 2KWIA 2ZI9A 3B60A 3T5DA 4DT1B 5JCZA 1ZNWA 1CKEA 3LFUA 4JLPA 2HJVA 3QF7A 1D6JA 4FI3C 1JECA 1KKLA 1EFUA 1M7GA 3M4YA 4QRHA 1DARA 2WKQA 5A4JA 1Z2AA 1AS2A 5FI0B 2Z4SA 2A5DA 2PCLA 1VCIA 1KYIA 3C5HA 3LX8A 5EE9A 4Q48A 4DB2A 1GITA 1E2GA 1NVVR 4QBHA 1QG2A 3CRRA 1VYUA 1E2KA 3CKLA 1OJLA 1BIFA 1P62B 4G5RA 3WRYC 5E95A 4GMDA 1KMQA 2ZI4A 4RKEA 4QJ5A 4M1YA 4M9XA 2PLFA 3K9NA 4WVFA 4BLQA 4B2IA 1ETUA 5SZHB 1JAHA 4XWOA 1XCPA 3TLXA 2FFAA 3DVLA 2BMJA 1JJ7A 1TMKA 1Z22A 1NVXQ 3TNFA 1X8JA 3H1TA 3HWSA 4Q1AA 4CYMA 1W4AA 1R0WA 4BLRA 3EIEA 4NE2A 1II9A 1H8HD 1U9IA 1OXTA 5IT5A 3PR1A 1Z6YA 4P0TA 5LD2C 4DLYA 1E9AA 2VTKA 2W0MA 5C2JB 3VHLB 2CLCX 2CCGA 2I3BA 1K5GA 2JJ1D 2G3YA 3AKDA 3B9QA 4R2IA 4BEBA 3CRMA 4LC1A 1CBUA 1GKUB 3AQ4A 3SZRA 4PZYA 3BFVA 4ZDWA 2C9CA 2QENA 2JEOA 2IYQA 2J87A 2RGBA 2WOOA 3GFOA 1ESNA 2A5JA 3BXZA 4TLDA 5CJPA 5E7JA 4GL2A 5BYJA 5L3RA 3KL4A 3ZZ0A 1YR6A 2HYIC 3IBGA 3WMFA 1ZAKA 1E2QA 3EZ2A 2DHRA 4TN1A 3I62A 1SQ5A 3S1AB 4C9BA 2IYYA 2A5FA 4QHYA 4O25A 2Q0HA 1PZNA 1TQ2A 1BKDR 4XIGS 1N6HA 2C99A
chains in the Genus database with same CATH superfamily
2WT9A 2ATXA 3KEGA 3UA3A 2AKYA 1JEAA 1PTJC 4RIHA 3RIMA 1C3OB 1AHHA 2I65A 4GRAA 4XWTA 3SR0A 3QRWA 4KN6A 3GNQA 4KK3A 2O3TA 2GN6A 2Q5QA 4FYHA 4HQOA 2LV8A 1N6KA 4QG7A 5ETJA 1V9LA 3IAHA 2Z57A 1C4WA 2G4VA 2IDMA 4AXXA 1Z83A 5KQSA 1YS4A 3K9CA 1ZI8A 3B52X 2BBTA 1G0OA 1TCUA 2GN2A 1U1DA 1HG1A 3AG6A 1AVTA 3LYUA 5KYVA 2GX6A 3KJFA 2X15A 2O4CA 1XQYA 1R66A 3TLCA 4DHEA 3LUPA 1E18A 4RZHA 4BIIA 5DHFA 1PW5A 1SMKA 4XLLA 2V7QA 1ATZA 3RJZA 1Z5UA 5BN1A 3DL0A 4DR4B 1FZTA 3GEDA 2YFKA 1ZHHA 2ZWAA 3OAAD 3ICEA 1AQLA 1ZCJA 3WLKX 2YFQA 5EWJA 2Q3HA 2IBMA 2JD2A 4P9NA 3T7DA 3A9TA 5JXGA 1Z2DA 1FFGA 1YU6A 1N3BA 5DYNA 4ZEWA 3V4PB 3FCXA 1UOOA 2XI4A 2AUTA 2H63A 1CEYA 3ENNA 2X7HA 2WJGA 3H1GA 4UXHA 1L9XA 3OPQA 4PEVA 3P19A 2QN6A 3EHEA 4AO7A 2HWKA 3HCDA 4W8GA 2V7GA 1UQTA 4S1PA 4YMIA 2Q2OA 1YRWA 1WZNA 2BH9A 3HN2A 5TVGA 4AMZA 4EY8A 1T4CA 3MSCA 1SKYE 1R16A 1FDIA 7MHTA 5SZIA 4BXOA 3KJNA 4L50A 4M1ZA 3OJXA 3GFBA 4AQYB 4B44A 1X7DA 3LF2A 2C9BA 4CLOB 1TIBA 1MOSA 4OUDB 4Y6RA 1I51A 3M6MD 1IEWA 2XNDD 2DQ4A 3A0UA 2B61A 5BORA 1SIUA 2BEVB 2GD2A 4DV6B 5JU6A 5ITVA 3D8BA 3RVOA 1TYBE 1TVEA 2W8ZA 3STVA 3FSRA 4REQB 5FNZA 2QZSA 3AOGA 3T3DA 1MAWA 1YKFA 1Q84A 3IO5A 4M88A 2JFWA 3KZKA 3NEPX 4BE4A 3ADDA 1ZINA 1N2CA 2C4UA 4RNCA 4TZ0A 1R3UA 2H0AA 3DG9A 5KTYA 3L82B 4BQRA 3BS4A 3ZK9A 3ROKA 4D9JA 2YV1A 3LSTA 1EX1A 5B6JA 5J4LA 2JIMA 4G2TA 5KX5F 3FNIA 2ODWA 3C7AA 4MA0A 1JR6A 3PZRA 3BJIC 3RK4A 4XCXA 3FPJA 4LOLA 3AP1A 2YUTA 4GKBA 3HJGA 2V55B 4KZPA 1YQGA 3F71A 5T4HA 4TYNA 3V7FA 2EHJA 2P8SA 5HIMA 2FZGA 5CA0F 3JX9A 3HKEA 4HEQA 4JJ7A 4MWSA 2R0QC 1MW8X 3KOXA 4P98A 4RVSA 1UJ6A 3LBNA 5M7EA 2O6LA 5TQ2B 1XBTA 4YJ2B 1LX7A 3GHYA 2XMGA 1HDYA 2A14A 1P2TA 4BZQA 3JQ7A 1VPTA 4F1WA 1E9DA 2Y05A 2YS6A 1OU4A 5JPDA 5EG5A 3UHFA 4NXMB 2OORC 2JCSA 2WT4A 4ZOLA 1ZUD1 4J0GA 1TECE 1CFZA 1J7JA 3C6KA 4TKVB 3LQQA 1Y5IA 5C4IA 3B3QA 3GLHB 1PSDA 3D1LA 1RLMA 3QVSA 2MSKA 3SC4A 3LV8A 2VUHB 1DZIA 1UFKA 1MW9X 4UCWA 2AMYA 3AOEC 4B2LA 3NS7A 3FGPA 2GEUA 5EXTA 5GM2A 3KOUA 1UPAA 2A0KA 1PR0A 2XTNA 3BXGA 4W6ZA 2NU9A 4YACA 4YO8A 2XKAA 3TIXB 1T3GA 3NHAA 2O23A 1UBJS 3LT0A 4NCAA 4DV5B 5CK4A 3RS8A 3KYBA 4IXMA 2YY6A 3TNYA 1XCBA 5DSXA 3ZV5A 5ES4B 3HP4A 2NVUB 1Y37A 4KE6A 1ZCZA 1L5SA 1TRKA 3PE4A 1IUPA 1N2GA 2H0QA 2R96A 1YZVA 3A4VA 3B9PA 4MA4A 2FUKA 3FYDA 3WLPA 4CWAA 1EINA 2ZZNA 1YH3A 1K92A 1BEEA 3BGDA 5HKLA 2QN7A 3NWEA 4M1OA 4TS1A 3ED5A 4OMUA 1B6TA 1KFKB 2FUG1 4ONEA 3V32A 3ZU4A 1VHJA 4MW7A 3VPSA 3K1TA 1QFZA 3A6HA 1JHDA 1FUKA 4KR9A 4B9AA 2CJXA 1GADO 1EVEA 4KLZA 4KO8A 4DNOA 3N2LA 5HMMA 3F4BA 4RADA 5BO5A 3DE3X 5LC1A 2N9UA 5C32A 3WLNA 5FNVA 4YRJA 2QP3A 3GCDA 3U4QA 1R9GA 5L9AA 1L7VC 3C3KA 2C94A 3QFCA 4MPDA 1R10A 1ZK2A 2R66A 3LUGA 4MS1A 2EZ8A 1LW6E 3SHOA 1U8EA 3P32A 1A0OA 3O1JC 3V3TA 3S6JA 1BD4A 1QMGA 1JHPA 5IARA 1A77A 1Z8NA 1GRVA 2SHKA 4B6GA 5FWYB 4M4SA 1Z34A 5H9VA 2C2XA 5K0JA 2C4MA 2BFWA 2JBWA 1IEQA 3M6XA 2FFQA 3DDSA 2JZCA 5AXBA 1YC5A 5KQMA 3ZVMA 2A78A 4HT3B 4YRLA 4LRQA 3DYBA 1HTTA 1I1HA 4D42A 1UM9A 1EXNA 3F7MA 4BNJA 1G7TA 5JTTA 5LOVF 4KH0A 2B1JA 1R8JA 5DNYB 4F91B 1EUQA 1UXOA 2HQSA 4ZT5A 3VDRA 3JWIA 1G8YA 1C0PA 1L7RA 4LXQA 2HIGA 2HMYB 2RJOA 1E1QA 3DMNA 4B6SA 1ZVMA 3I9FA 2CNKA 3U4HA 3NHFA 1PRYA 2XZPA 3MCZA 4M0MA 4Z51A 3U19A 4YWHA 2GLXA 2J9RA 4RTMA 1NVGA 1Z4QA 3S8MA 4LSMA 3I1YA 3FPKA 1U0RA 4C4YA 1ZH6A 2C31A 2YJNA 4RVDA 3ZCXA 4CT5A 4QVIA 2IH4A 4XOIA 4URZR 1NRXA 5F77A 4MGZR 4PGAA 5FUVA 5AVOA 4IIJA 1ZK4A 2VRNA 2ZBPA 3HR7A 4EZEA 2ZU6A 1ZG3A 4YUVA 5TQVA 4F7WA 2RHJA 5CLQA 3UENA 3KDPA 3OM0A 4GQAA 2QL6A 1GPWB 1NUAA 3U7FB 2QBYB 1U8TA 2J3JA 1QHHA 2XGSA 4F9TA 4REMA 4Z3DA 4NMWA 1EUDB 1NNSA 4R8KA 4I9HA 3U3MA 5I9SA 3A37A 3FJYA 5FOXA 3CN7A 1PR2A 4KQMA 4YAFA 3CT4A 3VNAA 4EBFA 3QK7A 4B09A 4BY9E 1AF4A 2QTBA 1WP9A 2E0IA 3GJRA 3W5IA 2WSSA 1OXUA 2Z43A 4WLOA 1YUNA 3I04A 3OEED 2ZIWB 3NHYA 3SMQA 2EATA 3P2IA 1EUZA 3AVPA 5ALQA 4TL8A 3INRA 1VIVA 2F8TA 4LQDA 1JQBA 3WGMA 4B3DA 5JEDA 2Z8YM 2FDXA 1L7OA 4IINA 1GD1O 4L6AA 5M29A 3ZS9A 4OJKA 4FFDA 3HXPA 4OHFA 5FTJA 2BONA 3TQQA 3X1XA 3I2JA 2JCVA 2VDWB 2YVUA 2YRWA 3KV1A 1UDAA 2HU7A 2L18A 3QKWA 4Y9UA 1Z15A 5CT4A 5CLJA 3A4TA 2WM8A 3Q9UA 3WR5A 4DV7B 2R48A 4MPJA 5COQA 2OPBA 3KPJA 2ZAYA 3I12A 4RTSA 3A1EA 1VE5A 4G8DA 3U7JA 4E6PA 3GUZA 4IHJA 2GZAA 4RA9A 2PS3A 4FZJA 1XNQB 2B0JA 3PPXA 4QHSA 2YX1A 2WDZA 2BP7A 2M98A 4WKNA 4IOKA 2XRFA 4KSYA 2X1MA 2LNDA 1RWMA 1V3UA 4BLSA 1EESA 1K0UA 1HWYA 2PQ0A 3FLBA 1C9MA 3ACCA 3KRTA 1H1TA 4FN4A 4KYTA 4NYMR 4O4LA 1ZWKA 2X4DA 1IXKA 1GOTA 1YQWA 4MR9A 1FVHA 2PK3A 3WZ2A 3WYCA 2O8DA 3EQ2A 3Q15C 3OZVA 4MGHA 3LCRA 3FAZA 1NURA 5DZSA 4D9HA 1KQFA 1JG3A 1E7MA 1HM5A 4NAUA 2GYWA 2Q28A 3GXOA 5HBRA 1N6LA 4PO8A 4UAJA 3T7AA 1USUA 4CDNA 3EZ7A 3LBAA 4K1LA 5AK4A 3E4CA 3RWOA 1DDGA 3M89A 3FRHA 2EFDB 1R4MB 4LY6A 4Y2YA 3QQPA 1Y4AE 4NHOA 4R7TA 2E5WA 2MR5A 1KYYA 2BSXA 5LIRA 4P4SA 3HBLA 1ORTA 1K6MA 3IC5A 1TA4A 3NHRA 3B70A 3RADC 2GEVA 5HFNA 4C3ZA 5JS8A 2PL1A 2PFKA 2GBGA 3ONFA 5G0TA 3FZNA 1OHHD 3IQIX 4BMXA 1AZLA 2PUVA 4PCVA 4XX1A 4FD2A 3WK7A 1BVRA 1VC2A 2SKDA 4GVXA 1EA5A 4EP1A 4FM9A 4MGEA 4XZ3A 4WERA 3HEAA 4BLTA 3F46A 1DIBA 2AIRA 4PLCA 5SYAA 1HV8A 5DNVA 3WLOA 1WKCA 4R2XA 1HFJA 2YC4C 2YIDA 3AJDA 1P6QA 2JHFA 5IKEA 1HLGA 1O94A 2GLTA 1XDDA 1FX0A 1EDOA 3NT4A 4LXIA 4GOOD 3OCWA 4GMKA 2H52A 3AEYA 3W5JA 3OQ1A 4AG3A 1OKKA 1FMFA 3ZDXB 1XEAA 3STTA 2G1KA 1ECPA 3R9WA 1LA2A 1CZUA 4W9MC 4AWAA 1EFPA 2IP2A 1G2IA 3I3SR 2G63A 3DW1X 2XNKA 4HGPA 3TQSA 4C01A 1TKCA 3GI1A 3MQ2A 4TTVA 3WISA 3GLIA 4KR0A 2R00A 2JH9A 1U1GA 3KG2A 5DNEA 4BP3A 1M1YA 1ND6A 1XDUA 2F1OA 2B37A 1DTWA 3Q98A 4Q3AA 1ID1A 3ZY5A 4E4RA 2QRQA 1NU6A 3RAFC 3HWWA 3VJLA 3K2BA 4OXNA 2E9SA 4XIFA 3KB1A 4EI2A 1BVUA 1O5TA 5IZ4A 4HXGA 1Y80A 4KHPB 1KMIY 1CUEA 3H86A 2ZVQX 4EHHA 3I32A 3LZDA 2RHGB 5ES3A 5KAMA 4L0MA 4P4GA 3GN2A 5LDGA 3TLGB 4KN5A 5GVSA 1E1QD 4MIEA 4EW2A 1DBWA 1T4DA 2MSNA 3GGSA 4X91A 5JDIA 5IXYA 2CLIB 3VZDA 2PVSA 4QPNA 3T1QA 2ZOSA 2CFSA 5CDFE 1I32A 3VOBA 4JA2A 3F8TA 5BXYA 4YECA 1ZK0A 1M2EA 4F21A 2E21A 2IXBA 3G2HA 1FNDA 1ZESA 2D0DA 2IU6A 3FZQA 4JKOA 2X19A 5J4YA 3RJTA 4N65A 1YFLA 4LHWA 5HJ2A 4W5OA 2BGJA 2TMDA 1DJPA 2ZYWX 3CW2A 4KO2S 4DQKA 3AL3A 1VI2A 5B58C 1WZ2A 1CR4A 4RDHA 2R1TB 2QAGA 2HPVA 4DDTA 1FU8A 1U7HA 4JXXA 3K9LA 1H0SA 2ZBVA 1H0RA 3LP8A 4K9SA 3UJ7A 3PE6A 1QIMA 3TRJA 3W7VA 2AQIA 5BQFA 2WNSA 1WF3A 2WZBA 4RD6A 1A82A 1WY5A 2FFJA 1K6XA 4Q3EA 3WMGA 3FKQA 4MJLA 5HHTA 4B80A 3AR2A 5GZ3A 5EXPA 1K08A 5DV9A 1GJRA 2NSHA 5TVKA 4C78A 3TG8A 3MWEA 2QUZA 1NDQA 2ZAMA 3AONB 4N6OA 3MTQA 4RJKA 4KPUB 3TNLA 3U62A 4DSTA 5DWVA 4EECA 1BD3A 4NH0A 3DPSA 5LZ5A 1VLMA 1H2HA 5FJIA 1FTWA 2Y66A 1PFYA 4O4JA 2XMSA 3SXJA 3ECSA 1N0VC 1ORHA 4RLHA 2VJBA 4X63A 1PYGA 1MAVA 1QDUA 2W11A 3FYCA 3EWIA 5KQGA 1RMQA 4AP6A 1T2AA 3O2NA 1SBQA 4FQ8A 4YJ3B 2OCAA 1M8KA 2VF8A 1TQ4A 3ZJVA 5GAJA 2JEZA 3ROZA 3CH5A 1FFCA 4A27A 1JQ3A 1ISRA 1NPDA 2GR9A 2WD7A 2PZLA 3TEJA 2AF3C 3JVEA 3NHWA 2P2NA 3OMLA 4MUMA 3ROFA 5ER6A 3ESBA 2ECKA 2LP4Y 2NO6A 1TZ2A 1AF7A 1ZM9A 5DIFA 1OAAA 2HDOA 4BU0A 4GECA 5EKDA 2C2HA 3K5WA 2GFHA 4BBZA 2IXDA 5CXSA 1U3FA 1F4PA 5IWCA 1FRQA 2O2IA 3A6JA 4GPAA 4AF8A 5AXAA 3QF4A 5HIAA 5I9NA 1Q1GA 4G8JA 4R7ZA 2RK6A 1TCBA 3K0BA 1Z0IA 1LK0A 3EUEA 1RD4A 5J4VA 5C51B 3CE6A 1CZNA 3FUWA 2XKBA 3EXEA 3ONWA 4QUBA 1IL0A 1O58A 1R0KA 2BWJA 2P5YA 4B73A 1CU1A 2C1XA 3G2OA 3PHIA 3R3WA 4Q4HA 5JVDB 2AJ8A 1OILA 2GLUA 4JLAA 3U0BA 1JUDA 1VHWA 4F4JA 4X1YA 5CB0A 4A0HA 4HZUA 1JGTA 2PA3A 5JATA 3R4CA 3L05A 1S3FA 2OGZA 1SCBA 2OV3A 1EX6A 3JWHA 4I2VA 3KBOA 2VJAA 3KK0A 1B3BA 2EOAA 2POQX 3ZDFA 4QRIA 2A9FA 1PLLA 4UPVA 5A02A 5LBIA 3OO0A 3RSCA 4TSFA 1NN3A 1KETA 2PYZA 4TTQA 4CN9A 4CT4B 5HEKA 4G1MB 1TA0A 4FBGA 4JB3A 2H65A 4KEAA 1HE5A 3GT7A 3PBKA 5KVVA 3KZNA 4XQEA 5IBRA 4F2DA 1BHJA 1PQWA 1I1NA 5JH7F 3OESA 1MHPA 3AR8A 3KU1A 3D8UA 4DY4A 1P0QA 3HABA 3LKBA 4S0XA 4M8NE 1CERA 3I8XA 4U39A 3W7BA 2BM9A 3NHLA 2GSWA 1BOFA 2C95A 4Z53A 1I14A 1PQUA 2WF5A 2QI9C 1LI4A 2H85A 1Z4JA 3OKFA 5DHPA 1KZHA 3U17A 4BNNA 3ETGA 4WFQA 3H2IA 3SIXA 3UHJA 2CHGA 4C20A 3BZWA 3OCYA 2DBVO 4RLQA 3SXUA 2HK8A 2JFZA 3I6QA 4FVTA 1OKKD 2BIFA 2E55A 3C45A 4YONB 2IV3A 821PA 4LUCA 3RYFA 4M83A 1JSZA 4EGSA 2GPNA 3QELA 4RM3A 2QP4A 4TMVA 2CL0X 4D4KA 4AICA 3LBIA 4WUTA 1TC1A 3EA4A 4EBBA 4GBGA 2CXPA 3HADA 4BX2A 3PHJA 3PSHA 1Y7HA 3ERCA 5TE9A 3QUSA 2IYFA 2FQXA 2ZM6B 1GLGA 4HB4A 4NAVA 1LW7A 1JPNA 2Q5HA 4KL8S 3HKCB 4AJ4A 5DISB 3SEQA 4K86A 3C85A 4NMLA 2OBLA 1PDOA 4EYGA 4DR6B 4QSMA 2AOWA 2OLJA 4ND8A 3T52A 3ZY3A 3VZCA 1M2GA 5BRNA 5JS6A 4OK3A 3A1DA 3OG9A 5AI6A 2H2IA 4EPXA 5LXTB 1E89A 2DHEA 4KUGA 1ADBA 4V3BA 2XQGA 1MJGM 1WHTB 1L8QA 3BFJA 1U3GA 3SXPA 5MGBA 3PSAA 4NULA 4C7XA 5JHGB 1GU1A 1MIOB 1XRPA 2I03A 3F97A 4DQUA 4JVOA 4YQYA 3QU2A 3F98A 5BQ3A 4JC0A 3T7SA 4C2AA 3TR0A 4Y2GA 3H3XA 3DKKA 3MFYA 1P0FA 3R9XB 4A2CA 3HSSA 5EMLA 5FV7A 5T5QA 4BMOB 2A30A 1B6SA 1ZD3A 3RVNA 3ZNPA 3L93A 5T67A 5KOIA 4RVUA 4OHZA 1K8YB 3F78A 4BB5A 4Z4FA 3CRQA 3W9YA 5A5EA 1SUPA 2RGNC 1EB8A 1B15A 1E59A 4LZZA 2VQ6A 3FE2A 3KYDB 2GKOA 3A04A 4HEJA 3IP8A 3M33A 4PLTA 4CCWA 1SCAA 3BGIA 3COPA 4BB6A 4YV0A 2VEOA 2GRUA 1CW2B 1LPBB 4F3RA 2JDIA 1GKLA 1KZ4A 4R98A 4A6DA 3QV2A 2J3MA 3GUUA 1T0UA 3PNPA 4H3KB 1QF9A 4JR1A 5M3BA 4R2JA 5A3SA 4AM8A 1T5DX 1XP8A 2WIGA 5I8WA 1A9XA 3MERA 3AC0A 1P9LA 5EZ6B 1I3CA 3U81A 4QDOA 2FPIA 4F38A 1KSHA 3V1YA 1QGYA 3FFTA 5LU8A 4NQZA 2VT6A 3WJAA 5FULA 1ODKA 2Y1XA 3ZXSA 1A5TA 3T3OA 5D6NA 2IX3A 4P36A 4H7FA 1ZVQA 1B93A 1XQ1A 1PEKE 3PNYA 3LKZA 3MAGA 3ZBPA 3PNQA 1I2CA 3NEYA 4UQPA 2YNMC 2XIQA 3IVXA 3LDHA 3IAUA 3ZW9A 1D6SA 2H8KA 2CXUA 2ZANA 3C1TA 2XYQA 1PJ4A 4PYIA 1J33A 1E6KA 4AZSA 1QKKA 3DL2A 1GTVA 2R4TA 3LXRA 1ZPDA 4NF2A 2D1FA 1A8IA 1GIAA 1YDMA 2BC9A 1LQUA 2P9GA 4NTZA 5ANRB 2JCBA 5DWDA 3EXHB 1GHTA 2D1TA 2AYZA 1FDOA 4XW2A 1E9SA 4AJHA 4AS1A 5BSEA 3GH1A 3IYLW 5DEOA 5DM2A 5MN6A 2G8LA 3AU9A 4K6CA 3E9YA 3F9CA 2OQVA 4C0HA 3K1JA 5BN5B 5JJBA 2UZIR 5FBVB 1Z4NA 3GF4A 4HWSA 3OZTA 3N2YA 3O3OB 3ZN2A 2BFBA 1OX5A 1M0EA 1QGAA 2EGHA 1L5ZA 3HU1A 5CX1A 4JP3A 1V11B 4YAUA 1F51E 3UAXA 4BKRA 2C83A 3IX7A 5L3SB 2VJPA 3TOSA 1L4LA 3F6SA 4AMBA 2CUZA 4YGYA 2WE8A 3CISA 5FUXA 4E12A 2B9EA 3NHJA 3R6LA 1IQ0A 5HKKA 2GCNA 4TV8A 2ZPTX 4H31A 1K7FB 1RKXA 2YXDA 3LFTA 3OJFA 4ASUD 5HZMA 2D6FA 1OXXK 2NO4A 5IK2A 2DU8A 4D0SA 2X0EA 1RLUA 3CR7A 2FSFA 1A2OA 2LRHA 5ENZA 4C3VA 2IUFA 2X5KO 1G63A 4JA0A 3C5WP 3G9QA 4ND4A 1DWOA 1RWPA 1DEOA 5AICA 4NEGA 4O0LA 2X8JB 4TSFD 2IT1A 3V1UA 4BP1A 4HH3C 1OIXA 4OHMA 5KX5A 4LZWA 2RB5A 5K0FA 3PUWA 1CB0A 4D43A 1NZFA 5B5SA 1UMDB 5T7BA 3WWPA 4FS8A 3AEKA 4R9NA 4W9RA 3FGOA 2L82A 4KQJA 3Q9LA 1PT8A 5CA0A 5B3KA 5IVHA 2WJVA 3IUJA 4BQNA 4BVEA 1AZTA 2V58A 1NN1A 3ZNOA 2PS0A 5JS2A 1NT2A 3H11A 1ADCA 1DFHA 3LY7A 1GILA 3LPMA 3QP9A 4PLYA 2C78A 2OHIA 1UKEA 1O8CA 5D01A 4M3NA 2QZPA 1A9QA 3AG5A 4QYMA 4C5CA 1WVMA 2A6PA 5E6UA 2BR3A 3KNZA 4U2FA 4CEJA 3H6KA 1ABEA 1Z74A 1F17A 2X2EA 7REQA 1T8UA 2YIMA 3BHIA 2ZR7A 5A05A 1KH3A 4TTRA 1ISJA 1O8BA 1Q83A 1YR2A 1KHTA 3QLUA 4NMHA 5H4HA 3USZA 4MVYA 2X8LA 1ZH8A 2C8LA 2X86A 2VNIA 4RO0A 1A95A 1E1LA 3NGXA 1CUHA 4ZAGA 1GYPA 3QBEA 4NY1A 2JFXA 3QTBA 2P5SA 4DM4A 5KZMB 1FIUA 3HXKA 4DTIA 4CMJA 2OGSA 1RYEA 4HQ6A 2I2AA 2JI4A 4DV1B 4KR2A 4IXDA 2PX4A 4LJKA 3BH6A 1U8XX 3PK0A 4L0DA 5ALHA 3RUFA 2V5AA 2W6QA 1NGSA 2O52A 3GC6A 4PC6A 4F5EA 1AS3A 5K4GA 3DWIA 5J43A 3PGXA 5JXHA 1SKUA 4WY2A 2WVAA 4YPOA 1PR4A 3M9WA 2JIOA 3K8OE 4WNCA 1PJAA 4JLUA 5MHTA 4WTOA 1VGVA 4L8FA 3P7MA 1I4OA 1O97C 2G7MC 3HCPA 2WABA 1QAMA 1XNGA 2BUCA 5FUBA 4EHNA 2HHHB 5DLDA 1QS0B 2AN9A 5FTLA 2ZTMA 3EZXA 4UU1A 5ALFA 1LQTA 1YA4A 3K5HA 2PMEA 4BU1A 4EELA 4W8HA 1VIYA 2RKWA 1V7PC 2V7UA 3CURA 1HDRA 1VG8A 3IEMA 2I62A 3CRZA 2O50A 3USES 2F8SA 1RLJA 1SXJC 3RIXA 3ASVA 3D1JA 1PUXA 1U2SA 1AKUA 2W6JA 3NGMA 1P19A 2DERA 2J59A 2BMVA 4FWIB 2CMGA 1B23P 4EF5A 3ND5A 2VJQA 5KTSA 5E1DA 1B6RA 3HUEA 1HDGO 1C1XA 5KINB 1EXWA 5TGZA 5GP1A 1P2BA 4IKEA 1FTGA 5EKUA 3GR6A 3SOZA 3ESRA 1YF3A 3KR9A 1K27A 2FZ5A 1EG2A 3C3CA 3HLKA 1AV7A 5AM3A 3LIIA 1J8VA 4TMWA 5JROA 5IN4A 4O2RA 1P77A 4I6JA 4NJEB 1Q3HA 2HRZA 3GFSA 4G0VA 1QXSA 1OWLA 1S7GA 3QMWA 4DBZA 3NYRA 1T4MA 3GH3A 1BMTA 3EW7A 4GMHA 1DPGA 4B75A 1EFHA 4CBVA 2WU3A 3NYIA 4CCAA 4DIMA 1PZEA 2HWWA 2LZ0A 1BGWA 3CCBA 1ZNXA 2MSDB 2G0AA 3KOOA 1C1YA 3KVRA 3W06A 4YAKA 1OFHA 4I50A 4Q47A 1NBHA 2WWTA 3AZQA 1OI2A 1JIXA 1ZXXA 1MQSA 1XQXA 1QKIA 3QLEA 4G56A 1C3EA 1OMOA 3ZWMA 5FWXB 2DQSA 4M9RA 1MOQA 4QGAA 4TMXA 2Q41A 1AJEA 2PLRA 3K5PA 4E5PA 3INNA 5C8ZA 5F78A 1M3SA 1P5JA 3ADKA 3FVRA 2AOUB 2ZK7A 1MJFA 1X1DA 3E5NA 3SZLA 1UBNA 2GI4A 1GNVA 4TX1A 4Z9BA 3OOEA 4I3FA 1NBAA 4PZAA 3RYTC 3VHQA 4A8PA 2BYTA 1VPEA 1HX7A 1ECGA 3D7RA 2BPOA 4OA8A 4Z4QA 4M1EA 1EJ6A 4MLDA 3S7ZA 3DTTA 2B98A 1MTOA 4EYOA 3WRWA 3DEHA 1P7YA 5HK8A 3VX3A 5IU6A 5K8VA 1YD7A 5CLFA 3G23A 2I7TA 5KPJA 1X8LA 5J5AA 2Y1DA 3GLSA 3TL3A 1S6YA 3DMTA 1V7ZA 3TB6A 5F23A 2AEEA 4AP5A 3HA7A 4K2HA 1SD2A 5D5HA 1T43A 2XB2A 2MYTA 3KEOA 4DCPA 4BX0A 1AQUA 3F9RA 5D6OA 2H2HA 5JNLA 4CMIB 1G6OA 1M2NA 1P9RA 4AZ3B 5FUQA 1NI4B 1U0NA 1WA5A 3LCVB 3W5CA 4QFDA 4RULA 2WW8A 3BWMA 1G19A 3H5RA 3SJZA 3UYKA 2KI5A 7AT1A 1FTYA 2IUSA 3GK3A 4RH0A 2I4IA 1R0YA 3LK6A 4QRDA 3B89A 1SK9A 2YHSA 1L0BA 5AVYA 1FUUA 2F48A 2VH2A 4LYFA 1T1IA 1SGWA 1IOZA 5CVCA 1JTFA 2F3TA 3W8DA 4XWWA 1KARA 2W70A 4LAFA 3N76A 1X7ZB 3AY0A 2VP4A 1UMCA 2ORIA 3FSEA 1FFXA 3GDOA 1HZJA 3R6DA 2A57A 1NBIA 2Q1TA 4TMYA 1RCFA 5E4JA 4E1VA 3L0PA 1E7SA 5SY4A 4ZAZA 2XCOA 3ZD6A 4B8YA 1WVIA 2XCQA 4IMIB 4N76A 4PCUA 1KJYA 2Z8YA 2ZXEA 1U4SA 1W581 1YB4A 2IIQA 2IOYA 1SVOA 3GRAA 3N74A 2NUAA 2FFHA 2Q4BA 3WB1A 1COWD 2VKTA 1WNTA 3QWHA 4U0KA 2Y0DA 5DTEA 1ZMRA 3OIDA 1WKVA 2C00A 4ZD6A 5A6SB 2DF8A 1YS7A 2BMDA 1LC0A 1XZBA 4B82A 2QTTA 2B8EA 1N1MA 1PO7A 5AYVA 4JAVC 1ADJA 4KIGA 4O4HB 5IAGA 1ZL2A 3QV1A 1VDZA 3MB8A 1EPUA 3M9XA 3HVRA 1VYVA 4PLZA 4UHKA 3USCS 2F4VB 3MAJA 1ULZA 4BMDA 1NXVA 1DQNA 1RE0A 3K6RA 1RABA 4IP0A 4BWVA 5CEJA 3ZXXA 1OIVA 3PDJA 4QBFA 2PRIA 3VYSB 1Y1RA 1HK7A 1XYVA 2HLDA 2Z6VA 3DHVA 3DO8A 3JQ6A 1QWOA 4YMSA 3OA2A 1CY8A 2C2GA 2EJTA 2GZDA 2GYVA 4Y7CA 1M5RA 3VR1A 5D51S 2UVDA 4E5VA 3L7NA 1D2MA 2H18A 1Y63A 5TR9A 2X14A 2VHTA 2PS9A 4QU0A 2BKLA 2XF2A 1WCIA 2I7DA 2APJA 2FY8A 2NU7A 2NZ2A 3HUDA 3VI3B 4RDCA 5B3AA 4R69A 4GX5A 1GL6A 5JCJA 5HOEA 3WLTA 2CYAA 1HE8B 1RJEA 3VVBA 4EITA 2I5PO 5JANA 4V0ME 2EGGA 4RK7A 2AFHA 3QG1A 1JIJA 3E7DA 1Z4OA 3HRIA 2ZDHA 3GL9A 4ZMSA 1UDBA 3I76A 4L78A 1MJHA 1NVTA 3T94A 1QNLA 3BD6A 1JX6A 4YJGA 3D4NA 1JG7A 3BGWA 3WSVA 1X1QA 2I54A 1YZGA 3SI7A 3QGMA 2OQRA 3FUUA 1QE0A 1QGOA 3SJAA 1XDZA 2X2PA 1XU4A 3MFQA 4QYIA 2Y0EA 5H9WA 2JATA 3H5AA 3K6JA 1JYSA 1VKZA 3DWGA 1J5XA 2GFQA 5HKAA 2OVFA 4P0PB 1FP1D 5EXSA 4YLGA 5FUMA 3QYPA 4RQUA 1R8YA 2G36A 4R84A 3H6GA 5KKAA 2K5UA 3H5IA 3O47A 1RXEA 5DTRA 3GNLA 3B13B 4F4IA 4NH4A 3QI7A 4HMQA 4C4SA 3W04A 3KPWA 4M46A 2WHXA 2QS9A 4OYYA 4D4IA 1YFJA 1NW3A 3CTPA 2F64A 1U0FA 1BWRA 3OMXA 4JLKA 4Q82A 4BO9A 4LTDA 4BLPA 5HJ7A 1N32B 3GFFA 4UU8A 4I1UA 3LTEA 1T9KA 3FVTA 4J7XA 1US8A 2J4DA 2VDOB 5H0IA 3M3DA 2HK9A 3NVMB 1OI4A 1WO8A 1QH0A 4Y6OA 1KAEA 1MUUA 1FDWA 3RYHA 7ADHA 3RWBA 2V8OA 2R79A 3OURA 5GJWC 1EM8B 1KY3A 3HBFA 1YSCA 2OO5A 3SEAA 1RLTA 2P4UA 1A7UA 2WTEA 4YMUA 4H0CA 5K8JB 4E32A 2OV1A 1KI8A 1U1IA 5BVHA 1NE7A 1B00A 3O4FA 4R8LA 4BRUA 2NAFA 3N8KA 1PL0A 4KAAA 3DBLA 3DP7A 2YRFA 3VHXA 4J29A 3AUAA 3EOZA 3L0OA 1RZ3A 4X8LA 4CR8A 1DAFA 4N7JA 2FRDA 1M83A 4LKOA 3TLEA 3MLAA 1T1SA 3GQVA 1CEEA 3HNOA 2ZJZA 4HB2A 4Z5XA 1J97A 1DAIA 1OREA 2AJBA 2PXXA 5JMWA 1MAHA 4PG5A 4DUGA 3QH4A 5AVUA 2IHBA 3CF0A 3ZZUA 1F9AA 2AWOA 2DWCA 1Z5OA 2QUHA 2X1HA 3PYLA 2CY0A 4Y9RA 1R0SA 1H6AA 4LK3A 5EC8A 4G5YA 4GLFA 1G55A 2BGUA 2H57A 2BMEA 3KX2A 3UJ9A 8MHTA 4MVJE 2OCGA 3EEOA 5AFSA 4KWEA 1Y5RA 1PVDA 3MOSA 4EUHA 3UJ6A 3MWFA 2AZMA 3JYLA 5DFAA 4CCSA 3P97A 4FFPA 1JFFB 1K9VF 1ZUNA 3E53A 3O4RA 4A7PA 3DHEA 3YASA 4Z3KA 3AERB 3GZNA 3BA6A 3LHDA 4XJXA 3U2QA 3G2JA 4QOSA 5B1HA 1L7MA 4R8VA 4OJNA 2X0FA 1WSAA 4C1BA 2H1VA 4IJ6A 1IK4A 3FTQA 3OO1A 3PWKA 3DXXA 1BMFA 4G0ZA 3TTSA 4CUZA 4AY6A 4ZHQB 3OEWA 4FMBB 2IIBA 1S2NA 3QX8A 2PV0A 1J1UA 4MEBA 1GUYA 4G0XA 4HDSA 1EK1A 1RI2A 6NULA 3EFOA 1W4BA 1J24A 1TO1E 2FWIA 3RD5A 2P6UA 3C1UA 2QQEA 4K6HA 1NATA 4RNDB 4X84A 1PWXA 2AV6A 3OLCX 2QKYA 1PJSA 3G9XA 2CMHA 4FC6A 4ENVA 1MEEA 1C14A 1J42A 1DQRA 3G0BA 3LAWA 1XTRA 1PZMA 1ST2A 1X0XA 2DSTA 3AIKA 3DV0B 3E9MA 4P31A 4RD2A 5LBUA 3CTMA 3TL6A 1K5DA 1MXHA 3T7TA 4ZT2A 1L4HA 4TL9A 5SYMA 4BN5A 4RHUA 2EJCA 1OLXA 1HGXA 2PN1A 2CVOA 4J75A 4JBWA 4G0QA 4OHBA 4ZO8A 4D4HA 4OH7A 5IDXA 5KOYA 4KRXA 1DPFA 1U2DC 1FVXA 1W2WB 2EKQA 4Y1RB 4XTCS 1XL1A 2AW3A 2J7PD 4TMZA 4W9NA 3C24A 3W5HA 5L6LB 4YRZA 1H5UA 1U5BA 2Z58A 3THRA 1V6SA 4I9GA 1NP3A 2BE9A 2HQOA 2ZBUA 4ZAXA 3S81A 1AN9A 1IUKA 2MDTA 1JTVA 1RXSA 3ZV3A 2FRXA 1I3KA 1BCRA 1Z0SA 2ISSD 3EMKA 3VR2D 4GGMX 4R1SA 3W7AA 4IQ0A 3K96A 3KLOA 5TMDA 2OENG 3AETB 3WYAA 4F45A 4ESOA 4Z4EA 2P1DA 4IMRA 2HSZA 1IMOA 5JH7A 1IQPA 1X38A 5JTUA 2J30A 1Y8AA 2RC6A 1D2GA 2WSBA 1FEZA 1NQXA 1VKOA 2XV1A 4FHEA 4HMOA 5K45A 2IU3A 4M49A 4UW9A 5DW0A 3HY3A 1E0JA 4LDRA 2AMVA 4FMPA 2EL9A 2OM2A 2QMEA 2VUIB 3DFKA 4RA6A 4MVXA 2QAIA 2H06A 4D3ZA 4KWCA 4W99A 5CT9A 2JAPA 4Y6QA 4LZAA 2ZZKA 4UHDA 3WTBA 9LDTA 5FWNA 5CH8A 1IY2A 2B7BA 5KTKA 3P20A 2OBFA 1XV5A 3LQYA 4EPWA 1P91A 3MCTA 1Z3CA 2Q3MA 5JC8A 5CR9A 5F4ZA 1X9IA 1HXHA 1Y8CA 3M2TA 1KL7A 1KJJA 1SD5A 1JNYA 1Q0QA 3BJRA 3KTAA 3QXCA 1KIFA 1JMKC 1UIRA 2EKLA 3H13A 3UB4A 4H3VA 2XXJA 4C6SA 2MTBA 3GEHA 3A6DA 2Z1NA 3OZBA 2ZULA 1G21A 2Q50A 4PCLA 3GNTA 4RS4A 4BLUA 4UQOA 3ZGXA 4DY6A 3TJRA 3D59A 3GLGB 2ZJ2A 4JI3B 4FFMA 3N28A 3VPFA 4CUKA 3GZJA 4I1IA 1KC3A 1CE8B 1V8DA 3SZOA 3OETA 2H7CA 3PXEA 4QXQA 2IK8A 5JO0A 3LK7A 5JY6A 4UHBA 3OY7A 4Q7LA 1N36B 1W0JA 2BFEB 2G71A 5TF0A 3EZGA 4BHTA 1E77A 2VSOA 3NRBA 1WEKA 4DQLA 5HVNA 4DUYB 4QZVA 3C3MA 2QJOA 1Y8QB 3UGJA 1Y1SA 1OBHA 2RGGA 3IT0A 4NFLA 3NKVA 4WCFC 4KTTE 5B4TA 1XELA 5ESRA 3JYHA 3W2IA 4DCUA 5ISMA 1JFSA 3TW0A 1SFRA 2DQYA 2IKQA 1QOQB 3DVAB 3JQ9C 4JJ6A 3ZDZB 2V3VA 3E3NA 5EIEA 4KV9A 2AH5A 4YYZA 4PPFA 1GU0A 2QLJA 5B1DA 4GPIB 4HPJB 3PNMA