1R4NI

Appbp1-uba3-nedd8, an e1-ubiquitin-like protein complex with atp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the APPBP1-UBA3-NEDD8-ATP complex reveals the basis for selective ubiquitin-like protein activation by an E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords amyloid beta precursor protein-binding protein 1
total genus 16
structure length 76
sequence length 76
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2003-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1r4nI00
4HJKA 1WX9A 3OAWA 4RM8A 4TQ1A 1U4AA 4M8NA 3ZO5B 5LXHA 3V61A 1GC7A 3CMMB 2L0FA 3NHEB 3VAWA 2KDIA 1E5WA 2N1WA 3RZFA 4F8CB 2KQSA 3HM6X 4BFRA 3H7PA 1X1MA 1WX7A 4IG7B 1P9DU 3DQVA 2KTRA 2L00B 2Z0EB 1KLVA 1E8YA 2LUEA 1E7UA 4ANVA 4HWIB 1V5TA 4MGZE 4XC2A 4HVBA 3UF8A 2JVCA 2QHOA 2L0TA 2RPQA 3IFWB 3JYUA 2KZRA 2RSUA 2KFJA 1VCBA 2GBRA 3DCGA 4MSMB 3QHTA 2KX0A 2WWZA 2KMAA 1L7YA 3PREA 1GNUA 4ZRKA 2M0XA 3APFA 5KHOA 2LD9A 4EZJA 3UQAA 2RD0A 5D6JB 3PGEA 5FR6A 1KJTA 2GBKA 4J6IA 3RUIB 3VXWA 1JRUA 2GBJA 1ZGUB 2IY0B 3V60A 2XBBC 3ZTCA 4EFOA 1Q1OA 4HXDA 3L54A 3C0RB 2C7MB 5L95C 3EHVA 1WE7A 3B1LX 3TL5A 1D3ZA 2ZCCA 3T9LA 4AP4C 3QC8B 4PS8A 4NQLB 3TMPB 2A4ZA 2KJHB 3A33B 2AWTA 2I1KA 2ZPYA 3KUCB 2DZIA 5JHBA 3QJZA 2IBIB 4GXBA 5D94A 2JT4B 2LVOA 1RRBA 3N30A 4II3B 4AWJA 2MWSB 4XX5A 1LM8B 2HE7A 1WJNA 4IWPA 3D32A 5C23A 2KK8A 1UD7A 4K7WA 2N7DA 3H1UA 3NY5A 2D07B 2M4NA 2ZJDA 4PYUA 2LVQA 2BGFA 1V81A 3R66C 3SDLC 3IBEA 2KTFA 3PT2B 1IPGA 2KLCA 2Y5BB 3VHTC 4BVUC 3U30A 2V1YA 1R4NI 4BKGA 1E7VA 2HJ8A 1WXMA 2LRUA 3DBLI 3H7SA 4MJSB 1RFAA 2BWES 4EZLA 2ZCBA 4NY0A 4ANXA 2AYOB 3ALBA 3MHSD 2GOWA 2UWQA 3R3MA 4NAWB 4YL8A 3DBRI 4MDKE 1G6JA 3V6EB 1WR6E 3RZWC 1NI2A 1J8CA 4PYZA 3ZNHB 1H4RA 3HIZA 1YX5B 4KDLB 3ZNZB 2PE9A 1E8WA 2NBUA 3APDA 2O6VB 2JXXA 2MP2B 2KXJA 3ONSA 3PRPB 4TUUA 2CHZA 2I1JA 3W1SC 5DPWA 1V2YA 2KX3A 2ZPNA 2LGXA 3ENEA 1WXSA 1TZ1A 3R7RA 2BYEA 4JIOU 4HPLB 2KC2A 2JWZA 4HDQA 4A3PA 1ZKHA 4W9GA 2K39A 3SD5A 4ZDVA 1TBEA 2FCSA 3GOEA 5E6OA 4K7UA 2AL6A 5AZFA 2ZNVB 4HDOA 4WJQA 2DENB 3M63B 3SHQA 2REXA 2G45B 3UQBA 2N9XA 2KHWB 4K7SA 4WAAA 3ECIA 4W9LA 1V49A 3ZRCA 2DAFA 1L2NA 1UZXB 2WYQA 3L0WB 4NQKE 3KW5B 2WX1A 4E3CA 2DAJA 2N1VA 2BWFA 3PRMB 1XD3B 4NAWA 1WX8A 3T8MA 4RM9A 1WJ4A 3QARA 2CHWA 2KDFB 1OGWA 4F1SA 1GG3A 4CO7A 4DHZB 1UBIA 2NBVB 3A9JB 3DVGX 4GMVA 1P3QU 2DYMA 3L17A 2LXCA 3X23A 3QWZB 1RLFA 4GDKA 1M94A 3QQ8B 2MBQA 4W9DA 3PTFC 2HD5B 4BBNC 5D7GA 3WAOA 2L8JA 4MEMA 4W9FA 3VUWA 2CHXA 4E71A 3A9JA 2XK5B 3K9PB 4FBJB 5IAAC 4PS3A 2DYOA 1V86A 3ZRFA 4W9EA 1WE6A 2EKEC 5DCNA 3EFUA 1Z5SB 2J7QB 3RCZA 2C7NB 1KM7A 3KUDB 5AZHA 3ZUNA 4DBGA 4K1RB 5DPRA 3W1YA 2J0KA 2MX2A 2GBMA 4WJPA 4GDKB 2NS5A 2OOBB 3JW0X 3NOBA 4DDID 2J0MA 3M62B 4OVUA 3TBLD 4W9IA 3DBHI 2RR9A 1YIWA 2G3QB 3OLMD 3PSEB 1WF9A 3AU4A 2MCNB 3M95A 3V62A 2FCMA 2LASA 2C9WB 2IY1B 1ISNA 2WDTB 2KDBA 3I3TB 3UIOB 3AXCA 2KJ6A 2FUHB 3VQIA 4NPNA 2KQ7A 3K9OB 3WAMA 2BYFA 2ZVOA 4IM2A 5JH5C 3VDZA 3ZNID 4MGIE 2FCQA 1IP9A 1OQYA 1I42A 4RMAA 3JVZX 4BOSC 4G50A 4DHZE 1WM3A 2KWVB 1WI0A 3HM3A 4II2B 2R2OA 2KKCA 2FNJB 4FLHA 2UYZB 4PS7A 4WJNA 2MLBA 2KWUB 1R4MI 2KN5A 4TV3A 1WIAA 5GMVA 2J0JA 3JSVB 2NPTA 1H8CA 3ZKJC 4P7IA 2OJRA 2ZVNA 3VH4B 2PE6B 3DOWA 4B6WA 2DX5B 3NS8A 3EECA 1YQBA 2NR2A 4W9JA 2LVPA 2GMIC 4IM3A 2JPHA 3DVNV 3HK0A 2ASQA 2XEWA 2CKHB 3RD2A 1WGHA 1E90A 2MA9B 4MGYE 4AJWA 3B0AA 4GOCA 3Q3JA 2VRRB 1WZ0A 4WWOA 4IWOA 4M8MA 1C3TA 2V3SA 4MM3A 2KC1A 1K8RB 3RULA 4IUMB 2A5UA 3X0WA 2D11A 2O6VD 2IO0B 3HHMA 1RAXA 2JRIB 2N9EB 3O65B 3PZDA 4CYEA 5LXIB 3A1QB 3A9KA 4BKTA 2LRWA 3L16A 3EC8A 4FN2A 2RGFA 2LGDA 1WGRA 2C5LC 4AOFA 4KZ0A 3TJPA 1UELA 1WMHA 2GBNA 2NCNA 1YJ1A 5J17A 3DVNU 3N3KB 4I6LB 4DWFA 4URKA 3KYDD 3V6CB 3KVFB 2JUOA 5C1ZA 3N32A 2Z59B 3VTWA 2YLMA 2YVCA 3A4RA 2IO3B 3KUZA 4LDTB 4FHKA 4WJOA 2C60A 3U7DA 1S3SG 2ZNVC 1XQQA 3ZDMC 1WRDB 5IA7A 3DPDA 4DK5A 2NPTB 4MH0E 1P0RA 1LFDA 3W1SA 4W9CA 5CHWA 2D2QA 1EO6A 3DDCB 2O2VB 4HK2A 3R7QA 2K25A 4E74A 1GJZA 3PHXB 3RT3B 3RYTA 4NJ7A 5EDSA 2KFKA 2LXAA 2BYVE 2V4LA 3AULA 4EEWA 4W9KA 2LJ5A 1TGZB 3PLVA 4TKNA 5DPSA 4BKSA 4I6PA 2B3AA 3PV1A 3ZTDA 5E6PA 4HCPB 1TTNA 1WJ6A 5CHVC 1UBQA 2NVUI 3LJ3A 1GUAB 3PHWB 4WWNA 3ML9A 5L83A 2BPSA 1E8ZA 4ANUA 1A5RA 1V6EA 4DHJB 3QK0A 1WH3A 3PRZA 4DXAB 3WA0A 3IHPC 4IC7B 2K8CA 5KHQA 2PJHA 2MP2A 3NZSA 3AI5A 2ZZPB 4ZYNA 2KLGA 2M17A 4TQ0A 4KIKA 4DDGD 2KJRA 4JL9A 4BOZB 4BBNF 2HTHA 2L3ZA 3PPAA 2KD0A 2KOXA 1BT0A 1WXAA 1MG8A 3PS6A 3MJWA 4JLCA 4ZRJA 3VFKA 4KSLC 4LJOB 3ZLZA 4JGHB 3L13A 2DZJA 4KV2A 4HLEA 1OEYA 1YX6B 2N4FA 4GB9A 3UINB 2CU1A 1IYFA 5AZGA 5G55A 2IYDB 3ZIMA 3UGBB 2BKRB 2MBOA 4BKSD 1C1YB 2XK5A 4I6NB 3GZNI 5AEKB 4EKUA 1UGMA 1OTRB 1S1QB 3TIXA 1WGGA 4ANWA 4W9HA 1J0GA 2JY6A 3PLUA 2FCNA 4NJ6A 5TR5A 4MELA 1ZW7A 4B9KA 4GDLB 2IO2B 3CF6E 1F9JA 3Q3FA 2LI5A 3P2BA 3H9DA 4HCNB 1Q5WB 3ZNGC 4G11A 2MW5A 3VTUA 2MSED 4FHJA 1V80A 1AARA 2M8SA 2IO1B 3ZVVA 1UH6A 3WALA 5HKHA 5LLIA 1WJUA 4KSKC 3ML8A 4MSQB 1WY8A 2BF8B 3QA8A 2C7HA 2DHZA 3DVGY 3WIMA 3TCAA 1Q0WB 2K8BA 2DZKA 1NDDA 4G3XB 1SGHA 4EUTA 5JZEB 2K6QA 2R2QA 2KDEB 4AUQC 4KZCA 4LCDE 1WFYA 3M3JA 1WXVA 5G2NA 1WYWB 4OVVA 5D2MB 1OEYJ 2FIFA 2KWCA 1HE8A 5E6NA 1Z2MA 5CTRC 2L05A 5J2RA 3WANA 3PVLA 1V5OA 2CR5A 2N7EA 1WR1A 2K1FA 1V9JA 4GN1A 4WQOB 1P1AA 2NBWB 3IG3A 2DZMA 2K8HA 4KDIC 3UIPB 2G4SA 4LJPB 2WX0A 4LDTD 3BY4B 2D10A 4XZ4A 2PPHA 5JHAA 2KTRB 4N9F4 3ZDTA 4ZRIA 5CHFA 1VD2A 1E8XA 4A3OA 1XT9B 3VH3B 2D3GA 4FJZA 2O6VA 3VVWB 3QAQA 3AU5A 4X57B 4CHKA 4K81A 1T0YA 3QCAA 2KMCA 3OJ3A 1QZEA 3L10B 3S2AA 3VUYA 2JF5A 3JSVA 3H6NA 4GSWA 1EUVB 4IWQA 2KFKB 4MGKE 4B95A 4G0NB 3H7PB 1WGYA 2G4DB 1WM2A 1Y8RC 4MJSA 3DBSA 2O2VA 4F7ZA 1J19A 4A20A 1WGDA 2FIDA 1SIFA 4M0WB 4IM0A 3U8ZA 4EOYA 4ICUA 2JRHA 2MBBB 2CS4A 2L76A 3L08A 2MBHA 1FXTB 2LZ6A 3KYCD 5DPTA 2MQJA 3KH0A 2AL3A 3QIJA 3CSTA 1NBFC 1LQBA 4GIVA 4GU2A 2LGYA 1YD8U 2EMTA 4NNJB 1WZ3A 2K6DB 4KVGB 2FAZA 3VTVA 2M1MA 1WMHB 3OJ4B 1P98A 3B08A 1CMXB 2JZZA 3APCA 2PEAA 1SE9A 4DHJD 1EF5A 2EMSA 4IW0A 2Z0DB 3VUXA 5CX3A 4WWPA 3WAPA 5BO4B 2ZEQA 3A1QA 3A9KB 3MTNB 3QX1A 2MRPA 4FJVB 2L7RA 2KO3A 3NZUA 2KANA 1KOTA 1PQSA 3SU8X 3LDZE 2DYBA 3IVFA 3ZW3A 2N9PC 5J18A 4ASWC 2MBEA 2W9NA 4FA6A 2BKFA 2KVRA 1EF1A 4GDLA 1LXDA 3A4SC 3CSFA 4FADA 4FULA 3BINA 1GC6A 4GGQA 4JQWC 2LWPA 2KNBA 2JZ3B 4FJYA 4ICVA 4AJYB 2IZVB 4KIKB 4HPMB 2AEHA 4EZKA 1I35A
chains in the Genus database with same CATH superfamily
1WX9A 3OAWA 2QDFA 1Q10A 1SJED 2L0FA 2KDIA 1E5WA 4F8CB 3AMZA 5C2TB 2KTRA 2L00B 3U2SC 1E7UA 4XGAB 1I4PA 2JVCA 2RPQA 2L0TA 4C80A 2QC8A 3BWUD 2KZRA 2KFJA 1F1HA 1JWBD 1N61A 2GBRA 3QHTA 3RNFC 1L7YA 3APFA 1E9MA 1GPXA 5D6JB 1FFUA 1IUEA 2WXMA 1KJTA 2GBKA 5FR6A 3VXWA 1FXIA 1UWXA 3V60A 4WQMA 1MG4A 2BQQA 4EFOA 4PK1A 3TSSA 1WE7A 1D3ZA 4ZRQA 1N60A 3TMPB 2KJHB 3A33B 2ZPYA 1RRBA 1L4DB 2HE7A 3SEBA 4IWPA 2V9HA 5C23A 2KK8A 2JWUA 1QOFA 1UD7A 4K7WA 3H1UA 2LHDA 4PYUA 2Y3AA 2LVQA 2SAKA 2X8XX 2RDBC 3SDLC 3IBEA 1WSPA 3PT2B 1FMAD 2V1YA 1R4NI 1UF0A 3IT6B 2WXQA 2QMTA 4C4VB 2BWES 4EZLA 2ZCBA 3MHSD 1L6UA 3GE8C 3RZWC 1NI2A 4GLSC 2BS2B 1YX5B 4KDLB 5D3IB 1ESFA 2O6VB 3PRPB 4TUUA 1ROEA 2CHZA 2I1JA 4ZRPA 3W1SC 4MT5A 2BYEA 5G5GA 2KC2A 1T0RC 4A3PA 4ZDVA 2K39A 2FCSA 5E6OA 2V3PA 5AZFA 2ZNVB 4HDOA 1SSNA 1JMLA 4M02A 3Q8EA 1DOIA 1EWYC 2G45B 4K7SA 2WXGA 1L2NA 3AEDB 4E3CA 1L5PA 2BWFA 4NAWA 1WX8A 2WXJA 1E0ZA 3DWGC 1ZDVA 2KAJA 4CO7A 1D6EC 3DHGC 4GMVA 1UWMA 3L17A 2J53A 3X23A 4OZBA 4H2AA 3QQ8B 4W9DA 4ITKA 4BBNC 1SIJA 1ZXIA 2LJIA 4E71A 2L8JA 3A9JA 2XK5B 1FCLA 3Q8CA 4OW0A 4FBJB 2DYOA 2IJ0A 3RNCC 1YJIA 4K1RB 4Q2JA 1AYFA 3FILB 2MX2A 4GDKB 4DDID 3NOBA 3GE3C 4OVUA 3TBLD 3FKYA 3DBHI 4W9IA 3AB5A 3OLMD 3PSEB 1VJKA 2LASA 1JALA 2IDYA 3I3TB 4NPNA 1QOBA 3VDZA 1ENFA 2VZKD 4JX1C 4MGIE 4C7YA 1RFKA 2FCQA 4RMAA 3JVZX 2Y5PA 1NVID 2FNJB 2JSVX 3BYYB 2UYZB 3VRAB 4WJNA 2MLBA 3BVGA 1WIAA 4A8XC 5GMVA 1SJHD 1H8CA 3P4SB 4P7IA 1GB4A 3P4RB 2DX5B 3WCQA 2WXRA 1SEBD 1OQRA 4IM3A 2CKHB 3RD2A 1WGHA 2J42A 3TEXA 1PDXA 4DXGA 1GOZA 2KC1A 4XWTA 4IUMB 2A5UA 3X0WA 4KX6B 2LRWA 2RGFA 2LGDA 1WGRA 3AECB 2C5LC 4KZ0A 3BZDB 3TJPA 3AM9A 2GBNA 2MHJA 1TKEA 1CJEA 3KYDD 3KVFB 2LEKA 5C1ZA 1VLBA 3A4RA 2IO3B 3KUZA 4WJOA 1S3SG 1XQQA 1JQ4A 3ZQ4A 1WRDB 2NPTB 4P1CC 1TY2A 1D4BA 1E6EB 2D2QA 1EO6A 3RT3B 2BYVE 4EEWA 5IP4D 5FR3A 2B3AA 4HCPB 4M0WA 1UBQA 3ML9A 1PGBA 2BPSA 1E8ZA 1UNSA 1GB1A 2PJHA 4A9AA 3NZSA 1FO4A 4US8A 1XLOA 4ZYNA 2KLGA 5I4DA 2WDVB 1JROA 4BBNF 1VDVA 3PS6A 2AQ3B 4HLEA 2DNFA 4PT5A 4GB9A 2IPKD 3DBRB 5G55A 1HA5A 4LLGM 3UGBB 4I6NB 5AEKB 5IO9A 1OTRB 3TIXA 1WGGA 4DXFA 3C19A 1LGRA 1J0GA 2RDGA 4LNNA 4NJ6A 5TR5A 4REZA 3CF6E 3P2BA 1IBXA 4HCNB 1T0QC 1EU4A 2MSED 1KRHA 4YXDB 1AARA 1UH6A 2WXPA 1HTQA 2AX5A 2DHZA 1Q0WB 1NEKB 5BMHA 2BBCA 4EUTA 2K6QA 2R2QA 2KDEB 2AQ1B 3NZ3A 1J7BA 3R2IA 3M3JA 1WXVA 5G2NA 4OVVA 1Z2MA 5CTRC 2BTEA 1V5OA 2CR5A 3KWLA 2G4SA 1V1PA 4LDTD 5EE0A 2D10A 4XZ4A 5JHAA 2KTRB 3C8YA 4ZRIA 3VH3B 2VH1A 2D3GA 4RGTA 2O6VA 3RFZB 1TS2A 4RH6A 5EE3A 3AU5A 3QCAA 1VZ7A 3VUYA 3S2AA 3L10B 3RNBC 4P1BC 1EUVB 3I9V1 4MGKE 3H7PB 2G4DB 3DBSA 1J19A 2PLPA 4US9A 3N1ZC 1MHXA 2JRHA 2CS4A 3KYCD 1FXTB 2UU7A 1R7SA 1F2RC 4IOIE 4WWMA 4KVGB 2FAZA 3EUB2 4HEA1 1K53A 2WQYB 1P98A 1CMXB 4J3OD 4ZHOA 4DHJD 2EMSA 5CX3A 1JWAD 5BO4B 2KANA 2HDEA 1M4VA 1PQSA 5J18A 4S17A 2W9NA 1IBXB 1TT5B 4GDLA 3W9CB 4FULA 4GGQA 2KMMA 3BYTB 4FJYA 2L32A 3HVDA 3MJ5A 4TSSA 2WP9B 4IC7B 2AEHA 4EZKA 1I35A 3ZO5B 1GC7A 3VAWA 1TS4A 2KQSA 3HM6X 2K9XA 3H7PA 5HHDG 3ZJTA 4RF0A 4OVZA 1E8YA 1V5TA 2PKOA 4XC2A 3DBHB 3UF8A 2QHOA 3AEGB 3HVZA 3DCGA 2KX0A 2WWZA 2RD0A 3RUIB 3ZTCA 2N9LA 1Q1OA 3L54A 3TL5A 2ZCCA 2W55A 3T9LA 4O1NA 2ONQA 3QC8B 3Q3NC 1JWSD 1L4ZB 3NS1A 5IN7A 2DZIA 5JHBA 3QJZA 2IBIB 2LVOA 4II3B 2MWSB 2WHIA 2IGGA 1YN3A 2BGFA 1IPGA 2JX5A 3AEFB 1E7VA 1CK1A 2HJ8A 3DBLI 3H7SA 3ZJVA 1R4MB 2AYOB 2GOWA 2UWQA 3H8HA 4YL8A 3RMKC 4UDUC 4YTPB 3LYYA 1J8CA 3ZNHB 3HIZA 2D3BA 3ZNZB 4KKJA 1E8WA 2NBUA 3APDA 2MP2B 2PW9A 1WYGA 1FPYA 2QEJC 3SFDB 1TZ1A 4HPLB 4C56C 4HDQA 1ZKHA 2MEKA 3SD5A 1TBEA 4WIPA 3GOEA 2K22A 4LTUA 1I7HA 4HPPA 3NJTA 5IKCM 2DENB 3SHQA 3UQBA 3ECIA 4W9LA 1QKZA 2DAFA 2YEPB 1FEHA 1UZXB 3L0WB 4ZHPA 4NQKE 3KW5B 2WX1A 4RGMA 3AE9B 1YQ4B 1QT9A 3QARA 2CHWA 1OGWA 4XDDA 4F1SA 4RF1A 4P16A 4M00A 2LGIA 1ZUD2 2BB6A 4GDKA 4R3DA 5D7GA 3CWIA 3WAOA 4W9FA 2CHXA 3K9PB 4XE0A 1V86A 2IGDA 4W9EA 1VRAB 2C7NB 2OEDA 4DBGA 5DPRA 4WJPA 2OOBB 1FD6A 4C00A 1I4GA 2RDHA 2I2YA 4WH4A 2MCNB 1KH0A 1NI3A 1ISNA 2KDBA 4KKIA 2D5GA 2KQ7A 3Q69A 2ZVOA 5JH5C 3MP9A 1OQYA 1I42A 3PZ7A 4BOSC 2KWVB 2JU6X 4PS7A 4TV3A 1MFWA 1IGDA 2J0JA 3RNEC 4RGOS 3VH4B 3DOWA 1N5XA 1T3QA 4HROA 3Q6BA 3HRDD 2LVPA 4XDCA 2JPHA 3DVNV 4A55A 4JWUC 3MFGA 4A6QA 1E90A 1XO3A 4TMAB 3B0AA 2OHFA 3E9SA 3Q3JA 4GOCA 4WWOA 1B9RA 4OZAA 2INDC 2O6VD 1FNUA 5LXIB 3A9KA 2WXIA 4C4VA 4FN2A 1C79A 4AOFA 1TJEA 2NCNA 1YJ1A 5J17A 3DVNU 2ACZB 3V6CB 3N32A 1BUIC 2IGHA 4XYCA 3VTWA 2YLMA 2YVCA 2ZNVC 3ZDMC 1KTKA 1I4HA 5TSSA 3DPDA 4MH0E 1P0RA 1DOYA 1LFDA 3FAHA 3W1SA 4W9CA 3DDCB 2O2VB 1GJZA 4NJ7A 2LXAA 1E7PB 3AULA 3MC9A 3BIID 2LJ5A 3I63C 4I6PA 3PV1A 1ZPSA 1TTNA 2J4XA 5CHVC 3LJ3A 3PHWB 4IKGA 5L83A 1CQVA 5BYQA 3V3XA 4DHJB 3P4QB 3T3NA 3PRZA 3IHPC 2ZZPB 2KT7A 2M17A 2R61A 4DDGD 2LUMA 2ON8A 2LGSA 4ZRJA 4KSLC 3ZLZA 1XF5L 4JGHB 2D3CA 1OEYA 1NYRA 3Q3MC 1HZ6A 2OJWA 2IYDB 3ZIMA 2GI9A 2MBOA 2KDMA 2FBWB 1UGMA 1V97A 4CQNA 2JY6A 1DGJA 3AE2B 3W5VB 1F9JA 2BW2A 3ZNGC 3VTUA 2MW5A 1V80A 2IO1B 3ZVVA 3N1XC 5LLIA 2QJLA 4MSQB 3AE5B 4HRSA 2BF8B 2PVOD 2C7HA 3WIMA 2EKIA 2DZKA 1JCKB 4G3XB 1SGHA 5JZEB 4ARIA 4WURA 1WFYA 3EA6A 3ETRA 5J2RA 2V3NA 2N7EA 3IG3A 2DZMA 1QOGA 3RNGC 1ZOYB 2KWDA 1C78A 3U7ZA 1AN8A 5HFYA 1SE3A 2BS3B 1VD2A 2JXTA 4A3OA 3GB1A 4X57B 3NVZA 3EGRA 3OJ3A 2JF5A 3JSVA 4GSWA 2KFKB 3W2DA 2O2VA 4F7ZA 2PTLA 4A20A 2FIDA 1SIFA 3ZXVA 1VZ6A 4IM0A 2MJ3A 2MBHA 2LZ6A 3NVWA 5DPTA 3KH0A 3CSTA 4GIVA 1LQBA 4ZOHC 3LXFA 4NNJB 1F77A 3AEEB 2WU2B 1J7CA 3VTVA 4KGRA 3OJ4B 2Z0DB 1OFFA 3A9KB 3MC8A 2Q5WD 2RPVA 4FJVB 2L7RA 2KO3A 3NZUA 3ZXRA 1XLQA 1HEZE 3IVFA 3OWEB 4ASWC 2BYTA 2MBEA 1WRIA 2BKFA 2KVRA 1LXDA 3ABVB 2JZPA 4AJYB 2IZVB 4KIKB 1ET6A 4HJKA 3TEYA 4RM8A 1TKGA 2QILA 3CMMB 3NHEB 2N1WA 4BFRA 1WX7A 3DQVA 2Z0EB 1RWSA 1KLVA 3FC4A 3IAM1 4HVBA 2HJ1A 3JYUA 3AEAB 5EE9A 1TIFA 2RSUA 1VCBA 4MSMB 3MHZA 2N9KA 2KMAA 3PREA 4LNOA 4EZJA 3VR9B 1JWMD 1TYGB 3AN1A 3PGEA 2MJDA 1JRUA 2GBJA 1KFYB 2L1AA 5H92C 1YN4A 3W5UB 2C7MB 5L95C 3DWMA 3EHVA 4NJCA 3B1LX 3VR8B 2W3SA 1TS3A 1JRPA 2AWTA 2I1KA 3B2GA 3KUCB 2JT4B 1FNWA 3N30A 1C9FA 1LM8B 4YSXB 4LK0M 2N7DA 3L4PA 2CU3A 2M4NA 3R66C 1V81A 2W82A 2WLBA 2CJNA 4BAXA 2Y5BB 2NMQA 3U30A 3U4EG 1WXMA 1A70A 1T6BX 1RFAA 4MH8A 4MDKE 1G6JA 3V6EB 1WR6E 1P7EA 1H4RA 1PYWD 2JXXA 2KXJA 3N20C 4YSYB 5DPWA 1V2YA 2KX3A 2ZPNA 2KACA 4JIOU 2JWZA 4W9GA 1FRDA 2AL6A 3Q8BA 2KVZA 1QILA 5GXGB 5BMIA 2WXOA 2REXA 2N9XA 2KHWB 2ZW1A 1V49A 3ZRCA 3RN9C 1ACCA 2B76B 4B0MA 1XD3B 5C3JB 4LNIA 4RM9A 3TEWA 1WJ4A 5BYSA 1I4XA 1XLPA 2NBVB 1P3QU 2DYMA 1C4PA 2LXCA 4MACA 3QWZB 1I4RA 1RLFA 1M94A 1ZE3D 2MBQA 1YOVB 3PTFC 2QCZA 2MJEA 4MEMA 2XNAC 5IAAC 4PS3A 1TKYA 4MM3B 3ZRFA 1V8CA 1WE6A 2EKEC 5DCNA 3EFUA 3KUDB 5AZHA 4XWWA 3W1YA 1N62A 2NS5A 3JW0X 1SE2A 1J7AA 2RR9A 2FCMA 2C9WB 3IT4B 1ZP0B 2K0PA 2KJ6A 3WAMA 3K9OB 4USAA 4IM2A 3ZNID 1FFVA 1K51A 4RNAA 3I57A 4DHZE 1WM3A 3HM3A 2R2OA 1YN5A 4FLHA 3DBLB 2KWUB 1R4MI 2KN5A 4LNKA 3SFEB 3JSVB 2NPTA 5LNK1 3ZKJC 1TY0A 3NS8A 3EECA 2GMIC 2PMVA 1HXYD 1KLGD 3HK0A 2XEWA 3PO0A 2K3UA 4MGYE 2BB5A 4AJWA 3SR6A 1STEA 4IWOA 3VRBB 2WU5B 4MM3A 3RULA 4YT0B 4ZYSA 2IO0B 3HHMA 1RAXA 3PZDA 4CYEA 1UGJA 3A1QB 4BKTA 3L16A 2NTSA 2FUG1 3EC8A 2W3RA 1UELA 2KYWA 1WMHA 5FKAC 4I6LB 4DWFA 4URKA 3OG5A 1MHHE 3DHIC 3NUHB 2PVGC 4EE2A 4FHKA 2G9HD 3N1YC 5IA7A 1XLNA 1PFDA 3AE1B 4E74A 2WDRB 4ARCA 2INNE 3N9YC 2KQ4X 3NRZA 4L23A 1EWCA 4W9KA 2BVCA 5AUKA 2AQ2B 1TGZB 3PLVA 4OZCA 5DPSA 1NYQA 1WJ6A 4WWNA 1IGCA 1V6EA 4OHJA 4DXAB 2K8CA 5HG2A 3AI5A 4TQ0A 1EM7A 4JL9A 4BOZB 2L3ZA 3BVZA 3DHHC 3FILA 2KD0A 4FXCA 1BT0A 3VFKA 4LJOB 2WXNA 3L13A 2N4FA 1IYFA 3UINB 2DLBA 2BS4B 2BT6A 5AZGA 4BKSD 2BKRB 2XK5A 3P1MA 3P42A 4ANWA 3B9JA 3PLUA 3AV8A 3NVVA 2WXFA 1ZW7A 4B9KA 4GDLB 2IO2B 3Q3FA 3H9DA 1UUPA 1C76A 3GZNB 3RI7C 3URYA 3GP7A 3WALA 1WJUA 3R2TA 1TS5A 3ML8A 5H8YE 3TCAA 2JYTA 4LCDE 5HI1A 1WYWB 4HJGE 1OEYJ 1VR9A 2FIFA 2L05A 3WANA 1WR1A 4GN1A 4KDIC 3AE4B 4LJPB 2WX0A 1FXAA 3U52E 1R4NB 2PPHA 3ZDTA 1E8XA 2WXLA 1XT9B 1QF6A 3VVWB 4YWGG 2WXKA 4K81A 1YNTE 2KMCA 1QZEA 4BZAA 1F0ZA 1L0XB 4IWQA 1ZDXA 4B95A 4G0NB 1WGYA 4HKZE 1WM2A 1Y8RC 5D3DA 2HTME 1V1PB 4N58A 3U8ZA 2MBBB 2L76A 2MQJA 2AL3A 1I4QA 2TSSA 2M0AA 5T8IA 1L0VB 4GU2A 2DWQA 3HUIA 4LNFA 3EFCA 1YMHE 3AE7B 1VZ8A 4WAFA 3CIRB 2M1MA 1WMHB 4NZLB 3B08A 1WWTA 2JZZA 3APCA 3J9CA 2G1EA 2LMCA 3VUXA 3WAPA 3A1QA 3QX1A 3MTNB 1L0YB 1YJJA 2H88B 1D5XC 4L1BA 1KOTA 1E10A 2N9PC 2WGSA 3CSFA 4FADA 1GC6A 3AE6B 1F52A 4JQWC 2LWPA 4TQ1A 1PGXA 5LXHA 1U4AA 4M8NA 3V61A 4NAMA 3RZFA 4K3BA 1SXTA 1X1MA 3GS2A 3PZ8A 1P9DU 4IG7B 2YEPF 2LUEA 3AE3B 4ANVA 4HWIB 2WS3B 4MGZE 3IFWB 2LHEA 5KHOA 1GNUA 4ZRKA 2M0XA 4B0EA 2LD9A 3UQAA 2CJOA 4J6IA 2IY0B 1ZGUB 4K3CA 4QAYA 1MI0A 2XBBC 4HXDA 3C0RB 4D2KA 1N6ZA 2N7JA 4M01A 4AP4C 1T0SC 2KN4A 4PS8A 4NQLB 3Q8AA 2A4ZA 2RMMA 4GXBA 5D94A 2XN9C 4AWJA 1D5ZC 4XX5A 3BK1A 1WJNA 3D32A 3Q3OC 5FK9C 3UI3A 1SB3C 2N0SB 2VH2A 3NY5A 2D07B 2ZJDA 3AE8B 4JE3B 2H89B 2KTFA 4ACFA 2KLCA 3VHTC 4BVUC 4BKGA 3AH7A 2LRUA 3P63A 4MJSB 4NY0A 4ANXA 1KLUD 2I38A 3ALBA 3R3MA 4NAWB 3DBRI 3V05A 4PYZA 1C4AA 2W54A 2PE9A 1KF6B 1MPEA 3ONSA 1XCTL 3I5JC 2LFIA 1DOXA 3ZJUA 1HZ5A 1Y56A 2LGXA 3ENEA 1WXSA 3R7RA 2FE8A 2GB1A 4RFBA 4K7UA 2X38A 2M56B 4WJQA 2JQRB 4YTNB 3M63B 4N59A 1AWDA 3AEBB 4WAAA 1FNVA 3ZYYX 5MPOA 4A90A 2WYQA 1WGKA 2ZW0A 1PGAA 2SEBD 2E6XA 2QSDA 2NTTA 2DAJA 2N1VA 3E56A 2MH7A 3PRMB 3T8MA 2KDFB 1GG3A 1L6VA 4DHZB 4RGNA 1UBIA 3A9JB 3DVGX 1BXTA 4KGTA 4HKQA 1CZPA 1ZXHA 2HD5B 4KGSA 3VUWA 4YSZB 2Y5CA 1HTOA 1Z5SB 2J7QB 3RCZA 1KM7A 1JWUD 3ZUNA 4DQOC 1XEEA 2J0KA 2GBMA 2J0MA 3M62B 4IDIA 3T3OA 1YIWA 2G3QB 5E6JA 1WF9A 1FIQA 3AU4A 3M95A 3V62A 3KLSX 2IY1B 2WDTB 4N6EB 3UIOB 3AXCA 2FUHB 3VQIA 2BYFA 1AW7A 3TEZA 2DBYA 1N5WA 4JPSA 4JWSC 1IP9A 4G50A 1WI0A 4II2B 3R8BA 2KKCA 2QIEB 1N63A 5G5HA 2OJRA 2ZVNA 2PE6B 4B6WA 1YQBA 1RM6C 2NR2A 4W9JA 2ASQA 2M19A 5IOIA 2MA9B 4L2YA 4S0RA 2VRRB 1WZ0A 4M8MA 1C3TA 2V3SA 1K8RB 2D11A 1F2RI 2N9EB 2JRIB 3O65B 3P4PB 1T5XD 3O13A 3N3KB 2JUOA 2Z59B 4LDTB 2C60A 3U7DA 4DK5A 1PUTA 3KQ4A 2INPE 4RCOA 5CHWA 3R7QA 4HK2A 2VZKB 2K25A 3PHXB 3B2FA 3RYTA 4AQ7A 5EDSA 2KFKA 1ET9A 1QOAA 2V4LA 4TKNA 4BKSA 3RPFC 3ZTDA 5E6PA 2NVUI 1TZOA 1GUAB 4ANUA 1A5RA 2J52A 3QK0A 1WH3A 3WA0A 5KHQA 2MP2A 2WXHA 4KIKA 1FM0D 2KJRA 5BYRA 3IAS1 2HTHA 1WXQA 1D5MC 3PPAA 1V1OA 2KOXA 1WXAA 1MG8A 1MVKA 3MJWA 4JLCA 4KV2A 2DZJA 1C77A 1YX6B 2GRIA 2CU1A 1XCQL 1C1YB 3GZNI 2Z8LA 4EKUA 4C7ZA 1LO5D 1S1QB 4W9HA 1P7FA 1C4CA 2FCNA 4MELA 2LI5A 1Q5WB 1SBBB 4G11A 1QQRA 4FHJA 2M8SA 5HKHA 1B1ZA 4KSKC 1WY8A 3QA8A 3DVGY 2L83A 1HQRD 2K8BA 1NDDA 4AUQC 4KZCA 2V4IB 5EE1A 2JYEA 3NVYA 1DYQA 5D2MB 2KWCA 1HE8A 5E6NA 1K50A 1GAQB 2WDQB 3PVLA 3Q8FA 3NG0A 3MC0B 1EU3A 2K1FA 1V9JA 2PIAA 4WQOB 1P1AA 2NBWB 2K8HA 3UIPB 1JW9D 3BY4B 1OQQA 1NENB 3Q14C 4N9F4 2INCC 5CHFA 3TUOA 3ZGZA 4FJZA 5AUIA 3QAQA 1RYJA 2EELA 2GLSA 4CHKA 1T0YA 1YQ3B 3RNAC 3H6NA 1XXGA 4MJSA 3BK2A 1K52A 1QLBB 1WGDA 4M0WB 4EOYA 4ICUA 3L08A 4YTMB 3Q2AC 3QIJA 1NBFC 2LGYA 1YD8U 2EMTA 1WZ3A 2K6DB 1MJDA 1SF0A 1BMLC 1FRRA 2PEAA 1SE9A 2ICIA 1EF5A 4IW0A 4WWPA 2ZEQA 2MRPA 5JXVA 1SE4A 3IXSA 5BMGA 2D3AA 3SU8X 3LDZE 2DYBA 3ZW3A 4AS1A 2WNMA 2L52A 4P6VF 4FA6A 2V0GA 1EF1A 3A4SC 1FCCC 3BINA 3LB8C 2K5PA 3BVMA 2KNBA 2JZ3B 2E3TA 4ICVA 4HPMB 3KWVA
chains in the Genus database with same CATH topology
4HJKA 1WX9A 3OAWA 4RM8A 4TQ1A 1U4AA 4M8NA 3ZO5B 5LXHA 3V61A 1GC7A 3CMMB 2L0FA 3NHEB 3VAWA 2KDIA 1E5WA 2N1WA 3RZFA 4F8CB 2KQSA 3HM6X 4BFRA 3H7PA 1X1MA 1WX7A 4IG7B 1P9DU 3DQVA 2KTRA 2L00B 2Z0EB 1KLVA 1E8YA 2LUEA 1E7UA 4ANVA 4HWIB 1V5TA 4MGZE 4XC2A 4HVBA 3UF8A 2JVCA 2QHOA 2L0TA 2RPQA 3IFWB 3JYUA 2KZRA 2RSUA 2KFJA 1VCBA 2GBRA 3DCGA 4MSMB 3QHTA 2KX0A 2WWZA 2KMAA 1L7YA 3PREA 1GNUA 4ZRKA 2M0XA 3APFA 5KHOA 2LD9A 4EZJA 3UQAA 2RD0A 5D6JB 3PGEA 5FR6A 1KJTA 2GBKA 4J6IA 3RUIB 3VXWA 1JRUA 2GBJA 1ZGUB 2IY0B 3V60A 2XBBC 3ZTCA 4EFOA 1Q1OA 4HXDA 3L54A 3C0RB 2C7MB 5L95C 3EHVA 1WE7A 3B1LX 3TL5A 1D3ZA 2ZCCA 3T9LA 4AP4C 3QC8B 4PS8A 4NQLB 3TMPB 2A4ZA 2KJHB 3A33B 2AWTA 2I1KA 2ZPYA 3KUCB 2DZIA 5JHBA 3QJZA 2IBIB 4GXBA 5D94A 2JT4B 2LVOA 1RRBA 3N30A 4II3B 4AWJA 2MWSB 4XX5A 1LM8B 2HE7A 1WJNA 4IWPA 3D32A 5C23A 2KK8A 1UD7A 4K7WA 2N7DA 3H1UA 3NY5A 2D07B 2M4NA 2ZJDA 4PYUA 2LVQA 2BGFA 1V81A 3R66C 3SDLC 3IBEA 2KTFA 3PT2B 1IPGA 2KLCA 2Y5BB 3VHTC 4BVUC 3U30A 2V1YA 1R4NI 4BKGA 1E7VA 2HJ8A 1WXMA 2LRUA 3DBLI 3H7SA 4MJSB 1RFAA 2BWES 4EZLA 2ZCBA 4NY0A 4ANXA 2AYOB 3ALBA 3MHSD 2GOWA 2UWQA 3R3MA 4NAWB 4YL8A 3DBRI 4MDKE 1G6JA 3V6EB 1WR6E 3RZWC 1NI2A 1J8CA 4PYZA 3ZNHB 1H4RA 3HIZA 1YX5B 4KDLB 3ZNZB 2PE9A 1E8WA 2NBUA 3APDA 2O6VB 2JXXA 2MP2B 2KXJA 3ONSA 3PRPB 4TUUA 2CHZA 2I1JA 3W1SC 5DPWA 1V2YA 2KX3A 2ZPNA 2LGXA 3ENEA 1WXSA 1TZ1A 3R7RA 2BYEA 4JIOU 4HPLB 2KC2A 2JWZA 4HDQA 4A3PA 1ZKHA 4W9GA 2K39A 3SD5A 4ZDVA 1TBEA 2FCSA 3GOEA 5E6OA 4K7UA 2AL6A 5AZFA 2ZNVB 4HDOA 4WJQA 2DENB 3M63B 3SHQA 2REXA 2G45B 3UQBA 2N9XA 2KHWB 4K7SA 4WAAA 3ECIA 4W9LA 1V49A 3ZRCA 2DAFA 1L2NA 1UZXB 2WYQA 3L0WB 4NQKE 3KW5B 2WX1A 4E3CA 2DAJA 2N1VA 2BWFA 3PRMB 1XD3B 4NAWA 1WX8A 3T8MA 4RM9A 1WJ4A 3QARA 2CHWA 2KDFB 1OGWA 4F1SA 1GG3A 4CO7A 4DHZB 1UBIA 2NBVB 3A9JB 3DVGX 4GMVA 1P3QU 2DYMA 3L17A 2LXCA 3X23A 3QWZB 1RLFA 4GDKA 1M94A 3QQ8B 2MBQA 4W9DA 3PTFC 2HD5B 4BBNC 5D7GA 3WAOA 2L8JA 4MEMA 4W9FA 3VUWA 2CHXA 4E71A 3A9JA 2XK5B 3K9PB 4FBJB 5IAAC 4PS3A 2DYOA 1V86A 3ZRFA 4W9EA 1WE6A 2EKEC 5DCNA 3EFUA 1Z5SB 2J7QB 3RCZA 2C7NB 1KM7A 3KUDB 5AZHA 3ZUNA 4DBGA 4K1RB 5DPRA 3W1YA 2J0KA 2MX2A 2GBMA 4WJPA 4GDKB 2NS5A 2OOBB 3JW0X 3NOBA 4DDID 2J0MA 3M62B 4OVUA 3TBLD 4W9IA 3DBHI 2RR9A 1YIWA 2G3QB 3OLMD 3PSEB 1WF9A 3AU4A 2MCNB 3M95A 3V62A 2FCMA 2LASA 2C9WB 2IY1B 1ISNA 2WDTB 2KDBA 3I3TB 3UIOB 3AXCA 2KJ6A 2FUHB 3VQIA 4NPNA 2KQ7A 3K9OB 3WAMA 2BYFA 2ZVOA 4IM2A 5JH5C 3VDZA 3ZNID 4MGIE 2FCQA 1IP9A 1OQYA 1I42A 4RMAA 3JVZX 4BOSC 4G50A 4DHZE 1WM3A 2KWVB 1WI0A 3HM3A 4II2B 2R2OA 2KKCA 2FNJB 4FLHA 2UYZB 4PS7A 4WJNA 2MLBA 2KWUB 1R4MI 2KN5A 4TV3A 1WIAA 5GMVA 2J0JA 3JSVB 2NPTA 1H8CA 3ZKJC 4P7IA 2OJRA 2ZVNA 3VH4B 2PE6B 3DOWA 4B6WA 2DX5B 3NS8A 3EECA 1YQBA 2NR2A 4W9JA 2LVPA 2GMIC 4IM3A 2JPHA 3DVNV 3HK0A 2ASQA 2XEWA 2CKHB 3RD2A 1WGHA 1E90A 2MA9B 4MGYE 4AJWA 3B0AA 4GOCA 3Q3JA 2VRRB 1WZ0A 4WWOA 4IWOA 4M8MA 1C3TA 2V3SA 4MM3A 2KC1A 1K8RB 3RULA 4IUMB 2A5UA 3X0WA 2D11A 2O6VD 2IO0B 3HHMA 1RAXA 2JRIB 2N9EB 3O65B 3PZDA 4CYEA 5LXIB 3A1QB 3A9KA 4BKTA 2LRWA 3L16A 3EC8A 4FN2A 2RGFA 2LGDA 1WGRA 2C5LC 4AOFA 4KZ0A 3TJPA 1UELA 1WMHA 2GBNA 2NCNA 1YJ1A 5J17A 3DVNU 3N3KB 4I6LB 4DWFA 4URKA 3KYDD 3V6CB 3KVFB 2JUOA 5C1ZA 3N32A 2Z59B 3VTWA 2YLMA 2YVCA 3A4RA 2IO3B 3KUZA 4LDTB 4FHKA 4WJOA 2C60A 3U7DA 1S3SG 2ZNVC 1XQQA 3ZDMC 1WRDB 5IA7A 3DPDA 4DK5A 2NPTB 4MH0E 1P0RA 1LFDA 3W1SA 4W9CA 5CHWA 2D2QA 1EO6A 3DDCB 2O2VB 4HK2A 3R7QA 2K25A 4E74A 1GJZA 3PHXB 3RT3B 3RYTA 4NJ7A 5EDSA 2KFKA 2LXAA 2BYVE 2V4LA 3AULA 4EEWA 4W9KA 2LJ5A 1TGZB 3PLVA 4TKNA 5DPSA 4BKSA 4I6PA 2B3AA 3PV1A 3ZTDA 5E6PA 4HCPB 1TTNA 1WJ6A 5CHVC 1UBQA 2NVUI 3LJ3A 1GUAB 3PHWB 4WWNA 3ML9A 5L83A 2BPSA 1E8ZA 4ANUA 1A5RA 1V6EA 4DHJB 3QK0A 1WH3A 3PRZA 4DXAB 3WA0A 3IHPC 4IC7B 2K8CA 5KHQA 2PJHA 2MP2A 3NZSA 3AI5A 2ZZPB 4ZYNA 2KLGA 2M17A 4TQ0A 4KIKA 4DDGD 2KJRA 4JL9A 4BOZB 4BBNF 2HTHA 2L3ZA 3PPAA 2KD0A 2KOXA 1BT0A 1WXAA 1MG8A 3PS6A 3MJWA 4JLCA 4ZRJA 3VFKA 4KSLC 4LJOB 3ZLZA 4JGHB 3L13A 2DZJA 4KV2A 4HLEA 1OEYA 1YX6B 2N4FA 4GB9A 3UINB 2CU1A 1IYFA 5AZGA 5G55A 2IYDB 3ZIMA 3UGBB 2BKRB 2MBOA 4BKSD 1C1YB 2XK5A 4I6NB 3GZNI 5AEKB 4EKUA 1UGMA 1OTRB 1S1QB 3TIXA 1WGGA 4ANWA 4W9HA 1J0GA 2JY6A 3PLUA 2FCNA 4NJ6A 5TR5A 4MELA 1ZW7A 4B9KA 4GDLB 2IO2B 3CF6E 1F9JA 3Q3FA 2LI5A 3P2BA 3H9DA 4HCNB 1Q5WB 3ZNGC 4G11A 2MW5A 3VTUA 2MSED 4FHJA 1V80A 1AARA 2M8SA 2IO1B 3ZVVA 1UH6A 3WALA 5HKHA 5LLIA 1WJUA 4KSKC 3ML8A 4MSQB 1WY8A 2BF8B 3QA8A 2C7HA 2DHZA 3DVGY 3WIMA 3TCAA 1Q0WB 2K8BA 2DZKA 1NDDA 4G3XB 1SGHA 4EUTA 5JZEB 2K6QA 2R2QA 2KDEB 4AUQC 4KZCA 4LCDE 1WFYA 3M3JA 1WXVA 5G2NA 1WYWB 4OVVA 5D2MB 1OEYJ 2FIFA 2KWCA 1HE8A 5E6NA 1Z2MA 5CTRC 2L05A 5J2RA 3WANA 3PVLA 1V5OA 2CR5A 2N7EA 1WR1A 2K1FA 1V9JA 4GN1A 4WQOB 1P1AA 2NBWB 3IG3A 2DZMA 2K8HA 4KDIC 3UIPB 2G4SA 4LJPB 2WX0A 4LDTD 3BY4B 2D10A 4XZ4A 2PPHA 5JHAA 2KTRB 4N9F4 3ZDTA 4ZRIA 5CHFA 1VD2A 1E8XA 4A3OA 1XT9B 3VH3B 2D3GA 4FJZA 2O6VA 3VVWB 3QAQA 3AU5A 4X57B 4CHKA 4K81A 1T0YA 3QCAA 2KMCA 3OJ3A 1QZEA 3L10B 3S2AA 3VUYA 2JF5A 3JSVA 3H6NA 4GSWA 1EUVB 4IWQA 2KFKB 4MGKE 4B95A 4G0NB 3H7PB 1WGYA 2G4DB 1WM2A 1Y8RC 4MJSA 3DBSA 2O2VA 4F7ZA 1J19A 4A20A 1WGDA 2FIDA 1SIFA 4M0WB 4IM0A 3U8ZA 4EOYA 4ICUA 2JRHA 2MBBB 2CS4A 2L76A 3L08A 2MBHA 1FXTB 2LZ6A 3KYCD 5DPTA 2MQJA 3KH0A 2AL3A 3QIJA 3CSTA 1NBFC 1LQBA 4GIVA 4GU2A 2LGYA 1YD8U 2EMTA 4NNJB 1WZ3A 2K6DB 4KVGB 2FAZA 3VTVA 2M1MA 1WMHB 3OJ4B 1P98A 3B08A 1CMXB 2JZZA 3APCA 2PEAA 1SE9A 4DHJD 1EF5A 2EMSA 4IW0A 2Z0DB 3VUXA 5CX3A 4WWPA 3WAPA 5BO4B 2ZEQA 3A1QA 3A9KB 3MTNB 3QX1A 2MRPA 4FJVB 2L7RA 2KO3A 3NZUA 2KANA 1KOTA 1PQSA 3SU8X 3LDZE 2DYBA 3IVFA 3ZW3A 2N9PC 5J18A 4ASWC 2MBEA 2W9NA 4FA6A 2BKFA 2KVRA 1EF1A 4GDLA 1LXDA 3A4SC 3CSFA 4FADA 4FULA 3BINA 1GC6A 4GGQA 4JQWC 2LWPA 2KNBA 2JZ3B 4FJYA 4ICVA 4AJYB 2IZVB 4KIKB 4HPMB 2AEHA 4EZKA 1I35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJK A;  1WX9 A;  3OAW A;  4RM8 A;  4TQ1 A;  1U4A A;  4M8N A;  3ZO5 B;  5LXH A;  3V61 A;  1GC7 A;  3CMM B;  2L0F A;  3NHE B;  3VAW A;  2KDI A;  1E5W A;  2N1W A;  3RZF A;  4F8C B;  2KQS A;  3HM6 X;  4BFR A;  3H7P A;  1X1M A;  1WX7 A;  4IG7 B;  1P9D U;  3DQV A;  2KTR A;  2L00 B;  2Z0E B;  1KLV A;  1E8Y A;  2LUE A;  1E7U A;  4ANV A;  4HWI B;  1V5T A;  4MGZ E;  4XC2 A;  4HVB A;  3UF8 A;  2JVC A;  2QHO A;  2L0T A;  2RPQ A;  3IFW B;  3JYU A;  2KZR A;  2RSU A;  2KFJ A;  1VCB A;  2GBR A;  3DCG A;  4MSM B;  3QHT A;  2KX0 A;  2WWZ A;  2KMA A;  1L7Y A;  3PRE A;  1GNU A;  4ZRK A;  2M0X A;  3APF A;  5KHO A;  2LD9 A;  4EZJ A;  3UQA A;  2RD0 A;  5D6J B;  3PGE A;  5FR6 A;  1KJT A;  2GBK A;  4J6I A;  3RUI B;  3VXW A;  1JRU A;  2GBJ A;  1ZGU B;  2IY0 B;  3V60 A;  2XBB C;  3ZTC A;  4EFO A;  1Q1O A;  4HXD A;  3L54 A;  3C0R B;  2C7M B;  5L95 C;  3EHV A;  1WE7 A;  3B1L X;  3TL5 A;  1D3Z A;  2ZCC A;  3T9L A;  4AP4 C;  3QC8 B;  4PS8 A;  4NQL B;  3TMP B;  2A4Z A;  2KJH B;  3A33 B;  2AWT A;  2I1K A;  2ZPY A;  3KUC B;  2DZI A;  5JHB A;  3QJZ A;  2IBI B;  4GXB A;  5D94 A;  2JT4 B;  2LVO A;  1RRB A;  3N30 A;  4II3 B;  4AWJ A;  2MWS B;  4XX5 A;  1LM8 B;  2HE7 A;  1WJN A;  4IWP A;  3D32 A;  5C23 A;  2KK8 A;  1UD7 A;  4K7W A;  2N7D A;  3H1U A;  3NY5 A;  2D07 B;  2M4N A;  2ZJD A;  4PYU A;  2LVQ A;  2BGF A;  1V81 A;  3R66 C;  3SDL C;  3IBE A;  2KTF A;  3PT2 B;  1IPG A;  2KLC A;  2Y5B B;  3VHT C;  4BVU C;  3U30 A;  2V1Y A;  1R4N I;  4BKG A;  1E7V A;  2HJ8 A;  1WXM A;  2LRU A;  3DBL I;  3H7S A;  4MJS B;  1RFA A;  2BWE S;  4EZL A;  2ZCB A;  4NY0 A;  4ANX A;  2AYO B;  3ALB A;  3MHS D;  2GOW A;  2UWQ A;  3R3M A;  4NAW B;  4YL8 A;  3DBR I;  4MDK E;  1G6J A;  3V6E B;  1WR6 E;  3RZW C;  1NI2 A;  1J8C A;  4PYZ A;  3ZNH B;  1H4R A;  3HIZ A;  1YX5 B;  4KDL B;  3ZNZ B;  2PE9 A;  1E8W A;  2NBU A;  3APD A;  2O6V B;  2JXX A;  2MP2 B;  2KXJ A;  3ONS A;  3PRP B;  4TUU A;  2CHZ A;  2I1J A;  3W1S C;  5DPW A;  1V2Y A;  2KX3 A;  2ZPN A;  2LGX A;  3ENE A;  1WXS A;  1TZ1 A;  3R7R A;  2BYE A;  4JIO U;  4HPL B;  2KC2 A;  2JWZ A;  4HDQ A;  4A3P A;  1ZKH A;  4W9G A;  2K39 A;  3SD5 A;  4ZDV A;  1TBE A;  2FCS A;  3GOE A;  5E6O A;  4K7U A;  2AL6 A;  5AZF A;  2ZNV B;  4HDO A;  4WJQ A;  2DEN B;  3M63 B;  3SHQ A;  2REX A;  2G45 B;  3UQB A;  2N9X A;  2KHW B;  4K7S A;  4WAA A;  3ECI A;  4W9L A;  1V49 A;  3ZRC A;  2DAF A;  1L2N A;  1UZX B;  2WYQ A;  3L0W B;  4NQK E;  3KW5 B;  2WX1 A;  4E3C A;  2DAJ A;  2N1V A;  2BWF A;  3PRM B;  1XD3 B;  4NAW A;  1WX8 A;  3T8M A;  4RM9 A;  1WJ4 A;  3QAR A;  2CHW A;  2KDF B;  1OGW A;  4F1S A;  1GG3 A;  4CO7 A;  4DHZ B;  1UBI A;  2NBV B;  3A9J B;  3DVG X;  4GMV A;  1P3Q U;  2DYM A;  3L17 A;  2LXC A;  3X23 A;  3QWZ B;  1RLF A;  4GDK A;  1M94 A;  3QQ8 B;  2MBQ A;  4W9D A;  3PTF C;  2HD5 B;  4BBN C;  5D7G A;  3WAO A;  2L8J A;  4MEM A;  4W9F A;  3VUW A;  2CHX A;  4E71 A;  3A9J A;  2XK5 B;  3K9P B;  4FBJ B;  5IAA C;  4PS3 A;  2DYO A;  1V86 A;  3ZRF A;  4W9E A;  1WE6 A;  2EKE C;  5DCN A;  3EFU A;  1Z5S B;  2J7Q B;  3RCZ A;  2C7N B;  1KM7 A;  3KUD B;  5AZH A;  3ZUN A;  4DBG A;  4K1R B;  5DPR A;  3W1Y A;  2J0K A;  2MX2 A;  2GBM A;  4WJP A;  4GDK B;  2NS5 A;  2OOB B;  3JW0 X;  3NOB A;  4DDI D;  2J0M A;  3M62 B;  4OVU A;  3TBL D;  4W9I A;  3DBH I;  2RR9 A;  1YIW A;  2G3Q B;  3OLM D;  3PSE B;  1WF9 A;  3AU4 A;  2MCN B;  3M95 A;  3V62 A;  2FCM A;  2LAS A;  2C9W B;  2IY1 B;  1ISN A;  2WDT B;  2KDB A;  3I3T B;  3UIO B;  3AXC A;  2KJ6 A;  2FUH B;  3VQI A;  4NPN A;  2KQ7 A;  3K9O B;  3WAM A;  2BYF A;  2ZVO A;  4IM2 A;  5JH5 C;  3VDZ A;  3ZNI D;  4MGI E;  2FCQ A;  1IP9 A;  1OQY A;  1I42 A;  4RMA A;  3JVZ X;  4BOS C;  4G50 A;  4DHZ E;  1WM3 A;  2KWV B;  1WI0 A;  3HM3 A;  4II2 B;  2R2O A;  2KKC A;  2FNJ B;  4FLH A;  2UYZ B;  4PS7 A;  4WJN A;  2MLB A;  2KWU B;  1R4M I;  2KN5 A;  4TV3 A;  1WIA A;  5GMV A;  2J0J A;  3JSV B;  2NPT A;  1H8C A;  3ZKJ C;  4P7I A;  2OJR A;  2ZVN A;  3VH4 B;  2PE6 B;  3DOW A;  4B6W A;  2DX5 B;  3NS8 A;  3EEC A;  1YQB A;  2NR2 A;  4W9J A;  2LVP A;  2GMI C;  4IM3 A;  2JPH A;  3DVN V;  3HK0 A;  2ASQ A;  2XEW A;  2CKH B;  3RD2 A;  1WGH A;  1E90 A;  2MA9 B;  4MGY E;  4AJW A;  3B0A A;  4GOC A;  3Q3J A;  2VRR B;  1WZ0 A;  4WWO A;  4IWO A;  4M8M A;  1C3T A;  2V3S A;  4MM3 A;  2KC1 A;  1K8R B;  3RUL A;  4IUM B;  2A5U A;  3X0W A;  2D11 A;  2O6V D;  2IO0 B;  3HHM A;  1RAX A;  2JRI B;  2N9E B;  3O65 B;  3PZD A;  4CYE A;  5LXI B;  3A1Q B;  3A9K A;  4BKT A;  2LRW A;  3L16 A;  3EC8 A;  4FN2 A;  2RGF A;  2LGD A;  1WGR A;  2C5L C;  4AOF A;  4KZ0 A;  3TJP A;  1UEL A;  1WMH A;  2GBN A;  2NCN A;  1YJ1 A;  5J17 A;  3DVN U;  3N3K B;  4I6L B;  4DWF A;  4URK A;  3KYD D;  3V6C B;  3KVF B;  2JUO A;  5C1Z A;  3N32 A;  2Z59 B;  3VTW A;  2YLM A;  2YVC A;  3A4R A;  2IO3 B;  3KUZ A;  4LDT B;  4FHK A;  4WJO A;  2C60 A;  3U7D A;  1S3S G;  2ZNV C;  1XQQ A;  3ZDM C;  1WRD B;  5IA7 A;  3DPD A;  4DK5 A;  2NPT B;  4MH0 E;  1P0R A;  1LFD A;  3W1S A;  4W9C A;  5CHW A;  2D2Q A;  1EO6 A;  3DDC B;  2O2V B;  4HK2 A;  3R7Q A;  2K25 A;  4E74 A;  1GJZ A;  3PHX B;  3RT3 B;  3RYT A;  4NJ7 A;  5EDS A;  2KFK A;  2LXA A;  2BYV E;  2V4L A;  3AUL A;  4EEW A;  4W9K A;  2LJ5 A;  1TGZ B;  3PLV A;  4TKN A;  5DPS A;  4BKS A;  4I6P A;  2B3A A;  3PV1 A;  3ZTD A;  5E6P A;  4HCP B;  1TTN A;  1WJ6 A;  5CHV C;  1UBQ A;  2NVU I;  3LJ3 A;  1GUA B;  3PHW B;  4WWN A;  3ML9 A;  5L83 A;  2BPS A;  1E8Z A;  4ANU A;  1A5R A;  1V6E A;  4DHJ B;  3QK0 A;  1WH3 A;  3PRZ A;  4DXA B;  3WA0 A;  3IHP C;  4IC7 B;  2K8C A;  5KHQ A;  2PJH A;  2MP2 A;  3NZS A;  3AI5 A;  2ZZP B;  4ZYN A;  2KLG A;  2M17 A;  4TQ0 A;  4KIK A;  4DDG D;  2KJR A;  4JL9 A;  4BOZ B;  4BBN F;  2HTH A;  2L3Z A;  3PPA A;  2KD0 A;  2KOX A;  1BT0 A;  1WXA A;  1MG8 A;  3PS6 A;  3MJW A;  4JLC A;  4ZRJ A;  3VFK A;  4KSL C;  4LJO B;  3ZLZ A;  4JGH B;  3L13 A;  2DZJ A;  4KV2 A;  4HLE A;  1OEY A;  1YX6 B;  2N4F A;  4GB9 A;  3UIN B;  2CU1 A;  1IYF A;  5AZG A;  5G55 A;  2IYD B;  3ZIM A;  3UGB B;  2BKR B;  2MBO A;  4BKS D;  1C1Y B;  2XK5 A;  4I6N B;  3GZN I;  5AEK B;  4EKU A;  1UGM A;  1OTR B;  1S1Q B;  3TIX A;  1WGG A;  4ANW A;  4W9H A;  1J0G A;  2JY6 A;  3PLU A;  2FCN A;  4NJ6 A;  5TR5 A;  4MEL A;  1ZW7 A;  4B9K A;  4GDL B;  2IO2 B;  3CF6 E;  1F9J A;  3Q3F A;  2LI5 A;  3P2B A;  3H9D A;  4HCN B;  1Q5W B;  3ZNG C;  4G11 A;  2MW5 A;  3VTU A;  2MSE D;  4FHJ A;  1V80 A;  1AAR A;  2M8S A;  2IO1 B;  3ZVV A;  1UH6 A;  3WAL A;  5HKH A;  5LLI A;  1WJU A;  4KSK C;  3ML8 A;  4MSQ B;  1WY8 A;  2BF8 B;  3QA8 A;  2C7H A;  2DHZ A;  3DVG Y;  3WIM A;  3TCA A;  1Q0W B;  2K8B A;  2DZK A;  1NDD A;  4G3X B;  1SGH A;  4EUT A;  5JZE B;  2K6Q A;  2R2Q A;  2KDE B;  4AUQ C;  4KZC A;  4LCD E;  1WFY A;  3M3J A;  1WXV A;  5G2N A;  1WYW B;  4OVV A;  5D2M B;  1OEY J;  2FIF A;  2KWC A;  1HE8 A;  5E6N A;  1Z2M A;  5CTR C;  2L05 A;  5J2R A;  3WAN A;  3PVL A;  1V5O A;  2CR5 A;  2N7E A;  1WR1 A;  2K1F A;  1V9J A;  4GN1 A;  4WQO B;  1P1A A;  2NBW B;  3IG3 A;  2DZM A;  2K8H A;  4KDI C;  3UIP B;  2G4S A;  4LJP B;  2WX0 A;  4LDT D;  3BY4 B;  2D10 A;  4XZ4 A;  2PPH A;  5JHA A;  2KTR B;  4N9F 4;  3ZDT A;  4ZRI A;  5CHF A;  1VD2 A;  1E8X A;  4A3O A;  1XT9 B;  3VH3 B;  2D3G A;  4FJZ A;  2O6V A;  3VVW B;  3QAQ A;  3AU5 A;  4X57 B;  4CHK A;  4K81 A;  1T0Y A;  3QCA A;  2KMC A;  3OJ3 A;  1QZE A;  3L10 B;  3S2A A;  3VUY A;  2JF5 A;  3JSV A;  3H6N A;  4GSW A;  1EUV B;  4IWQ A;  2KFK B;  4MGK E;  4B95 A;  4G0N B;  3H7P B;  1WGY A;  2G4D B;  1WM2 A;  1Y8R C;  4MJS A;  3DBS A;  2O2V A;  4F7Z A;  1J19 A;  4A20 A;  1WGD A;  2FID A;  1SIF A;  4M0W B;  4IM0 A;  3U8Z A;  4EOY A;  4ICU A;  2JRH A;  2MBB B;  2CS4 A;  2L76 A;  3L08 A;  2MBH A;  1FXT B;  2LZ6 A;  3KYC D;  5DPT A;  2MQJ A;  3KH0 A;  2AL3 A;  3QIJ A;  3CST A;  1NBF C;  1LQB A;  4GIV A;  4GU2 A;  2LGY A;  1YD8 U;  2EMT A;  4NNJ B;  1WZ3 A;  2K6D B;  4KVG B;  2FAZ A;  3VTV A;  2M1M A;  1WMH B;  3OJ4 B;  1P98 A;  3B08 A;  1CMX B;  2JZZ A;  3APC A;  2PEA A;  1SE9 A;  4DHJ D;  1EF5 A;  2EMS A;  4IW0 A;  2Z0D B;  3VUX A;  5CX3 A;  4WWP A;  3WAP A;  5BO4 B;  2ZEQ A;  3A1Q A;  3A9K B;  3MTN B;  3QX1 A;  2MRP A;  4FJV B;  2L7R A;  2KO3 A;  3NZU A;  2KAN A;  1KOT A;  1PQS A;  3SU8 X;  3LDZ E;  2DYB A;  3IVF A;  3ZW3 A;  2N9P C;  5J18 A;  4ASW C;  2MBE A;  2W9N A;  4FA6 A;  2BKF A;  2KVR A;  1EF1 A;  4GDL A;  1LXD A;  3A4S C;  3CSF A;  4FAD A;  4FUL A;  3BIN A;  1GC6 A;  4GGQ A;  4JQW C;  2LWP A;  2KNB A;  2JZ3 B;  4FJY A;  4ICV A;  4AJY B;  2IZV B;  4KIK B;  4HPM B;  2AEH A;  4EZK A;  1I35 A; 
#chains in the Genus database with same CATH topology
 1WX9 A;  3OAW A;  2QDF A;  1Q10 A;  1SJE D;  2L0F A;  2KDI A;  1E5W A;  4F8C B;  3AMZ A;  5C2T B;  2KTR A;  2L00 B;  3U2S C;  1E7U A;  4XGA B;  1I4P A;  2JVC A;  2RPQ A;  2L0T A;  4C80 A;  2QC8 A;  3BWU D;  2KZR A;  2KFJ A;  1F1H A;  1JWB D;  1N61 A;  2GBR A;  3QHT A;  3RNF C;  1L7Y A;  3APF A;  1E9M A;  1GPX A;  5D6J B;  1FFU A;  1IUE A;  2WXM A;  1KJT A;  2GBK A;  5FR6 A;  3VXW A;  1FXI A;  1UWX A;  3V60 A;  4WQM A;  1MG4 A;  2BQQ A;  4EFO A;  4PK1 A;  3TSS A;  1WE7 A;  1D3Z A;  4ZRQ A;  1N60 A;  3TMP B;  2KJH B;  3A33 B;  2ZPY A;  1RRB A;  1L4D B;  2HE7 A;  3SEB A;  4IWP A;  2V9H A;  5C23 A;  2KK8 A;  2JWU A;  1QOF A;  1UD7 A;  4K7W A;  3H1U A;  2LHD A;  4PYU A;  2Y3A A;  2LVQ A;  2SAK A;  2X8X X;  2RDB C;  3SDL C;  3IBE A;  1WSP A;  3PT2 B;  1FMA D;  2V1Y A;  1R4N I;  1UF0 A;  3IT6 B;  2WXQ A;  2QMT A;  4C4V B;  2BWE S;  4EZL A;  2ZCB A;  3MHS D;  1L6U A;  3GE8 C;  3RZW C;  1NI2 A;  4GLS C;  2BS2 B;  1YX5 B;  4KDL B;  5D3I B;  1ESF A;  2O6V B;  3PRP B;  4TUU A;  1ROE A;  2CHZ A;  2I1J A;  4ZRP A;  3W1S C;  4MT5 A;  2BYE A;  5G5G A;  2KC2 A;  1T0R C;  4A3P A;  4ZDV A;  2K39 A;  2FCS A;  5E6O A;  2V3P A;  5AZF A;  2ZNV B;  4HDO A;  1SSN A;  1JML A;  4M02 A;  3Q8E A;  1DOI A;  1EWY C;  2G45 B;  4K7S A;  2WXG A;  1L2N A;  3AED B;  4E3C A;  1L5P A;  2BWF A;  4NAW A;  1WX8 A;  2WXJ A;  1E0Z A;  3DWG C;  1ZDV A;  2KAJ A;  4CO7 A;  1D6E C;  3DHG C;  4GMV A;  1UWM A;  3L17 A;  2J53 A;  3X23 A;  4OZB A;  4H2A A;  3QQ8 B;  4W9D A;  4ITK A;  4BBN C;  1SIJ A;  1ZXI A;  2LJI A;  4E71 A;  2L8J A;  3A9J A;  2XK5 B;  1FCL A;  3Q8C A;  4OW0 A;  4FBJ B;  2DYO A;  2IJ0 A;  3RNC C;  1YJI A;  4K1R B;  4Q2J A;  1AYF A;  3FIL B;  2MX2 A;  4GDK B;  4DDI D;  3NOB A;  3GE3 C;  4OVU A;  3TBL D;  3FKY A;  3DBH I;  4W9I A;  3AB5 A;  3OLM D;  3PSE B;  1VJK A;  2LAS A;  1JAL A;  2IDY A;  3I3T B;  4NPN A;  1QOB A;  3VDZ A;  1ENF A;  2VZK D;  4JX1 C;  4MGI E;  4C7Y A;  1RFK A;  2FCQ A;  4RMA A;  3JVZ X;  2Y5P A;  1NVI D;  2FNJ B;  2JSV X;  3BYY B;  2UYZ B;  3VRA B;  4WJN A;  2MLB A;  3BVG A;  1WIA A;  4A8X C;  5GMV A;  1SJH D;  1H8C A;  3P4S B;  4P7I A;  1GB4 A;  3P4R B;  2DX5 B;  3WCQ A;  2WXR A;  1SEB D;  1OQR A;  4IM3 A;  2CKH B;  3RD2 A;  1WGH A;  2J42 A;  3TEX A;  1PDX A;  4DXG A;  1GOZ A;  2KC1 A;  4XWT A;  4IUM B;  2A5U A;  3X0W A;  4KX6 B;  2LRW A;  2RGF A;  2LGD A;  1WGR A;  3AEC B;  2C5L C;  4KZ0 A;  3BZD B;  3TJP A;  3AM9 A;  2GBN A;  2MHJ A;  1TKE A;  1CJE A;  3KYD D;  3KVF B;  2LEK A;  5C1Z A;  1VLB A;  3A4R A;  2IO3 B;  3KUZ A;  4WJO A;  1S3S G;  1XQQ A;  1JQ4 A;  3ZQ4 A;  1WRD B;  2NPT B;  4P1C C;  1TY2 A;  1D4B A;  1E6E B;  2D2Q A;  1EO6 A;  3RT3 B;  2BYV E;  4EEW A;  5IP4 D;  5FR3 A;  2B3A A;  4HCP B;  4M0W A;  1UBQ A;  3ML9 A;  1PGB A;  2BPS A;  1E8Z A;  1UNS A;  1GB1 A;  2PJH A;  4A9A A;  3NZS A;  1FO4 A;  4US8 A;  1XLO A;  4ZYN A;  2KLG A;  5I4D A;  2WDV B;  1JRO A;  4BBN F;  1VDV A;  3PS6 A;  2AQ3 B;  4HLE A;  2DNF A;  4PT5 A;  4GB9 A;  2IPK D;  3DBR B;  5G55 A;  1HA5 A;  4LLG M;  3UGB B;  4I6N B;  5AEK B;  5IO9 A;  1OTR B;  3TIX A;  1WGG A;  4DXF A;  3C19 A;  1LGR A;  1J0G A;  2RDG A;  4LNN A;  4NJ6 A;  5TR5 A;  4REZ A;  3CF6 E;  3P2B A;  1IBX A;  4HCN B;  1T0Q C;  1EU4 A;  2MSE D;  1KRH A;  4YXD B;  1AAR A;  1UH6 A;  2WXP A;  1HTQ A;  2AX5 A;  2DHZ A;  1Q0W B;  1NEK B;  5BMH A;  2BBC A;  4EUT A;  2K6Q A;  2R2Q A;  2KDE B;  2AQ1 B;  3NZ3 A;  1J7B A;  3R2I A;  3M3J A;  1WXV A;  5G2N A;  4OVV A;  1Z2M A;  5CTR C;  2BTE A;  1V5O A;  2CR5 A;  3KWL A;  2G4S A;  1V1P A;  4LDT D;  5EE0 A;  2D10 A;  4XZ4 A;  5JHA A;  2KTR B;  3C8Y A;  4ZRI A;  3VH3 B;  2VH1 A;  2D3G A;  4RGT A;  2O6V A;  3RFZ B;  1TS2 A;  4RH6 A;  5EE3 A;  3AU5 A;  3QCA A;  1VZ7 A;  3VUY A;  3S2A A;  3L10 B;  3RNB C;  4P1B C;  1EUV B;  3I9V 1;  4MGK E;  3H7P B;  2G4D B;  3DBS A;  1J19 A;  2PLP A;  4US9 A;  3N1Z C;  1MHX A;  2JRH A;  2CS4 A;  3KYC D;  1FXT B;  2UU7 A;  1R7S A;  1F2R C;  4IOI E;  4WWM A;  4KVG B;  2FAZ A;  3EUB 2;  4HEA 1;  1K53 A;  2WQY B;  1P98 A;  1CMX B;  4J3O D;  4ZHO A;  4DHJ D;  2EMS A;  5CX3 A;  1JWA D;  5BO4 B;  2KAN A;  2HDE A;  1M4V A;  1PQS A;  5J18 A;  4S17 A;  2W9N A;  1IBX B;  1TT5 B;  4GDL A;  3W9C B;  4FUL A;  4GGQ A;  2KMM A;  3BYT B;  4FJY A;  2L32 A;  3HVD A;  3MJ5 A;  4TSS A;  2WP9 B;  4IC7 B;  2AEH A;  4EZK A;  1I35 A;  3ZO5 B;  1GC7 A;  3VAW A;  1TS4 A;  2KQS A;  3HM6 X;  2K9X A;  3H7P A;  5HHD G;  3ZJT A;  4RF0 A;  4OVZ A;  1E8Y A;  1V5T A;  2PKO A;  4XC2 A;  3DBH B;  3UF8 A;  2QHO A;  3AEG B;  3HVZ A;  3DCG A;  2KX0 A;  2WWZ A;  2RD0 A;  3RUI B;  3ZTC A;  2N9L A;  1Q1O A;  3L54 A;  3TL5 A;  2ZCC A;  2W55 A;  3T9L A;  4O1N A;  2ONQ A;  3QC8 B;  3Q3N C;  1JWS D;  1L4Z B;  3NS1 A;  5IN7 A;  2DZI A;  5JHB A;  3QJZ A;  2IBI B;  2LVO A;  4II3 B;  2MWS B;  2WHI A;  2IGG A;  1YN3 A;  2BGF A;  1IPG A;  2JX5 A;  3AEF B;  1E7V A;  1CK1 A;  2HJ8 A;  3DBL I;  3H7S A;  3ZJV A;  1R4M B;  2AYO B;  2GOW A;  2UWQ A;  3H8H A;  4YL8 A;  3RMK C;  4UDU C;  4YTP B;  3LYY A;  1J8C A;  3ZNH B;  3HIZ A;  2D3B A;  3ZNZ B;  4KKJ A;  1E8W A;  2NBU A;  3APD A;  2MP2 B;  2PW9 A;  1WYG A;  1FPY A;  2QEJ C;  3SFD B;  1TZ1 A;  4HPL B;  4C56 C;  4HDQ A;  1ZKH A;  2MEK A;  3SD5 A;  1TBE A;  4WIP A;  3GOE A;  2K22 A;  4LTU A;  1I7H A;  4HPP A;  3NJT A;  5IKC M;  2DEN B;  3SHQ A;  3UQB A;  3ECI A;  4W9L A;  1QKZ A;  2DAF A;  2YEP B;  1FEH A;  1UZX B;  3L0W B;  4ZHP A;  4NQK E;  3KW5 B;  2WX1 A;  4RGM A;  3AE9 B;  1YQ4 B;  1QT9 A;  3QAR A;  2CHW A;  1OGW A;  4XDD A;  4F1S A;  4RF1 A;  4P16 A;  4M00 A;  2LGI A;  1ZUD 2;  2BB6 A;  4GDK A;  4R3D A;  5D7G A;  3CWI A;  3WAO A;  4W9F A;  2CHX A;  3K9P B;  4XE0 A;  1V86 A;  2IGD A;  4W9E A;  1VRA B;  2C7N B;  2OED A;  4DBG A;  5DPR A;  4WJP A;  2OOB B;  1FD6 A;  4C00 A;  1I4G A;  2RDH A;  2I2Y A;  4WH4 A;  2MCN B;  1KH0 A;  1NI3 A;  1ISN A;  2KDB A;  4KKI A;  2D5G A;  2KQ7 A;  3Q69 A;  2ZVO A;  5JH5 C;  3MP9 A;  1OQY A;  1I42 A;  3PZ7 A;  4BOS C;  2KWV B;  2JU6 X;  4PS7 A;  4TV3 A;  1MFW A;  1IGD A;  2J0J A;  3RNE C;  4RGO S;  3VH4 B;  3DOW A;  1N5X A;  1T3Q A;  4HRO A;  3Q6B A;  3HRD D;  2LVP A;  4XDC A;  2JPH A;  3DVN V;  4A55 A;  4JWU C;  3MFG A;  4A6Q A;  1E90 A;  1XO3 A;  4TMA B;  3B0A A;  2OHF A;  3E9S A;  3Q3J A;  4GOC A;  4WWO A;  1B9R A;  4OZA A;  2IND C;  2O6V D;  1FNU A;  5LXI B;  3A9K A;  2WXI A;  4C4V A;  4FN2 A;  1C79 A;  4AOF A;  1TJE A;  2NCN A;  1YJ1 A;  5J17 A;  3DVN U;  2ACZ B;  3V6C B;  3N32 A;  1BUI C;  2IGH A;  4XYC A;  3VTW A;  2YLM A;  2YVC A;  2ZNV C;  3ZDM C;  1KTK A;  1I4H A;  5TSS A;  3DPD A;  4MH0 E;  1P0R A;  1DOY A;  1LFD A;  3FAH A;  3W1S A;  4W9C A;  3DDC B;  2O2V B;  1GJZ A;  4NJ7 A;  2LXA A;  1E7P B;  3AUL A;  3MC9 A;  3BII D;  2LJ5 A;  3I63 C;  4I6P A;  3PV1 A;  1ZPS A;  1TTN A;  2J4X A;  5CHV C;  3LJ3 A;  3PHW B;  4IKG A;  5L83 A;  1CQV A;  5BYQ A;  3V3X A;  4DHJ B;  3P4Q B;  3T3N A;  3PRZ A;  3IHP C;  2ZZP B;  2KT7 A;  2M17 A;  2R61 A;  4DDG D;  2LUM A;  2ON8 A;  2LGS A;  4ZRJ A;  4KSL C;  3ZLZ A;  1XF5 L;  4JGH B;  2D3C A;  1OEY A;  1NYR A;  3Q3M C;  1HZ6 A;  2OJW A;  2IYD B;  3ZIM A;  2GI9 A;  2MBO A;  2KDM A;  2FBW B;  1UGM A;  1V97 A;  4CQN A;  2JY6 A;  1DGJ A;  3AE2 B;  3W5V B;  1F9J A;  2BW2 A;  3ZNG C;  3VTU A;  2MW5 A;  1V80 A;  2IO1 B;  3ZVV A;  3N1X C;  5LLI A;  2QJL A;  4MSQ B;  3AE5 B;  4HRS A;  2BF8 B;  2PVO D;  2C7H A;  3WIM A;  2EKI A;  2DZK A;  1JCK B;  4G3X B;  1SGH A;  5JZE B;  4ARI A;  4WUR A;  1WFY A;  3EA6 A;  3ETR A;  5J2R A;  2V3N A;  2N7E A;  3IG3 A;  2DZM A;  1QOG A;  3RNG C;  1ZOY B;  2KWD A;  1C78 A;  3U7Z A;  1AN8 A;  5HFY A;  1SE3 A;  2BS3 B;  1VD2 A;  2JXT A;  4A3O A;  3GB1 A;  4X57 B;  3NVZ A;  3EGR A;  3OJ3 A;  2JF5 A;  3JSV A;  4GSW A;  2KFK B;  3W2D A;  2O2V A;  4F7Z A;  2PTL A;  4A20 A;  2FID A;  1SIF A;  3ZXV A;  1VZ6 A;  4IM0 A;  2MJ3 A;  2MBH A;  2LZ6 A;  3NVW A;  5DPT A;  3KH0 A;  3CST A;  4GIV A;  1LQB A;  4ZOH C;  3LXF A;  4NNJ B;  1F77 A;  3AEE B;  2WU2 B;  1J7C A;  3VTV A;  4KGR A;  3OJ4 B;  2Z0D B;  1OFF A;  3A9K B;  3MC8 A;  2Q5W D;  2RPV A;  4FJV B;  2L7R A;  2KO3 A;  3NZU A;  3ZXR A;  1XLQ A;  1HEZ E;  3IVF A;  3OWE B;  4ASW C;  2BYT A;  2MBE A;  1WRI A;  2BKF A;  2KVR A;  1LXD A;  3ABV B;  2JZP A;  4AJY B;  2IZV B;  4KIK B;  1ET6 A;  4HJK A;  3TEY A;  4RM8 A;  1TKG A;  2QIL A;  3CMM B;  3NHE B;  2N1W A;  4BFR A;  1WX7 A;  3DQV A;  2Z0E B;  1RWS A;  1KLV A;  3FC4 A;  3IAM 1;  4HVB A;  2HJ1 A;  3JYU A;  3AEA B;  5EE9 A;  1TIF A;  2RSU A;  1VCB A;  4MSM B;  3MHZ A;  2N9K A;  2KMA A;  3PRE A;  4LNO A;  4EZJ A;  3VR9 B;  1JWM D;  1TYG B;  3AN1 A;  3PGE A;  2MJD A;  1JRU A;  2GBJ A;  1KFY B;  2L1A A;  5H92 C;  1YN4 A;  3W5U B;  2C7M B;  5L95 C;  3DWM A;  3EHV A;  4NJC A;  3B1L X;  3VR8 B;  2W3S A;  1TS3 A;  1JRP A;  2AWT A;  2I1K A;  3B2G A;  3KUC B;  2JT4 B;  1FNW A;  3N30 A;  1C9F A;  1LM8 B;  4YSX B;  4LK0 M;  2N7D A;  3L4P A;  2CU3 A;  2M4N A;  3R66 C;  1V81 A;  2W82 A;  2WLB A;  2CJN A;  4BAX A;  2Y5B B;  2NMQ A;  3U30 A;  3U4E G;  1WXM A;  1A70 A;  1T6B X;  1RFA A;  4MH8 A;  4MDK E;  1G6J A;  3V6E B;  1WR6 E;  1P7E A;  1H4R A;  1PYW D;  2JXX A;  2KXJ A;  3N20 C;  4YSY B;  5DPW A;  1V2Y A;  2KX3 A;  2ZPN A;  2KAC A;  4JIO U;  2JWZ A;  4W9G A;  1FRD A;  2AL6 A;  3Q8B A;  2KVZ A;  1QIL A;  5GXG B;  5BMI A;  2WXO A;  2REX A;  2N9X A;  2KHW B;  2ZW1 A;  1V49 A;  3ZRC A;  3RN9 C;  1ACC A;  2B76 B;  4B0M A;  1XD3 B;  5C3J B;  4LNI A;  4RM9 A;  3TEW A;  1WJ4 A;  5BYS A;  1I4X A;  1XLP A;  2NBV B;  1P3Q U;  2DYM A;  1C4P A;  2LXC A;  4MAC A;  3QWZ B;  1I4R A;  1RLF A;  1M94 A;  1ZE3 D;  2MBQ A;  1YOV B;  3PTF C;  2QCZ A;  2MJE A;  4MEM A;  2XNA C;  5IAA C;  4PS3 A;  1TKY A;  4MM3 B;  3ZRF A;  1V8C A;  1WE6 A;  2EKE C;  5DCN A;  3EFU A;  3KUD B;  5AZH A;  4XWW A;  3W1Y A;  1N62 A;  2NS5 A;  3JW0 X;  1SE2 A;  1J7A A;  2RR9 A;  2FCM A;  2C9W B;  3IT4 B;  1ZP0 B;  2K0P A;  2KJ6 A;  3WAM A;  3K9O B;  4USA A;  4IM2 A;  3ZNI D;  1FFV A;  1K51 A;  4RNA A;  3I57 A;  4DHZ E;  1WM3 A;  3HM3 A;  2R2O A;  1YN5 A;  4FLH A;  3DBL B;  2KWU B;  1R4M I;  2KN5 A;  4LNK A;  3SFE B;  3JSV B;  2NPT A;  5LNK 1;  3ZKJ C;  1TY0 A;  3NS8 A;  3EEC A;  2GMI C;  2PMV A;  1HXY D;  1KLG D;  3HK0 A;  2XEW A;  3PO0 A;  2K3U A;  4MGY E;  2BB5 A;  4AJW A;  3SR6 A;  1STE A;  4IWO A;  3VRB B;  2WU5 B;  4MM3 A;  3RUL A;  4YT0 B;  4ZYS A;  2IO0 B;  3HHM A;  1RAX A;  3PZD A;  4CYE A;  1UGJ A;  3A1Q B;  4BKT A;  3L16 A;  2NTS A;  2FUG 1;  3EC8 A;  2W3R A;  1UEL A;  2KYW A;  1WMH A;  5FKA C;  4I6L B;  4DWF A;  4URK A;  3OG5 A;  1MHH E;  3DHI C;  3NUH B;  2PVG C;  4EE2 A;  4FHK A;  2G9H D;  3N1Y C;  5IA7 A;  1XLN A;  1PFD A;  3AE1 B;  4E74 A;  2WDR B;  4ARC A;  2INN E;  3N9Y C;  2KQ4 X;  3NRZ A;  4L23 A;  1EWC A;  4W9K A;  2BVC A;  5AUK A;  2AQ2 B;  1TGZ B;  3PLV A;  4OZC A;  5DPS A;  1NYQ A;  1WJ6 A;  4WWN A;  1IGC A;  1V6E A;  4OHJ A;  4DXA B;  2K8C A;  5HG2 A;  3AI5 A;  4TQ0 A;  1EM7 A;  4JL9 A;  4BOZ B;  2L3Z A;  3BVZ A;  3DHH C;  3FIL A;  2KD0 A;  4FXC A;  1BT0 A;  3VFK A;  4LJO B;  2WXN A;  3L13 A;  2N4F A;  1IYF A;  3UIN B;  2DLB A;  2BS4 B;  2BT6 A;  5AZG A;  4BKS D;  2BKR B;  2XK5 A;  3P1M A;  3P42 A;  4ANW A;  3B9J A;  3PLU A;  3AV8 A;  3NVV A;  2WXF A;  1ZW7 A;  4B9K A;  4GDL B;  2IO2 B;  3Q3F A;  3H9D A;  1UUP A;  1C76 A;  3GZN B;  3RI7 C;  3URY A;  3GP7 A;  3WAL A;  1WJU A;  3R2T A;  1TS5 A;  3ML8 A;  5H8Y E;  3TCA A;  2JYT A;  4LCD E;  5HI1 A;  1WYW B;  4HJG E;  1OEY J;  1VR9 A;  2FIF A;  2L05 A;  3WAN A;  1WR1 A;  4GN1 A;  4KDI C;  3AE4 B;  4LJP B;  2WX0 A;  1FXA A;  3U52 E;  1R4N B;  2PPH A;  3ZDT A;  1E8X A;  2WXL A;  1XT9 B;  1QF6 A;  3VVW B;  4YWG G;  2WXK A;  4K81 A;  1YNT E;  2KMC A;  1QZE A;  4BZA A;  1F0Z A;  1L0X B;  4IWQ A;  1ZDX A;  4B95 A;  4G0N B;  1WGY A;  4HKZ E;  1WM2 A;  1Y8R C;  5D3D A;  2HTM E;  1V1P B;  4N58 A;  3U8Z A;  2MBB B;  2L76 A;  2MQJ A;  2AL3 A;  1I4Q A;  2TSS A;  2M0A A;  5T8I A;  1L0V B;  4GU2 A;  2DWQ A;  3HUI A;  4LNF A;  3EFC A;  1YMH E;  3AE7 B;  1VZ8 A;  4WAF A;  3CIR B;  2M1M A;  1WMH B;  4NZL B;  3B08 A;  1WWT A;  2JZZ A;  3APC A;  3J9C A;  2G1E A;  2LMC A;  3VUX A;  3WAP A;  3A1Q A;  3QX1 A;  3MTN B;  1L0Y B;  1YJJ A;  2H88 B;  1D5X C;  4L1B A;  1KOT A;  1E10 A;  2N9P C;  2WGS A;  3CSF A;  4FAD A;  1GC6 A;  3AE6 B;  1F52 A;  4JQW C;  2LWP A;  4TQ1 A;  1PGX A;  5LXH A;  1U4A A;  4M8N A;  3V61 A;  4NAM A;  3RZF A;  4K3B A;  1SXT A;  1X1M A;  3GS2 A;  3PZ8 A;  1P9D U;  4IG7 B;  2YEP F;  2LUE A;  3AE3 B;  4ANV A;  4HWI B;  2WS3 B;  4MGZ E;  3IFW B;  2LHE A;  5KHO A;  1GNU A;  4ZRK A;  2M0X A;  4B0E A;  2LD9 A;  3UQA A;  2CJO A;  4J6I A;  2IY0 B;  1ZGU B;  4K3C A;  4QAY A;  1MI0 A;  2XBB C;  4HXD A;  3C0R B;  4D2K A;  1N6Z A;  2N7J A;  4M01 A;  4AP4 C;  1T0S C;  2KN4 A;  4PS8 A;  4NQL B;  3Q8A A;  2A4Z A;  2RMM A;  4GXB A;  5D94 A;  2XN9 C;  4AWJ A;  1D5Z C;  4XX5 A;  3BK1 A;  1WJN A;  3D32 A;  3Q3O C;  5FK9 C;  3UI3 A;  1SB3 C;  2N0S B;  2VH2 A;  3NY5 A;  2D07 B;  2ZJD A;  3AE8 B;  4JE3 B;  2H89 B;  2KTF A;  4ACF A;  2KLC A;  3VHT C;  4BVU C;  4BKG A;  3AH7 A;  2LRU A;  3P63 A;  4MJS B;  4NY0 A;  4ANX A;  1KLU D;  2I38 A;  3ALB A;  3R3M A;  4NAW B;  3DBR I;  3V05 A;  4PYZ A;  1C4A A;  2W54 A;  2PE9 A;  1KF6 B;  1MPE A;  3ONS A;  1XCT L;  3I5J C;  2LFI A;  1DOX A;  3ZJU A;  1HZ5 A;  1Y56 A;  2LGX A;  3ENE A;  1WXS A;  3R7R A;  2FE8 A;  2GB1 A;  4RFB A;  4K7U A;  2X38 A;  2M56 B;  4WJQ A;  2JQR B;  4YTN B;  3M63 B;  4N59 A;  1AWD A;  3AEB B;  4WAA A;  1FNV A;  3ZYY X;  5MPO A;  4A90 A;  2WYQ A;  1WGK A;  2ZW0 A;  1PGA A;  2SEB D;  2E6X A;  2QSD A;  2NTT A;  2DAJ A;  2N1V A;  3E56 A;  2MH7 A;  3PRM B;  3T8M A;  2KDF B;  1GG3 A;  1L6V A;  4DHZ B;  4RGN A;  1UBI A;  3A9J B;  3DVG X;  1BXT A;  4KGT A;  4HKQ A;  1CZP A;  1ZXH A;  2HD5 B;  4KGS A;  3VUW A;  4YSZ B;  2Y5C A;  1HTO A;  1Z5S B;  2J7Q B;  3RCZ A;  1KM7 A;  1JWU D;  3ZUN A;  4DQO C;  1XEE A;  2J0K A;  2GBM A;  2J0M A;  3M62 B;  4IDI A;  3T3O A;  1YIW A;  2G3Q B;  5E6J A;  1WF9 A;  1FIQ A;  3AU4 A;  3M95 A;  3V62 A;  3KLS X;  2IY1 B;  2WDT B;  4N6E B;  3UIO B;  3AXC A;  2FUH B;  3VQI A;  2BYF A;  1AW7 A;  3TEZ A;  2DBY A;  1N5W A;  4JPS A;  4JWS C;  1IP9 A;  4G50 A;  1WI0 A;  4II2 B;  3R8B A;  2KKC A;  2QIE B;  1N63 A;  5G5H A;  2OJR A;  2ZVN A;  2PE6 B;  4B6W A;  1YQB A;  1RM6 C;  2NR2 A;  4W9J A;  2ASQ A;  2M19 A;  5IOI A;  2MA9 B;  4L2Y A;  4S0R A;  2VRR B;  1WZ0 A;  4M8M A;  1C3T A;  2V3S A;  1K8R B;  2D11 A;  1F2R I;  2N9E B;  2JRI B;  3O65 B;  3P4P B;  1T5X D;  3O13 A;  3N3K B;  2JUO A;  2Z59 B;  4LDT B;  2C60 A;  3U7D A;  4DK5 A;  1PUT A;  3KQ4 A;  2INP E;  4RCO A;  5CHW A;  3R7Q A;  4HK2 A;  2VZK B;  2K25 A;  3PHX B;  3B2F A;  3RYT A;  4AQ7 A;  5EDS A;  2KFK A;  1ET9 A;  1QOA A;  2V4L A;  4TKN A;  4BKS A;  3RPF C;  3ZTD A;  5E6P A;  2NVU I;  1TZO A;  1GUA B;  4ANU A;  1A5R A;  2J52 A;  3QK0 A;  1WH3 A;  3WA0 A;  5KHQ A;  2MP2 A;  2WXH A;  4KIK A;  1FM0 D;  2KJR A;  5BYR A;  3IAS 1;  2HTH A;  1WXQ A;  1D5M C;  3PPA A;  1V1O A;  2KOX A;  1WXA A;  1MG8 A;  1MVK A;  3MJW A;  4JLC A;  4KV2 A;  2DZJ A;  1C77 A;  1YX6 B;  2GRI A;  2CU1 A;  1XCQ L;  1C1Y B;  3GZN I;  2Z8L A;  4EKU A;  4C7Z A;  1LO5 D;  1S1Q B;  4W9H A;  1P7F A;  1C4C A;  2FCN A;  4MEL A;  2LI5 A;  1Q5W B;  1SBB B;  4G11 A;  1QQR A;  4FHJ A;  2M8S A;  5HKH A;  1B1Z A;  4KSK C;  1WY8 A;  3QA8 A;  3DVG Y;  2L83 A;  1HQR D;  2K8B A;  1NDD A;  4AUQ C;  4KZC A;  2V4I B;  5EE1 A;  2JYE A;  3NVY A;  1DYQ A;  5D2M B;  2KWC A;  1HE8 A;  5E6N A;  1K50 A;  1GAQ B;  2WDQ B;  3PVL A;  3Q8F A;  3NG0 A;  3MC0 B;  1EU3 A;  2K1F A;  1V9J A;  2PIA A;  4WQO B;  1P1A A;  2NBW B;  2K8H A;  3UIP B;  1JW9 D;  3BY4 B;  1OQQ A;  1NEN B;  3Q14 C;  4N9F 4;  2INC C;  5CHF A;  3TUO A;  3ZGZ A;  4FJZ A;  5AUI A;  3QAQ A;  1RYJ A;  2EEL A;  2GLS A;  4CHK A;  1T0Y A;  1YQ3 B;  3RNA C;  3H6N A;  1XXG A;  4MJS A;  3BK2 A;  1K52 A;  1QLB B;  1WGD A;  4M0W B;  4EOY A;  4ICU A;  3L08 A;  4YTM B;  3Q2A C;  3QIJ A;  1NBF C;  2LGY A;  1YD8 U;  2EMT A;  1WZ3 A;  2K6D B;  1MJD A;  1SF0 A;  1BML C;  1FRR A;  2PEA A;  1SE9 A;  2ICI A;  1EF5 A;  4IW0 A;  4WWP A;  2ZEQ A;  2MRP A;  5JXV A;  1SE4 A;  3IXS A;  5BMG A;  2D3A A;  3SU8 X;  3LDZ E;  2DYB A;  3ZW3 A;  4AS1 A;  2WNM A;  2L52 A;  4P6V F;  4FA6 A;  2V0G A;  1EF1 A;  3A4S C;  1FCC C;  3BIN A;  3LB8 C;  2K5P A;  3BVM A;  2KNB A;  2JZ3 B;  2E3T A;  4ICV A;  4HPM B;  3KWV A; 
#chains in the Genus database with same CATH homology
 4HJK A;  1WX9 A;  3OAW A;  4RM8 A;  4TQ1 A;  1U4A A;  4M8N A;  3ZO5 B;  5LXH A;  3V61 A;  1GC7 A;  3CMM B;  2L0F A;  3NHE B;  3VAW A;  2KDI A;  1E5W A;  2N1W A;  3RZF A;  4F8C B;  2KQS A;  3HM6 X;  4BFR A;  3H7P A;  1X1M A;  1WX7 A;  4IG7 B;  1P9D U;  3DQV A;  2KTR A;  2L00 B;  2Z0E B;  1KLV A;  1E8Y A;  2LUE A;  1E7U A;  4ANV A;  4HWI B;  1V5T A;  4MGZ E;  4XC2 A;  4HVB A;  3UF8 A;  2JVC A;  2QHO A;  2L0T A;  2RPQ A;  3IFW B;  3JYU A;  2KZR A;  2RSU A;  2KFJ A;  1VCB A;  2GBR A;  3DCG A;  4MSM B;  3QHT A;  2KX0 A;  2WWZ A;  2KMA A;  1L7Y A;  3PRE A;  1GNU A;  4ZRK A;  2M0X A;  3APF A;  5KHO A;  2LD9 A;  4EZJ A;  3UQA A;  2RD0 A;  5D6J B;  3PGE A;  5FR6 A;  1KJT A;  2GBK A;  4J6I A;  3RUI B;  3VXW A;  1JRU A;  2GBJ A;  1ZGU B;  2IY0 B;  3V60 A;  2XBB C;  3ZTC A;  4EFO A;  1Q1O A;  4HXD A;  3L54 A;  3C0R B;  2C7M B;  5L95 C;  3EHV A;  1WE7 A;  3B1L X;  3TL5 A;  1D3Z A;  2ZCC A;  3T9L A;  4AP4 C;  3QC8 B;  4PS8 A;  4NQL B;  3TMP B;  2A4Z A;  2KJH B;  3A33 B;  2AWT A;  2I1K A;  2ZPY A;  3KUC B;  2DZI A;  5JHB A;  3QJZ A;  2IBI B;  4GXB A;  5D94 A;  2JT4 B;  2LVO A;  1RRB A;  3N30 A;  4II3 B;  4AWJ A;  2MWS B;  4XX5 A;  1LM8 B;  2HE7 A;  1WJN A;  4IWP A;  3D32 A;  5C23 A;  2KK8 A;  1UD7 A;  4K7W A;  2N7D A;  3H1U A;  3NY5 A;  2D07 B;  2M4N A;  2ZJD A;  4PYU A;  2LVQ A;  2BGF A;  1V81 A;  3R66 C;  3SDL C;  3IBE A;  2KTF A;  3PT2 B;  1IPG A;  2KLC A;  2Y5B B;  3VHT C;  4BVU C;  3U30 A;  2V1Y A;  1R4N I;  4BKG A;  1E7V A;  2HJ8 A;  1WXM A;  2LRU A;  3DBL I;  3H7S A;  4MJS B;  1RFA A;  2BWE S;  4EZL A;  2ZCB A;  4NY0 A;  4ANX A;  2AYO B;  3ALB A;  3MHS D;  2GOW A;  2UWQ A;  3R3M A;  4NAW B;  4YL8 A;  3DBR I;  4MDK E;  1G6J A;  3V6E B;  1WR6 E;  3RZW C;  1NI2 A;  1J8C A;  4PYZ A;  3ZNH B;  1H4R A;  3HIZ A;  1YX5 B;  4KDL B;  3ZNZ B;  2PE9 A;  1E8W A;  2NBU A;  3APD A;  2O6V B;  2JXX A;  2MP2 B;  2KXJ A;  3ONS A;  3PRP B;  4TUU A;  2CHZ A;  2I1J A;  3W1S C;  5DPW A;  1V2Y A;  2KX3 A;  2ZPN A;  2LGX A;  3ENE A;  1WXS A;  1TZ1 A;  3R7R A;  2BYE A;  4JIO U;  4HPL B;  2KC2 A;  2JWZ A;  4HDQ A;  4A3P A;  1ZKH A;  4W9G A;  2K39 A;  3SD5 A;  4ZDV A;  1TBE A;  2FCS A;  3GOE A;  5E6O A;  4K7U A;  2AL6 A;  5AZF A;  2ZNV B;  4HDO A;  4WJQ A;  2DEN B;  3M63 B;  3SHQ A;  2REX A;  2G45 B;  3UQB A;  2N9X A;  2KHW B;  4K7S A;  4WAA A;  3ECI A;  4W9L A;  1V49 A;  3ZRC A;  2DAF A;  1L2N A;  1UZX B;  2WYQ A;  3L0W B;  4NQK E;  3KW5 B;  2WX1 A;  4E3C A;  2DAJ A;  2N1V A;  2BWF A;  3PRM B;  1XD3 B;  4NAW A;  1WX8 A;  3T8M A;  4RM9 A;  1WJ4 A;  3QAR A;  2CHW A;  2KDF B;  1OGW A;  4F1S A;  1GG3 A;  4CO7 A;  4DHZ B;  1UBI A;  2NBV B;  3A9J B;  3DVG X;  4GMV A;  1P3Q U;  2DYM A;  3L17 A;  2LXC A;  3X23 A;  3QWZ B;  1RLF A;  4GDK A;  1M94 A;  3QQ8 B;  2MBQ A;  4W9D A;  3PTF C;  2HD5 B;  4BBN C;  5D7G A;  3WAO A;  2L8J A;  4MEM A;  4W9F A;  3VUW A;  2CHX A;  4E71 A;  3A9J A;  2XK5 B;  3K9P B;  4FBJ B;  5IAA C;  4PS3 A;  2DYO A;  1V86 A;  3ZRF A;  4W9E A;  1WE6 A;  2EKE C;  5DCN A;  3EFU A;  1Z5S B;  2J7Q B;  3RCZ A;  2C7N B;  1KM7 A;  3KUD B;  5AZH A;  3ZUN A;  4DBG A;  4K1R B;  5DPR A;  3W1Y A;  2J0K A;  2MX2 A;  2GBM A;  4WJP A;  4GDK B;  2NS5 A;  2OOB B;  3JW0 X;  3NOB A;  4DDI D;  2J0M A;  3M62 B;  4OVU A;  3TBL D;  4W9I A;  3DBH I;  2RR9 A;  1YIW A;  2G3Q B;  3OLM D;  3PSE B;  1WF9 A;  3AU4 A;  2MCN B;  3M95 A;  3V62 A;  2FCM A;  2LAS A;  2C9W B;  2IY1 B;  1ISN A;  2WDT B;  2KDB A;  3I3T B;  3UIO B;  3AXC A;  2KJ6 A;  2FUH B;  3VQI A;  4NPN A;  2KQ7 A;  3K9O B;  3WAM A;  2BYF A;  2ZVO A;  4IM2 A;  5JH5 C;  3VDZ A;  3ZNI D;  4MGI E;  2FCQ A;  1IP9 A;  1OQY A;  1I42 A;  4RMA A;  3JVZ X;  4BOS C;  4G50 A;  4DHZ E;  1WM3 A;  2KWV B;  1WI0 A;  3HM3 A;  4II2 B;  2R2O A;  2KKC A;  2FNJ B;  4FLH A;  2UYZ B;  4PS7 A;  4WJN A;  2MLB A;  2KWU B;  1R4M I;  2KN5 A;  4TV3 A;  1WIA A;  5GMV A;  2J0J A;  3JSV B;  2NPT A;  1H8C A;  3ZKJ C;  4P7I A;  2OJR A;  2ZVN A;  3VH4 B;  2PE6 B;  3DOW A;  4B6W A;  2DX5 B;  3NS8 A;  3EEC A;  1YQB A;  2NR2 A;  4W9J A;  2LVP A;  2GMI C;  4IM3 A;  2JPH A;  3DVN V;  3HK0 A;  2ASQ A;  2XEW A;  2CKH B;  3RD2 A;  1WGH A;  1E90 A;  2MA9 B;  4MGY E;  4AJW A;  3B0A A;  4GOC A;  3Q3J A;  2VRR B;  1WZ0 A;  4WWO A;  4IWO A;  4M8M A;  1C3T A;  2V3S A;  4MM3 A;  2KC1 A;  1K8R B;  3RUL A;  4IUM B;  2A5U A;  3X0W A;  2D11 A;  2O6V D;  2IO0 B;  3HHM A;  1RAX A;  2JRI B;  2N9E B;  3O65 B;  3PZD A;  4CYE A;  5LXI B;  3A1Q B;  3A9K A;  4BKT A;  2LRW A;  3L16 A;  3EC8 A;  4FN2 A;  2RGF A;  2LGD A;  1WGR A;  2C5L C;  4AOF A;  4KZ0 A;  3TJP A;  1UEL A;  1WMH A;  2GBN A;  2NCN A;  1YJ1 A;  5J17 A;  3DVN U;  3N3K B;  4I6L B;  4DWF A;  4URK A;  3KYD D;  3V6C B;  3KVF B;  2JUO A;  5C1Z A;  3N32 A;  2Z59 B;  3VTW A;  2YLM A;  2YVC A;  3A4R A;  2IO3 B;  3KUZ A;  4LDT B;  4FHK A;  4WJO A;  2C60 A;  3U7D A;  1S3S G;  2ZNV C;  1XQQ A;  3ZDM C;  1WRD B;  5IA7 A;  3DPD A;  4DK5 A;  2NPT B;  4MH0 E;  1P0R A;  1LFD A;  3W1S A;  4W9C A;  5CHW A;  2D2Q A;  1EO6 A;  3DDC B;  2O2V B;  4HK2 A;  3R7Q A;  2K25 A;  4E74 A;  1GJZ A;  3PHX B;  3RT3 B;  3RYT A;  4NJ7 A;  5EDS A;  2KFK A;  2LXA A;  2BYV E;  2V4L A;  3AUL A;  4EEW A;  4W9K A;  2LJ5 A;  1TGZ B;  3PLV A;  4TKN A;  5DPS A;  4BKS A;  4I6P A;  2B3A A;  3PV1 A;  3ZTD A;  5E6P A;  4HCP B;  1TTN A;  1WJ6 A;  5CHV C;  1UBQ A;  2NVU I;  3LJ3 A;  1GUA B;  3PHW B;  4WWN A;  3ML9 A;  5L83 A;  2BPS A;  1E8Z A;  4ANU A;  1A5R A;  1V6E A;  4DHJ B;  3QK0 A;  1WH3 A;  3PRZ A;  4DXA B;  3WA0 A;  3IHP C;  4IC7 B;  2K8C A;  5KHQ A;  2PJH A;  2MP2 A;  3NZS A;  3AI5 A;  2ZZP B;  4ZYN A;  2KLG A;  2M17 A;  4TQ0 A;  4KIK A;  4DDG D;  2KJR A;  4JL9 A;  4BOZ B;  4BBN F;  2HTH A;  2L3Z A;  3PPA A;  2KD0 A;  2KOX A;  1BT0 A;  1WXA A;  1MG8 A;  3PS6 A;  3MJW A;  4JLC A;  4ZRJ A;  3VFK A;  4KSL C;  4LJO B;  3ZLZ A;  4JGH B;  3L13 A;  2DZJ A;  4KV2 A;  4HLE A;  1OEY A;  1YX6 B;  2N4F A;  4GB9 A;  3UIN B;  2CU1 A;  1IYF A;  5AZG A;  5G55 A;  2IYD B;  3ZIM A;  3UGB B;  2BKR B;  2MBO A;  4BKS D;  1C1Y B;  2XK5 A;  4I6N B;  3GZN I;  5AEK B;  4EKU A;  1UGM A;  1OTR B;  1S1Q B;  3TIX A;  1WGG A;  4ANW A;  4W9H A;  1J0G A;  2JY6 A;  3PLU A;  2FCN A;  4NJ6 A;  5TR5 A;  4MEL A;  1ZW7 A;  4B9K A;  4GDL B;  2IO2 B;  3CF6 E;  1F9J A;  3Q3F A;  2LI5 A;  3P2B A;  3H9D A;  4HCN B;  1Q5W B;  3ZNG C;  4G11 A;  2MW5 A;  3VTU A;  2MSE D;  4FHJ A;  1V80 A;  1AAR A;  2M8S A;  2IO1 B;  3ZVV A;  1UH6 A;  3WAL A;  5HKH A;  5LLI A;  1WJU A;  4KSK C;  3ML8 A;  4MSQ B;  1WY8 A;  2BF8 B;  3QA8 A;  2C7H A;  2DHZ A;  3DVG Y;  3WIM A;  3TCA A;  1Q0W B;  2K8B A;  2DZK A;  1NDD A;  4G3X B;  1SGH A;  4EUT A;  5JZE B;  2K6Q A;  2R2Q A;  2KDE B;  4AUQ C;  4KZC A;  4LCD E;  1WFY A;  3M3J A;  1WXV A;  5G2N A;  1WYW B;  4OVV A;  5D2M B;  1OEY J;  2FIF A;  2KWC A;  1HE8 A;  5E6N A;  1Z2M A;  5CTR C;  2L05 A;  5J2R A;  3WAN A;  3PVL A;  1V5O A;  2CR5 A;  2N7E A;  1WR1 A;  2K1F A;  1V9J A;  4GN1 A;  4WQO B;  1P1A A;  2NBW B;  3IG3 A;  2DZM A;  2K8H A;  4KDI C;  3UIP B;  2G4S A;  4LJP B;  2WX0 A;  4LDT D;  3BY4 B;  2D10 A;  4XZ4 A;  2PPH A;  5JHA A;  2KTR B;  4N9F 4;  3ZDT A;  4ZRI A;  5CHF A;  1VD2 A;  1E8X A;  4A3O A;  1XT9 B;  3VH3 B;  2D3G A;  4FJZ A;  2O6V A;  3VVW B;  3QAQ A;  3AU5 A;  4X57 B;  4CHK A;  4K81 A;  1T0Y A;  3QCA A;  2KMC A;  3OJ3 A;  1QZE A;  3L10 B;  3S2A A;  3VUY A;  2JF5 A;  3JSV A;  3H6N A;  4GSW A;  1EUV B;  4IWQ A;  2KFK B;  4MGK E;  4B95 A;  4G0N B;  3H7P B;  1WGY A;  2G4D B;  1WM2 A;  1Y8R C;  4MJS A;  3DBS A;  2O2V A;  4F7Z A;  1J19 A;  4A20 A;  1WGD A;  2FID A;  1SIF A;  4M0W B;  4IM0 A;  3U8Z A;  4EOY A;  4ICU A;  2JRH A;  2MBB B;  2CS4 A;  2L76 A;  3L08 A;  2MBH A;  1FXT B;  2LZ6 A;  3KYC D;  5DPT A;  2MQJ A;  3KH0 A;  2AL3 A;  3QIJ A;  3CST A;  1NBF C;  1LQB A;  4GIV A;  4GU2 A;  2LGY A;  1YD8 U;  2EMT A;  4NNJ B;  1WZ3 A;  2K6D B;  4KVG B;  2FAZ A;  3VTV A;  2M1M A;  1WMH B;  3OJ4 B;  1P98 A;  3B08 A;  1CMX B;  2JZZ A;  3APC A;  2PEA A;  1SE9 A;  4DHJ D;  1EF5 A;  2EMS A;  4IW0 A;  2Z0D B;  3VUX A;  5CX3 A;  4WWP A;  3WAP A;  5BO4 B;  2ZEQ A;  3A1Q A;  3A9K B;  3MTN B;  3QX1 A;  2MRP A;  4FJV B;  2L7R A;  2KO3 A;  3NZU A;  2KAN A;  1KOT A;  1PQS A;  3SU8 X;  3LDZ E;  2DYB A;  3IVF A;  3ZW3 A;  2N9P C;  5J18 A;  4ASW C;  2MBE A;  2W9N A;  4FA6 A;  2BKF A;  2KVR A;  1EF1 A;  4GDL A;  1LXD A;  3A4S C;  3CSF A;  4FAD A;  4FUL A;  3BIN A;  1GC6 A;  4GGQ A;  4JQW C;  2LWP A;  2KNB A;  2JZ3 B;  4FJY A;  4ICV A;  4AJY B;  2IZV B;  4KIK B;  4HPM B;  2AEH A;  4EZK A;  1I35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...