1R4NI

Appbp1-uba3-nedd8, an e1-ubiquitin-like protein complex with atp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords amyloid beta precursor protein-binding protein 1
publication title The structure of the APPBP1-UBA3-NEDD8-ATP complex reveals the basis for selective ubiquitin-like protein activation by an E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 16
structure length 76
sequence length 76
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2003-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1r4nI00
4RMAA 1Y8RC 4FJYA 2G3QB 4W9GA 3WAMA 2XBBC 4LJPB 2LVOA 4IWOA 2RD0A 1GC6A 1OTRB 3B1LX 3UIOB 1OQYA 1OGWA 1WFYA 2BKRB 5TR5A 3P2BA 4FULA 1E90A 1CMXB 2KJHB 4NJ7A 1R4NI 1V81A 3PS6A 4M8MA 3PPAA 4PYZA 3RZWC 2AWTA 2DZIA 2GBRA 4FHKA 4GDKA 5CHVC 4W9JA 4II2B 1WX8A 4NAWA 3ZTCA 5LLIA 5HKHA 4WWOA 4KZCA 4DHZE 2N9PC 2EMTA 3AXCA 1R4MI 1WJNA 3HM3A 2WYQA 4AJWA 3S2AA 4GB9A 1ZKHA 2C7NB 2FCSA 5CHFA 3JSVB 3VDZA 3WANA 1RFAA 1BT0A 2BF8B 1Q5WB 2JWZA 2R2OA 3OLMD 2J7QB 2KD0A 2L0FA 3ML8A 1I42A 4ICVA 2C9WB 4W9EA 2KVRA 2M8SA 3SHQA 1E7UA 1UH6A 1S1QB 3TBLD 4EEWA 2BKFA 3LJ3A 4XZ4A 4LDTD 2N7DA 2KHWB 4W9CA 3D32A 1TZ1A 4JQWC 3PLUA 4K7SA 1E7VA 1WI0A 4K7UA 2KDEB 2MA9B 4EZJA 1Z2MA 1IP9A 1UD7A 2GBNA 2LRUA 4A3OA 2K6DB 4MM3A 2MBQA 1WGRA 3M62B 2D3GA 4KZ0A 3EFUA 3N32A 3OJ4B 5GMVA 3VFKA 3L10B 3APDA 3PVLA 2MCNB 2PE9A 5G55A 2KWUB 1NI2A 2LASA 3PHXB 5J18A 3LDZE 1E8WA 5DPTA 4WJOA 3JVZX 4IW0A 2N7EA 3CMMB 2HTHA 1GC7A 1YJ1A 2LXCA 4BFRA 1YX6B 1WRDB 4ZRKA 2KFJA 4DBGA 3CSTA 2KDIA 3QCAA 2C5LC 2O6VA 3A4RA 4G50A 2LD9A 4WJPA 1EO6A 2AYOB 2Z59B 4MELA 3L0WB 3UIPB 2KOXA 3PV1A 2KMAA 3DQVA 2KNBA 2KX3A 4MH0E 1V9JA 2IZVB 2LGXA 4HK2A 5E6OA 1WGGA 4B95A 2LZ6A 2K8HA 1FXTB 2BYEA 3R7QA 3V6EB 2ZPNA 3WAPA 2KC2A 1WGDA 4HJKA 3H1UA 3KUCB 2K8BA 3EC8A 2A4ZA 3HK0A 3PREA 3WALA 4G0NB 2HD5B 4BKTA 4HPLB 3A33B 2R2QA 2KC1A 4IG7B 4DHZB 4NY0A 1E8YA 2K39A 5FR6A 4AWJA 2DAJA 2XK5B 1YD8U 2KFKB 2N9EB 3H7PB 3QHTA 4XC2A 4M0WB 3UINB 2D2QA 5CX3A 2IO2B 3H6NA 4JGHB 2GBJA 2K6QA 1WR6E 1WH3A 2V3SA 2XEWA 2NBVB 3A4SC 2L05A 1XQQA 3HHMA 1WYWB 2LGDA 3A9KA 5D7GA 4GU2A 4K81A 2L00B 3Q3JA 1VD2A 4MGIE 4HDQA 4ZYNA 4IM2A 2W9NA 1U4AA 3IG3A 4GIVA 2FIFA 4IM0A 5J2RA 4XX5A 3H7SA 4N9F4 3DVNU 1QZEA 1E5WA 3DBRI 3ML9A 1WJUA 2HE7A 4J6IA 2KDFB 3PRMB 2O6VD 4MEMA 4WJNA 2DENB 4BVUC 4ANXA 1L2NA 3Q3FA 5AZGA 5LXIB 1S3SG 2UYZB 3IFWB 4P7IA 4BKSD 1TTNA 1KOTA 1EUVB 2KKCA 4MJSA 4CHKA 4GXBA 3W1SA 2CU1A 1EF1A 4ANUA 2J0MA 1E8ZA 1WIAA 2KX0A 1J19A 1V80A 3PLVA 3RCZA 2C7HA 2N1WA 4JIOU 3MHSD 3MJWA 3M3JA 4FBJB 1LFDA 2GBKA 1V6EA 1WMHA 3PT2B 2DYMA 3TCAA 2NCNA 2N1VA 3VUXA 4KIKA 4W9DA 1LXDA 2KQSA 1PQSA 3ZVVA 5IA7A 4GDLA 5DPRA 3ZDTA 1JRUA 3PSEB 3V61A 2ZJDA 4FJVB 4G11A 2BYVE 2JUOA 3I3TB 4TQ0A 3ZRFA 5JZEB 2IY0B 3ECIA 4G3XB 2KLCA 3O65B 2PPHA 4GDKB 4KVGB 3TJPA 1KJTA 3QC8B 2CHZA 3PGEA 3DVGY 4NAWB 1IYFA 4GOCA 1MG8A 4FLHA 2J0KA 3H9DA 3QAQA 2BWES 2WWZA 3DOWA 4GN1A 4TV3A 5JHAA 2L8JA 3CSFA 2KTRA 2QHOA 3SD5A 4IWPA 2DX5B 5EDSA 4EOYA 2FIDA 2FCQA 3RYTA 2D10A 2MLBA 2N4FA 2O2VA 1KLVA 4ZRIA 4CO7A 1GJZA 4KSKC 1Q0WB 4JL9A 3UQAA 1UBIA 2BWFA 3JW0X 5JHBA 4EUTA 3DBLI 2Y5BB 4PS8A 1WJ4A 4II3B 4ANVA 4AJYB 2IO0B 1NBFC 5IAAC 1D3ZA 3ZNID 1OEYJ 2EMSA 2KMCA 4NJ6A 1WX9A 4HXDA 3BINA 3L08A 1RAXA 3A1QA 4JLCA 5AZHA 1WGYA 4DXAB 4DHJD 2LXAA 4PS7A 5DCNA 3VH4B 3APFA 2BGFA 4NPNA 1M94A 1TBEA 1VCBA 1I35A 2DYOA 3WAOA 3QX1A 2NR2A 1IPGA 4KDLB 5AEKB 1NDDA 1ZW7A 2DZJA 3WA0A 2MBBB 3KYCD 4HLEA 2MBHA 4MGKE 2NPTA 2LI5A 2A5UA 2REXA 5DPSA 3KYDD 2GMIC 1V86A 2AL3A 3ZNHB 4AUQC 1WZ0A 3A9JA 2O6VB 2KWVB 2LGYA 4MDKE 3HM6X 3ZRCA 1J0GA 3M95A 4HCPB 3ZDMC 4EFOA 3K9PB 4W9HA 1ISNA 2LVPA 3PTFC 1LQBA 3PRZA 4I6LB 4TKNA 3AI5A 4DK5A 5C1ZA 2ZCCA 3RZFA 1WXAA 2Z0DB 4WWPA 4F7ZA 4RM8A 1G6JA 3RUIB 2FCNA 2JRIB 2MP2A 4ASWC 4ANWA 4TUUA 4ZDVA 1UBQA 1UZXB 2M1MA 5J17A 4EKUA 4A3PA 1P98A 2FNJB 2JVCA 3PHWB 4KV2A 4PYUA 5E6NA 3GZNI 2DHZA 2M0XA 4KSLC 1XD3B 4X57B 5D94A 3EECA 2RSUA 3VH3B 4E74A 4OVVA 4IM3A 3R7RA 3SDLC 1P3QU 3IBEA 2KO3A 4NQLB 4K1RB 5JH5C 4BBNF 4GMVA 3A9KB 4CYEA 3L54A 3RT3B 4WWNA 2KWCA 3GOEA 2L3ZA 4FHJA 2CHXA 3DPDA 3NS8A 4TQ1A 1P9DU 3QJZA 1L7YA 2UWQA 4W9IA 3VHTC 2G45B 2LUEA 2MBOA 3T9LA 3IVFA 2IO3B 2MBEA 4WQOB 1J8CA 1WE7A 2BYFA 2C7MB 4FN2A 1WXVA 2KZRA 4M8NA 4OVUA 1WE6A 3VQIA 2MX2A 1GG3A 4YL8A 1P0RA 5CTRC 2KJRA 2ZVNA 4BKGA 2DZKA 4I6NB 3L17A 2I1JA 3DVGX 5D6JB 2V1YA 5LXHA 2KTFA 4DWFA 4HWIB 3K9OB 1C3TA 3TMPB 1F9JA 2IYDB 4FADA 3QA8A 3AU5A 4MJSB 1WF9A 4MSMB 2JF5A 3VVWB 3JYUA 1ZGUB 4B9KA 2OOBB 2D07B 1WJ6A 3RD2A 1GNUA 4BOSC 3VTUA 2VRRB 2K1FA 4DHJB 2MWSB 2OJRA 1WMHB 3ZKJC 2DZMA 2FAZA 3AU4A 4BBNC 4KIKB 4F1SA 3B0AA 2LJ5A 3KUDB 3R66C 4GDLB 1H8CA 1K8RB 1TGZB 3ALBA 3L13A 5BO4B 2Z0EB 3UQBA 3N3KB 4URKA 2K25A 3ZTDA 1WXMA 3X23A 3QWZB 2WX0A 1P1AA 2G4SA 3NHEB 2K8CA 3JSVA 4EZLA 1LM8B 4WAAA 1V2YA 5L83A 2B3AA 2DYBA 3B08A 4F8CB 2MRPA 2JZZA 3VUWA 2KTRB 2YVCA 4MSQB 4FA6A 2MSED 5AZFA 4AOFA 4EZKA 4NQKE 2O2VB 3IHPC 4AP4C 2AEHA 1X1MA 2IO1B 3HIZA 1WM2A 4MGZE 2M17A 2KANA 2PJHA 4I6PA 5KHOA 1V49A 4IC7B 3R3MA 3ZNGC 3ZO5B 5E6PA 4FJZA 2JRHA 2PEAA 5D2MB 2C60A 2KQ7A 2L7RA 4PS3A 5L95C 2NBWB 3V6CB 3BY4B 2JXXA 1WY8A 2PE6B 3AULA 3L16A 3M63B 3VXWA 3APCA 3U8ZA 2RPQA 3ZIMA 4A20A 3UF8A 2L0TA 3A1QB 2V4LA 2KJ6A 3KVFB 5DPWA 4B6WA 2J0JA 4LJOB 2AL6A 1T0YA 3VAWA 3QK0A 2FCMA 3PZDA 4GGQA 5C23A 3ONSA 2LWPA 4LCDE 3DVNV 1WZ3A 3WIMA 4W9KA 1KM7A 1WGHA 2NBUA 4BOZB 1Q1OA 2NPTB 2GBMA 3UGBB 3QIJA 1RLFA 2ZPYA 3DBHI 2WX1A 2MQJA 1AARA 2RR9A 4GSWA 2HJ8A 1A5RA 2KLGA 3DCGA 3A9JB 4MGYE 3V62A 2LRWA 2NVUI 2KDBA 3NZUA 4IWQA 4BKSA 2CKHB 1Z5SB 2KXJA 2MW5A 3VTVA 3KW5B 4HVBA 3N30A 1UGMA 4W9LA 2ASQA 3ZW3A 2RGFA 5KHQA 1SGHA 4WJQA 3X0WA 2YLMA 4ZRJA 3VTWA 4HPMB 3DBSA 2IY1B 2MP2B 2D11A 2KFKA 2XK5A 3V60A 3H7PA 3W1SC 2FUHB 2WDTB 2ZNVC 4W9FA 3T8MA 1UELA 4K7WA 2ZVOA 4E3CA 2KK8A 1YIWA 4ICUA 2JY6A 1XT9B 3NY5A 5CHWA 5G2NA 2CHWA 2BPSA 3RULA 1C1YB 4DDID 3EHVA 2G4DB 2ZEQA 4IUMB 2NS5A 3NOBA 3W1YA 3VUYA 2JPHA 1WM3A 4HCNB 2DAFA 4DDGD 2JZ3B 2LVQA 1V5OA 3DDCB 3MTNB 3OAWA 1EF5A 4E71A 1YQBA 3NZSA 3ENEA 4KDIC 4RM9A 1V5TA 4HDOA 1SE9A 3U7DA 1GUAB 3ZUNA 2GOWA 1E8XA 2I1KA 3U30A 2ZCBA 1YX5B 1WR1A 2EKEC 1RRBA 2N9XA 3QQ8B 2ZNVB 3C0RB 3KUZA 3SU8X 3TIXA 1OEYA 2CS4A 2ZZPB 3OJ3A 3PRPB 1WX7A 2CR5A 2M4NA 1HE8A 3ZLZA 1WXSA 2L76A 1SIFA 1H4RA 2IBIB 3CF6E 3QARA 4NNJB 3TL5A 2KN5A 4LDTB 3ZNZB 3KH0A 2JT4B
chains in the Genus database with same CATH superfamily
4A9AA 4ZRQA 4FJYA 1SE3A 1OTRB 1NI3A 1WFYA 5TR5A 3GE8C 4FULA 1VZ7A 3CWIA 5FKAC 4M8MA 1YJIA 4GDKA 4II2B 2VZKD 4RNAA 4JWSC 2BB5A 4M00A 4AJWA 3S2AA 2NTSA 2V0GA 4MACA 3BVMA 5D3IB 4WURA 2R2OA 1GB1A 1SE4A 3OLMD 4ICVA 2C9WB 4RCOA 1WXQA 4RGOS 1S1QB 4XZ4A 4HPPA 3PLUA 4K7UA 1Z2MA 4TMAB 3B2FA 3CIRB 4P1CC 2K6DB 1SE2A 1F2RI 1NEKB 3Q8CA 5G55A 2CJNA 2LASA 3E56A 4JWUC 1UGJA 2SAKA 4WJOA 2N7EA 2IGGA 2YEPB 1WRDB 2KMMA 4DBGA 3CSTA 2C5LC 4US9A 4WJPA 4L2YA 3UIPB 2KOXA 3ETRA 4MH0E 4YTMB 1JWSD 2K8HA 2BYEA 3GZNB 3R7QA 2ZPNA 4LNKA 1DOIA 2KC2A 3KUCB 4RF0A 2A4ZA 3PREA 4IG7B 4J3OD 4NY0A 1N6ZA 2DAJA 3BK1A 3DBRB 1JROA 4XC2A 5CX3A 2NBVB 1WYWB 2LGDA 3A9KA 3RNAC 1VD2A 1ZPSA 3KWVA 4YT0B 1U4AA 3B9JA 2FIFA 5J2RA 4KX6B 1L4ZB 3DVNU 1WWTA 3ML9A 2HE7A 2KDFB 2O6VD 3Q3FA 5LXIB 1SEBD 1TTNA 1EUVB 5IO9A 3LB8C 1EF1A 1UF0A 2BYTA 3IAM1 1SJED 4KKIA 2KN4A 1V6EA 1WMHA 4KKJA 3O13A 5C2TB 1KH0A 2KQSA 5IA7A 2IJ0A 5EE0A 1I4XA 3V61A 3AE9B 2JUOA 2NMQA 4TQ0A 3ZRFA 2IY0B 3DBLB 4G3XB 2BT6A 1IYFA 4FLHA 3DOWA 4TV3A 2L8JA 2QHOA 4EOYA 2FIDA 2X38A 2FCQA 1VJKA 2MLBA 2O2VA 1XLOA 1Q10A 1UBIA 4EUTA 1HZ5A 1C76A 2MEKA 1D3ZA 1UWXA 2EMSA 2QJLA 1A70A 3ZYYX 3BINA 1QF6A 1JW9D 1PGXA 2LXAA 3VH4B 1M94A 1TBEA 4WIPA 1SSNA 4N59A 3WAOA 4WH4A 5H92C 1FFUA 3P4RB 3KYCD 4L1BA 2BTEA 2LI5A 1T0SC 1V1PB 2D3AA 1QOBA 3ZRCA 3ZDMC 4I6LB 4K3BA 4XDDA 2LGSA 3Q8BA 5G5GA 2WS3B 4RM8A 2JRIB 4LK0M 3N1YC 1SF0A 5E6NA 2IDYA 1N5WA 1DYQA 5T8IA 2RSUA 3SDLC 1K52A 4K1RB 4DXGA 1WRIA 1I4RA 3P4QB 2Q5WD 4WWNA 2L3ZA 4TQ1A 2QMTA 1JWUD 1P9DU 2WHIA 3ZJTA 2IPKD 3VHTC 1C4AA 2IO3B 1UUPA 3BWUD 2MX2A 3AEEB 5CTRC 3NVVA 2L83A 2ZVNA 4BKGA 3L17A 5LXHA 1FM0D 3K9OB 1IGCA 4USAA 1VZ6A 2IYDB 3TMPB 3AU5A 1PFDA 3JYUA 3WCQA 2WXQA 2QEJC 2K1FA 2LFIA 4DHJB 2ICIA 3ZKJC 3AU4A 4KIKB 4F1SA 3R66C 1QILA 3L13A 3UQBA 4URKA 2K25A 3AE1B 4LNOA 3ZTDA 1L5PA 5HG2A 2G4SA 2ZW0A 1CZPA 3NHEB 3IAS1 1V2YA 2M56B 2B3AA 1L6VA 2JZZA 3VUWA 2FUG1 2YVCA 3R2IA 1FRRA 3DHIC 3IHPC 3HIZA 2WXLA 2M17A 2KANA 3I57A 4FJZA 3GE3C 1HZ6A 2HDEA 2C60A 2KQ7A 3BY4B 4LLGM 3DBHB 3L16A 1FXAA 3BYTB 4LNNA 3APCA 2WP9B 2E3TA 3ZIMA 4A20A 3UF8A 3A1QB 2KJ6A 2J0JA 2AL6A 1K50A 1TS5A 5C23A 1JCKB 4US8A 4C4VA 2LHDA 1RLFA 3Q6BA 1KLUD 2RR9A 2HJ8A 4C00A 2KLGA 3E9SA 3IT6B 1ZDVA 3V62A 3ZXVA 2LRWA 2KDBA 3P1MA 4BKSA 2KXJA 4OZAA 1BMLC 4HVBA 5GXGB 5KHQA 3Q8EA 3X0WA 2WNMA 4HPMB 2MP2B 3H7PA 1IGDA 3W1SC 1NENB 3GB1A 3NY5A 5G2NA 1EWYC 3EHVA 1ET6A 5HFYA 4DDGD 2VZKB 4ZHOA 3MTNB 4RM9A 1OFFA 1AW7A 3OWEB 2KT7A 3U30A 2ZCBA 1YX5B 1WR1A 3RPFC 1R4NB 2N9XA 3QQ8B 2WXGA 3KUZA 2DWQA 1OEYA 1E6EB 2CR5A 2GRIA 1HE8A 2L76A 3CF6E 3IT4B 2INPE 3TSSA 1J7CA 2Y3AA 2JT4B 3TEWA 4RMAA 1Y8RC 2G3QB 2LVOA 4IWOA 3B1LX 3I9V1 2BKRB 3HVDA 2E6XA 2KJHB 1TS3A 4XWTA 4W9JA 3MC9A 1XCTL 4NAWA 2RMMA 2EMTA 1EWCA 1C4PA 2BBCA 2AQ2B 2WDVB 2C7NB 2FCSA 4OZCA 3VDZA 4YSZB 4C56C 2K5PA 4PK1A 1F1HA 1BXTA 1VDVA 2QILA 3ML8A 1I42A 1BUIC 1SB3C 2KVRA 2G1EA 1UH6A 4EEWA 5BYSA 2N7DA 2KHWB 4K7SA 1WI0A 1YQ3B 2MA9B 2GBNA 5BMIA 3BK2A 4A3OA 2MBQA 5HHDG 1WGRA 3BIID 3M62B 2D3GA 4YTPB 3MJ5A 4KZ0A 3OJ4B 1IBXB 3W9CB 3APDA 2PE9A 1I4QA 2KWUB 2L1AA 3LDZE 2FBWB 1E7PB 2X8XX 5DPTA 2LGIA 3JVZX 2WQYB 1GC7A 3QCAA 2O6VA 3A4RA 3ZJUA 1EO6A 2Z59B 2KMAA 3DQVA 2KNBA 2KX3A 1V9JA 4HK2A 1JQ4A 4B95A 4JPSA 3V6EB 4HJKA 1ZUD2 3HK0A 3RNBC 5FR6A 1XO3A 2KQ4X 2JYEA 2KFKB 3QHTA 4M0WB 3UINB 3URYA 4JGHB 2K6QA 2LMCA 2XEWA 3A4SC 3HHMA 2L05A 1XQQA 5AUKA 1AN8A 1YMHE 4YSXB 3N20C 1XLPA 3Q3NC 2L00B 2AQ1B 1YN4A 4HDQA 4HJGE 4HRSA 4ZYSA 1JRPA 2BB6A 1E5WA 4OW0A 2DENB 1J7AA 4RGNA 3Q3OC 1S3SG 5FK9C 3IFWB 4BKSD 4MJSA 4GXBA 3BYYB 3W1SA 3ZGZA 1ZOYB 1WIAA 2N9KA 1P7FA 1XEEA 3MHSD 3M3JA 4FBJB 1PGAA 1LFDA 1PUTA 3TCAA 3VUXA 2TSSA 2N1VA 2J42A 1PQSA 3ZVVA 4GDLA 1N60A 3B2GA 1CK1A 4FJVB 3I3TB 5JZEB 3ECIA 1QOAA 3O65B 4GDKB 3W2DA 2CHZA 3PGEA 3DVGY 2J0KA 3QAQA 4OZBA 4S17A 4IWPA 4N6EB 2DX5B 5EDSA 4ZRPA 4S0RA 2N4FA 3VRAB 1R7SA 5BMGA 2JZPA 4KSKC 1GJZA 3AE3B 4JL9A 2BWFA 4XWWA 4PS8A 1HQRD 2L52A 4II3B 2IO0B 3FKYA 4HXDA 3L08A 1GB4A 1KTKA 1FRDA 1ZDXA 1QOGA 2DYOA 3NVYA 3LYYA 1D6EC 3QX1A 1JWAD 5AEKB 1ZW7A 3WA0A 2N7JA 2NPTA 2KYWA 2A5UA 4RF1A 3KYDD 3R8BA 2GMIC 2KWVB 3M95A 2W54A 4KGTA 4EFOA 3K9PB 4W9HA 3RNGC 1T3QA 4NZLB 4TKNA 3RZFA 1WXAA 3RUIB 2FCNA 4TUUA 2M1MA 5J17A 4A3PA 2FNJB 3R2TA 3EECA 1I4PA 1VLBA 4E74A 4OVVA 4IM3A 3R7RA 1MHHE 1Y56A 1E0ZA 2KO3A 3A9KB 3RNFC 3SFEB 2CHXA 4KGRA 2G45B 3T9LA 2ON8A 2MBEA 2C7MB 3V3XA 3NRZA 1WXVA 1PYWD 1WE6A 3VQIA 1GG3A 2DLBA 5E6JA 4R3DA 2KJRA 2V1YA 1AWDA 4FADA 3C19A 3QA8A 3NS1A 2ZW1A 1FEHA 1WJ6A 1WMHB 2BQQA 1N63A 3B0AA 2LJ5A 5BO4B 1L0VB 3N3KB 4N58A 4ZOHC 1WXMA 3P42A 3X23A 1D4BA 1I7HA 5EE3A 4YXDB 3JSVA 5L83A 2DYBA 3BZDB 4F8CB 2MRPA 3U7ZA 4HKQA 4FA6A 2O2VB 3FILA 2AEHA 1X1MA 2CU3A 2IO1B 1WM2A 4MGZE 4P6VF 3ZNGC 4L23A 2INNE 3ZO5B 5E6PA 2PEAA 5D2MB 2L7RA 1F52A 2EKIA 4GLSC 2JXXA 4MH8A 2PE6B 1MVKA 1NVID 3SFDB 2WXOA 1N61A 5DPWA 3KVFB 4LJOB 2BW2A 4WAFA 3ONSA 2BS4B 5IOIA 4LCDE 5AUIA 4W9KA 1KM7A 1E9MA 1Q1OA 3EUB2 1I4HA 1KLGD 5IKCM 1AARA 4GSWA 3DCGA 1PDXA 2MW5A 3VTVA 1TS4A 1UGMA 1SIJA 3DWGC 2RGFA 4ZRJA 3VTWA 3DBSA 3EFCA 2XK5A 5BYQA 1L6UA 2FUHB 3T8MA 2V4IB 4K7WA 4E3CA 1YIWA 1XT9B 5CHWA 1L0XB 2ZEQA 4IUMB 2NS5A 2VH1A 3AE8B 3W1YA 3VUYA 3PZ7A 2LVQA 3AMZA 3NJTA 1V5OA 4B0MA 1ZP0B 4E71A 3OAWA 1EF5A 3NZSA 1PGBA 2FE8A 3Q14C 3ZJVA 2XN9C 2GOWA 1E8XA 2WXKA 4M02A 2I1KA 2EKEC 1YN3A 3TIXA 2J53A 2CS4A 2ZZPB 4WWMA 5HI1A 1GAQB 2ACZB 1SIFA 3QARA 5IP4D 2KN5A 3PO0A 1ACCA 3ZNZB 1ENFA 3EGRA 1ZE3D 2WXJA 4W9GA 3RFZB 4LJPB 3TEYA 2RD0A 3UIOB 3BVZA 1FFVA 4NJ7A 1CMXB 4C7ZA 3PS6A 3PPAA 4PYZA 2DZIA 2GBRA 3J9CA 3TUOA 4FHKA 1WX8A 1YNTE 1AYFA 5LLIA 4DHZE 1RM6C 3I63C 3AXCA 4XE0A 5D3DA 1EU4A 2JWUA 3WANA 2BF8B 3W5VB 2K0PA 2LHEA 3AE2B 4HKZE 4XDCA 3TBLD 4W9CA 1TZ1A 4BZAA 1E7VA 4REZA 2KDEB 1IP9A 1UD7A 2LRUA 4MM3A 1L4DB 3N32A 4RH6A 1TJEA 3PVLA 3VFKA 2MCNB 1NI2A 1XCQL 1E8WA 4YWGG 2KDMA 1KFYB 4IW0A 3CMMB 2HTHA 1YJ1A 2LXCA 2KFJA 4C4VB 2KDIA 4FXCA 1TIFA 2LUMA 2LJIA 4MELA 4ITKA 2LGXA 2IZVB 1WGGA 2LZ6A 3C8YA 1KRHA 2EELA 3RI7C 1WGDA 2R61A 2K8BA 3EC8A 2UU7A 1FNVA 3WALA 1ROEA 2HD5B 4BKTA 2KACA 1D5ZC 2KC1A 4DHZB 1E8YA 2K39A 4AWJA 1YD8U 1KF6B 3H7PB 2BVCA 2IO2B 3AEFB 1WR6E 1WH3A 4IOIE 3N1XC 2K3UA 1D5MC 3Q3JA 4MGIE 4IM2A 4GIVA 3H7SA 4N9F4 5BMHA 3AH7A 1QZEA 2JX5A 1WYGA 3DBRI 2JQRB 3T3NA 2ONQA 4ANXA 2YEPF 5AZGA 4A55A 1WSPA 1KOTA 4CHKA 2CU1A 1DOYA 2KX0A 1V80A 3RCZA 2PW9A 3MJWA 2INCC 3PT2B 2NCNA 1QT9A 1TT5B 4ARCA 5DPRA 3ZDTA 1JRUA 1HTQA 2ZJDA 1YQ4B 2PPHA 4KVGB 2VH2A 4C7YA 3QC8B 4LTUA 4NAWB 3H9DA 2WWZA 3CSFA 2KTRA 3SD5A 2INDC 1C79A 2Y5CA 3RYTA 4NAMA 1KLVA 4CO7A 2M19A 5JHBA 3DBLI 1T0QC 1FO4A 3AEAB 4BAXA 4AJYB 5IAAC 1FCLA 2KMCA 4NJ6A 1P7EA 1GPXA 4PT5A 4B0EA 4C80A 2CJOA 5AZHA 2GI9A 3AN1A 4WQMA 4DHJD 4PS7A 5DCNA 1FCCC 2BGFA 4NPNA 1VCBA 2QSDA 5I4DA 4P16A 2NR2A 1IPGA 2M0AA 1NDDA 1EU3A 2MBBB 4HLEA 4MGKE 1MG4A 2REXA 5DPSA 1V86A 3ZNHB 2K9XA 4AUQC 1ESFA 2O6VB 3A9JA 3HRDD 2H89B 3PRZA 1QQRA 3AI5A 5C1ZA 2N0SB 1E10A 1HXYD 1HA5A 2LEKA 1TY0A 4ASWC 3NVWA 1UBQA 4EKUA 1P98A 2JVCA 3PHWB 4KV2A 2G9HD 2WXNA 3SEBA 1FXIA 2M0XA 2W3SA 3MP9A 1XD3B 4KSLC 4X57B 1FNUA 5D94A 4QAYA 1P3QU 3AE6B 5JH5C 4BBNF 1DGJA 3L54A 3RT3B 2KWCA 4FHJA 3NS8A 5JXVA 2UWQA 2H88B 2MBOA 5EE9A 3IVFA 4AQ7A 4WQOB 4YTNB 1WE7A 2KZRA 2PVGC 1FPYA 1TY2A 4YL8A 1L0YB 2SEBD 2DZKA 5D6JB 1I4GA 3DVGX 2QCZA 4DWFA 4HWIB 1C3TA 5IN7A 1N5XA 4MJSB 4LNFA 3VVWB 1ZGUB 4B9KA 1FNWA 2PVOD 4BOSC 1D5XC 3VTUA 2VRRB 2MWSB 2DZMA 2FAZA 4BBNC 1QKZA 4GDLB 1H8CA 3ALBA 1XLNA 3QWZB 2WXRA 2WX0A 2WU5B 1LM8B 2AX5A 3N9YC 4WAAA 2GB1A 1JALA 3KQ4A 4D2KA 2J4XA 2BS3B 2W3RA 2MSED 4NQKE 3VR8B 3ABVB 4AP4C 5BYRA 4I6PA 5KHOA 1V49A 4IC7B 2WDRB 1LO5D 4PS3A 3FC4A 4DQOC 5L95C 2NBWB 1WY8A 3U8ZA 1VRAB 1JMLA 2RPQA 2L0TA 4CQNA 3BVGA 2NTTA 2V4LA 5MPOA 4XYCA 4B6WA 3HUIA 1T0YA 3QK0A 2FCMA 2J52A 3PZDA 2B76B 4GGQA 2PIAA 2LWPA 1WZ3A 3WIMA 2NBUA 4BOZB 2NPTB 1STEA 3QIJA 3DBHI 3RNEC 2D5GA 1MI0A 2NVUI 2WXPA 3NZUA 4IWQA 2V9HA 2CKHB 2WDQB 2V3PA 3V05A 1C77A 2ASQA 1SGHA 4WJQA 2YLMA 2GLSA 1V8CA 2IY1B 2D11A 2WDTB 4W9FA 1V97A 2ZVOA 5H8YE 3N1ZC 2KK8A 2K22A 2CHWA 4O1NA 2MHJA 1ZXIA 4DDID 3NOBA 3AE4B 1SBBB 3DDCB 3ENEA 4KDIC 3AB5A 1SE9A 1HEZE 2KAJA 3U7DA 3ZUNA 1QLBB 1JWBD 1ET9A 1RYJA 2ZNVB 3SU8X 4ACFA 3OJ3A 3PRPB 2M4NA 3ZLZA 1TKEA 2IBIB 1F2RC 2RDHA 2Z8LA 5EE1A 3WAMA 2QIEB 2XBBC 3NG0A 1GC6A 1OQYA 1XXGA 3U2SC 2JXTA 1OGWA 2W55A 3P2BA 2QDFA 1E90A 2WU2B 1R4NI 1JWMD 1V81A 3RZWC 1SJHD 2AWTA 5CHVC 4LNIA 3ZTCA 5HKHA 1TKGA 4KZCA 4WWOA 2N9PC 1R4MI 1WJNA 3HM3A 2WYQA 3RN9C 3ZQ4A 4GB9A 1ZKHA 5CHFA 3JSVB 1RFAA 1BT0A 1Q5WB 2JWZA 4Q2JA 2J7QB 2KD0A 2L0FA 4W9EA 2M8SA 3SHQA 1E7UA 1TS2A 3FILB 4P1BC 2BKFA 3LJ3A 2DNFA 4LDTD 3D32A 4JQWC 2RDGA 1MJDA 4EZJA 2L32A 3EA6A 1CJEA 3AECB 1F0ZA 1QOFA 3EFUA 5GMVA 1TZOA 3L10B 2MH7A 5J18A 3PHXB 2WGSA 3MFGA 1YOVB 4BFRA 2RPVA 1V1PA 1YX6B 4ZRKA 3VR9B 3AEDB 4G50A 2LD9A 2AYOB 3L0WB 2MJEA 3PV1A 3TEZA 3AEGB 4KGSA 2MJDA 2PKOA 5E6OA 1FXTB 1CQVA 3WAPA 3H1UA 3RNCC 4TSSA 4G0NB 3MHZA 5TSSA 4HPLB 3A33B 2R2QA 2XK5B 4UDUC 2N9EB 4MT5A 1MFWA 2D2QA 3H6NA 2GBJA 2V3SA 2I38A 4ARIA 1FD6A 5D7GA 3Q8FA 4GU2A 4K81A 1M4VA 4ZYNA 2WXFA 2W9NA 3IG3A 2D3BA 4IM0A 4XX5A 1J7BA 4AS1A 1WJUA 1UWMA 2KVZA 4J6IA 3PRMB 4WJNA 4MEMA 4BVUC 3DWMA 4A6QA 4HEA1 1L2NA 1DOXA 2UYZB 4P7IA 2PTLA 2KKCA 4A8XC 3Q3MC 4ANUA 2BS2B 2J0MA 1E8ZA 3PLVA 1J19A 2IGHA 1XLQA 2C7HA 2N1WA 4JIOU 1NYQA 1K51A 1FIQA 1OQQA 2GBKA 3MC0B 2DYMA 1HTOA 4IKGA 4KIKA 4W9DA 1LXDA 4ZHPA 1TKYA 4JE3B 3PSEB 4G11A 5FR3A 4JX1C 2BYVE 1C78A 2Y5PA 2KLCA 1B1ZA 2OJWA 3TJPA 1YN5A 1KJTA 4GOCA 1MG8A 4A90A 2BWES 4GN1A 1VZ8A 5JHAA 2D10A 1RWSA 4ZRIA 4DXFA 1Q0WB 3UQAA 3JW0X 2RDBC 2Y5BB 1WJ4A 4ANVA 4H2AA 1OQRA 1NBFC 3ZNID 1OEYJ 3P63A 1WX9A 2WXHA 2WXMA 4IDIA 1RAXA 2PLPA 4RFBA 3A1QA 4JLCA 2QC8A 2V3NA 1WGYA 4MM3B 1F77A 4DXAB 3APFA 1ZXHA 2JYTA 1I35A 3P4PB 3NUHB 4KDLB 3FAHA 2DZJA 4EE2A 2MBHA 3DHHC 1TYGB 2WXIA 2MJ3A 1FMAD 2AL3A 1WZ0A 2LGYA 3I5JC 3AM9A 3HM6X 4MDKE 3TEXA 1J0GA 4HCPB 1V1OA 1ISNA 2LVPA 3PTFC 1LQBA 3W5UB 3UI3A 4DK5A 2ZCCA 2Z0DB 4WWPA 4F7ZA 2PMVA 1G6JA 2MP2A 4ANWA 3U4EG 4ZDVA 1WGKA 2HTME 1UZXB 2HJ1A 1IUEA 1NYRA 3AEBB 1T6BX 4PYUA 3GZNI 2DHZA 3LXFA 2DBYA 4M01A 3VH3B 1GOZA 3IBEA 4NQLB 1B9RA 4GMVA 4CYEA 3GOEA 3DPDA 3QJZA 1L7YA 4W9IA 2LUEA 1J8CA 2BYFA 4FN2A 4M8NA 4OVUA 3SR6A 2WLBA 2W82A 1K53A 1P0RA 1EM7A 2OEDA 4I6NB 2I1JA 2KTFA 3OG5A 1F9JA 4OVZA 1WF9A 4MSMB 2JF5A 1N62A 2N9LA 4YSYB 2OOBB 2D07B 3RD2A 1GNUA 3AE5B 3DHGC 2OJRA 1R4MB 1T0RC 2JU6X 3KUDB 1K8RB 1TGZB 3H8HA 2Z0EB 1P1AA 2K8CA 3VRBB 4EZLA 4RGMA 3T3OA 3B08A 2KWDA 2KTRB 4MSQB 2OHFA 3Q69A 5AZFA 3MC8A 4AOFA 4EZKA 3IXSA 2PJHA 3R3MA 1MPEA 2JRHA 1SXTA 3V6CB 1RFKA 1IBXA 3M63B 3AULA 3VXWA 3GS2A 3AE7B 3L4PA 3VAWA 3Q2AC 3DVNV 1WGHA 3Q8AA 2XNAC 3U52E 3GP7A 2GBMA 2AQ3B 3UGBB 2ZPYA 2WX1A 2MQJA 1A5RA 1UNSA 2I2YA 3A9JB 4MGYE 2D3CA 3KLSX 3AV8A 4HROA 3RMKC 1Z5SB 3KW5B 3PZ8A 3N30A 4W9LA 3NZ3A 2JSVX 3ZW3A 3NVZA 3KWLA 2IGDA 2KFKA 3V60A 4M0WA 2ZNVC 1UELA 5G5HA 4XGAB 3P4SB 4ICUA 2JY6A 4RGTA 2BPSA 3RULA 1C1YB 2G4DB 4OHJA 4K3CA 1C9FA 1LGRA 2JPHA 1WM3A 4HCNB 1C4CA 2DAFA 2JZ3B 5C3JB 3ZXRA 1YQBA 1V5TA 4HDOA 1GUAB 1VR9A 1T5XD 4NJCA 5LNK1 1RRBA 1YJJA 1MHXA 3C0RB 1WX7A 1WXSA 1H4RA 4NNJB 3TL5A 4LDTB 3HVZA 3KH0A 1XF5L
chains in the Genus database with same CATH topology
4RMAA 1Y8RC 4FJYA 2G3QB 4W9GA 3WAMA 2XBBC 4LJPB 2LVOA 4IWOA 2RD0A 1GC6A 1OTRB 3B1LX 3UIOB 1OQYA 1OGWA 1WFYA 2BKRB 5TR5A 3P2BA 4FULA 1E90A 1CMXB 2KJHB 4NJ7A 1R4NI 1V81A 3PS6A 4M8MA 3PPAA 4PYZA 3RZWC 2AWTA 2DZIA 2GBRA 4FHKA 4GDKA 5CHVC 4W9JA 4II2B 1WX8A 4NAWA 3ZTCA 5LLIA 5HKHA 4WWOA 4KZCA 4DHZE 2N9PC 2EMTA 3AXCA 1R4MI 1WJNA 3HM3A 2WYQA 4AJWA 3S2AA 4GB9A 1ZKHA 2C7NB 2FCSA 5CHFA 3JSVB 3VDZA 3WANA 1RFAA 1BT0A 2BF8B 1Q5WB 2JWZA 2R2OA 3OLMD 2J7QB 2KD0A 2L0FA 3ML8A 1I42A 4ICVA 2C9WB 4W9EA 2KVRA 2M8SA 3SHQA 1E7UA 1UH6A 1S1QB 3TBLD 4EEWA 2BKFA 3LJ3A 4XZ4A 4LDTD 2N7DA 2KHWB 4W9CA 3D32A 1TZ1A 4JQWC 3PLUA 4K7SA 1E7VA 1WI0A 4K7UA 2KDEB 2MA9B 4EZJA 1Z2MA 1IP9A 1UD7A 2GBNA 2LRUA 4A3OA 2K6DB 4MM3A 2MBQA 1WGRA 3M62B 2D3GA 4KZ0A 3EFUA 3N32A 3OJ4B 5GMVA 3VFKA 3L10B 3APDA 3PVLA 2MCNB 2PE9A 5G55A 2KWUB 1NI2A 2LASA 3PHXB 5J18A 3LDZE 1E8WA 5DPTA 4WJOA 3JVZX 4IW0A 2N7EA 3CMMB 2HTHA 1GC7A 1YJ1A 2LXCA 4BFRA 1YX6B 1WRDB 4ZRKA 2KFJA 4DBGA 3CSTA 2KDIA 3QCAA 2C5LC 2O6VA 3A4RA 4G50A 2LD9A 4WJPA 1EO6A 2AYOB 2Z59B 4MELA 3L0WB 3UIPB 2KOXA 3PV1A 2KMAA 3DQVA 2KNBA 2KX3A 4MH0E 1V9JA 2IZVB 2LGXA 4HK2A 5E6OA 1WGGA 4B95A 2LZ6A 2K8HA 1FXTB 2BYEA 3R7QA 3V6EB 2ZPNA 3WAPA 2KC2A 1WGDA 4HJKA 3H1UA 3KUCB 2K8BA 3EC8A 2A4ZA 3HK0A 3PREA 3WALA 4G0NB 2HD5B 4BKTA 4HPLB 3A33B 2R2QA 2KC1A 4IG7B 4DHZB 4NY0A 1E8YA 2K39A 5FR6A 4AWJA 2DAJA 2XK5B 1YD8U 2KFKB 2N9EB 3H7PB 3QHTA 4XC2A 4M0WB 3UINB 2D2QA 5CX3A 2IO2B 3H6NA 4JGHB 2GBJA 2K6QA 1WR6E 1WH3A 2V3SA 2XEWA 2NBVB 3A4SC 2L05A 1XQQA 3HHMA 1WYWB 2LGDA 3A9KA 5D7GA 4GU2A 4K81A 2L00B 3Q3JA 1VD2A 4MGIE 4HDQA 4ZYNA 4IM2A 2W9NA 1U4AA 3IG3A 4GIVA 2FIFA 4IM0A 5J2RA 4XX5A 3H7SA 4N9F4 3DVNU 1QZEA 1E5WA 3DBRI 3ML9A 1WJUA 2HE7A 4J6IA 2KDFB 3PRMB 2O6VD 4MEMA 4WJNA 2DENB 4BVUC 4ANXA 1L2NA 3Q3FA 5AZGA 5LXIB 1S3SG 2UYZB 3IFWB 4P7IA 4BKSD 1TTNA 1KOTA 1EUVB 2KKCA 4MJSA 4CHKA 4GXBA 3W1SA 2CU1A 1EF1A 4ANUA 2J0MA 1E8ZA 1WIAA 2KX0A 1J19A 1V80A 3PLVA 3RCZA 2C7HA 2N1WA 4JIOU 3MHSD 3MJWA 3M3JA 4FBJB 1LFDA 2GBKA 1V6EA 1WMHA 3PT2B 2DYMA 3TCAA 2NCNA 2N1VA 3VUXA 4KIKA 4W9DA 1LXDA 2KQSA 1PQSA 3ZVVA 5IA7A 4GDLA 5DPRA 3ZDTA 1JRUA 3PSEB 3V61A 2ZJDA 4FJVB 4G11A 2BYVE 2JUOA 3I3TB 4TQ0A 3ZRFA 5JZEB 2IY0B 3ECIA 4G3XB 2KLCA 3O65B 2PPHA 4GDKB 4KVGB 3TJPA 1KJTA 3QC8B 2CHZA 3PGEA 3DVGY 4NAWB 1IYFA 4GOCA 1MG8A 4FLHA 2J0KA 3H9DA 3QAQA 2BWES 2WWZA 3DOWA 4GN1A 4TV3A 5JHAA 2L8JA 3CSFA 2KTRA 2QHOA 3SD5A 4IWPA 2DX5B 5EDSA 4EOYA 2FIDA 2FCQA 3RYTA 2D10A 2MLBA 2N4FA 2O2VA 1KLVA 4ZRIA 4CO7A 1GJZA 4KSKC 1Q0WB 4JL9A 3UQAA 1UBIA 2BWFA 3JW0X 5JHBA 4EUTA 3DBLI 2Y5BB 4PS8A 1WJ4A 4II3B 4ANVA 4AJYB 2IO0B 1NBFC 5IAAC 1D3ZA 3ZNID 1OEYJ 2EMSA 2KMCA 4NJ6A 1WX9A 4HXDA 3BINA 3L08A 1RAXA 3A1QA 4JLCA 5AZHA 1WGYA 4DXAB 4DHJD 2LXAA 4PS7A 5DCNA 3VH4B 3APFA 2BGFA 4NPNA 1M94A 1TBEA 1VCBA 1I35A 2DYOA 3WAOA 3QX1A 2NR2A 1IPGA 4KDLB 5AEKB 1NDDA 1ZW7A 2DZJA 3WA0A 2MBBB 3KYCD 4HLEA 2MBHA 4MGKE 2NPTA 2LI5A 2A5UA 2REXA 5DPSA 3KYDD 2GMIC 1V86A 2AL3A 3ZNHB 4AUQC 1WZ0A 3A9JA 2O6VB 2KWVB 2LGYA 4MDKE 3HM6X 3ZRCA 1J0GA 3M95A 4HCPB 3ZDMC 4EFOA 3K9PB 4W9HA 1ISNA 2LVPA 3PTFC 1LQBA 3PRZA 4I6LB 4TKNA 3AI5A 4DK5A 5C1ZA 2ZCCA 3RZFA 1WXAA 2Z0DB 4WWPA 4F7ZA 4RM8A 1G6JA 3RUIB 2FCNA 2JRIB 2MP2A 4ASWC 4ANWA 4TUUA 4ZDVA 1UBQA 1UZXB 2M1MA 5J17A 4EKUA 4A3PA 1P98A 2FNJB 2JVCA 3PHWB 4KV2A 4PYUA 5E6NA 3GZNI 2DHZA 2M0XA 4KSLC 1XD3B 4X57B 5D94A 3EECA 2RSUA 3VH3B 4E74A 4OVVA 4IM3A 3R7RA 3SDLC 1P3QU 3IBEA 2KO3A 4NQLB 4K1RB 5JH5C 4BBNF 4GMVA 3A9KB 4CYEA 3L54A 3RT3B 4WWNA 2KWCA 3GOEA 2L3ZA 4FHJA 2CHXA 3DPDA 3NS8A 4TQ1A 1P9DU 3QJZA 1L7YA 2UWQA 4W9IA 3VHTC 2G45B 2LUEA 2MBOA 3T9LA 3IVFA 2IO3B 2MBEA 4WQOB 1J8CA 1WE7A 2BYFA 2C7MB 4FN2A 1WXVA 2KZRA 4M8NA 4OVUA 1WE6A 3VQIA 2MX2A 1GG3A 4YL8A 1P0RA 5CTRC 2KJRA 2ZVNA 4BKGA 2DZKA 4I6NB 3L17A 2I1JA 3DVGX 5D6JB 2V1YA 5LXHA 2KTFA 4DWFA 4HWIB 3K9OB 1C3TA 3TMPB 1F9JA 2IYDB 4FADA 3QA8A 3AU5A 4MJSB 1WF9A 4MSMB 2JF5A 3VVWB 3JYUA 1ZGUB 4B9KA 2OOBB 2D07B 1WJ6A 3RD2A 1GNUA 4BOSC 3VTUA 2VRRB 2K1FA 4DHJB 2MWSB 2OJRA 1WMHB 3ZKJC 2DZMA 2FAZA 3AU4A 4BBNC 4KIKB 4F1SA 3B0AA 2LJ5A 3KUDB 3R66C 4GDLB 1H8CA 1K8RB 1TGZB 3ALBA 3L13A 5BO4B 2Z0EB 3UQBA 3N3KB 4URKA 2K25A 3ZTDA 1WXMA 3X23A 3QWZB 2WX0A 1P1AA 2G4SA 3NHEB 2K8CA 3JSVA 4EZLA 1LM8B 4WAAA 1V2YA 5L83A 2B3AA 2DYBA 3B08A 4F8CB 2MRPA 2JZZA 3VUWA 2KTRB 2YVCA 4MSQB 4FA6A 2MSED 5AZFA 4AOFA 4EZKA 4NQKE 2O2VB 3IHPC 4AP4C 2AEHA 1X1MA 2IO1B 3HIZA 1WM2A 4MGZE 2M17A 2KANA 2PJHA 4I6PA 5KHOA 1V49A 4IC7B 3R3MA 3ZNGC 3ZO5B 5E6PA 4FJZA 2JRHA 2PEAA 5D2MB 2C60A 2KQ7A 2L7RA 4PS3A 5L95C 2NBWB 3V6CB 3BY4B 2JXXA 1WY8A 2PE6B 3AULA 3L16A 3M63B 3VXWA 3APCA 3U8ZA 2RPQA 3ZIMA 4A20A 3UF8A 2L0TA 3A1QB 2V4LA 2KJ6A 3KVFB 5DPWA 4B6WA 2J0JA 4LJOB 2AL6A 1T0YA 3VAWA 3QK0A 2FCMA 3PZDA 4GGQA 5C23A 3ONSA 2LWPA 4LCDE 3DVNV 1WZ3A 3WIMA 4W9KA 1KM7A 1WGHA 2NBUA 4BOZB 1Q1OA 2NPTB 2GBMA 3UGBB 3QIJA 1RLFA 2ZPYA 3DBHI 2WX1A 2MQJA 1AARA 2RR9A 4GSWA 2HJ8A 1A5RA 2KLGA 3DCGA 3A9JB 4MGYE 3V62A 2LRWA 2NVUI 2KDBA 3NZUA 4IWQA 4BKSA 2CKHB 1Z5SB 2KXJA 2MW5A 3VTVA 3KW5B 4HVBA 3N30A 1UGMA 4W9LA 2ASQA 3ZW3A 2RGFA 5KHQA 1SGHA 4WJQA 3X0WA 2YLMA 4ZRJA 3VTWA 4HPMB 3DBSA 2IY1B 2MP2B 2D11A 2KFKA 2XK5A 3V60A 3H7PA 3W1SC 2FUHB 2WDTB 2ZNVC 4W9FA 3T8MA 1UELA 4K7WA 2ZVOA 4E3CA 2KK8A 1YIWA 4ICUA 2JY6A 1XT9B 3NY5A 5CHWA 5G2NA 2CHWA 2BPSA 3RULA 1C1YB 4DDID 3EHVA 2G4DB 2ZEQA 4IUMB 2NS5A 3NOBA 3W1YA 3VUYA 2JPHA 1WM3A 4HCNB 2DAFA 4DDGD 2JZ3B 2LVQA 1V5OA 3DDCB 3MTNB 3OAWA 1EF5A 4E71A 1YQBA 3NZSA 3ENEA 4KDIC 4RM9A 1V5TA 4HDOA 1SE9A 3U7DA 1GUAB 3ZUNA 2GOWA 1E8XA 2I1KA 3U30A 2ZCBA 1YX5B 1WR1A 2EKEC 1RRBA 2N9XA 3QQ8B 2ZNVB 3C0RB 3KUZA 3SU8X 3TIXA 1OEYA 2CS4A 2ZZPB 3OJ3A 3PRPB 1WX7A 2CR5A 2M4NA 1HE8A 3ZLZA 1WXSA 2L76A 1SIFA 1H4RA 2IBIB 3CF6E 3QARA 4NNJB 3TL5A 2KN5A 4LDTB 3ZNZB 3KH0A 2JT4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RMA A;  1Y8R C;  4FJY A;  2G3Q B;  4W9G A;  3WAM A;  2XBB C;  4LJP B;  2LVO A;  4IWO A;  2RD0 A;  1GC6 A;  1OTR B;  3B1L X;  3UIO B;  1OQY A;  1OGW A;  1WFY A;  2BKR B;  5TR5 A;  3P2B A;  4FUL A;  1E90 A;  1CMX B;  2KJH B;  4NJ7 A;  1R4N I;  1V81 A;  3PS6 A;  4M8M A;  3PPA A;  4PYZ A;  3RZW C;  2AWT A;  2DZI A;  2GBR A;  4FHK A;  4GDK A;  5CHV C;  4W9J A;  4II2 B;  1WX8 A;  4NAW A;  3ZTC A;  5LLI A;  5HKH A;  4WWO A;  4KZC A;  4DHZ E;  2N9P C;  2EMT A;  3AXC A;  1R4M I;  1WJN A;  3HM3 A;  2WYQ A;  4AJW A;  3S2A A;  4GB9 A;  1ZKH A;  2C7N B;  2FCS A;  5CHF A;  3JSV B;  3VDZ A;  3WAN A;  1RFA A;  1BT0 A;  2BF8 B;  1Q5W B;  2JWZ A;  2R2O A;  3OLM D;  2J7Q B;  2KD0 A;  2L0F A;  3ML8 A;  1I42 A;  4ICV A;  2C9W B;  4W9E A;  2KVR A;  2M8S A;  3SHQ A;  1E7U A;  1UH6 A;  1S1Q B;  3TBL D;  4EEW A;  2BKF A;  3LJ3 A;  4XZ4 A;  4LDT D;  2N7D A;  2KHW B;  4W9C A;  3D32 A;  1TZ1 A;  4JQW C;  3PLU A;  4K7S A;  1E7V A;  1WI0 A;  4K7U A;  2KDE B;  2MA9 B;  4EZJ A;  1Z2M A;  1IP9 A;  1UD7 A;  2GBN A;  2LRU A;  4A3O A;  2K6D B;  4MM3 A;  2MBQ A;  1WGR A;  3M62 B;  2D3G A;  4KZ0 A;  3EFU A;  3N32 A;  3OJ4 B;  5GMV A;  3VFK A;  3L10 B;  3APD A;  3PVL A;  2MCN B;  2PE9 A;  5G55 A;  2KWU B;  1NI2 A;  2LAS A;  3PHX B;  5J18 A;  3LDZ E;  1E8W A;  5DPT A;  4WJO A;  3JVZ X;  4IW0 A;  2N7E A;  3CMM B;  2HTH A;  1GC7 A;  1YJ1 A;  2LXC A;  4BFR A;  1YX6 B;  1WRD B;  4ZRK A;  2KFJ A;  4DBG A;  3CST A;  2KDI A;  3QCA A;  2C5L C;  2O6V A;  3A4R A;  4G50 A;  2LD9 A;  4WJP A;  1EO6 A;  2AYO B;  2Z59 B;  4MEL A;  3L0W B;  3UIP B;  2KOX A;  3PV1 A;  2KMA A;  3DQV A;  2KNB A;  2KX3 A;  4MH0 E;  1V9J A;  2IZV B;  2LGX A;  4HK2 A;  5E6O A;  1WGG A;  4B95 A;  2LZ6 A;  2K8H A;  1FXT B;  2BYE A;  3R7Q A;  3V6E B;  2ZPN A;  3WAP A;  2KC2 A;  1WGD A;  4HJK A;  3H1U A;  3KUC B;  2K8B A;  3EC8 A;  2A4Z A;  3HK0 A;  3PRE A;  3WAL A;  4G0N B;  2HD5 B;  4BKT A;  4HPL B;  3A33 B;  2R2Q A;  2KC1 A;  4IG7 B;  4DHZ B;  4NY0 A;  1E8Y A;  2K39 A;  5FR6 A;  4AWJ A;  2DAJ A;  2XK5 B;  1YD8 U;  2KFK B;  2N9E B;  3H7P B;  3QHT A;  4XC2 A;  4M0W B;  3UIN B;  2D2Q A;  5CX3 A;  2IO2 B;  3H6N A;  4JGH B;  2GBJ A;  2K6Q A;  1WR6 E;  1WH3 A;  2V3S A;  2XEW A;  2NBV B;  3A4S C;  2L05 A;  1XQQ A;  3HHM A;  1WYW B;  2LGD A;  3A9K A;  5D7G A;  4GU2 A;  4K81 A;  2L00 B;  3Q3J A;  1VD2 A;  4MGI E;  4HDQ A;  4ZYN A;  4IM2 A;  2W9N A;  1U4A A;  3IG3 A;  4GIV A;  2FIF A;  4IM0 A;  5J2R A;  4XX5 A;  3H7S A;  4N9F 4;  3DVN U;  1QZE A;  1E5W A;  3DBR I;  3ML9 A;  1WJU A;  2HE7 A;  4J6I A;  2KDF B;  3PRM B;  2O6V D;  4MEM A;  4WJN A;  2DEN B;  4BVU C;  4ANX A;  1L2N A;  3Q3F A;  5AZG A;  5LXI B;  1S3S G;  2UYZ B;  3IFW B;  4P7I A;  4BKS D;  1TTN A;  1KOT A;  1EUV B;  2KKC A;  4MJS A;  4CHK A;  4GXB A;  3W1S A;  2CU1 A;  1EF1 A;  4ANU A;  2J0M A;  1E8Z A;  1WIA A;  2KX0 A;  1J19 A;  1V80 A;  3PLV A;  3RCZ A;  2C7H A;  2N1W A;  4JIO U;  3MHS D;  3MJW A;  3M3J A;  4FBJ B;  1LFD A;  2GBK A;  1V6E A;  1WMH A;  3PT2 B;  2DYM A;  3TCA A;  2NCN A;  2N1V A;  3VUX A;  4KIK A;  4W9D A;  1LXD A;  2KQS A;  1PQS A;  3ZVV A;  5IA7 A;  4GDL A;  5DPR A;  3ZDT A;  1JRU A;  3PSE B;  3V61 A;  2ZJD A;  4FJV B;  4G11 A;  2BYV E;  2JUO A;  3I3T B;  4TQ0 A;  3ZRF A;  5JZE B;  2IY0 B;  3ECI A;  4G3X B;  2KLC A;  3O65 B;  2PPH A;  4GDK B;  4KVG B;  3TJP A;  1KJT A;  3QC8 B;  2CHZ A;  3PGE A;  3DVG Y;  4NAW B;  1IYF A;  4GOC A;  1MG8 A;  4FLH A;  2J0K A;  3H9D A;  3QAQ A;  2BWE S;  2WWZ A;  3DOW A;  4GN1 A;  4TV3 A;  5JHA A;  2L8J A;  3CSF A;  2KTR A;  2QHO A;  3SD5 A;  4IWP A;  2DX5 B;  5EDS A;  4EOY A;  2FID A;  2FCQ A;  3RYT A;  2D10 A;  2MLB A;  2N4F A;  2O2V A;  1KLV A;  4ZRI A;  4CO7 A;  1GJZ A;  4KSK C;  1Q0W B;  4JL9 A;  3UQA A;  1UBI A;  2BWF A;  3JW0 X;  5JHB A;  4EUT A;  3DBL I;  2Y5B B;  4PS8 A;  1WJ4 A;  4II3 B;  4ANV A;  4AJY B;  2IO0 B;  1NBF C;  5IAA C;  1D3Z A;  3ZNI D;  1OEY J;  2EMS A;  2KMC A;  4NJ6 A;  1WX9 A;  4HXD A;  3BIN A;  3L08 A;  1RAX A;  3A1Q A;  4JLC A;  5AZH A;  1WGY A;  4DXA B;  4DHJ D;  2LXA A;  4PS7 A;  5DCN A;  3VH4 B;  3APF A;  2BGF A;  4NPN A;  1M94 A;  1TBE A;  1VCB A;  1I35 A;  2DYO A;  3WAO A;  3QX1 A;  2NR2 A;  1IPG A;  4KDL B;  5AEK B;  1NDD A;  1ZW7 A;  2DZJ A;  3WA0 A;  2MBB B;  3KYC D;  4HLE A;  2MBH A;  4MGK E;  2NPT A;  2LI5 A;  2A5U A;  2REX A;  5DPS A;  3KYD D;  2GMI C;  1V86 A;  2AL3 A;  3ZNH B;  4AUQ C;  1WZ0 A;  3A9J A;  2O6V B;  2KWV B;  2LGY A;  4MDK E;  3HM6 X;  3ZRC A;  1J0G A;  3M95 A;  4HCP B;  3ZDM C;  4EFO A;  3K9P B;  4W9H A;  1ISN A;  2LVP A;  3PTF C;  1LQB A;  3PRZ A;  4I6L B;  4TKN A;  3AI5 A;  4DK5 A;  5C1Z A;  2ZCC A;  3RZF A;  1WXA A;  2Z0D B;  4WWP A;  4F7Z A;  4RM8 A;  1G6J A;  3RUI B;  2FCN A;  2JRI B;  2MP2 A;  4ASW C;  4ANW A;  4TUU A;  4ZDV A;  1UBQ A;  1UZX B;  2M1M A;  5J17 A;  4EKU A;  4A3P A;  1P98 A;  2FNJ B;  2JVC A;  3PHW B;  4KV2 A;  4PYU A;  5E6N A;  3GZN I;  2DHZ A;  2M0X A;  4KSL C;  1XD3 B;  4X57 B;  5D94 A;  3EEC A;  2RSU A;  3VH3 B;  4E74 A;  4OVV A;  4IM3 A;  3R7R A;  3SDL C;  1P3Q U;  3IBE A;  2KO3 A;  4NQL B;  4K1R B;  5JH5 C;  4BBN F;  4GMV A;  3A9K B;  4CYE A;  3L54 A;  3RT3 B;  4WWN A;  2KWC A;  3GOE A;  2L3Z A;  4FHJ A;  2CHX A;  3DPD A;  3NS8 A;  4TQ1 A;  1P9D U;  3QJZ A;  1L7Y A;  2UWQ A;  4W9I A;  3VHT C;  2G45 B;  2LUE A;  2MBO A;  3T9L A;  3IVF A;  2IO3 B;  2MBE A;  4WQO B;  1J8C A;  1WE7 A;  2BYF A;  2C7M B;  4FN2 A;  1WXV A;  2KZR A;  4M8N A;  4OVU A;  1WE6 A;  3VQI A;  2MX2 A;  1GG3 A;  4YL8 A;  1P0R A;  5CTR C;  2KJR A;  2ZVN A;  4BKG A;  2DZK A;  4I6N B;  3L17 A;  2I1J A;  3DVG X;  5D6J B;  2V1Y A;  5LXH A;  2KTF A;  4DWF A;  4HWI B;  3K9O B;  1C3T A;  3TMP B;  1F9J A;  2IYD B;  4FAD A;  3QA8 A;  3AU5 A;  4MJS B;  1WF9 A;  4MSM B;  2JF5 A;  3VVW B;  3JYU A;  1ZGU B;  4B9K A;  2OOB B;  2D07 B;  1WJ6 A;  3RD2 A;  1GNU A;  4BOS C;  3VTU A;  2VRR B;  2K1F A;  4DHJ B;  2MWS B;  2OJR A;  1WMH B;  3ZKJ C;  2DZM A;  2FAZ A;  3AU4 A;  4BBN C;  4KIK B;  4F1S A;  3B0A A;  2LJ5 A;  3KUD B;  3R66 C;  4GDL B;  1H8C A;  1K8R B;  1TGZ B;  3ALB A;  3L13 A;  5BO4 B;  2Z0E B;  3UQB A;  3N3K B;  4URK A;  2K25 A;  3ZTD A;  1WXM A;  3X23 A;  3QWZ B;  2WX0 A;  1P1A A;  2G4S A;  3NHE B;  2K8C A;  3JSV A;  4EZL A;  1LM8 B;  4WAA A;  1V2Y A;  5L83 A;  2B3A A;  2DYB A;  3B08 A;  4F8C B;  2MRP A;  2JZZ A;  3VUW A;  2KTR B;  2YVC A;  4MSQ B;  4FA6 A;  2MSE D;  5AZF A;  4AOF A;  4EZK A;  4NQK E;  2O2V B;  3IHP C;  4AP4 C;  2AEH A;  1X1M A;  2IO1 B;  3HIZ A;  1WM2 A;  4MGZ E;  2M17 A;  2KAN A;  2PJH A;  4I6P A;  5KHO A;  1V49 A;  4IC7 B;  3R3M A;  3ZNG C;  3ZO5 B;  5E6P A;  4FJZ A;  2JRH A;  2PEA A;  5D2M B;  2C60 A;  2KQ7 A;  2L7R A;  4PS3 A;  5L95 C;  2NBW B;  3V6C B;  3BY4 B;  2JXX A;  1WY8 A;  2PE6 B;  3AUL A;  3L16 A;  3M63 B;  3VXW A;  3APC A;  3U8Z A;  2RPQ A;  3ZIM A;  4A20 A;  3UF8 A;  2L0T A;  3A1Q B;  2V4L A;  2KJ6 A;  3KVF B;  5DPW A;  4B6W A;  2J0J A;  4LJO B;  2AL6 A;  1T0Y A;  3VAW A;  3QK0 A;  2FCM A;  3PZD A;  4GGQ A;  5C23 A;  3ONS A;  2LWP A;  4LCD E;  3DVN V;  1WZ3 A;  3WIM A;  4W9K A;  1KM7 A;  1WGH A;  2NBU A;  4BOZ B;  1Q1O A;  2NPT B;  2GBM A;  3UGB B;  3QIJ A;  1RLF A;  2ZPY A;  3DBH I;  2WX1 A;  2MQJ A;  1AAR A;  2RR9 A;  4GSW A;  2HJ8 A;  1A5R A;  2KLG A;  3DCG A;  3A9J B;  4MGY E;  3V62 A;  2LRW A;  2NVU I;  2KDB A;  3NZU A;  4IWQ A;  4BKS A;  2CKH B;  1Z5S B;  2KXJ A;  2MW5 A;  3VTV A;  3KW5 B;  4HVB A;  3N30 A;  1UGM A;  4W9L A;  2ASQ A;  3ZW3 A;  2RGF A;  5KHQ A;  1SGH A;  4WJQ A;  3X0W A;  2YLM A;  4ZRJ A;  3VTW A;  4HPM B;  3DBS A;  2IY1 B;  2MP2 B;  2D11 A;  2KFK A;  2XK5 A;  3V60 A;  3H7P A;  3W1S C;  2FUH B;  2WDT B;  2ZNV C;  4W9F A;  3T8M A;  1UEL A;  4K7W A;  2ZVO A;  4E3C A;  2KK8 A;  1YIW A;  4ICU A;  2JY6 A;  1XT9 B;  3NY5 A;  5CHW A;  5G2N A;  2CHW A;  2BPS A;  3RUL A;  1C1Y B;  4DDI D;  3EHV A;  2G4D B;  2ZEQ A;  4IUM B;  2NS5 A;  3NOB A;  3W1Y A;  3VUY A;  2JPH A;  1WM3 A;  4HCN B;  2DAF A;  4DDG D;  2JZ3 B;  2LVQ A;  1V5O A;  3DDC B;  3MTN B;  3OAW A;  1EF5 A;  4E71 A;  1YQB A;  3NZS A;  3ENE A;  4KDI C;  4RM9 A;  1V5T A;  4HDO A;  1SE9 A;  3U7D A;  1GUA B;  3ZUN A;  2GOW A;  1E8X A;  2I1K A;  3U30 A;  2ZCB A;  1YX5 B;  1WR1 A;  2EKE C;  1RRB A;  2N9X A;  3QQ8 B;  2ZNV B;  3C0R B;  3KUZ A;  3SU8 X;  3TIX A;  1OEY A;  2CS4 A;  2ZZP B;  3OJ3 A;  3PRP B;  1WX7 A;  2CR5 A;  2M4N A;  1HE8 A;  3ZLZ A;  1WXS A;  2L76 A;  1SIF A;  1H4R A;  2IBI B;  3CF6 E;  3QAR A;  4NNJ B;  3TL5 A;  2KN5 A;  4LDT B;  3ZNZ B;  3KH0 A;  2JT4 B; 
#chains in the Genus database with same CATH topology
 4A9A A;  4ZRQ A;  4FJY A;  1SE3 A;  1OTR B;  1NI3 A;  1WFY A;  5TR5 A;  3GE8 C;  4FUL A;  1VZ7 A;  3CWI A;  5FKA C;  4M8M A;  1YJI A;  4GDK A;  4II2 B;  2VZK D;  4RNA A;  4JWS C;  2BB5 A;  4M00 A;  4AJW A;  3S2A A;  2NTS A;  2V0G A;  4MAC A;  3BVM A;  5D3I B;  4WUR A;  2R2O A;  1GB1 A;  1SE4 A;  3OLM D;  4ICV A;  2C9W B;  4RCO A;  1WXQ A;  4RGO S;  1S1Q B;  4XZ4 A;  4HPP A;  3PLU A;  4K7U A;  1Z2M A;  4TMA B;  3B2F A;  3CIR B;  4P1C C;  2K6D B;  1SE2 A;  1F2R I;  1NEK B;  3Q8C A;  5G55 A;  2CJN A;  2LAS A;  3E56 A;  4JWU C;  1UGJ A;  2SAK A;  4WJO A;  2N7E A;  2IGG A;  2YEP B;  1WRD B;  2KMM A;  4DBG A;  3CST A;  2C5L C;  4US9 A;  4WJP A;  4L2Y A;  3UIP B;  2KOX A;  3ETR A;  4MH0 E;  4YTM B;  1JWS D;  2K8H A;  2BYE A;  3GZN B;  3R7Q A;  2ZPN A;  4LNK A;  1DOI A;  2KC2 A;  3KUC B;  4RF0 A;  2A4Z A;  3PRE A;  4IG7 B;  4J3O D;  4NY0 A;  1N6Z A;  2DAJ A;  3BK1 A;  3DBR B;  1JRO A;  4XC2 A;  5CX3 A;  2NBV B;  1WYW B;  2LGD A;  3A9K A;  3RNA C;  1VD2 A;  1ZPS A;  3KWV A;  4YT0 B;  1U4A A;  3B9J A;  2FIF A;  5J2R A;  4KX6 B;  1L4Z B;  3DVN U;  1WWT A;  3ML9 A;  2HE7 A;  2KDF B;  2O6V D;  3Q3F A;  5LXI B;  1SEB D;  1TTN A;  1EUV B;  5IO9 A;  3LB8 C;  1EF1 A;  1UF0 A;  2BYT A;  3IAM 1;  1SJE D;  4KKI A;  2KN4 A;  1V6E A;  1WMH A;  4KKJ A;  3O13 A;  5C2T B;  1KH0 A;  2KQS A;  5IA7 A;  2IJ0 A;  5EE0 A;  1I4X A;  3V61 A;  3AE9 B;  2JUO A;  2NMQ A;  4TQ0 A;  3ZRF A;  2IY0 B;  3DBL B;  4G3X B;  2BT6 A;  1IYF A;  4FLH A;  3DOW A;  4TV3 A;  2L8J A;  2QHO A;  4EOY A;  2FID A;  2X38 A;  2FCQ A;  1VJK A;  2MLB A;  2O2V A;  1XLO A;  1Q10 A;  1UBI A;  4EUT A;  1HZ5 A;  1C76 A;  2MEK A;  1D3Z A;  1UWX A;  2EMS A;  2QJL A;  1A70 A;  3ZYY X;  3BIN A;  1QF6 A;  1JW9 D;  1PGX A;  2LXA A;  3VH4 B;  1M94 A;  1TBE A;  4WIP A;  1SSN A;  4N59 A;  3WAO A;  4WH4 A;  5H92 C;  1FFU A;  3P4R B;  3KYC D;  4L1B A;  2BTE A;  2LI5 A;  1T0S C;  1V1P B;  2D3A A;  1QOB A;  3ZRC A;  3ZDM C;  4I6L B;  4K3B A;  4XDD A;  2LGS A;  3Q8B A;  5G5G A;  2WS3 B;  4RM8 A;  2JRI B;  4LK0 M;  3N1Y C;  1SF0 A;  5E6N A;  2IDY A;  1N5W A;  1DYQ A;  5T8I A;  2RSU A;  3SDL C;  1K52 A;  4K1R B;  4DXG A;  1WRI A;  1I4R A;  3P4Q B;  2Q5W D;  4WWN A;  2L3Z A;  4TQ1 A;  2QMT A;  1JWU D;  1P9D U;  2WHI A;  3ZJT A;  2IPK D;  3VHT C;  1C4A A;  2IO3 B;  1UUP A;  3BWU D;  2MX2 A;  3AEE B;  5CTR C;  3NVV A;  2L83 A;  2ZVN A;  4BKG A;  3L17 A;  5LXH A;  1FM0 D;  3K9O B;  1IGC A;  4USA A;  1VZ6 A;  2IYD B;  3TMP B;  3AU5 A;  1PFD A;  3JYU A;  3WCQ A;  2WXQ A;  2QEJ C;  2K1F A;  2LFI A;  4DHJ B;  2ICI A;  3ZKJ C;  3AU4 A;  4KIK B;  4F1S A;  3R66 C;  1QIL A;  3L13 A;  3UQB A;  4URK A;  2K25 A;  3AE1 B;  4LNO A;  3ZTD A;  1L5P A;  5HG2 A;  2G4S A;  2ZW0 A;  1CZP A;  3NHE B;  3IAS 1;  1V2Y A;  2M56 B;  2B3A A;  1L6V A;  2JZZ A;  3VUW A;  2FUG 1;  2YVC A;  3R2I A;  1FRR A;  3DHI C;  3IHP C;  3HIZ A;  2WXL A;  2M17 A;  2KAN A;  3I57 A;  4FJZ A;  3GE3 C;  1HZ6 A;  2HDE A;  2C60 A;  2KQ7 A;  3BY4 B;  4LLG M;  3DBH B;  3L16 A;  1FXA A;  3BYT B;  4LNN A;  3APC A;  2WP9 B;  2E3T A;  3ZIM A;  4A20 A;  3UF8 A;  3A1Q B;  2KJ6 A;  2J0J A;  2AL6 A;  1K50 A;  1TS5 A;  5C23 A;  1JCK B;  4US8 A;  4C4V A;  2LHD A;  1RLF A;  3Q6B A;  1KLU D;  2RR9 A;  2HJ8 A;  4C00 A;  2KLG A;  3E9S A;  3IT6 B;  1ZDV A;  3V62 A;  3ZXV A;  2LRW A;  2KDB A;  3P1M A;  4BKS A;  2KXJ A;  4OZA A;  1BML C;  4HVB A;  5GXG B;  5KHQ A;  3Q8E A;  3X0W A;  2WNM A;  4HPM B;  2MP2 B;  3H7P A;  1IGD A;  3W1S C;  1NEN B;  3GB1 A;  3NY5 A;  5G2N A;  1EWY C;  3EHV A;  1ET6 A;  5HFY A;  4DDG D;  2VZK B;  4ZHO A;  3MTN B;  4RM9 A;  1OFF A;  1AW7 A;  3OWE B;  2KT7 A;  3U30 A;  2ZCB A;  1YX5 B;  1WR1 A;  3RPF C;  1R4N B;  2N9X A;  3QQ8 B;  2WXG A;  3KUZ A;  2DWQ A;  1OEY A;  1E6E B;  2CR5 A;  2GRI A;  1HE8 A;  2L76 A;  3CF6 E;  3IT4 B;  2INP E;  3TSS A;  1J7C A;  2Y3A A;  2JT4 B;  3TEW A;  4RMA A;  1Y8R C;  2G3Q B;  2LVO A;  4IWO A;  3B1L X;  3I9V 1;  2BKR B;  3HVD A;  2E6X A;  2KJH B;  1TS3 A;  4XWT A;  4W9J A;  3MC9 A;  1XCT L;  4NAW A;  2RMM A;  2EMT A;  1EWC A;  1C4P A;  2BBC A;  2AQ2 B;  2WDV B;  2C7N B;  2FCS A;  4OZC A;  3VDZ A;  4YSZ B;  4C56 C;  2K5P A;  4PK1 A;  1F1H A;  1BXT A;  1VDV A;  2QIL A;  3ML8 A;  1I42 A;  1BUI C;  1SB3 C;  2KVR A;  2G1E A;  1UH6 A;  4EEW A;  5BYS A;  2N7D A;  2KHW B;  4K7S A;  1WI0 A;  1YQ3 B;  2MA9 B;  2GBN A;  5BMI A;  3BK2 A;  4A3O A;  2MBQ A;  5HHD G;  1WGR A;  3BII D;  3M62 B;  2D3G A;  4YTP B;  3MJ5 A;  4KZ0 A;  3OJ4 B;  1IBX B;  3W9C B;  3APD A;  2PE9 A;  1I4Q A;  2KWU B;  2L1A A;  3LDZ E;  2FBW B;  1E7P B;  2X8X X;  5DPT A;  2LGI A;  3JVZ X;  2WQY B;  1GC7 A;  3QCA A;  2O6V A;  3A4R A;  3ZJU A;  1EO6 A;  2Z59 B;  2KMA A;  3DQV A;  2KNB A;  2KX3 A;  1V9J A;  4HK2 A;  1JQ4 A;  4B95 A;  4JPS A;  3V6E B;  4HJK A;  1ZUD 2;  3HK0 A;  3RNB C;  5FR6 A;  1XO3 A;  2KQ4 X;  2JYE A;  2KFK B;  3QHT A;  4M0W B;  3UIN B;  3URY A;  4JGH B;  2K6Q A;  2LMC A;  2XEW A;  3A4S C;  3HHM A;  2L05 A;  1XQQ A;  5AUK A;  1AN8 A;  1YMH E;  4YSX B;  3N20 C;  1XLP A;  3Q3N C;  2L00 B;  2AQ1 B;  1YN4 A;  4HDQ A;  4HJG E;  4HRS A;  4ZYS A;  1JRP A;  2BB6 A;  1E5W A;  4OW0 A;  2DEN B;  1J7A A;  4RGN A;  3Q3O C;  1S3S G;  5FK9 C;  3IFW B;  4BKS D;  4MJS A;  4GXB A;  3BYY B;  3W1S A;  3ZGZ A;  1ZOY B;  1WIA A;  2N9K A;  1P7F A;  1XEE A;  3MHS D;  3M3J A;  4FBJ B;  1PGA A;  1LFD A;  1PUT A;  3TCA A;  3VUX A;  2TSS A;  2N1V A;  2J42 A;  1PQS A;  3ZVV A;  4GDL A;  1N60 A;  3B2G A;  1CK1 A;  4FJV B;  3I3T B;  5JZE B;  3ECI A;  1QOA A;  3O65 B;  4GDK B;  3W2D A;  2CHZ A;  3PGE A;  3DVG Y;  2J0K A;  3QAQ A;  4OZB A;  4S17 A;  4IWP A;  4N6E B;  2DX5 B;  5EDS A;  4ZRP A;  4S0R A;  2N4F A;  3VRA B;  1R7S A;  5BMG A;  2JZP A;  4KSK C;  1GJZ A;  3AE3 B;  4JL9 A;  2BWF A;  4XWW A;  4PS8 A;  1HQR D;  2L52 A;  4II3 B;  2IO0 B;  3FKY A;  4HXD A;  3L08 A;  1GB4 A;  1KTK A;  1FRD A;  1ZDX A;  1QOG A;  2DYO A;  3NVY A;  3LYY A;  1D6E C;  3QX1 A;  1JWA D;  5AEK B;  1ZW7 A;  3WA0 A;  2N7J A;  2NPT A;  2KYW A;  2A5U A;  4RF1 A;  3KYD D;  3R8B A;  2GMI C;  2KWV B;  3M95 A;  2W54 A;  4KGT A;  4EFO A;  3K9P B;  4W9H A;  3RNG C;  1T3Q A;  4NZL B;  4TKN A;  3RZF A;  1WXA A;  3RUI B;  2FCN A;  4TUU A;  2M1M A;  5J17 A;  4A3P A;  2FNJ B;  3R2T A;  3EEC A;  1I4P A;  1VLB A;  4E74 A;  4OVV A;  4IM3 A;  3R7R A;  1MHH E;  1Y56 A;  1E0Z A;  2KO3 A;  3A9K B;  3RNF C;  3SFE B;  2CHX A;  4KGR A;  2G45 B;  3T9L A;  2ON8 A;  2MBE A;  2C7M B;  3V3X A;  3NRZ A;  1WXV A;  1PYW D;  1WE6 A;  3VQI A;  1GG3 A;  2DLB A;  5E6J A;  4R3D A;  2KJR A;  2V1Y A;  1AWD A;  4FAD A;  3C19 A;  3QA8 A;  3NS1 A;  2ZW1 A;  1FEH A;  1WJ6 A;  1WMH B;  2BQQ A;  1N63 A;  3B0A A;  2LJ5 A;  5BO4 B;  1L0V B;  3N3K B;  4N58 A;  4ZOH C;  1WXM A;  3P42 A;  3X23 A;  1D4B A;  1I7H A;  5EE3 A;  4YXD B;  3JSV A;  5L83 A;  2DYB A;  3BZD B;  4F8C B;  2MRP A;  3U7Z A;  4HKQ A;  4FA6 A;  2O2V B;  3FIL A;  2AEH A;  1X1M A;  2CU3 A;  2IO1 B;  1WM2 A;  4MGZ E;  4P6V F;  3ZNG C;  4L23 A;  2INN E;  3ZO5 B;  5E6P A;  2PEA A;  5D2M B;  2L7R A;  1F52 A;  2EKI A;  4GLS C;  2JXX A;  4MH8 A;  2PE6 B;  1MVK A;  1NVI D;  3SFD B;  2WXO A;  1N61 A;  5DPW A;  3KVF B;  4LJO B;  2BW2 A;  4WAF A;  3ONS A;  2BS4 B;  5IOI A;  4LCD E;  5AUI A;  4W9K A;  1KM7 A;  1E9M A;  1Q1O A;  3EUB 2;  1I4H A;  1KLG D;  5IKC M;  1AAR A;  4GSW A;  3DCG A;  1PDX A;  2MW5 A;  3VTV A;  1TS4 A;  1UGM A;  1SIJ A;  3DWG C;  2RGF A;  4ZRJ A;  3VTW A;  3DBS A;  3EFC A;  2XK5 A;  5BYQ A;  1L6U A;  2FUH B;  3T8M A;  2V4I B;  4K7W A;  4E3C A;  1YIW A;  1XT9 B;  5CHW A;  1L0X B;  2ZEQ A;  4IUM B;  2NS5 A;  2VH1 A;  3AE8 B;  3W1Y A;  3VUY A;  3PZ7 A;  2LVQ A;  3AMZ A;  3NJT A;  1V5O A;  4B0M A;  1ZP0 B;  4E71 A;  3OAW A;  1EF5 A;  3NZS A;  1PGB A;  2FE8 A;  3Q14 C;  3ZJV A;  2XN9 C;  2GOW A;  1E8X A;  2WXK A;  4M02 A;  2I1K A;  2EKE C;  1YN3 A;  3TIX A;  2J53 A;  2CS4 A;  2ZZP B;  4WWM A;  5HI1 A;  1GAQ B;  2ACZ B;  1SIF A;  3QAR A;  5IP4 D;  2KN5 A;  3PO0 A;  1ACC A;  3ZNZ B;  1ENF A;  3EGR A;  1ZE3 D;  2WXJ A;  4W9G A;  3RFZ B;  4LJP B;  3TEY A;  2RD0 A;  3UIO B;  3BVZ A;  1FFV A;  4NJ7 A;  1CMX B;  4C7Z A;  3PS6 A;  3PPA A;  4PYZ A;  2DZI A;  2GBR A;  3J9C A;  3TUO A;  4FHK A;  1WX8 A;  1YNT E;  1AYF A;  5LLI A;  4DHZ E;  1RM6 C;  3I63 C;  3AXC A;  4XE0 A;  5D3D A;  1EU4 A;  2JWU A;  3WAN A;  2BF8 B;  3W5V B;  2K0P A;  2LHE A;  3AE2 B;  4HKZ E;  4XDC A;  3TBL D;  4W9C A;  1TZ1 A;  4BZA A;  1E7V A;  4REZ A;  2KDE B;  1IP9 A;  1UD7 A;  2LRU A;  4MM3 A;  1L4D B;  3N32 A;  4RH6 A;  1TJE A;  3PVL A;  3VFK A;  2MCN B;  1NI2 A;  1XCQ L;  1E8W A;  4YWG G;  2KDM A;  1KFY B;  4IW0 A;  3CMM B;  2HTH A;  1YJ1 A;  2LXC A;  2KFJ A;  4C4V B;  2KDI A;  4FXC A;  1TIF A;  2LUM A;  2LJI A;  4MEL A;  4ITK A;  2LGX A;  2IZV B;  1WGG A;  2LZ6 A;  3C8Y A;  1KRH A;  2EEL A;  3RI7 C;  1WGD A;  2R61 A;  2K8B A;  3EC8 A;  2UU7 A;  1FNV A;  3WAL A;  1ROE A;  2HD5 B;  4BKT A;  2KAC A;  1D5Z C;  2KC1 A;  4DHZ B;  1E8Y A;  2K39 A;  4AWJ A;  1YD8 U;  1KF6 B;  3H7P B;  2BVC A;  2IO2 B;  3AEF B;  1WR6 E;  1WH3 A;  4IOI E;  3N1X C;  2K3U A;  1D5M C;  3Q3J A;  4MGI E;  4IM2 A;  4GIV A;  3H7S A;  4N9F 4;  5BMH A;  3AH7 A;  1QZE A;  2JX5 A;  1WYG A;  3DBR I;  2JQR B;  3T3N A;  2ONQ A;  4ANX A;  2YEP F;  5AZG A;  4A55 A;  1WSP A;  1KOT A;  4CHK A;  2CU1 A;  1DOY A;  2KX0 A;  1V80 A;  3RCZ A;  2PW9 A;  3MJW A;  2INC C;  3PT2 B;  2NCN A;  1QT9 A;  1TT5 B;  4ARC A;  5DPR A;  3ZDT A;  1JRU A;  1HTQ A;  2ZJD A;  1YQ4 B;  2PPH A;  4KVG B;  2VH2 A;  4C7Y A;  3QC8 B;  4LTU A;  4NAW B;  3H9D A;  2WWZ A;  3CSF A;  2KTR A;  3SD5 A;  2IND C;  1C79 A;  2Y5C A;  3RYT A;  4NAM A;  1KLV A;  4CO7 A;  2M19 A;  5JHB A;  3DBL I;  1T0Q C;  1FO4 A;  3AEA B;  4BAX A;  4AJY B;  5IAA C;  1FCL A;  2KMC A;  4NJ6 A;  1P7E A;  1GPX A;  4PT5 A;  4B0E A;  4C80 A;  2CJO A;  5AZH A;  2GI9 A;  3AN1 A;  4WQM A;  4DHJ D;  4PS7 A;  5DCN A;  1FCC C;  2BGF A;  4NPN A;  1VCB A;  2QSD A;  5I4D A;  4P16 A;  2NR2 A;  1IPG A;  2M0A A;  1NDD A;  1EU3 A;  2MBB B;  4HLE A;  4MGK E;  1MG4 A;  2REX A;  5DPS A;  1V86 A;  3ZNH B;  2K9X A;  4AUQ C;  1ESF A;  2O6V B;  3A9J A;  3HRD D;  2H89 B;  3PRZ A;  1QQR A;  3AI5 A;  5C1Z A;  2N0S B;  1E10 A;  1HXY D;  1HA5 A;  2LEK A;  1TY0 A;  4ASW C;  3NVW A;  1UBQ A;  4EKU A;  1P98 A;  2JVC A;  3PHW B;  4KV2 A;  2G9H D;  2WXN A;  3SEB A;  1FXI A;  2M0X A;  2W3S A;  3MP9 A;  1XD3 B;  4KSL C;  4X57 B;  1FNU A;  5D94 A;  4QAY A;  1P3Q U;  3AE6 B;  5JH5 C;  4BBN F;  1DGJ A;  3L54 A;  3RT3 B;  2KWC A;  4FHJ A;  3NS8 A;  5JXV A;  2UWQ A;  2H88 B;  2MBO A;  5EE9 A;  3IVF A;  4AQ7 A;  4WQO B;  4YTN B;  1WE7 A;  2KZR A;  2PVG C;  1FPY A;  1TY2 A;  4YL8 A;  1L0Y B;  2SEB D;  2DZK A;  5D6J B;  1I4G A;  3DVG X;  2QCZ A;  4DWF A;  4HWI B;  1C3T A;  5IN7 A;  1N5X A;  4MJS B;  4LNF A;  3VVW B;  1ZGU B;  4B9K A;  1FNW A;  2PVO D;  4BOS C;  1D5X C;  3VTU A;  2VRR B;  2MWS B;  2DZM A;  2FAZ A;  4BBN C;  1QKZ A;  4GDL B;  1H8C A;  3ALB A;  1XLN A;  3QWZ B;  2WXR A;  2WX0 A;  2WU5 B;  1LM8 B;  2AX5 A;  3N9Y C;  4WAA A;  2GB1 A;  1JAL A;  3KQ4 A;  4D2K A;  2J4X A;  2BS3 B;  2W3R A;  2MSE D;  4NQK E;  3VR8 B;  3ABV B;  4AP4 C;  5BYR A;  4I6P A;  5KHO A;  1V49 A;  4IC7 B;  2WDR B;  1LO5 D;  4PS3 A;  3FC4 A;  4DQO C;  5L95 C;  2NBW B;  1WY8 A;  3U8Z A;  1VRA B;  1JML A;  2RPQ A;  2L0T A;  4CQN A;  3BVG A;  2NTT A;  2V4L A;  5MPO A;  4XYC A;  4B6W A;  3HUI A;  1T0Y A;  3QK0 A;  2FCM A;  2J52 A;  3PZD A;  2B76 B;  4GGQ A;  2PIA A;  2LWP A;  1WZ3 A;  3WIM A;  2NBU A;  4BOZ B;  2NPT B;  1STE A;  3QIJ A;  3DBH I;  3RNE C;  2D5G A;  1MI0 A;  2NVU I;  2WXP A;  3NZU A;  4IWQ A;  2V9H A;  2CKH B;  2WDQ B;  2V3P A;  3V05 A;  1C77 A;  2ASQ A;  1SGH A;  4WJQ A;  2YLM A;  2GLS A;  1V8C A;  2IY1 B;  2D11 A;  2WDT B;  4W9F A;  1V97 A;  2ZVO A;  5H8Y E;  3N1Z C;  2KK8 A;  2K22 A;  2CHW A;  4O1N A;  2MHJ A;  1ZXI A;  4DDI D;  3NOB A;  3AE4 B;  1SBB B;  3DDC B;  3ENE A;  4KDI C;  3AB5 A;  1SE9 A;  1HEZ E;  2KAJ A;  3U7D A;  3ZUN A;  1QLB B;  1JWB D;  1ET9 A;  1RYJ A;  2ZNV B;  3SU8 X;  4ACF A;  3OJ3 A;  3PRP B;  2M4N A;  3ZLZ A;  1TKE A;  2IBI B;  1F2R C;  2RDH A;  2Z8L A;  5EE1 A;  3WAM A;  2QIE B;  2XBB C;  3NG0 A;  1GC6 A;  1OQY A;  1XXG A;  3U2S C;  2JXT A;  1OGW A;  2W55 A;  3P2B A;  2QDF A;  1E90 A;  2WU2 B;  1R4N I;  1JWM D;  1V81 A;  3RZW C;  1SJH D;  2AWT A;  5CHV C;  4LNI A;  3ZTC A;  5HKH A;  1TKG A;  4KZC A;  4WWO A;  2N9P C;  1R4M I;  1WJN A;  3HM3 A;  2WYQ A;  3RN9 C;  3ZQ4 A;  4GB9 A;  1ZKH A;  5CHF A;  3JSV B;  1RFA A;  1BT0 A;  1Q5W B;  2JWZ A;  4Q2J A;  2J7Q B;  2KD0 A;  2L0F A;  4W9E A;  2M8S A;  3SHQ A;  1E7U A;  1TS2 A;  3FIL B;  4P1B C;  2BKF A;  3LJ3 A;  2DNF A;  4LDT D;  3D32 A;  4JQW C;  2RDG A;  1MJD A;  4EZJ A;  2L32 A;  3EA6 A;  1CJE A;  3AEC B;  1F0Z A;  1QOF A;  3EFU A;  5GMV A;  1TZO A;  3L10 B;  2MH7 A;  5J18 A;  3PHX B;  2WGS A;  3MFG A;  1YOV B;  4BFR A;  2RPV A;  1V1P A;  1YX6 B;  4ZRK A;  3VR9 B;  3AED B;  4G50 A;  2LD9 A;  2AYO B;  3L0W B;  2MJE A;  3PV1 A;  3TEZ A;  3AEG B;  4KGS A;  2MJD A;  2PKO A;  5E6O A;  1FXT B;  1CQV A;  3WAP A;  3H1U A;  3RNC C;  4TSS A;  4G0N B;  3MHZ A;  5TSS A;  4HPL B;  3A33 B;  2R2Q A;  2XK5 B;  4UDU C;  2N9E B;  4MT5 A;  1MFW A;  2D2Q A;  3H6N A;  2GBJ A;  2V3S A;  2I38 A;  4ARI A;  1FD6 A;  5D7G A;  3Q8F A;  4GU2 A;  4K81 A;  1M4V A;  4ZYN A;  2WXF A;  2W9N A;  3IG3 A;  2D3B A;  4IM0 A;  4XX5 A;  1J7B A;  4AS1 A;  1WJU A;  1UWM A;  2KVZ A;  4J6I A;  3PRM B;  4WJN A;  4MEM A;  4BVU C;  3DWM A;  4A6Q A;  4HEA 1;  1L2N A;  1DOX A;  2UYZ B;  4P7I A;  2PTL A;  2KKC A;  4A8X C;  3Q3M C;  4ANU A;  2BS2 B;  2J0M A;  1E8Z A;  3PLV A;  1J19 A;  2IGH A;  1XLQ A;  2C7H A;  2N1W A;  4JIO U;  1NYQ A;  1K51 A;  1FIQ A;  1OQQ A;  2GBK A;  3MC0 B;  2DYM A;  1HTO A;  4IKG A;  4KIK A;  4W9D A;  1LXD A;  4ZHP A;  1TKY A;  4JE3 B;  3PSE B;  4G11 A;  5FR3 A;  4JX1 C;  2BYV E;  1C78 A;  2Y5P A;  2KLC A;  1B1Z A;  2OJW A;  3TJP A;  1YN5 A;  1KJT A;  4GOC A;  1MG8 A;  4A90 A;  2BWE S;  4GN1 A;  1VZ8 A;  5JHA A;  2D10 A;  1RWS A;  4ZRI A;  4DXF A;  1Q0W B;  3UQA A;  3JW0 X;  2RDB C;  2Y5B B;  1WJ4 A;  4ANV A;  4H2A A;  1OQR A;  1NBF C;  3ZNI D;  1OEY J;  3P63 A;  1WX9 A;  2WXH A;  2WXM A;  4IDI A;  1RAX A;  2PLP A;  4RFB A;  3A1Q A;  4JLC A;  2QC8 A;  2V3N A;  1WGY A;  4MM3 B;  1F77 A;  4DXA B;  3APF A;  1ZXH A;  2JYT A;  1I35 A;  3P4P B;  3NUH B;  4KDL B;  3FAH A;  2DZJ A;  4EE2 A;  2MBH A;  3DHH C;  1TYG B;  2WXI A;  2MJ3 A;  1FMA D;  2AL3 A;  1WZ0 A;  2LGY A;  3I5J C;  3AM9 A;  3HM6 X;  4MDK E;  3TEX A;  1J0G A;  4HCP B;  1V1O A;  1ISN A;  2LVP A;  3PTF C;  1LQB A;  3W5U B;  3UI3 A;  4DK5 A;  2ZCC A;  2Z0D B;  4WWP A;  4F7Z A;  2PMV A;  1G6J A;  2MP2 A;  4ANW A;  3U4E G;  4ZDV A;  1WGK A;  2HTM E;  1UZX B;  2HJ1 A;  1IUE A;  1NYR A;  3AEB B;  1T6B X;  4PYU A;  3GZN I;  2DHZ A;  3LXF A;  2DBY A;  4M01 A;  3VH3 B;  1GOZ A;  3IBE A;  4NQL B;  1B9R A;  4GMV A;  4CYE A;  3GOE A;  3DPD A;  3QJZ A;  1L7Y A;  4W9I A;  2LUE A;  1J8C A;  2BYF A;  4FN2 A;  4M8N A;  4OVU A;  3SR6 A;  2WLB A;  2W82 A;  1K53 A;  1P0R A;  1EM7 A;  2OED A;  4I6N B;  2I1J A;  2KTF A;  3OG5 A;  1F9J A;  4OVZ A;  1WF9 A;  4MSM B;  2JF5 A;  1N62 A;  2N9L A;  4YSY B;  2OOB B;  2D07 B;  3RD2 A;  1GNU A;  3AE5 B;  3DHG C;  2OJR A;  1R4M B;  1T0R C;  2JU6 X;  3KUD B;  1K8R B;  1TGZ B;  3H8H A;  2Z0E B;  1P1A A;  2K8C A;  3VRB B;  4EZL A;  4RGM A;  3T3O A;  3B08 A;  2KWD A;  2KTR B;  4MSQ B;  2OHF A;  3Q69 A;  5AZF A;  3MC8 A;  4AOF A;  4EZK A;  3IXS A;  2PJH A;  3R3M A;  1MPE A;  2JRH A;  1SXT A;  3V6C B;  1RFK A;  1IBX A;  3M63 B;  3AUL A;  3VXW A;  3GS2 A;  3AE7 B;  3L4P A;  3VAW A;  3Q2A C;  3DVN V;  1WGH A;  3Q8A A;  2XNA C;  3U52 E;  3GP7 A;  2GBM A;  2AQ3 B;  3UGB B;  2ZPY A;  2WX1 A;  2MQJ A;  1A5R A;  1UNS A;  2I2Y A;  3A9J B;  4MGY E;  2D3C A;  3KLS X;  3AV8 A;  4HRO A;  3RMK C;  1Z5S B;  3KW5 B;  3PZ8 A;  3N30 A;  4W9L A;  3NZ3 A;  2JSV X;  3ZW3 A;  3NVZ A;  3KWL A;  2IGD A;  2KFK A;  3V60 A;  4M0W A;  2ZNV C;  1UEL A;  5G5H A;  4XGA B;  3P4S B;  4ICU A;  2JY6 A;  4RGT A;  2BPS A;  3RUL A;  1C1Y B;  2G4D B;  4OHJ A;  4K3C A;  1C9F A;  1LGR A;  2JPH A;  1WM3 A;  4HCN B;  1C4C A;  2DAF A;  2JZ3 B;  5C3J B;  3ZXR A;  1YQB A;  1V5T A;  4HDO A;  1GUA B;  1VR9 A;  1T5X D;  4NJC A;  5LNK 1;  1RRB A;  1YJJ A;  1MHX A;  3C0R B;  1WX7 A;  1WXS A;  1H4R A;  4NNJ B;  3TL5 A;  4LDT B;  3HVZ A;  3KH0 A;  1XF5 L; 
#chains in the Genus database with same CATH homology
 4RMA A;  1Y8R C;  4FJY A;  2G3Q B;  4W9G A;  3WAM A;  2XBB C;  4LJP B;  2LVO A;  4IWO A;  2RD0 A;  1GC6 A;  1OTR B;  3B1L X;  3UIO B;  1OQY A;  1OGW A;  1WFY A;  2BKR B;  5TR5 A;  3P2B A;  4FUL A;  1E90 A;  1CMX B;  2KJH B;  4NJ7 A;  1R4N I;  1V81 A;  3PS6 A;  4M8M A;  3PPA A;  4PYZ A;  3RZW C;  2AWT A;  2DZI A;  2GBR A;  4FHK A;  4GDK A;  5CHV C;  4W9J A;  4II2 B;  1WX8 A;  4NAW A;  3ZTC A;  5LLI A;  5HKH A;  4WWO A;  4KZC A;  4DHZ E;  2N9P C;  2EMT A;  3AXC A;  1R4M I;  1WJN A;  3HM3 A;  2WYQ A;  4AJW A;  3S2A A;  4GB9 A;  1ZKH A;  2C7N B;  2FCS A;  5CHF A;  3JSV B;  3VDZ A;  3WAN A;  1RFA A;  1BT0 A;  2BF8 B;  1Q5W B;  2JWZ A;  2R2O A;  3OLM D;  2J7Q B;  2KD0 A;  2L0F A;  3ML8 A;  1I42 A;  4ICV A;  2C9W B;  4W9E A;  2KVR A;  2M8S A;  3SHQ A;  1E7U A;  1UH6 A;  1S1Q B;  3TBL D;  4EEW A;  2BKF A;  3LJ3 A;  4XZ4 A;  4LDT D;  2N7D A;  2KHW B;  4W9C A;  3D32 A;  1TZ1 A;  4JQW C;  3PLU A;  4K7S A;  1E7V A;  1WI0 A;  4K7U A;  2KDE B;  2MA9 B;  4EZJ A;  1Z2M A;  1IP9 A;  1UD7 A;  2GBN A;  2LRU A;  4A3O A;  2K6D B;  4MM3 A;  2MBQ A;  1WGR A;  3M62 B;  2D3G A;  4KZ0 A;  3EFU A;  3N32 A;  3OJ4 B;  5GMV A;  3VFK A;  3L10 B;  3APD A;  3PVL A;  2MCN B;  2PE9 A;  5G55 A;  2KWU B;  1NI2 A;  2LAS A;  3PHX B;  5J18 A;  3LDZ E;  1E8W A;  5DPT A;  4WJO A;  3JVZ X;  4IW0 A;  2N7E A;  3CMM B;  2HTH A;  1GC7 A;  1YJ1 A;  2LXC A;  4BFR A;  1YX6 B;  1WRD B;  4ZRK A;  2KFJ A;  4DBG A;  3CST A;  2KDI A;  3QCA A;  2C5L C;  2O6V A;  3A4R A;  4G50 A;  2LD9 A;  4WJP A;  1EO6 A;  2AYO B;  2Z59 B;  4MEL A;  3L0W B;  3UIP B;  2KOX A;  3PV1 A;  2KMA A;  3DQV A;  2KNB A;  2KX3 A;  4MH0 E;  1V9J A;  2IZV B;  2LGX A;  4HK2 A;  5E6O A;  1WGG A;  4B95 A;  2LZ6 A;  2K8H A;  1FXT B;  2BYE A;  3R7Q A;  3V6E B;  2ZPN A;  3WAP A;  2KC2 A;  1WGD A;  4HJK A;  3H1U A;  3KUC B;  2K8B A;  3EC8 A;  2A4Z A;  3HK0 A;  3PRE A;  3WAL A;  4G0N B;  2HD5 B;  4BKT A;  4HPL B;  3A33 B;  2R2Q A;  2KC1 A;  4IG7 B;  4DHZ B;  4NY0 A;  1E8Y A;  2K39 A;  5FR6 A;  4AWJ A;  2DAJ A;  2XK5 B;  1YD8 U;  2KFK B;  2N9E B;  3H7P B;  3QHT A;  4XC2 A;  4M0W B;  3UIN B;  2D2Q A;  5CX3 A;  2IO2 B;  3H6N A;  4JGH B;  2GBJ A;  2K6Q A;  1WR6 E;  1WH3 A;  2V3S A;  2XEW A;  2NBV B;  3A4S C;  2L05 A;  1XQQ A;  3HHM A;  1WYW B;  2LGD A;  3A9K A;  5D7G A;  4GU2 A;  4K81 A;  2L00 B;  3Q3J A;  1VD2 A;  4MGI E;  4HDQ A;  4ZYN A;  4IM2 A;  2W9N A;  1U4A A;  3IG3 A;  4GIV A;  2FIF A;  4IM0 A;  5J2R A;  4XX5 A;  3H7S A;  4N9F 4;  3DVN U;  1QZE A;  1E5W A;  3DBR I;  3ML9 A;  1WJU A;  2HE7 A;  4J6I A;  2KDF B;  3PRM B;  2O6V D;  4MEM A;  4WJN A;  2DEN B;  4BVU C;  4ANX A;  1L2N A;  3Q3F A;  5AZG A;  5LXI B;  1S3S G;  2UYZ B;  3IFW B;  4P7I A;  4BKS D;  1TTN A;  1KOT A;  1EUV B;  2KKC A;  4MJS A;  4CHK A;  4GXB A;  3W1S A;  2CU1 A;  1EF1 A;  4ANU A;  2J0M A;  1E8Z A;  1WIA A;  2KX0 A;  1J19 A;  1V80 A;  3PLV A;  3RCZ A;  2C7H A;  2N1W A;  4JIO U;  3MHS D;  3MJW A;  3M3J A;  4FBJ B;  1LFD A;  2GBK A;  1V6E A;  1WMH A;  3PT2 B;  2DYM A;  3TCA A;  2NCN A;  2N1V A;  3VUX A;  4KIK A;  4W9D A;  1LXD A;  2KQS A;  1PQS A;  3ZVV A;  5IA7 A;  4GDL A;  5DPR A;  3ZDT A;  1JRU A;  3PSE B;  3V61 A;  2ZJD A;  4FJV B;  4G11 A;  2BYV E;  2JUO A;  3I3T B;  4TQ0 A;  3ZRF A;  5JZE B;  2IY0 B;  3ECI A;  4G3X B;  2KLC A;  3O65 B;  2PPH A;  4GDK B;  4KVG B;  3TJP A;  1KJT A;  3QC8 B;  2CHZ A;  3PGE A;  3DVG Y;  4NAW B;  1IYF A;  4GOC A;  1MG8 A;  4FLH A;  2J0K A;  3H9D A;  3QAQ A;  2BWE S;  2WWZ A;  3DOW A;  4GN1 A;  4TV3 A;  5JHA A;  2L8J A;  3CSF A;  2KTR A;  2QHO A;  3SD5 A;  4IWP A;  2DX5 B;  5EDS A;  4EOY A;  2FID A;  2FCQ A;  3RYT A;  2D10 A;  2MLB A;  2N4F A;  2O2V A;  1KLV A;  4ZRI A;  4CO7 A;  1GJZ A;  4KSK C;  1Q0W B;  4JL9 A;  3UQA A;  1UBI A;  2BWF A;  3JW0 X;  5JHB A;  4EUT A;  3DBL I;  2Y5B B;  4PS8 A;  1WJ4 A;  4II3 B;  4ANV A;  4AJY B;  2IO0 B;  1NBF C;  5IAA C;  1D3Z A;  3ZNI D;  1OEY J;  2EMS A;  2KMC A;  4NJ6 A;  1WX9 A;  4HXD A;  3BIN A;  3L08 A;  1RAX A;  3A1Q A;  4JLC A;  5AZH A;  1WGY A;  4DXA B;  4DHJ D;  2LXA A;  4PS7 A;  5DCN A;  3VH4 B;  3APF A;  2BGF A;  4NPN A;  1M94 A;  1TBE A;  1VCB A;  1I35 A;  2DYO A;  3WAO A;  3QX1 A;  2NR2 A;  1IPG A;  4KDL B;  5AEK B;  1NDD A;  1ZW7 A;  2DZJ A;  3WA0 A;  2MBB B;  3KYC D;  4HLE A;  2MBH A;  4MGK E;  2NPT A;  2LI5 A;  2A5U A;  2REX A;  5DPS A;  3KYD D;  2GMI C;  1V86 A;  2AL3 A;  3ZNH B;  4AUQ C;  1WZ0 A;  3A9J A;  2O6V B;  2KWV B;  2LGY A;  4MDK E;  3HM6 X;  3ZRC A;  1J0G A;  3M95 A;  4HCP B;  3ZDM C;  4EFO A;  3K9P B;  4W9H A;  1ISN A;  2LVP A;  3PTF C;  1LQB A;  3PRZ A;  4I6L B;  4TKN A;  3AI5 A;  4DK5 A;  5C1Z A;  2ZCC A;  3RZF A;  1WXA A;  2Z0D B;  4WWP A;  4F7Z A;  4RM8 A;  1G6J A;  3RUI B;  2FCN A;  2JRI B;  2MP2 A;  4ASW C;  4ANW A;  4TUU A;  4ZDV A;  1UBQ A;  1UZX B;  2M1M A;  5J17 A;  4EKU A;  4A3P A;  1P98 A;  2FNJ B;  2JVC A;  3PHW B;  4KV2 A;  4PYU A;  5E6N A;  3GZN I;  2DHZ A;  2M0X A;  4KSL C;  1XD3 B;  4X57 B;  5D94 A;  3EEC A;  2RSU A;  3VH3 B;  4E74 A;  4OVV A;  4IM3 A;  3R7R A;  3SDL C;  1P3Q U;  3IBE A;  2KO3 A;  4NQL B;  4K1R B;  5JH5 C;  4BBN F;  4GMV A;  3A9K B;  4CYE A;  3L54 A;  3RT3 B;  4WWN A;  2KWC A;  3GOE A;  2L3Z A;  4FHJ A;  2CHX A;  3DPD A;  3NS8 A;  4TQ1 A;  1P9D U;  3QJZ A;  1L7Y A;  2UWQ A;  4W9I A;  3VHT C;  2G45 B;  2LUE A;  2MBO A;  3T9L A;  3IVF A;  2IO3 B;  2MBE A;  4WQO B;  1J8C A;  1WE7 A;  2BYF A;  2C7M B;  4FN2 A;  1WXV A;  2KZR A;  4M8N A;  4OVU A;  1WE6 A;  3VQI A;  2MX2 A;  1GG3 A;  4YL8 A;  1P0R A;  5CTR C;  2KJR A;  2ZVN A;  4BKG A;  2DZK A;  4I6N B;  3L17 A;  2I1J A;  3DVG X;  5D6J B;  2V1Y A;  5LXH A;  2KTF A;  4DWF A;  4HWI B;  3K9O B;  1C3T A;  3TMP B;  1F9J A;  2IYD B;  4FAD A;  3QA8 A;  3AU5 A;  4MJS B;  1WF9 A;  4MSM B;  2JF5 A;  3VVW B;  3JYU A;  1ZGU B;  4B9K A;  2OOB B;  2D07 B;  1WJ6 A;  3RD2 A;  1GNU A;  4BOS C;  3VTU A;  2VRR B;  2K1F A;  4DHJ B;  2MWS B;  2OJR A;  1WMH B;  3ZKJ C;  2DZM A;  2FAZ A;  3AU4 A;  4BBN C;  4KIK B;  4F1S A;  3B0A A;  2LJ5 A;  3KUD B;  3R66 C;  4GDL B;  1H8C A;  1K8R B;  1TGZ B;  3ALB A;  3L13 A;  5BO4 B;  2Z0E B;  3UQB A;  3N3K B;  4URK A;  2K25 A;  3ZTD A;  1WXM A;  3X23 A;  3QWZ B;  2WX0 A;  1P1A A;  2G4S A;  3NHE B;  2K8C A;  3JSV A;  4EZL A;  1LM8 B;  4WAA A;  1V2Y A;  5L83 A;  2B3A A;  2DYB A;  3B08 A;  4F8C B;  2MRP A;  2JZZ A;  3VUW A;  2KTR B;  2YVC A;  4MSQ B;  4FA6 A;  2MSE D;  5AZF A;  4AOF A;  4EZK A;  4NQK E;  2O2V B;  3IHP C;  4AP4 C;  2AEH A;  1X1M A;  2IO1 B;  3HIZ A;  1WM2 A;  4MGZ E;  2M17 A;  2KAN A;  2PJH A;  4I6P A;  5KHO A;  1V49 A;  4IC7 B;  3R3M A;  3ZNG C;  3ZO5 B;  5E6P A;  4FJZ A;  2JRH A;  2PEA A;  5D2M B;  2C60 A;  2KQ7 A;  2L7R A;  4PS3 A;  5L95 C;  2NBW B;  3V6C B;  3BY4 B;  2JXX A;  1WY8 A;  2PE6 B;  3AUL A;  3L16 A;  3M63 B;  3VXW A;  3APC A;  3U8Z A;  2RPQ A;  3ZIM A;  4A20 A;  3UF8 A;  2L0T A;  3A1Q B;  2V4L A;  2KJ6 A;  3KVF B;  5DPW A;  4B6W A;  2J0J A;  4LJO B;  2AL6 A;  1T0Y A;  3VAW A;  3QK0 A;  2FCM A;  3PZD A;  4GGQ A;  5C23 A;  3ONS A;  2LWP A;  4LCD E;  3DVN V;  1WZ3 A;  3WIM A;  4W9K A;  1KM7 A;  1WGH A;  2NBU A;  4BOZ B;  1Q1O A;  2NPT B;  2GBM A;  3UGB B;  3QIJ A;  1RLF A;  2ZPY A;  3DBH I;  2WX1 A;  2MQJ A;  1AAR A;  2RR9 A;  4GSW A;  2HJ8 A;  1A5R A;  2KLG A;  3DCG A;  3A9J B;  4MGY E;  3V62 A;  2LRW A;  2NVU I;  2KDB A;  3NZU A;  4IWQ A;  4BKS A;  2CKH B;  1Z5S B;  2KXJ A;  2MW5 A;  3VTV A;  3KW5 B;  4HVB A;  3N30 A;  1UGM A;  4W9L A;  2ASQ A;  3ZW3 A;  2RGF A;  5KHQ A;  1SGH A;  4WJQ A;  3X0W A;  2YLM A;  4ZRJ A;  3VTW A;  4HPM B;  3DBS A;  2IY1 B;  2MP2 B;  2D11 A;  2KFK A;  2XK5 A;  3V60 A;  3H7P A;  3W1S C;  2FUH B;  2WDT B;  2ZNV C;  4W9F A;  3T8M A;  1UEL A;  4K7W A;  2ZVO A;  4E3C A;  2KK8 A;  1YIW A;  4ICU A;  2JY6 A;  1XT9 B;  3NY5 A;  5CHW A;  5G2N A;  2CHW A;  2BPS A;  3RUL A;  1C1Y B;  4DDI D;  3EHV A;  2G4D B;  2ZEQ A;  4IUM B;  2NS5 A;  3NOB A;  3W1Y A;  3VUY A;  2JPH A;  1WM3 A;  4HCN B;  2DAF A;  4DDG D;  2JZ3 B;  2LVQ A;  1V5O A;  3DDC B;  3MTN B;  3OAW A;  1EF5 A;  4E71 A;  1YQB A;  3NZS A;  3ENE A;  4KDI C;  4RM9 A;  1V5T A;  4HDO A;  1SE9 A;  3U7D A;  1GUA B;  3ZUN A;  2GOW A;  1E8X A;  2I1K A;  3U30 A;  2ZCB A;  1YX5 B;  1WR1 A;  2EKE C;  1RRB A;  2N9X A;  3QQ8 B;  2ZNV B;  3C0R B;  3KUZ A;  3SU8 X;  3TIX A;  1OEY A;  2CS4 A;  2ZZP B;  3OJ3 A;  3PRP B;  1WX7 A;  2CR5 A;  2M4N A;  1HE8 A;  3ZLZ A;  1WXS A;  2L76 A;  1SIF A;  1H4R A;  2IBI B;  3CF6 E;  3QAR A;  4NNJ B;  3TL5 A;  2KN5 A;  4LDT B;  3ZNZ B;  3KH0 A;  2JT4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...