1R4QB

Shiga toxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Shiga Toxin Type 2 (Stx2) from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Shigella dysenteriae
molecule tags Toxin
molecule keywords SHT cytotoxin A subunit
total genus 18
structure length 69
sequence length 69
chains with identical sequence C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2003-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1r4qB00
1C4QA 1D1KA 3MXGA 1QNUA 1CZGA 2XSCA 1CQFA 1DM0B 1R4PB 1QOHA 1CZWA 1R4QB 1C48A 1BOSA 2BOSA 4P2CB 2C5CA 4ULLA 4M1UB 1D1IA 2GA4B
chains in the Genus database with same CATH superfamily
2BH2A 4RGNA 2RCNA 3GD7A 2M00A 1A3UA 3D4WA 5EPLA 1WTXA 4OO1G 4A3FH 4UDUC 2UUAQ 1F9QA 1I4HA 1ZKOA 2VZAA 4Y7NH 3HOZH 4AYBB 1S5DD 3EBEA 4IUUA 4UP9A 1YZ6A 1Z7TA 1HR0L 3FDTA 4O0AA 2RQXA 1I50B 1VQBA 1WFQA 3J81j 2N49A 3L3OC 2KHJA 4XTCS 5C44G 2Y0SG 3PMFA 3SR1A 1RD9D 4K8JA 5NUCA 3PF5A 2FINB 1QG7A 2NTSA 3F2BA 1WTOA 2MJ8A 5G3LF 3R8BA 3EFXD 1S72A 1PRTD 5IY0A 1HR0Q 1PMRA 4H7BA 3GTLH 4QIWE 3RZOB 1PFMA 3TP8A 4UP7A 2A6EC 1K8GA 3KF8B 4RKBA 5HURA 1SE4A 5C4JB 3HOWG 2Z4IA 4HJAA 1EYCA 4CKBA 2IX1A 4BS9A 4GN4B 2G9HD 4A3BH 3UDFA 2Q8IB 2XNAC 4AYBE 1V8QA 2B63B 3CPFA 1F9PA 1L0YB 1TXYA 3PIO3 3BYYB 4RFBA 1RIPA 4OX9Q 2UUAL 4C3HG 2CHBD 5LL6X 4B3ML 2EQSA 2L5TA 1Q81C 4RCNA 1SNPA 2F4VQ 5CV6A 2XGTA 5E4WC 1PV4A 4XT3B 2D0OA 2X69A 1B53A 1JJGA 1XTCD 3N52A 3KOJA 1EU3A 5T1GA 3OPOA 3HKZB 2QKIC 1XJVA 3OWEB 2R61A 3QIAA 2NVXH 1ILQA 2EY2A 3OW7A 5EGTA 1I6VC 3S17H 3J80c 1FJGQ 5FO7B 1PZID 4A93H 3U4ZA 5A2QE 4DV2L 4XQNA 1C48A 1EU4A 1GM5A 1FD7D 1SMYD 1G291 1I94L 5ELEA 1VQHA 4TVAB 1GVPA 1SRUA 1SYBA 5IGDA 1CKNB 2JA7H 2BDOA 3J7A5 1PTOD 4HJ5A 1NY4A 1F2ZA 4LW1A 1DD2A 1VMPA 2HIVA 4ALPA 2BDNA 4U68A 3BZCA 4LF7Q 3D8GA 1IBML 4X64Q 4OXPA 4DUYQ 2EY6A 4GOPB 1I94Q 1II3A 2AKWB 1PRTC 2NVYB 2R93G 3CC4A 3I90A 3HP3A 4JI7L 3OWFA 2B2VC 5D3DA 1JORA 4PG3A 5FLMG 1P16A 1KHIA 3E0EA 3S9WA 1LUZA 3MTSA 2LXKA 3J7AV 1ML0D 3CMEA 1I3QB 2ZTDA 1CM9A 1SFOH 3MA2B 1CTMA 3GTOB 5EKKA 3PO2G 4BXXH 4DV3L 2D5DA 4UY8C 1QJOA 3AYHB 1SYEA 5ISRA 3K7AB 1KTKA 2F3VA 2OXPA 3HS0C 4OO1H 1E2ZA 4A3FG 4G7HC 2PMZB 3MXGA 1STEA 1CKNA 4DK3C 1V1QA 4DV4Q 2PNRC 1VQCA 2HDMA 2K33A 1FNUA 1HZCA 1JC7A 3FVQA 4HSVA 2ID0A 1EYGA 4ID6A 2VQEL 2DNEA 1H9MA 3T53B 2M2LA 2WKDA 2NVTH 3K5MA 4PMBA 2EE1A 1I4XA 5CV4A 1IYVA 4H13C 3K5LA 4XDXA 4DV1L 3S1MB 1YVCA 2O4XA 4BBSH 1LTBD 4DF7A 3DMUA 4M8AA 1XNQQ 4Q5VA 4O2DA 4LFAL 1SMYC 4XQQA 3H09A 1AW7A 2KJXA 4WRDA 3JAML 4A93B 2NWGA 4LFBQ 1K3RA 3QWNA 5CGKA 2X6GA 3TZUA 1TR5A 1X56A 3BS1A 3TQYA 2MUYA 3RZDB 4IFDI 4KKSA 4C3IB 3VA5A 1Q7YC 3GTQH 3VA7A 4BY1H 4EQ5A 3MC0B 2JA8H 3HOVH 3TREA 4JI3L 3DM1A 3I56A 2B8FA 1OO9B 3KF6A 1YBYA 5ELBA 1HJPA 3MXNA 1B44D 5C4ZA 2K01A 2E2DC 4QQBX 1HZBA 3H3VI 5JJLA 1BUVT 1EOVA 1DZ1A 2MQHA 4FF3A 1SJHD 2J4XA 3NENA 3H0GB 4DV3Q 1I3QH 1NUCA 1BOSA 2IX0A 4WJ3M 2JA7G 1LTLA 1GUGA 2SEBD 1EEFD 5I2XA 3KBXA 1TWCB 2EXDA 1WCMH 4JVZA 2NZ1D 3GTPB 1S5CD 1F2LA 3MHBA 5D14A 3TDQA 1SR3A 4QUFA 1D7QA 2QDBA 2Q8TA 5IWAQ 1PH6A 1TWGB 1LT5D 1X3PA 3DM3A 1CK1A 4X62L 2RDHA 1VQ8A 1EFID 1PXUA 2E74C 2K05A 1HTLD 4KN4C 3P75A 2ZTEA 5T1IA 1STGA 2CCZA 2XRSD 1JR0D 3GTGB 2XWJB 4JI8Q 3PSIA 3KJOA 1KNAA 1XNRL 4IFDG 2Z6BA 1Y1WH 3M4OH 3PUVA 1CKMA 1X3EA 2WAQB 4R4OA 1JMCA 5EBDA 1CT1D 4C3JH 1QVCA 3RUZA 4DNRB 1EOTA 2EVBA 1WOCA 3J81L 5M5WH 1O7IA 2B2TA 4JI8L 3NK9A 5FK9C 1K73C 3PO3H 3CCVA 1CA6A 3QOLA 4LF4L 4CDEC 2HCIA 5FJ8H 1TQOA 1CKOA 5H1SE 3G6EA 1NJIC 3K5NA 1TT2A 1LTTD 5KNBA 1PFNA 4Y7NB 1UAPA 3J81i 4B3TQ 1SYDA 1KNEA 5LMNL 4GOPC 1WVLA 2NBFA 2CVRA 2UXCQ 1BNZA 1OXUA 1VQPA 2PMZE 1XPRA 3F2DA 4DUZL 3GTJB 2AMCB 2WKCA 3J7ZC 3DUZA 3I4LA 3CD6A 1IBLL 2GVAA 4P2CB 2QA4A 1RL2A 5AJ3L 3GTMB 4V0BA 3H0GH 2E2JB 1QZHA 1GHKA 3KUPA 1RF2D 2N8NA 3S1NB 1K8MA 1K9MC 4YCVA 1M90C 1ZYRC 3V05A 3HOYH 4LWCA 1IL8A 3AFQA 4YCWA 1GOZA 1A63A 5EPKA 1NR4A 1B4OA 5FKAC 1KAWA 1SNOA 3D6CA 5GROA 1TY0A 2JEAI 3K58A 3A74A 1IKLA 4LF5Q 1STHA 2OTJA 1SXTA 4K5XA 1YNJC 4KY6A 1E24A 3S17B 3O13A 4PV1C 1JICA 1EQRA 3H91A 2I5MX 1A0IA 1BBUA 1Q12A 4X62Q 1JCKB 1LT3D 3EVQA 1NAPA 1KL9A 1KDBA 2K04A 1L0XB 1K8AC 2WV6D 3K59A 3EN2A 3S16H 2Z4HA 4IJHA 5DEHA 1Y1WB 5IYBH 1TWAB 2UXDQ 2JA5G 1XPOA 4HIOA 4DR2L 2ICEC 2B2YA 2F3WA 4J1MA 5CYUA 1WTWA 1QZGA 5EKLA 2MGSA 3NQIA 4DV7Q 4UHVA 1SE3A 4CJ0B 3ICEA 3PUZA 2MP1A 2ATWA 2K5HA 3CW2C 1HNXL 1YEZA 1Y8NB 4RMFA 1BKBA 1N8RC 2F0OA 4GN3B 4BY7H 1XWEA 2UUBL 3VYRA 2DN8A 4HCSA 3H3VH 4LUOA 4NP5A 4IUPA 3KBGA 1TWAH 1NE3A 3S14H 4QL5A 2TMPA 1AE2A 4YWMA 3Q22A 4IOCA 2E5LQ 2AHOB 1NTGA 4CJ2C 4DA2A 3L9AX 4JV5Q 1OXVA 1A2TA 1A3TA 4APVA 5FO9B 4ABNA 1MHWC 1AE3A 2A6HC 3PIOA 1HUMA 1SYCA 3CC7A 2DUDA 1FGUA 4RG1A 2R92G 3CMAA 2SNSA 3PV0A 4I65A 5M5YB 1E3PA 1ESRA 3VYTA 1LTSD 2ENBA 2WP8J 4KLKA 1B3QA 4M1UB 3E5SA 1BVSA 1XXGA 3U50C 4C56C 4A3KG 2SOBA 5M9OA 3T1YQ 3VR3A 1CUKA 4DR2Q 2B2UA 4KK7A 2KCTA 1YNJD 2DY8A 4A3MG 2I0QA 3CXCA 3AB9A 1B9MA 3S15H 4I7ZC 3SK4A 2K50A 3OTOL 4RCOA 4IPCA 2EY1A 4Z9CB 2NVTB 1PA6A 3PIP3 3I4MG 2QW7A 4K0KQ 4HMJA 1N33L 3T51B 4CKCA 1GUSA 1LO5D 4Q0FA 5C5MA 3FMCA 1NMFA 4OL7A 3SXHA 5HGTA 3K80C 2L15A 3IFTA 1QWYA 4DAMA 3I4MB 3H3VC 3U9SA 3PF4A 1LM0A 4OEMB 1N32Q 2ZJPA 4R4CA 1HZ9A 3K7UC 3AQQA 2C9OA 1X3GA 1TS5A 5J1ZA 3S1RH 5KNCA 4DAYB 1I5FA 3PQIA 1K83B 2PCFB 4C3IH 1EY6A 3HG9A 4A3CG 3D3RA 4JI3Q 4LNQA 3RD4A 3GTOH 5EJWA 3BG3A 4H02A 2B63G 1EQVA 1A15A 4A3JB 1B50A 2SDFA 4FXDA 4DAVA 1DGSA 1T5XD 4JI5L 5CC4A 3OOCA 3IRBA 2F03A 3CCJA 2R7ZG 2IJ0A 1QNKA 4A75A 4LF6L 1EWHA 4ILWA 4LJZC 1RKNA 1HZAA 1VQGA 4P73A 5IE8A 4IJLA 4DR5Q 2I07B 4OIJA 4LFCL 4XXEA 1GKHA 1MIUA 2BA0A 5JPNC 4MHEA 4JI5Q 3L7ZC 4DAPA 1KRSA 3JAME 1D2BA 5C3EB 1LACA 2NN6H 1JE4A 5C0XG 4F7XA 1C0AA 4LF9L 2LMCB 2FHTA 3PUWA 1DXMA 3F8TA 5IYCG 2Z6KC 4R4QA 2IW3A 5D3IB 1W3SA 1PYBA 1BR9A 1VMCA 5HY6A 2RCFA 1ESFA 4QJFA 2EOTA 2X6LA 2B29A 2MO1A 4KHZA 1YNXA 2OCEA 2E2HH 1IYJB 4EX5A 2NVYH 4A3LG 4A3GG 5ELDA 1W6KA 1GXDC 2AWOA 1IBMQ 1U5KA 1EFWA 1SN8A 5D65A 4LF9Q 1SBBB 1U4MA 3K7AH 4KY7A 2JA6H 5E7NA 3GO5A 3X3MA 3HOUH 4PMCA 4JI7Q 3BZKA 4DV4L 1TWFH 2R93B 4HEDA 1I4PA 3ITPA 2QDLA 1SFOB 3NPPA 2YTXA 5IGCA 2KEEA 4DR3L 3NUCA 2RSOA 3UDXA 4BBRG 2E2HB 3ULJA 3TP6A 4NXML 1CI3M 4TSSA 5DLQE 2AQ1B 2M9VA 3LNNA 1QNUA 3HOVB 3U58A 3NTHA 2EXZA 1QE6A 1QOHA 1M8AA 2F0MA 1VQ6A 4GKJL 4JI1L 2J7ZA 3S1NH 1EY0A 2UU9L 4OHJA 2XRQD 1EQQA 3QO2A 4H44C 4J8QA 5M3FG 3SK5A 2VL6A 4RWSC 3SVMA 2EYOA 2UXBQ 2NYZD 1B7YB 1HPCA 4ME3A 3RN5A 4LUVA 2HHHQ 3CHBD 3CCLA 2F0JA 1SNMA 5JEAJ 1UE1A 4A93G 3IFDA 2ZTCA 3GTKB 3PIPA 1YITA 3I4NG 3B6YA 2E2IB 1D1IA 1EY9A 1X54A 2GA4B 4L5TA 3HGBA 4HSPA 4JG2A 4JI2Q 2F0NA 5L37A 2WB1B 1STNA 4POFA 1HNWQ 2D62A 1EIHA 4K6LA 4RGOS 4IO9A 3UE1A 3L0OA 1EWCA 3D4RA 3SK8A 4JC0A 2XSCA 4FF2A 2KA7A 4QMGA 3OYYA 1Y1VG 1EZ8A 1N9WA 1FR3A 4JBKA 4C3IG 1QVFA 3MEFA 1O78A 3TS2A 4A3CH 2EJGC 3K5OA 2JJQA 5E4XA 4A3IB 3URYA 4GNXA 5EQ0A 1JWMD 3CCUA 3A5UA 1AZQA 3HOUB 2IPKD 4IALA 4F88A 2CH4A 3C1FA 4QGUA 4CGYB 2F0HA 1C8CA 1G91A 1SNDA 4HJ8A 5IGFA 5C3EG 4FXKC 1EY4A 1X55A 3CRKC 3A8KE 4JYAL 1JOOA 2P5ZX 4IPGA 4P71A 4HIMA 2A69D 3E9IA 2F4IA 1E2VA 4DXGA 2O5IC 1E0BA 4N8X1 3KF6B 4GKJQ 1FNVA 1HNWL 3OSOA 4MN3A 4L5SA 2AWNA 4ZKBB 4QF4A 3JC66 2K5NA 1CSQA 4C3HH 2XIWA 2IX3A 4A3LH 3E6ZX 1TKWB 4KV6A 5M3MG 3DHQA 1G51A 2PQEA 4C3JB 5IOCA 3W1BA 3CF5A 1AP0A 3F2CA 1QUQB 1LV9A 2WAQE 2UUCQ 2K5DA 1WD1A 1XTDA 1VQKA 1A8VA 4O1NA 3S14B 1V43A 5IYDG 2LFNA 5EAYA 2UXCL 2LSSA 1I4GA 1YHQA 5GAHC 1N36L 4LFBL 2OQKA 2ZXRA 5GADC 1V9PA 1VCIA 2R7ZB 1ILPA 4C1NK 1WTPA 5COYA 1RTNA 3NEMA 1C7YA 1LYLA 4TKOB 4DR1L 4JYAQ 3A8JE 4ZCKA 1K3BC 1OTCA 1KDCA 4FVMA 5GAEC 3GTPH 2A74C 2A5HA 2DNCA 1VQDA 1CSPA 3VR2A 1U0LA 2A68C 1VQJA 4TQUS 1PYWD 4DNIA 1MBYA 3I4OA 1X3QA 2XTIA 3I4NB 2Z0SA 2CH4W 3HOXG 1BCPD 3BDOA 2Z6KA 1VQ4A 3S1QH 4GNXC 2KOLA 1Y69U 2D9UA 3OMGA 2EYFA 2KVMA 1V1OA 5ELFA 5CMDA 1VQ5A 3MXNB 1O7LA 4X3UA 4G7OC 1ENFA 2CQAA 3ZJYC 1WTVA 1Z47A 1PTOC 1TS2A 4MIUA 4QB4A 1DM0B 2B8GA 3KDFB 2E76C 3CCEA 1BBXC 2C35B 4N8FA 3SHLA 3MEHA 3M4PA 3PO2H 2I46A 4JBWA 4BXXG 2ZXOA 3A7LA 1LT6D 1PH5A 2JA8B 3GDEA 3LWEA 3ER0A 2F0PA 4G57A 3KLRA 2R93H 4DV6L 5J3BA 3OHXC 3H15A 3CCSA 2PZUA 1Y1VH 1K83H 3F1ZA 1KDAA 2KCCA 3SGIA 1SMXA 3EQLC 3QG1A 2JN4A 4A3EH 4K14A 1CHPD 2A19A 1F9RA 2L4NA 3K81C 1LTAD 3PGZA 3K0YA 1HNXQ 5C44B 1L0WA 2KUMA 2Q2TA 4IUTA 1FVIA 2B39A 3RNUA 3E0JA 5FLXc 1Q3LA 3TMEA 5LHY1 3S2HB 4AYBG 3T1HQ 4POGA 2LY7A 2BE5C 3G7LA 2PI2E 2ICIA 1HR0W 5DM63 1PH2A 2N3SA 2YU9H 5I6WA 4IFDH 1FL0A 2IY5B 4A3GB 5C3EH 3J7AF 1HRJA 2YU9B 2B2WC 4C3JG 4HN7A 4K0KL 2EIFA 1I6HH 3I8ZA 2VQFQ 4BBSG 1CHQD 1UEBA 1OXSC 4K8IA 2EYLA 3UE0A 3J81c 1G2TA 2QILA 4IUQA 3IAYA 4LF8Q 1TWHH 3M85A 1QVGA 2A6ED 4CKEA 5BN5A 1PHJA 5I9OA 5C4XH 4DV6Q 4KMUC 4A3JH 3NWTA 5LL6S 4BY1G 5KYIA 2CFMA 2KEDA 1RDPD 3T4AC 4C3HB 1DJRD 1HA6A 2F0UA 2K5QA 3KFUA 3HOVG 1HQMC 1GD7A 3MZ5A 1BCPB 1DCZA 5FLXL 4XT1B 1GUTA 3OTOQ 1D5XC 1DOMA 1R9TH 2ZM6L 1RCVD 2NTTA 2KHSA 3HKZG 2IL8A 1YHBA 2R3ZA 3AMUA 1JE5A 3K6OA 2VB3X 3Q8DA 1JB7A 3SK6A 4DV2Q 3RMHA 3W2DA 2F1MA 2OT2A 4V190 2PZWA 4JI1Q 4YHHL 2R7FA 2R7DA 4MTKA 2EZVA 1XMOQ 3ND8A 4Y52H 1VQ9A 1VQAA 1BO0A 1ENCA 4DUZQ 2JA8G 4DR7L 1KXLA 2N55A 2E2JH 2KQ3A 1ONLA 4B08A 3WDNA 4LFCQ 4S3SA 4GZYC 1I4RA 4C1NI 5JEAG 4RHSA 5CV5A 3S2DH 1H9KA 1U4LA 3K57A 5ELNA 3HZXA 3BZDB 3R2IA 5C4JH 4K2LA 1HQRD 2HIXA 1V1PA 3CCMA 1TS4A 1G6PA 4HMIA 1JB3A 4DK0A 4JV5L 2H1EA 4IZ8A 2YTYA 1D5ZC 1U4RA 1XMQL 1VF5C 1NNXA 4KI0A 4NW2A 3HOXB 4DR4L 1YJNA 1ZEQX 1KLGD 3I7FA 2F52A 5IT9E 1IW7C 1SDFA 5M5WB 4DV5L 2RDGA 4OX9L 1FNWA 4EQNA 1L1OB 3HKZE 3PUYA 5ELOA 1N34Q 2UXBL 1CQFA 3W1GA 1VQIA 3C3LA 1ZXTA 4JOIA 2VQFL 3C2PA 4HCEA 3PO2B 3ERSX 5IIFA 5JPMC 4YHHQ 1A2UA 2VB2X 2L0CA 1J5EL 5JAVA 2B2TC 2EYMA 4PZ8A 5IP7G 1LT4D 4ZAIA 5K36H 2EYPA 1EYAA 3N6RA 2K52A 4RKLA 2PQAA 4BY7B 4JI4L 1HCZA 4NDXA 2PYKA 4AQYL 4B3RQ 2F0SA 1WD0A 5KIXA 4CJ1B 3HRZC 1DOLA 2B3GA 2NB0A 5E3FA 1EYDA 4KTAA 4GNXB 1GJXA 3TS0A 4ZUJA 3M4YA 5K5PA 2NVQB 3D31A 3FPUB 4KKTA 1SNCA 4DR6Q 5ELCA 4EQPA 3S15B 1WTQA 1SYGA 3G48A 3UDIA 3SEBA 2F4VL 1D1KA 2PPBC 1VQNA 3GTLB 1HA5A 3PO3G 2HDLA 1I4QA 1SE8A 4A3KH 4OWWB 1JWSD 3PO3B 3NXWA 1PDQA 2F0FA 2WFWA 5M5YH 3Q6SA 4YWKA 4OONA 1PTOB 1Y14B 3BYTB 1VF7A 3GV3A 4JBJA 4KD3A 4BBRB 4CBVA 5LMNW 2I5LX 5C4XG 2GVBA 5CV7A 4A3DB 2HD3A 4FO2A 4PQXA 5BN3A 2JEBI 2WINB 3D4DA 3MAQA 4WORA 4RA8A 1LABA 1SAPA 3H0GG 1BCPF 3J80L 1PH9A 1MGSA 4KHPQ 1GUOA 4BY1B 3DEOA 5IWAL 4XYQA 1KAAA 3HOYG 4G7ZC 5BR8L 2RDFA 1EIFA 4JW0A 2HQEA 3S1QB 1T9HA 4PMWA 1K0SA 4K6DA 3NBIA 3I72A 1CFMA 5JVG3 4DXFA 4UP8A 1GUWA 1YJWA 4DPGA 4KKUA 3RR5A 3PCOB 2HQLA 4AIMA 4FP5D 3T13A 1D5MC 1G8ZD 3S2DB 4DGZA 5CBEE 1LLRD 2BE5D 3TSSA 4QUCA 5KRUA 4LF4Q 1EQTA 1Q8KA 2CW0D 4DV1Q 2O2LD 1VDZA 3IKJA 2JA5H 1KRTA 2ALYB 3J80E 2ZT9C 2IT1A 4NMZA 4X66L 1KLUD 4NXMQ 1PH8A 1TVXA 4BWGB 1LTID 4HTHA 1PH7A 2R92H 3CQZB 1TWHB 2NN6G 1XNRQ 4DK6C 4YY3Q 4A3BG 1MSGA 1RTOA 1HFNA 3OIQA 3E9HA 3UDGA 1SSOA 2PI2A 2UU9Q 2E8GA 4GN5A 3BVMA 1PH3A 3GP7A 1BCPC 2NZHA 4KJOA 2B2YC 2YTVA 2WAQG 1BBWA 2Z1CA 1NCVA 2CWPA 2QEXA 1STAA 4CHTB 4MZ9A 3NELA 4B3RL 2JQOA 4CDCC 4IURA 2JA6G 2BOSA 1SYFA 4PZ7A 4NKLA 4MNOA 3ONAB 3FP9A 1ZYRD 2F0EA 1PFSA 5LMNQ 4ZK9B 3SE0A 5FOBB 2ES2A 3I4MH 3WOFA 4IPHA 1S40A 1B70B 2CKZB 4B3SL 4DK1A 1OXXK 4ME5A 3G6JB 1B2TA 4QY7A 1U9RA 3PUXA 3I55A 2K6AA 2NN6I 1HTPA 1B8AA 1VQ7A 2UUBQ 1HUNA 2YV5A 1Q46A 1HH2P 1D6EC 2ZJRA 1E22A 3Q23A 4YCUA 2JP1A 5M3MB 2JSOA 1UNSA 1H9SB 3E3XA 1HXYD 2HUGA 3RLFA 2CQOA 2KENA 1DYQA 1KIXA 1ICWA 4RGTA 4NB3A 3AEVA 1EIGA 4OWTB 3W5OA 1G2SA 4C2MH 1VS0A 3TEHB 4X65L 4RHRA 1Q8IA 2BCOA 1JT8A 1YNNC 3A0JA 1S4ZA 2MPMA 5G3LD 4NPSA 4LUZA 4WFN3 1EY7A 1L1OC 1V1PB 3RZDH 5IGGA 5FLMH 1IXRA 3VDYA 3T56B 1IW7D 1RJTA 3I4NH 5C4XB 2HCCA 3IL8A 1Z6HA 1Z9FA 1X65A 3AU7A 2EYHA 2E5LL 1QB5D 3QJYA 2MNAA 1MSHA 2K32A 1NSNS 2RBMA 3NWSA 2LKVA 5C44H 1CZWA 4YY3L 2HHHL 3SDZA 4A3BB 1N33Q 1X9NA 3QB3A 3BVGA 3HEJA 1YIJA 2AUJD 4CDDC 2KBNA 2FMMA 3C1EA 4AH6A 3TZDA 4IQZA 3FKIH 5A2QL 2KHIA 2WACA 2F0KA 3V96A 2KCNA 2JA7B 3CKIB 4J6HA 4XQJA 4EQOA 5C0XI 4X3SA 3HOWH 5KEEA 1ET9A 5AJ3Q 3CPWA 2F0WA 1YI2A 4E6IA 5C5LA 3OW2A 4QCLA 5I2YA 1L2FA 1BQQT 4DV5Q 1VQLA 1G6ZA 4JI0L 3CU7A 2VNUD 1YNND 1WI5A 4IFDJ 2KECA 2EYJA 2WB1E 4DV7L 1PZKD 1W2BA 2KCMA 1X6OA 3M9BA 4DV0L 4GLAC 1MJEA 3DWPA 1EY5A 1DONA 1TS3A 4X3TA 4JI0Q 2IHEA 3D0FA 1SE2A 1SROA 3HOWB 4IUVA 1JJCB 1X3FA 2VXWA 4L5RC 2JYOA 1JOQA 5M3MH 1MI2A 1ICFB 4WJWA 5EPJA 1S5BD 2RHQB 2CWAA 5C6AA 1T5EA 2BH8A 3NHHA 4X3KA 4ZKCB 3CCRA 3TN2A 5IYDH 1WYDA 3A7AB 3BU2A 1J8IA 1N34L 4R4TA 1P8LA 5FLXE 2Y0SB 1LTGD 3T1HL 1RHPA 1A3VA 4IOAA 3ZYYX 5BN4A 1Q86C 3QOJA 4DKAC 4GOPA 2JXMB 4OIKA 5M5XB 4LF6Q 4KJNA 2ZM6Q 3WWVA 5GQOA 2VW9A 5M3FH 3M3YB 1H9SA 4DFAA 1IBKL 4JI4Q 2AQ2B 1XMQQ 2UUCL 4X65Q 4L8JA 4N9PA 2V1CC 3G71A 1IYUA 2OF1A 4U673 5F2DA 3NE5B 2OTLA 2PW7A 1GO3E 1K8OA 3V2TA 3Q0AA 3NQTA 3R93A 3U9OA 3S1RB 3HOXH 4FF4A 1MJCA 3R3OA 5M5XH 4P74A 4RAUC 3A8IE 3TRZA 1F9SA 5AFWA 1DOKA 3MXUA 1PH4A 1XYIA 3DWQA 5LMUL 3JAMi 4DU9A 2AUKA 1Y8OB 1NMGA 5C0XJ 2A69C 2CW0C 3GTGH 2B2WA 5I6YA 1R4PB 3CAMA 3OIPA 1JQYD 5C3XA 3C46A 4N9TA 1S5FD 2WIIB 3KLSA 1Y1WG 1TY2A 1LTRD 1U4PA 4FYDA 1WCMG 2K28A 3M7NA 1QCBD 2DJGC 1F77A 3X3NA 1WTRA 2F0QA 4LMQD 4WJ4A 1H95A 1F2YA 1STBA 2O5JC 4IPDA 4X64L 4LF8L 1WCMB 3BVZA 3I3CA 4F87A 2F0GA 2J0TD 2L1BA 3EROA 1XNQL 4X6AH 1CQVA 5FJ8G 4CDFC 1FJGL 1ASYA 2OQ0A 3FKIG 5J39A 2Y0SE 3K8AA 5C4HA 1QUQA 2B2VA 3ERQA 3I73A 1JJ2A 3A54A 3DLLA 4JBMA 2NVXB 1ET6A 2FFKB 2PW5A 4LK1C 2FXQA 4FF1A 2PZTA 4K5WA 1H9RA 3U4VA 4AQYQ 5CORA 1PRTF 3ULLA 1O80A 2ZJQA 4LF7L 4LAAA 1KABA 2C5CA 1XMOL 4DV0Q 1STYA 1K0RA 3NTIA 5TSSA 3HOYB 1C4QA 4H0LC 3EJIA 1Q90A 1EY8A 3MVVA 1AH9A 5JJKA 3T16A 3FPPA 2L11A 4A3MB 1S5ED 1EL0A 3FEWX 1HNZQ 1EWIA 3TP7A 3RN2A 3NTKA 2E2IH 3LWUA 4DNTB 2JK8A 2D2CC 2PO4A 1QILA 1E2WA 2G5DA 4O42A 1B1ZA 3WOEA 4P72A 5FO8B 5JJZA 4OELB 1UE5A 1AEXA 1A6XA 2I5HA 1TU2B 1PFBA 4K2KA 2F0LA 3DEPA 2K03A 3OMCA 4R8NA 3S16B 3J80i 3CRLC 1CZGA 3LX0A 2QF7A 1PTOH 5IYBG 3DWAA 5I9PA 2Q8RE 3A5ZB 1AFPA 1R4QB 4KHPL 2N78A 1VQEA 1Q1BA 2MO0A 1I50H 3MXPA 2Q2UA 2EJMA 1UE6A 2AQ3B 2OWOA 4UPAA 1SLJA 4A3FB 1B9NA 1XPUA 5JJIA 1EZ6A 4DR5L 3MWYW 4PNYA 2NZOA 2JA5B 1J9OA 1M1KC 4GLXA 2Q2HA 5CR3A 1AZPA 4DR3Q 4JI6Q 4EVOA 4ZYSA 1EUJA 2OEOA 1OXTA 2A6HD 3P1HA 5JVH3 4DUYL 3KJPA 3MFGA 4B3TL 2JA6B 4KHVA 2HT1A 2RHSB 2A8VA 4R9WA 4LFAQ 3H94A 3GTKH 3LGJA 2MHVA 2ASBA 4DAYA 3A56A 1CA5A 4GLVB 4JI6L 1J6QA 5BR8Q 4QIWB 3M4QA 1BXTA 2XN9C 2NVQH 2LS01 2F0DA 3AFPA 1GHJA 2RA4A 5CV8A 4A4IA 3EIVA 4BA1I 1C9OA 3ULPA 1Y8PB 4JOIC 1L1OA 1N36Q 4B9WA 4A3EG 1EIYB 1N32L 1WJJA 1H9JA 5I4DA 2L9HA 3VYUA 4OO1I 4A3MH 3D6WA 3NBHB 2F3IA 4A3DG 2L12A 4DR4Q 4K5VA 2RVLA 2QEJC 4ODGA 1TIID 5EKIA 5C3WA 2IHFA 2K1BA 1A62A 2FMCA 4BA2I 3I2ZA 2A73B 4R1JA 2F0VA 2PQAB 5CV9A 4RH6A 4JCVE 3L2PA 4A3JG 5HGQA 3F2UA 4C2MB 4ULLA 3M7GA 3G4SA 2QCPX 4GKKQ 1BDOA 4P75A 4FXGC 1R9TB 3STBC 1IKMA 1B3AA 3GTQB 1TWFB 2PNHA 3J7YW 1I6HB 2B2UC 3W3AA 1AN8A 4HIKA 2K4KA 4PZ6A 5EBCA 3VR4A 3H6MA 2Q2IA 3DXJC 1E1OA 1PH1A 1GUNA 2ZXPA 5IT9c 5IT9L 4A3KB 3FRPB 3P20A 2K7VA 3FHWA 4L5QA 3QR8A 2DJFC 4YWLA 3GTJH 1YJ9A 1E1TA 2B63H 2TSSA 3GV6A 2JE6I 3NP8A 5IP9G 2N88A 2VUMG 4IN3A 5JEAH 3NBHA 3ND9A 1FYCA 4A3IG 1FGBD 1KD1C 4JI2L 3KLWA 1F2MA 1IHZA 1RODA 4ZRZA 4R4IA 4B9XA 4JPBW 4ZQ3A 2R7ZH 1UEAB 3HFZB 1Y1VB 3STBD 1Q1EA 4UAIA 1BF4A 1SNQA 4FDBA 4EGVA 3HOZG 1PTOF 3BDCA 2NUCA 1XX8A 4OGQC 5E1FA 2IWHA 2BA1A 4HIDA 4XYOA 2D0PA 3CP0A 4MTNA 3CCQA 2JA9A 1EEID 2EDGA 2WB1G 2K75A 1UWVA 4NXNQ 1UUPA 3CQZH 3M4OB 4L63B 5C0XH 5KYLA 2K5WA 3I91A 4HJ7A 2LXJA 2XWBB 4HR7B 1MKHA 4ZUIA 5A35A 1JOKA 4LF5L 4BY7G 5KGUA 2E75C 1NR2A 2A1AA 2DGYA 4HJ9A 4FNFA 4OWXB 4DN4M 1ASZA 4A3GH 1O7ZA 2K5VA 1UE7A 4IUNA 2F0TA 4NXNL 2K14A 2VY3A 3KF8A 2VQEQ 2RSNA 3R2TA 4TRDA 1PYSB 5LMUQ 2V4DA 3KK7A 1SJED 2F0IA 5IP7H 4X66Q 3HOUG 1Q82C 4L6TB 2FJ2A 3I70A 4BBSB 1PRTB 3VR6A 1TWCH 5KNDA 1PZJD 4B3SQ 3S1MH 4I7AA 5IYCH 2UXDL 4G4KA 1IBKQ 4A76A 3J81E 4YIJA 1IL2A 1MD2D 5IGBA 1WTHA 4RGMA 2EPBA 3GTMH 4KY5A 2XVSA 2SNMA 2GN5A 5CBAE 3K0XA 2DY7A 1VQMA 2A68D 4B3MQ 5K36G 1VQOA 2H5XA 3RZOH 1KC8C 1YHAA 4J15A 3RLOA 1ENAA 3KLSX 3KYHC 1HFGA 2R92B 5JOBA 2Z8LA 2RF4A 4ZLTF 2G9DA 2EJFC 1D8LA 4A3DH 4A3EB 3BDLA 3MFYA 4BBRH 5DM73 5IGEA 2RKSA 1M4VA 3BJUA 3HKSA 4XIGS 1KQSA 2L55A 1VQFA 1IZ6A 4KD4A 4GKKL 3Q24A 5IODA 2EY5A 3UI2A 3A55A 3VR5A 5DNFA 4DR1Q 4KN7C 3HOZB 3S24A 1E7ZA 5M3FB 3M3YH 1O7YA 1J5EQ 2H4OA 1X32A 4R8IA 1NBWA 3VYSA 3GQBA 2VS1A 3NSWA 1K28A 3T1YL 5DAUA 1S3OA 1IBLQ 4F8MA 2VUMB 3TBIB 4JK1C 3CC2A 1HHVA 2Z9HA 3JAMc 1SEBD 1HNZL 3FKIB 3EA6A 4GS3A 2QGQA 3RLNA 4DR7Q 1JWUD 1TWGH 1W6JA 3P7JA 4HAEA 4DR6L 2YYZA 3KDFA 3TP5A 5J22A 2R6GA 2MFIA 3S2HH 5IP9H 5GAGC 2VUMH 1PVOA 1PLFA 4A3IH
chains in the Genus database with same CATH topology
4RGNA 3GD7A 2M00A 1A3UA 3D4WA 5EPLA 1WTXA 4OO1G 4UDUC 1F9QA 1I4HA 1ZKOA 4AYBB 1S5DD 4IUUA 1Z7TA 3FDTA 2RQXA 1I50B 3L3OC 4XTCS 3PMFA 3SR1A 1RD9D 4K8JA 5NUCA 2FINB 1QG7A 2NTSA 1WTOA 2MJ8A 5G3LF 3R8BA 3EFXD 1PRTD 1PMRA 4H7BA 3RZOB 1PFMA 3TP8A 2A6EC 4RKBA 5HURA 1SE4A 5C4JB 2Z4IA 1EYCA 4CKBA 2IX1A 4BS9A 2G9HD 2Q8IB 2XNAC 2B63B 1V8QA 1F9PA 1L0YB 3PIO3 3BYYB 4RFBA 4C3HG 2CHBD 5LL6X 2L5TA 4RCNA 1SNPA 5CV6A 5E4WC 4XT3B 2X69A 1B53A 1XTCD 3N52A 1EU3A 5T1GA 3OPOA 3HKZB 2QKIC 3OWEB 2R61A 3QIAA 1ILQA 2EY2A 3OW7A 5EGTA 1I6VC 5FO7B 1PZID 5A2QE 4XQNA 1C48A 1EU4A 1FD7D 1SMYD 1G291 5ELEA 1SYBA 5IGDA 2BDOA 1PTOD 1F2ZA 1DD2A 1VMPA 2BDNA 4U68A 3D8GA 2EY6A 1II3A 1PRTC 2NVYB 3I90A 3HP3A 3OWFA 2B2VC 5D3DA 1JORA 3S9WA 3MTSA 3J7AV 1ML0D 1I3QB 1CM9A 3MA2B 1CTMA 3GTOB 5EKKA 2D5DA 1QJOA 1SYEA 5ISRA 2F3VA 1KTKA 2OXPA 3HS0C 3K7AB 4OO1H 1E2ZA 4G7HC 2PMZB 3MXGA 1STEA 2PNRC 2HDMA 2K33A 1FNUA 1JC7A 3FVQA 4HSVA 2ID0A 4ID6A 2DNEA 1H9MA 3T53B 2M2LA 2WKDA 3K5MA 4PMBA 2EE1A 1I4XA 5CV4A 1IYVA 4H13C 3K5LA 4XDXA 3S1MB 2O4XA 1LTBD 4DF7A 3DMUA 4M8AA 4Q5VA 1SMYC 4XQQA 3H09A 1AW7A 2KJXA 4WRDA 3JAML 4A93B 2NWGA 3QWNA 5CGKA 2X6GA 3TZUA 1TR5A 3BS1A 2MUYA 3RZDB 4IFDI 4KKSA 4C3IB 3VA5A 3VA7A 3MC0B 3DM1A 2B8FA 1OO9B 5ELBA 3MXNA 1B44D 5C4ZA 2K01A 2E2DC 1BUVT 1DZ1A 4FF3A 1SJHD 2J4XA 3H0GB 1NUCA 1BOSA 2IX0A 1GUGA 2SEBD 1EEFD 5I2XA 3KBXA 1TWCB 2NZ1D 3GTPB 1S5CD 1F2LA 3MHBA 5D14A 3TDQA 4QUFA 2QDBA 2Q8TA 1TWGB 1LT5D 1X3PA 1CK1A 2RDHA 1EFID 1PXUA 2E74C 2K05A 1HTLD 4KN4C 3P75A 5T1IA 1STGA 2XRSD 1JR0D 3GTGB 2XWJB 1KNAA 4IFDG 3PUVA 2WAQB 5EBDA 1CT1D 3RUZA 4DNRB 1EOTA 2EVBA 3J81L 2B2TA 3NK9A 5FK9C 1CA6A 3QOLA 2HCIA 1TQOA 3K5NA 1TT2A 1LTTD 5KNBA 4Y7NB 1PFNA 1UAPA 1SYDA 1KNEA 1WVLA 2NBFA 2CVRA 1BNZA 1OXUA 3GTJB 2WKCA 3DUZA 3I4LA 4P2CB 3GTMB 4V0BA 2E2JB 1GHKA 3KUPA 1RF2D 3S1NB 1K8MA 1ZYRC 3V05A 1IL8A 1GOZA 5EPKA 1NR4A 1B4OA 5FKAC 1SNOA 3D6CA 1TY0A 2JEAI 3K58A 1IKLA 1STHA 1SXTA 4K5XA 1YNJC 4KY6A 3S17B 3O13A 4PV1C 1JICA 3H91A 1Q12A 1JCKB 1LT3D 3EVQA 1NAPA 1KDBA 2K04A 1L0XB 2WV6D 3K59A 2Z4HA 5DEHA 1Y1WB 1TWAB 2ICEC 2B2YA 2F3WA 4J1MA 5CYUA 1WTWA 5EKLA 2MGSA 3NQIA 1SE3A 4CJ0B 3PUZA 2MP1A 1Y8NB 2F0OA 1XWEA 3VYRA 2DN8A 4HCSA 4NP5A 4IUPA 3KBGA 2TMPA 3Q22A 4CJ2C 4DA2A 3L9AX 1OXVA 1A2TA 1A3TA 5FO9B 4ABNA 2A6HC 1HUMA 1SYCA 2SNSA 3PV0A 4I65A 5M5YB 1ESRA 3VYTA 1LTSD 2ENBA 2WP8J 4M1UB 3E5SA 1XXGA 4C56C 2SOBA 5M9OA 3VR3A 2B2UA 4KK7A 1YNJD 2DY8A 3AB9A 1B9MA 4I7ZC 3SK4A 4RCOA 2EY1A 4Z9CB 2NVTB 3PIP3 4HMJA 3T51B 4CKCA 1GUSA 1LO5D 4Q0FA 5C5MA 3FMCA 4OL7A 3SXHA 5HGTA 3IFTA 1QWYA 3I4MB 3H3VC 3U9SA 2C9OA 1TS5A 5J1ZA 5KNCA 1K83B 2PCFB 1EY6A 3HG9A 3D3RA 3RD4A 5EJWA 3BG3A 1EQVA 1A15A 4A3JB 1B50A 2SDFA 4FXDA 4DAVA 1T5XD 5CC4A 3OOCA 2F03A 2IJ0A 1QNKA 1EWHA 4ILWA 4LJZC 1RKNA 2I07B 4OIJA 4XXEA 2BA0A 5JPNC 4MHEA 3L7ZC 4DAPA 3JAME 1D2BA 5C3EB 1LACA 2NN6H 1JE4A 5C0XG 4F7XA 2LMCB 2FHTA 3PUWA 1DXMA 2IW3A 5D3IB 1BR9A 1VMCA 1ESFA 2EOTA 2X6LA 4KHZA 5ELDA 1W6KA 1GXDC 2AWOA 5D65A 1SBBB 1U4MA 4KY7A 3GO5A 3X3MA 4PMCA 2R93B 4HEDA 1I4PA 3ITPA 1SFOB 3NPPA 5IGCA 2KEEA 3NUCA 2RSOA 2E2HB 3TP6A 1CI3M 4TSSA 2AQ1B 2M9VA 3LNNA 1QNUA 3HOVB 3NTHA 2EXZA 1QE6A 1QOHA 1M8AA 2F0MA 2J7ZA 1EY0A 4OHJA 2XRQD 3QO2A 4H44C 4J8QA 3SK5A 4RWSC 3SVMA 2EYOA 2NYZD 1HPCA 3CHBD 2F0JA 1SNMA 5JEAJ 3IFDA 3GTKB 2E2IB 1D1IA 1EY9A 2GA4B 3HGBA 4HSPA 2F0NA 2WB1B 1STNA 2D62A 1EIHA 4K6LA 4RGOS 1EWCA 3D4RA 3SK8A 2XSCA 4FF2A 2KA7A 4QMGA 1EZ8A 1FR3A 4C3IG 1O78A 2EJGC 3K5OA 5E4XA 4A3IB 3URYA 5EQ0A 1JWMD 1AZQA 3HOUB 2IPKD 4IALA 4F88A 3C1FA 4CGYB 2F0HA 1C8CA 1G91A 1SNDA 5IGFA 4FXKC 1EY4A 3CRKC 3A8KE 1JOOA 2A69D 2F4IA 1E2VA 4DXGA 2O5IC 1E0BA 1FNVA 3OSOA 4MN3A 2AWNA 4ZKBB 4QF4A 2XIWA 2IX3A 3E6ZX 1TKWB 4KV6A 3DHQA 2PQEA 4C3JB 5IOCA 1AP0A 1LV9A 2K5DA 1WD1A 4O1NA 3S14B 1V43A 2LFNA 1I4GA 2ZXRA 1VCIA 2R7ZB 1ILPA 4C1NK 1WTPA 5COYA 1RTNA 4TKOB 3A8JE 1KDCA 4FVMA 2A74C 2A5HA 2DNCA 3VR2A 2A68C 4TQUS 1PYWD 1MBYA 1X3QA 3I4NB 1BCPD 3BDOA 2KOLA 1Y69U 2D9UA 3OMGA 2EYFA 2KVMA 1V1OA 5ELFA 5CMDA 1O7LA 4X3UA 4G7OC 1ENFA 2CQAA 1WTVA 1Z47A 1PTOC 1TS2A 4MIUA 4QB4A 1DM0B 2B8GA 2E76C 1BBXC 3SHLA 3MEHA 2I46A 4JBWA 2ZXOA 3A7LA 1LT6D 2JA8B 3LWEA 2F0PA 4G57A 3KLRA 3OHXC 2PZUA 1KDAA 2KCCA 3EQLC 3QG1A 4K14A 1CHPD 1F9RA 2L4NA 1LTAD 3K0YA 5C44B 2KUMA 4IUTA 2B39A 3E0JA 1Q3LA 3TMEA 5LHY1 3S2HB 2LY7A 2BE5C 3G7LA 2ICIA 5DM63 5I6WA 4IFDH 4A3GB 3J7AF 1HRJA 2YU9B 2B2WC 4C3JG 4HN7A 3I8ZA 1CHQD 1OXSC 4K8IA 2EYLA 1G2TA 2QILA 4IUQA 3IAYA 3M85A 2A6ED 4CKEA 5BN5A 5I9OA 4KMUC 3NWTA 5LL6S 5KYIA 2KEDA 3T4AC 1RDPD 4C3HB 1DJRD 1HA6A 2F0UA 2K5QA 1HQMC 3MZ5A 1BCPB 1DCZA 5FLXL 4XT1B 1GUTA 1DOMA 1D5XC 1RCVD 2NTTA 2KHSA 2IL8A 2R3ZA 3AMUA 3K6OA 2VB3X 3SK6A 3RMHA 3W2DA 2F1MA 2OT2A 4V190 2PZWA 2EZVA 3ND8A 1BO0A 1ENCA 2N55A 2KQ3A 1ONLA 4B08A 3WDNA 4S3SA 4GZYC 1I4RA 4C1NI 5JEAG 4RHSA 5CV5A 1H9KA 1U4LA 3K57A 3HZXA 3BZDB 3R2IA 4K2LA 1HQRD 1V1PA 1TS4A 4HMIA 1JB3A 4DK0A 2H1EA 4IZ8A 1D5ZC 1U4RA 1VF5C 4KI0A 4NW2A 3HOXB 1ZEQX 1KLGD 5IT9E 1IW7C 1SDFA 5M5WB 2RDGA 1FNWA 4EQNA 3PUYA 1CQFA 3C3LA 1ZXTA 3C2PA 4HCEA 3PO2B 5IIFA 5JPMC 1A2UA 2VB2X 2L0CA 5JAVA 2B2TC 2EYMA 1LT4D 4ZAIA 5K36H 2EYPA 1EYAA 3N6RA 4RKLA 4BY7B 1HCZA 4NDXA 2PYKA 2F0SA 1WD0A 5KIXA 4CJ1B 3HRZC 1DOLA 2NB0A 5E3FA 1EYDA 4KTAA 1GJXA 4ZUJA 3M4YA 5K5PA 2NVQB 3D31A 3FPUB 4KKTA 1SNCA 5ELCA 4EQPA 3S15B 1WTQA 1SYGA 3SEBA 1D1KA 2PPBC 3GTLB 1HA5A 2HDLA 1I4QA 1JWSD 3PO3B 3NXWA 1PDQA 2F0FA 3Q6SA 1PTOB 3BYTB 1VF7A 3GV3A 4KD3A 4BBRB 4CBVA 5CV7A 4A3DB 4FO2A 5BN3A 4PQXA 2JEBI 2WINB 3D4DA 3MAQA 4WORA 4RA8A 1LABA 1SAPA 1BCPF 3J80L 1MGSA 1GUOA 4BY1B 3DEOA 4XYQA 1KAAA 4G7ZC 2RDFA 2HQEA 3S1QB 4PMWA 4K6DA 3NBIA 3I72A 1CFMA 5JVG3 4DXFA 1GUWA 4KKUA 4FP5D 3T13A 1D5MC 1G8ZD 3S2DB 4DGZA 5CBEE 1LLRD 2BE5D 3TSSA 4QUCA 5KRUA 1EQTA 2CW0D 2O2LD 1VDZA 3IKJA 3J80E 2ZT9C 2IT1A 4NMZA 1KLUD 1TVXA 4BWGB 1LTID 4HTHA 3CQZB 1TWHB 2NN6G 1MSGA 1RTOA 1HFNA 3OIQA 1SSOA 3BVMA 3GP7A 1BCPC 4KJOA 2B2YC 2Z1CA 1NCVA 1STAA 4CHTB 4IURA 2BOSA 1SYFA 4NKLA 3ONAB 1ZYRD 2F0EA 4ZK9B 3SE0A 5FOBB 3WOFA 4DK1A 1OXXK 4ME5A 3G6JB 1B2TA 1U9RA 3PUXA 2K6AA 2NN6I 1HTPA 1HUNA 1D6EC 3Q23A 2JP1A 5M3MB 2JSOA 1UNSA 1H9SB 1HXYD 2HUGA 3RLFA 1DYQA 1ICWA 4RGTA 1EIGA 1G2SA 4RHRA 1Q8IA 2BCOA 1YNNC 1S4ZA 2MPMA 5G3LD 4WFN3 1EY7A 1V1PB 5IGGA 3T56B 1IW7D 1RJTA 5C4XB 2HCCA 3IL8A 1Z6HA 3AU7A 2EYHA 1QB5D 3QJYA 1MSHA 2K32A 1NSNS 2RBMA 3NWSA 2LKVA 1CZWA 3SDZA 4A3BB 3QB3A 3BVGA 3HEJA 2AUJD 2FMMA 3C1EA 3TZDA 4IQZA 5A2QL 2WACA 2F0KA 3V96A 2KCNA 2JA7B 3CKIB 4J6HA 4XQJA 4EQOA 5C0XI 4X3SA 5KEEA 1ET9A 2F0WA 4E6IA 5C5LA 4QCLA 5I2YA 1BQQT 1G6ZA 3CU7A 2VNUD 1YNND 4IFDJ 2KECA 2EYJA 1PZKD 3DWPA 1EY5A 1DONA 1TS3A 4X3TA 1SE2A 3HOWB 4IUVA 2VXWA 2JYOA 1JOQA 1MI2A 4WJWA 5EPJA 1S5BD 5C6AA 4ZKCB 1T5EA 3NHHA 4X3KA 3TN2A 3A7AB 1J8IA 5FLXE 2Y0SB 1LTGD 1A3VA 1RHPA 3ZYYX 5BN4A 3QOJA 2JXMB 4OIKA 5M5XB 4KJNA 3M3YB 1H9SA 4DFAA 2AQ2B 4L8JA 4N9PA 1IYUA 2OF1A 4U673 5F2DA 3NE5B 2PW7A 1K8OA 3V2TA 3Q0AA 3NQTA 3R93A 3U9OA 3S1RB 4FF4A 3R3OA 4RAUC 3A8IE 1F9SA 5AFWA 1DOKA 3MXUA 1XYIA 3DWQA 4DU9A 2AUKA 1Y8OB 5C0XJ 2A69C 2CW0C 2B2WA 5I6YA 1R4PB 3OIPA 1JQYD 5C3XA 3C46A 4N9TA 1S5FD 2WIIB 3KLSA 1TY2A 1LTRD 1U4PA 4FYDA 2K28A 3M7NA 1QCBD 3X3NA 1F77A 1WTRA 2F0QA 4LMQD 1F2YA 1STBA 2O5JC 1WCMB 3BVZA 3I3CA 4F87A 2F0GA 2J0TD 2L1BA 3EROA 1CQVA 5J39A 5C4HA 2B2VA 3ERQA 3I73A 3A54A 2NVXB 1ET6A 2FFKB 2PW5A 4LK1C 4FF1A 2PZTA 4K5WA 1H9RA 5CORA 1PRTF 1O80A 4LAAA 1KABA 2C5CA 1STYA 3NTIA 5TSSA 3HOYB 1C4QA 4H0LC 3EJIA 1Q90A 1EY8A 3MVVA 3T16A 3FPPA 2L11A 4A3MB 1S5ED 1EL0A 3FEWX 3TP7A 3NTKA 3LWUA 4DNTB 2D2CC 2PO4A 1QILA 1E2WA 4O42A 1B1ZA 3WOEA 5FO8B 5JJZA 1AEXA 1A6XA 1TU2B 1PFBA 4K2KA 2F0LA 3DEPA 2K03A 3OMCA 4R8NA 3S16B 3CRLC 1CZGA 3LX0A 2QF7A 1PTOH 3DWAA 5I9PA 2Q8RE 1AFPA 1R4QB 3MXPA 1Q1BA 2EJMA 2AQ3B 4A3FB 1B9NA 1EZ6A 3MWYW 4PNYA 2JA5B 1J9OA 5CR3A 1AZPA 4EVOA 4ZYSA 2OEOA 1OXTA 2A6HD 3P1HA 5JVH3 3MFGA 2JA6B 4KHVA 4R9WA 3H94A 2MHVA 4DAYA 3A56A 1CA5A 4QIWB 1BXTA 2XN9C 2LS01 2F0DA 1GHJA 2RA4A 5CV8A 4BA1I 1Y8PB 4B9WA 1H9JA 5I4DA 2L9HA 3VYUA 4OO1I 3D6WA 2L12A 4K5VA 2RVLA 2QEJC 4ODGA 1TIID 5EKIA 5C3WA 2K1BA 2FMCA 4BA2I 2A73B 2F0VA 5CV9A 4RH6A 3F2UA 4C2MB 4ULLA 3M7GA 2QCPX 1BDOA 4FXGC 1R9TB 1IKMA 1B3AA 3GTQB 1TWFB 3J7YW 1I6HB 2B2UC 3W3AA 1AN8A 5EBCA 3VR4A 3H6MA 3DXJC 1GUNA 2ZXPA 5IT9L 4A3KB 3FRPB 3P20A 2K7VA 2TSSA 3GV6A 2JE6I 3NP8A 2N88A 4IN3A 5JEAH 3NBHA 3ND9A 1FYCA 1FGBD 1F2MA 1IHZA 1RODA 4ZRZA 4B9XA 4ZQ3A 1UEAB 1Y1VB 1Q1EA 4UAIA 1BF4A 1SNQA 4EGVA 1PTOF 3BDCA 2NUCA 1XX8A 4OGQC 5E1FA 2IWHA 2BA1A 4XYOA 1EEID 2EDGA 1UUPA 3M4OB 4L63B 5C0XH 5KYLA 2K5WA 3I91A 2XWBB 4HR7B 4ZUIA 5A35A 1JOKA 5KGUA 2E75C 1NR2A 4FNFA 4DN4M 1O7ZA 4IUNA 2F0TA 3KF8A 2RSNA 3R2TA 4TRDA 2V4DA 3KK7A 1SJED 2F0IA 2FJ2A 4L6TB 3I70A 4BBSB 1PRTB 3VR6A 5KNDA 1PZJD 4G4KA 3J81E 4YIJA 1MD2D 5IGBA 4RGMA 2EPBA 4KY5A 2XVSA 2SNMA 5CBAE 2DY7A 2A68D 5K36G 1ENAA 3KLSX 1HFGA 2R92B 5JOBA 2Z8LA 4ZLTF 2G9DA 2EJFC 4A3EB 3BDLA 3MFYA 5DM73 5IGEA 2RKSA 1M4VA 4XIGS 2L55A 4KD4A 3Q24A 5IODA 2EY5A 3UI2A 3A55A 3VR5A 5DNFA 4KN7C 3HOZB 5M3FB 1O7YA 2H4OA 1X32A 4R8IA 3VYSA 3GQBA 3NSWA 5DAUA 4F8MA 2VUMB 3TBIB 4JK1C 1HHVA 1SEBD 3FKIB 3EA6A 1JWUD 1W6JA 3P7JA 4HAEA 2YYZA 3TP5A 5J22A 2R6GA 1PLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C4Q A;  1D1K A;  3MXG A;  1QNU A;  1CZG A;  2XSC A;  1CQF A;  1DM0 B;  1R4P B;  1QOH A;  1CZW A;  1R4Q B;  1C48 A;  1BOS A;  2BOS A;  4P2C B;  2C5C A;  4ULL A;  4M1U B;  1D1I A;  2GA4 B; 
#chains in the Genus database with same CATH topology
 2BH2 A;  4RGN A;  2RCN A;  3GD7 A;  2M00 A;  1A3U A;  3D4W A;  5EPL A;  1WTX A;  4OO1 G;  4A3F H;  4UDU C;  2UUA Q;  1F9Q A;  1I4H A;  1ZKO A;  2VZA A;  4Y7N H;  3HOZ H;  4AYB B;  1S5D D;  3EBE A;  4IUU A;  4UP9 A;  1YZ6 A;  1Z7T A;  1HR0 L;  3FDT A;  4O0A A;  2RQX A;  1I50 B;  1VQB A;  1WFQ A;  3J81 j;  2N49 A;  3L3O C;  2KHJ A;  4XTC S;  5C44 G;  2Y0S G;  3PMF A;  3SR1 A;  1RD9 D;  4K8J A;  5NUC A;  3PF5 A;  2FIN B;  1QG7 A;  2NTS A;  3F2B A;  1WTO A;  2MJ8 A;  5G3L F;  3R8B A;  3EFX D;  1S72 A;  1PRT D;  5IY0 A;  1HR0 Q;  1PMR A;  4H7B A;  3GTL H;  4QIW E;  3RZO B;  1PFM A;  3TP8 A;  4UP7 A;  2A6E C;  1K8G A;  3KF8 B;  4RKB A;  5HUR A;  1SE4 A;  5C4J B;  3HOW G;  2Z4I A;  4HJA A;  1EYC A;  4CKB A;  2IX1 A;  4BS9 A;  4GN4 B;  2G9H D;  4A3B H;  3UDF A;  2Q8I B;  2XNA C;  4AYB E;  1V8Q A;  2B63 B;  3CPF A;  1F9P A;  1L0Y B;  1TXY A;  3PIO 3;  3BYY B;  4RFB A;  1RIP A;  4OX9 Q;  2UUA L;  4C3H G;  2CHB D;  5LL6 X;  4B3M L;  2EQS A;  2L5T A;  1Q81 C;  4RCN A;  1SNP A;  2F4V Q;  5CV6 A;  2XGT A;  5E4W C;  1PV4 A;  4XT3 B;  2D0O A;  2X69 A;  1B53 A;  1JJG A;  1XTC D;  3N52 A;  3KOJ A;  1EU3 A;  5T1G A;  3OPO A;  3HKZ B;  2QKI C;  1XJV A;  3OWE B;  2R61 A;  3QIA A;  2NVX H;  1ILQ A;  2EY2 A;  3OW7 A;  5EGT A;  1I6V C;  3S17 H;  3J80 c;  1FJG Q;  5FO7 B;  1PZI D;  4A93 H;  3U4Z A;  5A2Q E;  4DV2 L;  4XQN A;  1C48 A;  1EU4 A;  1GM5 A;  1FD7 D;  1SMY D;  1G29 1;  1I94 L;  5ELE A;  1VQH A;  4TVA B;  1GVP A;  1SRU A;  1SYB A;  5IGD A;  1CKN B;  2JA7 H;  2BDO A;  3J7A 5;  1PTO D;  4HJ5 A;  1NY4 A;  1F2Z A;  4LW1 A;  1DD2 A;  1VMP A;  2HIV A;  4ALP A;  2BDN A;  4U68 A;  3BZC A;  4LF7 Q;  3D8G A;  1IBM L;  4X64 Q;  4OXP A;  4DUY Q;  2EY6 A;  4GOP B;  1I94 Q;  1II3 A;  2AKW B;  1PRT C;  2NVY B;  2R93 G;  3CC4 A;  3I90 A;  3HP3 A;  4JI7 L;  3OWF A;  2B2V C;  5D3D A;  1JOR A;  4PG3 A;  5FLM G;  1P16 A;  1KHI A;  3E0E A;  3S9W A;  1LUZ A;  3MTS A;  2LXK A;  3J7A V;  1ML0 D;  3CME A;  1I3Q B;  2ZTD A;  1CM9 A;  1SFO H;  3MA2 B;  1CTM A;  3GTO B;  5EKK A;  3PO2 G;  4BXX H;  4DV3 L;  2D5D A;  4UY8 C;  1QJO A;  3AYH B;  1SYE A;  5ISR A;  3K7A B;  1KTK A;  2F3V A;  2OXP A;  3HS0 C;  4OO1 H;  1E2Z A;  4A3F G;  4G7H C;  2PMZ B;  3MXG A;  1STE A;  1CKN A;  4DK3 C;  1V1Q A;  4DV4 Q;  2PNR C;  1VQC A;  2HDM A;  2K33 A;  1FNU A;  1HZC A;  1JC7 A;  3FVQ A;  4HSV A;  2ID0 A;  1EYG A;  4ID6 A;  2VQE L;  2DNE A;  1H9M A;  3T53 B;  2M2L A;  2WKD A;  2NVT H;  3K5M A;  4PMB A;  2EE1 A;  1I4X A;  5CV4 A;  1IYV A;  4H13 C;  3K5L A;  4XDX A;  4DV1 L;  3S1M B;  1YVC A;  2O4X A;  4BBS H;  1LTB D;  4DF7 A;  3DMU A;  4M8A A;  1XNQ Q;  4Q5V A;  4O2D A;  4LFA L;  1SMY C;  4XQQ A;  3H09 A;  1AW7 A;  2KJX A;  4WRD A;  3JAM L;  4A93 B;  2NWG A;  4LFB Q;  1K3R A;  3QWN A;  5CGK A;  2X6G A;  3TZU A;  1TR5 A;  1X56 A;  3BS1 A;  3TQY A;  2MUY A;  3RZD B;  4IFD I;  4KKS A;  4C3I B;  3VA5 A;  1Q7Y C;  3GTQ H;  3VA7 A;  4BY1 H;  4EQ5 A;  3MC0 B;  2JA8 H;  3HOV H;  3TRE A;  4JI3 L;  3DM1 A;  3I56 A;  2B8F A;  1OO9 B;  3KF6 A;  1YBY A;  5ELB A;  1HJP A;  3MXN A;  1B44 D;  5C4Z A;  2K01 A;  2E2D C;  4QQB X;  1HZB A;  3H3V I;  5JJL A;  1BUV T;  1EOV A;  1DZ1 A;  2MQH A;  4FF3 A;  1SJH D;  2J4X A;  3NEN A;  3H0G B;  4DV3 Q;  1I3Q H;  1NUC A;  1BOS A;  2IX0 A;  4WJ3 M;  2JA7 G;  1LTL A;  1GUG A;  2SEB D;  1EEF D;  5I2X A;  3KBX A;  1TWC B;  2EXD A;  1WCM H;  4JVZ A;  2NZ1 D;  3GTP B;  1S5C D;  1F2L A;  3MHB A;  5D14 A;  3TDQ A;  1SR3 A;  4QUF A;  1D7Q A;  2QDB A;  2Q8T A;  5IWA Q;  1PH6 A;  1TWG B;  1LT5 D;  1X3P A;  3DM3 A;  1CK1 A;  4X62 L;  2RDH A;  1VQ8 A;  1EFI D;  1PXU A;  2E74 C;  2K05 A;  1HTL D;  4KN4 C;  3P75 A;  2ZTE A;  5T1I A;  1STG A;  2CCZ A;  2XRS D;  1JR0 D;  3GTG B;  2XWJ B;  4JI8 Q;  3PSI A;  3KJO A;  1KNA A;  1XNR L;  4IFD G;  2Z6B A;  1Y1W H;  3M4O H;  3PUV A;  1CKM A;  1X3E A;  2WAQ B;  4R4O A;  1JMC A;  5EBD A;  1CT1 D;  4C3J H;  1QVC A;  3RUZ A;  4DNR B;  1EOT A;  2EVB A;  1WOC A;  3J81 L;  5M5W H;  1O7I A;  2B2T A;  4JI8 L;  3NK9 A;  5FK9 C;  1K73 C;  3PO3 H;  3CCV A;  1CA6 A;  3QOL A;  4LF4 L;  4CDE C;  2HCI A;  5FJ8 H;  1TQO A;  1CKO A;  5H1S E;  3G6E A;  1NJI C;  3K5N A;  1TT2 A;  1LTT D;  5KNB A;  1PFN A;  4Y7N B;  1UAP A;  3J81 i;  4B3T Q;  1SYD A;  1KNE A;  5LMN L;  4GOP C;  1WVL A;  2NBF A;  2CVR A;  2UXC Q;  1BNZ A;  1OXU A;  1VQP A;  2PMZ E;  1XPR A;  3F2D A;  4DUZ L;  3GTJ B;  2AMC B;  2WKC A;  3J7Z C;  3DUZ A;  3I4L A;  3CD6 A;  1IBL L;  2GVA A;  4P2C B;  2QA4 A;  1RL2 A;  5AJ3 L;  3GTM B;  4V0B A;  3H0G H;  2E2J B;  1QZH A;  1GHK A;  3KUP A;  1RF2 D;  2N8N A;  3S1N B;  1K8M A;  1K9M C;  4YCV A;  1M90 C;  1ZYR C;  3V05 A;  3HOY H;  4LWC A;  1IL8 A;  3AFQ A;  4YCW A;  1GOZ A;  1A63 A;  5EPK A;  1NR4 A;  1B4O A;  5FKA C;  1KAW A;  1SNO A;  3D6C A;  5GRO A;  1TY0 A;  2JEA I;  3K58 A;  3A74 A;  1IKL A;  4LF5 Q;  1STH A;  2OTJ A;  1SXT A;  4K5X A;  1YNJ C;  4KY6 A;  1E24 A;  3S17 B;  3O13 A;  4PV1 C;  1JIC A;  1EQR A;  3H91 A;  2I5M X;  1A0I A;  1BBU A;  1Q12 A;  4X62 Q;  1JCK B;  1LT3 D;  3EVQ A;  1NAP A;  1KL9 A;  1KDB A;  2K04 A;  1L0X B;  1K8A C;  2WV6 D;  3K59 A;  3EN2 A;  3S16 H;  2Z4H A;  4IJH A;  5DEH A;  1Y1W B;  5IYB H;  1TWA B;  2UXD Q;  2JA5 G;  1XPO A;  4HIO A;  4DR2 L;  2ICE C;  2B2Y A;  2F3W A;  4J1M A;  5CYU A;  1WTW A;  1QZG A;  5EKL A;  2MGS A;  3NQI A;  4DV7 Q;  4UHV A;  1SE3 A;  4CJ0 B;  3ICE A;  3PUZ A;  2MP1 A;  2ATW A;  2K5H A;  3CW2 C;  1HNX L;  1YEZ A;  1Y8N B;  4RMF A;  1BKB A;  1N8R C;  2F0O A;  4GN3 B;  4BY7 H;  1XWE A;  2UUB L;  3VYR A;  2DN8 A;  4HCS A;  3H3V H;  4LUO A;  4NP5 A;  4IUP A;  3KBG A;  1TWA H;  1NE3 A;  3S14 H;  4QL5 A;  2TMP A;  1AE2 A;  4YWM A;  3Q22 A;  4IOC A;  2E5L Q;  2AHO B;  1NTG A;  4CJ2 C;  4DA2 A;  3L9A X;  4JV5 Q;  1OXV A;  1A2T A;  1A3T A;  4APV A;  5FO9 B;  4ABN A;  1MHW C;  1AE3 A;  2A6H C;  3PIO A;  1HUM A;  1SYC A;  3CC7 A;  2DUD A;  1FGU A;  4RG1 A;  2R92 G;  3CMA A;  2SNS A;  3PV0 A;  4I65 A;  5M5Y B;  1E3P A;  1ESR A;  3VYT A;  1LTS D;  2ENB A;  2WP8 J;  4KLK A;  1B3Q A;  4M1U B;  3E5S A;  1BVS A;  1XXG A;  3U50 C;  4C56 C;  4A3K G;  2SOB A;  5M9O A;  3T1Y Q;  3VR3 A;  1CUK A;  4DR2 Q;  2B2U A;  4KK7 A;  2KCT A;  1YNJ D;  2DY8 A;  4A3M G;  2I0Q A;  3CXC A;  3AB9 A;  1B9M A;  3S15 H;  4I7Z C;  3SK4 A;  2K50 A;  3OTO L;  4RCO A;  4IPC A;  2EY1 A;  4Z9C B;  2NVT B;  1PA6 A;  3PIP 3;  3I4M G;  2QW7 A;  4K0K Q;  4HMJ A;  1N33 L;  3T51 B;  4CKC A;  1GUS A;  1LO5 D;  4Q0F A;  5C5M A;  3FMC A;  1NMF A;  4OL7 A;  3SXH A;  5HGT A;  3K80 C;  2L15 A;  3IFT A;  1QWY A;  4DAM A;  3I4M B;  3H3V C;  3U9S A;  3PF4 A;  1LM0 A;  4OEM B;  1N32 Q;  2ZJP A;  4R4C A;  1HZ9 A;  3K7U C;  3AQQ A;  2C9O A;  1X3G A;  1TS5 A;  5J1Z A;  3S1R H;  5KNC A;  4DAY B;  1I5F A;  3PQI A;  1K83 B;  2PCF B;  4C3I H;  1EY6 A;  3HG9 A;  4A3C G;  3D3R A;  4JI3 Q;  4LNQ A;  3RD4 A;  3GTO H;  5EJW A;  3BG3 A;  4H02 A;  2B63 G;  1EQV A;  1A15 A;  4A3J B;  1B50 A;  2SDF A;  4FXD A;  4DAV A;  1DGS A;  1T5X D;  4JI5 L;  5CC4 A;  3OOC A;  3IRB A;  2F03 A;  3CCJ A;  2R7Z G;  2IJ0 A;  1QNK A;  4A75 A;  4LF6 L;  1EWH A;  4ILW A;  4LJZ C;  1RKN A;  1HZA A;  1VQG A;  4P73 A;  5IE8 A;  4IJL A;  4DR5 Q;  2I07 B;  4OIJ A;  4LFC L;  4XXE A;  1GKH A;  1MIU A;  2BA0 A;  5JPN C;  4MHE A;  4JI5 Q;  3L7Z C;  4DAP A;  1KRS A;  3JAM E;  1D2B A;  5C3E B;  1LAC A;  2NN6 H;  1JE4 A;  5C0X G;  4F7X A;  1C0A A;  4LF9 L;  2LMC B;  2FHT A;  3PUW A;  1DXM A;  3F8T A;  5IYC G;  2Z6K C;  4R4Q A;  2IW3 A;  5D3I B;  1W3S A;  1PYB A;  1BR9 A;  1VMC A;  5HY6 A;  2RCF A;  1ESF A;  4QJF A;  2EOT A;  2X6L A;  2B29 A;  2MO1 A;  4KHZ A;  1YNX A;  2OCE A;  2E2H H;  1IYJ B;  4EX5 A;  2NVY H;  4A3L G;  4A3G G;  5ELD A;  1W6K A;  1GXD C;  2AWO A;  1IBM Q;  1U5K A;  1EFW A;  1SN8 A;  5D65 A;  4LF9 Q;  1SBB B;  1U4M A;  3K7A H;  4KY7 A;  2JA6 H;  5E7N A;  3GO5 A;  3X3M A;  3HOU H;  4PMC A;  4JI7 Q;  3BZK A;  4DV4 L;  1TWF H;  2R93 B;  4HED A;  1I4P A;  3ITP A;  2QDL A;  1SFO B;  3NPP A;  2YTX A;  5IGC A;  2KEE A;  4DR3 L;  3NUC A;  2RSO A;  3UDX A;  4BBR G;  2E2H B;  3ULJ A;  3TP6 A;  4NXM L;  1CI3 M;  4TSS A;  5DLQ E;  2AQ1 B;  2M9V A;  3LNN A;  1QNU A;  3HOV B;  3U58 A;  3NTH A;  2EXZ A;  1QE6 A;  1QOH A;  1M8A A;  2F0M A;  1VQ6 A;  4GKJ L;  4JI1 L;  2J7Z A;  3S1N H;  1EY0 A;  2UU9 L;  4OHJ A;  2XRQ D;  1EQQ A;  3QO2 A;  4H44 C;  4J8Q A;  5M3F G;  3SK5 A;  2VL6 A;  4RWS C;  3SVM A;  2EYO A;  2UXB Q;  2NYZ D;  1B7Y B;  1HPC A;  4ME3 A;  3RN5 A;  4LUV A;  2HHH Q;  3CHB D;  3CCL A;  2F0J A;  1SNM A;  5JEA J;  1UE1 A;  4A93 G;  3IFD A;  2ZTC A;  3GTK B;  3PIP A;  1YIT A;  3I4N G;  3B6Y A;  2E2I B;  1D1I A;  1EY9 A;  1X54 A;  2GA4 B;  4L5T A;  3HGB A;  4HSP A;  4JG2 A;  4JI2 Q;  2F0N A;  5L37 A;  2WB1 B;  1STN A;  4POF A;  1HNW Q;  2D62 A;  1EIH A;  4K6L A;  4RGO S;  4IO9 A;  3UE1 A;  3L0O A;  1EWC A;  3D4R A;  3SK8 A;  4JC0 A;  2XSC A;  4FF2 A;  2KA7 A;  4QMG A;  3OYY A;  1Y1V G;  1EZ8 A;  1N9W A;  1FR3 A;  4JBK A;  4C3I G;  1QVF A;  3MEF A;  1O78 A;  3TS2 A;  4A3C H;  2EJG C;  3K5O A;  2JJQ A;  5E4X A;  4A3I B;  3URY A;  4GNX A;  5EQ0 A;  1JWM D;  3CCU A;  3A5U A;  1AZQ A;  3HOU B;  2IPK D;  4IAL A;  4F88 A;  2CH4 A;  3C1F A;  4QGU A;  4CGY B;  2F0H A;  1C8C A;  1G91 A;  1SND A;  4HJ8 A;  5IGF A;  5C3E G;  4FXK C;  1EY4 A;  1X55 A;  3CRK C;  3A8K E;  4JYA L;  1JOO A;  2P5Z X;  4IPG A;  4P71 A;  4HIM A;  2A69 D;  3E9I A;  2F4I A;  1E2V A;  4DXG A;  2O5I C;  1E0B A;  4N8X 1;  3KF6 B;  4GKJ Q;  1FNV A;  1HNW L;  3OSO A;  4MN3 A;  4L5S A;  2AWN A;  4ZKB B;  4QF4 A;  3JC6 6;  2K5N A;  1CSQ A;  4C3H H;  2XIW A;  2IX3 A;  4A3L H;  3E6Z X;  1TKW B;  4KV6 A;  5M3M G;  3DHQ A;  1G51 A;  2PQE A;  4C3J B;  5IOC A;  3W1B A;  3CF5 A;  1AP0 A;  3F2C A;  1QUQ B;  1LV9 A;  2WAQ E;  2UUC Q;  2K5D A;  1WD1 A;  1XTD A;  1VQK A;  1A8V A;  4O1N A;  3S14 B;  1V43 A;  5IYD G;  2LFN A;  5EAY A;  2UXC L;  2LSS A;  1I4G A;  1YHQ A;  5GAH C;  1N36 L;  4LFB L;  2OQK A;  2ZXR A;  5GAD C;  1V9P A;  1VCI A;  2R7Z B;  1ILP A;  4C1N K;  1WTP A;  5COY A;  1RTN A;  3NEM A;  1C7Y A;  1LYL A;  4TKO B;  4DR1 L;  4JYA Q;  3A8J E;  4ZCK A;  1K3B C;  1OTC A;  1KDC A;  4FVM A;  5GAE C;  3GTP H;  2A74 C;  2A5H A;  2DNC A;  1VQD A;  1CSP A;  3VR2 A;  1U0L A;  2A68 C;  1VQJ A;  4TQU S;  1PYW D;  4DNI A;  1MBY A;  3I4O A;  1X3Q A;  2XTI A;  3I4N B;  2Z0S A;  2CH4 W;  3HOX G;  1BCP D;  3BDO A;  2Z6K A;  1VQ4 A;  3S1Q H;  4GNX C;  2KOL A;  1Y69 U;  2D9U A;  3OMG A;  2EYF A;  2KVM A;  1V1O A;  5ELF A;  5CMD A;  1VQ5 A;  3MXN B;  1O7L A;  4X3U A;  4G7O C;  1ENF A;  2CQA A;  3ZJY C;  1WTV A;  1Z47 A;  1PTO C;  1TS2 A;  4MIU A;  4QB4 A;  1DM0 B;  2B8G A;  3KDF B;  2E76 C;  3CCE A;  1BBX C;  2C35 B;  4N8F A;  3SHL A;  3MEH A;  3M4P A;  3PO2 H;  2I46 A;  4JBW A;  4BXX G;  2ZXO A;  3A7L A;  1LT6 D;  1PH5 A;  2JA8 B;  3GDE A;  3LWE A;  3ER0 A;  2F0P A;  4G57 A;  3KLR A;  2R93 H;  4DV6 L;  5J3B A;  3OHX C;  3H15 A;  3CCS A;  2PZU A;  1Y1V H;  1K83 H;  3F1Z A;  1KDA A;  2KCC A;  3SGI A;  1SMX A;  3EQL C;  3QG1 A;  2JN4 A;  4A3E H;  4K14 A;  1CHP D;  2A19 A;  1F9R A;  2L4N A;  3K81 C;  1LTA D;  3PGZ A;  3K0Y A;  1HNX Q;  5C44 B;  1L0W A;  2KUM A;  2Q2T A;  4IUT A;  1FVI A;  2B39 A;  3RNU A;  3E0J A;  5FLX c;  1Q3L A;  3TME A;  5LHY 1;  3S2H B;  4AYB G;  3T1H Q;  4POG A;  2LY7 A;  2BE5 C;  3G7L A;  2PI2 E;  2ICI A;  1HR0 W;  5DM6 3;  1PH2 A;  2N3S A;  2YU9 H;  5I6W A;  4IFD H;  1FL0 A;  2IY5 B;  4A3G B;  5C3E H;  3J7A F;  1HRJ A;  2YU9 B;  2B2W C;  4C3J G;  4HN7 A;  4K0K L;  2EIF A;  1I6H H;  3I8Z A;  2VQF Q;  4BBS G;  1CHQ D;  1UEB A;  1OXS C;  4K8I A;  2EYL A;  3UE0 A;  3J81 c;  1G2T A;  2QIL A;  4IUQ A;  3IAY A;  4LF8 Q;  1TWH H;  3M85 A;  1QVG A;  2A6E D;  4CKE A;  5BN5 A;  1PHJ A;  5I9O A;  5C4X H;  4DV6 Q;  4KMU C;  4A3J H;  3NWT A;  5LL6 S;  4BY1 G;  5KYI A;  2CFM A;  2KED A;  1RDP D;  3T4A C;  4C3H B;  1DJR D;  1HA6 A;  2F0U A;  2K5Q A;  3KFU A;  3HOV G;  1HQM C;  1GD7 A;  3MZ5 A;  1BCP B;  1DCZ A;  5FLX L;  4XT1 B;  1GUT A;  3OTO Q;  1D5X C;  1DOM A;  1R9T H;  2ZM6 L;  1RCV D;  2NTT A;  2KHS A;  3HKZ G;  2IL8 A;  1YHB A;  2R3Z A;  3AMU A;  1JE5 A;  3K6O A;  2VB3 X;  3Q8D A;  1JB7 A;  3SK6 A;  4DV2 Q;  3RMH A;  3W2D A;  2F1M A;  2OT2 A;  4V19 0;  2PZW A;  4JI1 Q;  4YHH L;  2R7F A;  2R7D A;  4MTK A;  2EZV A;  1XMO Q;  3ND8 A;  4Y52 H;  1VQ9 A;  1VQA A;  1BO0 A;  1ENC A;  4DUZ Q;  2JA8 G;  4DR7 L;  1KXL A;  2N55 A;  2E2J H;  2KQ3 A;  1ONL A;  4B08 A;  3WDN A;  4LFC Q;  4S3S A;  4GZY C;  1I4R A;  4C1N I;  5JEA G;  4RHS A;  5CV5 A;  3S2D H;  1H9K A;  1U4L A;  3K57 A;  5ELN A;  3HZX A;  3BZD B;  3R2I A;  5C4J H;  4K2L A;  1HQR D;  2HIX A;  1V1P A;  3CCM A;  1TS4 A;  1G6P A;  4HMI A;  1JB3 A;  4DK0 A;  4JV5 L;  2H1E A;  4IZ8 A;  2YTY A;  1D5Z C;  1U4R A;  1XMQ L;  1VF5 C;  1NNX A;  4KI0 A;  4NW2 A;  3HOX B;  4DR4 L;  1YJN A;  1ZEQ X;  1KLG D;  3I7F A;  2F52 A;  5IT9 E;  1IW7 C;  1SDF A;  5M5W B;  4DV5 L;  2RDG A;  4OX9 L;  1FNW A;  4EQN A;  1L1O B;  3HKZ E;  3PUY A;  5ELO A;  1N34 Q;  2UXB L;  1CQF A;  3W1G A;  1VQI A;  3C3L A;  1ZXT A;  4JOI A;  2VQF L;  3C2P A;  4HCE A;  3PO2 B;  3ERS X;  5IIF A;  5JPM C;  4YHH Q;  1A2U A;  2VB2 X;  2L0C A;  1J5E L;  5JAV A;  2B2T C;  2EYM A;  4PZ8 A;  5IP7 G;  1LT4 D;  4ZAI A;  5K36 H;  2EYP A;  1EYA A;  3N6R A;  2K52 A;  4RKL A;  2PQA A;  4BY7 B;  4JI4 L;  1HCZ A;  4NDX A;  2PYK A;  4AQY L;  4B3R Q;  2F0S A;  1WD0 A;  5KIX A;  4CJ1 B;  3HRZ C;  1DOL A;  2B3G A;  2NB0 A;  5E3F A;  1EYD A;  4KTA A;  4GNX B;  1GJX A;  3TS0 A;  4ZUJ A;  3M4Y A;  5K5P A;  2NVQ B;  3D31 A;  3FPU B;  4KKT A;  1SNC A;  4DR6 Q;  5ELC A;  4EQP A;  3S15 B;  1WTQ A;  1SYG A;  3G48 A;  3UDI A;  3SEB A;  2F4V L;  1D1K A;  2PPB C;  1VQN A;  3GTL B;  1HA5 A;  3PO3 G;  2HDL A;  1I4Q A;  1SE8 A;  4A3K H;  4OWW B;  1JWS D;  3PO3 B;  3NXW A;  1PDQ A;  2F0F A;  2WFW A;  5M5Y H;  3Q6S A;  4YWK A;  4OON A;  1PTO B;  1Y14 B;  3BYT B;  1VF7 A;  3GV3 A;  4JBJ A;  4KD3 A;  4BBR B;  4CBV A;  5LMN W;  2I5L X;  5C4X G;  2GVB A;  5CV7 A;  4A3D B;  2HD3 A;  4FO2 A;  4PQX A;  5BN3 A;  2JEB I;  2WIN B;  3D4D A;  3MAQ A;  4WOR A;  4RA8 A;  1LAB A;  1SAP A;  3H0G G;  1BCP F;  3J80 L;  1PH9 A;  1MGS A;  4KHP Q;  1GUO A;  4BY1 B;  3DEO A;  5IWA L;  4XYQ A;  1KAA A;  3HOY G;  4G7Z C;  5BR8 L;  2RDF A;  1EIF A;  4JW0 A;  2HQE A;  3S1Q B;  1T9H A;  4PMW A;  1K0S A;  4K6D A;  3NBI A;  3I72 A;  1CFM A;  5JVG 3;  4DXF A;  4UP8 A;  1GUW A;  1YJW A;  4DPG A;  4KKU A;  3RR5 A;  3PCO B;  2HQL A;  4AIM A;  4FP5 D;  3T13 A;  1D5M C;  1G8Z D;  3S2D B;  4DGZ A;  5CBE E;  1LLR D;  2BE5 D;  3TSS A;  4QUC A;  5KRU A;  4LF4 Q;  1EQT A;  1Q8K A;  2CW0 D;  4DV1 Q;  2O2L D;  1VDZ A;  3IKJ A;  2JA5 H;  1KRT A;  2ALY B;  3J80 E;  2ZT9 C;  2IT1 A;  4NMZ A;  4X66 L;  1KLU D;  4NXM Q;  1PH8 A;  1TVX A;  4BWG B;  1LTI D;  4HTH A;  1PH7 A;  2R92 H;  3CQZ B;  1TWH B;  2NN6 G;  1XNR Q;  4DK6 C;  4YY3 Q;  4A3B G;  1MSG A;  1RTO A;  1HFN A;  3OIQ A;  3E9H A;  3UDG A;  1SSO A;  2PI2 A;  2UU9 Q;  2E8G A;  4GN5 A;  3BVM A;  1PH3 A;  3GP7 A;  1BCP C;  2NZH A;  4KJO A;  2B2Y C;  2YTV A;  2WAQ G;  1BBW A;  2Z1C A;  1NCV A;  2CWP A;  2QEX A;  1STA A;  4CHT B;  4MZ9 A;  3NEL A;  4B3R L;  2JQO A;  4CDC C;  4IUR A;  2JA6 G;  2BOS A;  1SYF A;  4PZ7 A;  4NKL A;  4MNO A;  3ONA B;  3FP9 A;  1ZYR D;  2F0E A;  1PFS A;  5LMN Q;  4ZK9 B;  3SE0 A;  5FOB B;  2ES2 A;  3I4M H;  3WOF A;  4IPH A;  1S40 A;  1B70 B;  2CKZ B;  4B3S L;  4DK1 A;  1OXX K;  4ME5 A;  3G6J B;  1B2T A;  4QY7 A;  1U9R A;  3PUX A;  3I55 A;  2K6A A;  2NN6 I;  1HTP A;  1B8A A;  1VQ7 A;  2UUB Q;  1HUN A;  2YV5 A;  1Q46 A;  1HH2 P;  1D6E C;  2ZJR A;  1E22 A;  3Q23 A;  4YCU A;  2JP1 A;  5M3M B;  2JSO A;  1UNS A;  1H9S B;  3E3X A;  1HXY D;  2HUG A;  3RLF A;  2CQO A;  2KEN A;  1DYQ A;  1KIX A;  1ICW A;  4RGT A;  4NB3 A;  3AEV A;  1EIG A;  4OWT B;  3W5O A;  1G2S A;  4C2M H;  1VS0 A;  3TEH B;  4X65 L;  4RHR A;  1Q8I A;  2BCO A;  1JT8 A;  1YNN C;  3A0J A;  1S4Z A;  2MPM A;  5G3L D;  4NPS A;  4LUZ A;  4WFN 3;  1EY7 A;  1L1O C;  1V1P B;  3RZD H;  5IGG A;  5FLM H;  1IXR A;  3VDY A;  3T56 B;  1IW7 D;  1RJT A;  3I4N H;  5C4X B;  2HCC A;  3IL8 A;  1Z6H A;  1Z9F A;  1X65 A;  3AU7 A;  2EYH A;  2E5L L;  1QB5 D;  3QJY A;  2MNA A;  1MSH A;  2K32 A;  1NSN S;  2RBM A;  3NWS A;  2LKV A;  5C44 H;  1CZW A;  4YY3 L;  2HHH L;  3SDZ A;  4A3B B;  1N33 Q;  1X9N A;  3QB3 A;  3BVG A;  3HEJ A;  1YIJ A;  2AUJ D;  4CDD C;  2KBN A;  2FMM A;  3C1E A;  4AH6 A;  3TZD A;  4IQZ A;  3FKI H;  5A2Q L;  2KHI A;  2WAC A;  2F0K A;  3V96 A;  2KCN A;  2JA7 B;  3CKI B;  4J6H A;  4XQJ A;  4EQO A;  5C0X I;  4X3S A;  3HOW H;  5KEE A;  1ET9 A;  5AJ3 Q;  3CPW A;  2F0W A;  1YI2 A;  4E6I A;  5C5L A;  3OW2 A;  4QCL A;  5I2Y A;  1L2F A;  1BQQ T;  4DV5 Q;  1VQL A;  1G6Z A;  4JI0 L;  3CU7 A;  2VNU D;  1YNN D;  1WI5 A;  4IFD J;  2KEC A;  2EYJ A;  2WB1 E;  4DV7 L;  1PZK D;  1W2B A;  2KCM A;  1X6O A;  3M9B A;  4DV0 L;  4GLA C;  1MJE A;  3DWP A;  1EY5 A;  1DON A;  1TS3 A;  4X3T A;  4JI0 Q;  2IHE A;  3D0F A;  1SE2 A;  1SRO A;  3HOW B;  4IUV A;  1JJC B;  1X3F A;  2VXW A;  4L5R C;  2JYO A;  1JOQ A;  5M3M H;  1MI2 A;  1ICF B;  4WJW A;  5EPJ A;  1S5B D;  2RHQ B;  2CWA A;  5C6A A;  1T5E A;  2BH8 A;  3NHH A;  4X3K A;  4ZKC B;  3CCR A;  3TN2 A;  5IYD H;  1WYD A;  3A7A B;  3BU2 A;  1J8I A;  1N34 L;  4R4T A;  1P8L A;  5FLX E;  2Y0S B;  1LTG D;  3T1H L;  1RHP A;  1A3V A;  4IOA A;  3ZYY X;  5BN4 A;  1Q86 C;  3QOJ A;  4DKA C;  4GOP A;  2JXM B;  4OIK A;  5M5X B;  4LF6 Q;  4KJN A;  2ZM6 Q;  3WWV A;  5GQO A;  2VW9 A;  5M3F H;  3M3Y B;  1H9S A;  4DFA A;  1IBK L;  4JI4 Q;  2AQ2 B;  1XMQ Q;  2UUC L;  4X65 Q;  4L8J A;  4N9P A;  2V1C C;  3G71 A;  1IYU A;  2OF1 A;  4U67 3;  5F2D A;  3NE5 B;  2OTL A;  2PW7 A;  1GO3 E;  1K8O A;  3V2T A;  3Q0A A;  3NQT A;  3R93 A;  3U9O A;  3S1R B;  3HOX H;  4FF4 A;  1MJC A;  3R3O A;  5M5X H;  4P74 A;  4RAU C;  3A8I E;  3TRZ A;  1F9S A;  5AFW A;  1DOK A;  3MXU A;  1PH4 A;  1XYI A;  3DWQ A;  5LMU L;  3JAM i;  4DU9 A;  2AUK A;  1Y8O B;  1NMG A;  5C0X J;  2A69 C;  2CW0 C;  3GTG H;  2B2W A;  5I6Y A;  1R4P B;  3CAM A;  3OIP A;  1JQY D;  5C3X A;  3C46 A;  4N9T A;  1S5F D;  2WII B;  3KLS A;  1Y1W G;  1TY2 A;  1LTR D;  1U4P A;  4FYD A;  1WCM G;  2K28 A;  3M7N A;  1QCB D;  2DJG C;  1F77 A;  3X3N A;  1WTR A;  2F0Q A;  4LMQ D;  4WJ4 A;  1H95 A;  1F2Y A;  1STB A;  2O5J C;  4IPD A;  4X64 L;  4LF8 L;  1WCM B;  3BVZ A;  3I3C A;  4F87 A;  2F0G A;  2J0T D;  2L1B A;  3ERO A;  1XNQ L;  4X6A H;  1CQV A;  5FJ8 G;  4CDF C;  1FJG L;  1ASY A;  2OQ0 A;  3FKI G;  5J39 A;  2Y0S E;  3K8A A;  5C4H A;  1QUQ A;  2B2V A;  3ERQ A;  3I73 A;  1JJ2 A;  3A54 A;  3DLL A;  4JBM A;  2NVX B;  1ET6 A;  2FFK B;  2PW5 A;  4LK1 C;  2FXQ A;  4FF1 A;  2PZT A;  4K5W A;  1H9R A;  3U4V A;  4AQY Q;  5COR A;  1PRT F;  3ULL A;  1O80 A;  2ZJQ A;  4LF7 L;  4LAA A;  1KAB A;  2C5C A;  1XMO L;  4DV0 Q;  1STY A;  1K0R A;  3NTI A;  5TSS A;  3HOY B;  1C4Q A;  4H0L C;  3EJI A;  1Q90 A;  1EY8 A;  3MVV A;  1AH9 A;  5JJK A;  3T16 A;  3FPP A;  2L11 A;  4A3M B;  1S5E D;  1EL0 A;  3FEW X;  1HNZ Q;  1EWI A;  3TP7 A;  3RN2 A;  3NTK A;  2E2I H;  3LWU A;  4DNT B;  2JK8 A;  2D2C C;  2PO4 A;  1QIL A;  1E2W A;  2G5D A;  4O42 A;  1B1Z A;  3WOE A;  4P72 A;  5FO8 B;  5JJZ A;  4OEL B;  1UE5 A;  1AEX A;  1A6X A;  2I5H A;  1TU2 B;  1PFB A;  4K2K A;  2F0L A;  3DEP A;  2K03 A;  3OMC A;  4R8N A;  3S16 B;  3J80 i;  3CRL C;  1CZG A;  3LX0 A;  2QF7 A;  1PTO H;  5IYB G;  3DWA A;  5I9P A;  2Q8R E;  3A5Z B;  1AFP A;  1R4Q B;  4KHP L;  2N78 A;  1VQE A;  1Q1B A;  2MO0 A;  1I50 H;  3MXP A;  2Q2U A;  2EJM A;  1UE6 A;  2AQ3 B;  2OWO A;  4UPA A;  1SLJ A;  4A3F B;  1B9N A;  1XPU A;  5JJI A;  1EZ6 A;  4DR5 L;  3MWY W;  4PNY A;  2NZO A;  2JA5 B;  1J9O A;  1M1K C;  4GLX A;  2Q2H A;  5CR3 A;  1AZP A;  4DR3 Q;  4JI6 Q;  4EVO A;  4ZYS A;  1EUJ A;  2OEO A;  1OXT A;  2A6H D;  3P1H A;  5JVH 3;  4DUY L;  3KJP A;  3MFG A;  4B3T L;  2JA6 B;  4KHV A;  2HT1 A;  2RHS B;  2A8V A;  4R9W A;  4LFA Q;  3H94 A;  3GTK H;  3LGJ A;  2MHV A;  2ASB A;  4DAY A;  3A56 A;  1CA5 A;  4GLV B;  4JI6 L;  1J6Q A;  5BR8 Q;  4QIW B;  3M4Q A;  1BXT A;  2XN9 C;  2NVQ H;  2LS0 1;  2F0D A;  3AFP A;  1GHJ A;  2RA4 A;  5CV8 A;  4A4I A;  3EIV A;  4BA1 I;  1C9O A;  3ULP A;  1Y8P B;  4JOI C;  1L1O A;  1N36 Q;  4B9W A;  4A3E G;  1EIY B;  1N32 L;  1WJJ A;  1H9J A;  5I4D A;  2L9H A;  3VYU A;  4OO1 I;  4A3M H;  3D6W A;  3NBH B;  2F3I A;  4A3D G;  2L12 A;  4DR4 Q;  4K5V A;  2RVL A;  2QEJ C;  4ODG A;  1TII D;  5EKI A;  5C3W A;  2IHF A;  2K1B A;  1A62 A;  2FMC A;  4BA2 I;  3I2Z A;  2A73 B;  4R1J A;  2F0V A;  2PQA B;  5CV9 A;  4RH6 A;  4JCV E;  3L2P A;  4A3J G;  5HGQ A;  3F2U A;  4C2M B;  4ULL A;  3M7G A;  3G4S A;  2QCP X;  4GKK Q;  1BDO A;  4P75 A;  4FXG C;  1R9T B;  3STB C;  1IKM A;  1B3A A;  3GTQ B;  1TWF B;  2PNH A;  3J7Y W;  1I6H B;  2B2U C;  3W3A A;  1AN8 A;  4HIK A;  2K4K A;  4PZ6 A;  5EBC A;  3VR4 A;  3H6M A;  2Q2I A;  3DXJ C;  1E1O A;  1PH1 A;  1GUN A;  2ZXP A;  5IT9 c;  5IT9 L;  4A3K B;  3FRP B;  3P20 A;  2K7V A;  3FHW A;  4L5Q A;  3QR8 A;  2DJF C;  4YWL A;  3GTJ H;  1YJ9 A;  1E1T A;  2B63 H;  2TSS A;  3GV6 A;  2JE6 I;  3NP8 A;  5IP9 G;  2N88 A;  2VUM G;  4IN3 A;  5JEA H;  3NBH A;  3ND9 A;  1FYC A;  4A3I G;  1FGB D;  1KD1 C;  4JI2 L;  3KLW A;  1F2M A;  1IHZ A;  1ROD A;  4ZRZ A;  4R4I A;  4B9X A;  4JPB W;  4ZQ3 A;  2R7Z H;  1UEA B;  3HFZ B;  1Y1V B;  3STB D;  1Q1E A;  4UAI A;  1BF4 A;  1SNQ A;  4FDB A;  4EGV A;  3HOZ G;  1PTO F;  3BDC A;  2NUC A;  1XX8 A;  4OGQ C;  5E1F A;  2IWH A;  2BA1 A;  4HID A;  4XYO A;  2D0P A;  3CP0 A;  4MTN A;  3CCQ A;  2JA9 A;  1EEI D;  2EDG A;  2WB1 G;  2K75 A;  1UWV A;  4NXN Q;  1UUP A;  3CQZ H;  3M4O B;  4L63 B;  5C0X H;  5KYL A;  2K5W A;  3I91 A;  4HJ7 A;  2LXJ A;  2XWB B;  4HR7 B;  1MKH A;  4ZUI A;  5A35 A;  1JOK A;  4LF5 L;  4BY7 G;  5KGU A;  2E75 C;  1NR2 A;  2A1A A;  2DGY A;  4HJ9 A;  4FNF A;  4OWX B;  4DN4 M;  1ASZ A;  4A3G H;  1O7Z A;  2K5V A;  1UE7 A;  4IUN A;  2F0T A;  4NXN L;  2K14 A;  2VY3 A;  3KF8 A;  2VQE Q;  2RSN A;  3R2T A;  4TRD A;  1PYS B;  5LMU Q;  2V4D A;  3KK7 A;  1SJE D;  2F0I A;  5IP7 H;  4X66 Q;  3HOU G;  1Q82 C;  4L6T B;  2FJ2 A;  3I70 A;  4BBS B;  1PRT B;  3VR6 A;  1TWC H;  5KND A;  1PZJ D;  4B3S Q;  3S1M H;  4I7A A;  5IYC H;  2UXD L;  4G4K A;  1IBK Q;  4A76 A;  3J81 E;  4YIJ A;  1IL2 A;  1MD2 D;  5IGB A;  1WTH A;  4RGM A;  2EPB A;  3GTM H;  4KY5 A;  2XVS A;  2SNM A;  2GN5 A;  5CBA E;  3K0X A;  2DY7 A;  1VQM A;  2A68 D;  4B3M Q;  5K36 G;  1VQO A;  2H5X A;  3RZO H;  1KC8 C;  1YHA A;  4J15 A;  3RLO A;  1ENA A;  3KLS X;  3KYH C;  1HFG A;  2R92 B;  5JOB A;  2Z8L A;  2RF4 A;  4ZLT F;  2G9D A;  2EJF C;  1D8L A;  4A3D H;  4A3E B;  3BDL A;  3MFY A;  4BBR H;  5DM7 3;  5IGE A;  2RKS A;  1M4V A;  3BJU A;  3HKS A;  4XIG S;  1KQS A;  2L55 A;  1VQF A;  1IZ6 A;  4KD4 A;  4GKK L;  3Q24 A;  5IOD A;  2EY5 A;  3UI2 A;  3A55 A;  3VR5 A;  5DNF A;  4DR1 Q;  4KN7 C;  3HOZ B;  3S24 A;  1E7Z A;  5M3F B;  3M3Y H;  1O7Y A;  1J5E Q;  2H4O A;  1X32 A;  4R8I A;  1NBW A;  3VYS A;  3GQB A;  2VS1 A;  3NSW A;  1K28 A;  3T1Y L;  5DAU A;  1S3O A;  1IBL Q;  4F8M A;  2VUM B;  3TBI B;  4JK1 C;  3CC2 A;  1HHV A;  2Z9H A;  3JAM c;  1SEB D;  1HNZ L;  3FKI B;  3EA6 A;  4GS3 A;  2QGQ A;  3RLN A;  4DR7 Q;  1JWU D;  1TWG H;  1W6J A;  3P7J A;  4HAE A;  4DR6 L;  2YYZ A;  3KDF A;  3TP5 A;  5J22 A;  2R6G A;  2MFI A;  3S2H H;  5IP9 H;  5GAG C;  2VUM H;  1PVO A;  1PLF A;  4A3I H; 
#chains in the Genus database with same CATH homology
 4RGN A;  3GD7 A;  2M00 A;  1A3U A;  3D4W A;  5EPL A;  1WTX A;  4OO1 G;  4UDU C;  1F9Q A;  1I4H A;  1ZKO A;  4AYB B;  1S5D D;  4IUU A;  1Z7T A;  3FDT A;  2RQX A;  1I50 B;  3L3O C;  4XTC S;  3PMF A;  3SR1 A;  1RD9 D;  4K8J A;  5NUC A;  2FIN B;  1QG7 A;  2NTS A;  1WTO A;  2MJ8 A;  5G3L F;  3R8B A;  3EFX D;  1PRT D;  1PMR A;  4H7B A;  3RZO B;  1PFM A;  3TP8 A;  2A6E C;  4RKB A;  5HUR A;  1SE4 A;  5C4J B;  2Z4I A;  1EYC A;  4CKB A;  2IX1 A;  4BS9 A;  2G9H D;  2Q8I B;  2XNA C;  2B63 B;  1V8Q A;  1F9P A;  1L0Y B;  3PIO 3;  3BYY B;  4RFB A;  4C3H G;  2CHB D;  5LL6 X;  2L5T A;  4RCN A;  1SNP A;  5CV6 A;  5E4W C;  4XT3 B;  2X69 A;  1B53 A;  1XTC D;  3N52 A;  1EU3 A;  5T1G A;  3OPO A;  3HKZ B;  2QKI C;  3OWE B;  2R61 A;  3QIA A;  1ILQ A;  2EY2 A;  3OW7 A;  5EGT A;  1I6V C;  5FO7 B;  1PZI D;  5A2Q E;  4XQN A;  1C48 A;  1EU4 A;  1FD7 D;  1SMY D;  1G29 1;  5ELE A;  1SYB A;  5IGD A;  2BDO A;  1PTO D;  1F2Z A;  1DD2 A;  1VMP A;  2BDN A;  4U68 A;  3D8G A;  2EY6 A;  1II3 A;  1PRT C;  2NVY B;  3I90 A;  3HP3 A;  3OWF A;  2B2V C;  5D3D A;  1JOR A;  3S9W A;  3MTS A;  3J7A V;  1ML0 D;  1I3Q B;  1CM9 A;  3MA2 B;  1CTM A;  3GTO B;  5EKK A;  2D5D A;  1QJO A;  1SYE A;  5ISR A;  2F3V A;  1KTK A;  2OXP A;  3HS0 C;  3K7A B;  4OO1 H;  1E2Z A;  4G7H C;  2PMZ B;  3MXG A;  1STE A;  2PNR C;  2HDM A;  2K33 A;  1FNU A;  1JC7 A;  3FVQ A;  4HSV A;  2ID0 A;  4ID6 A;  2DNE A;  1H9M A;  3T53 B;  2M2L A;  2WKD A;  3K5M A;  4PMB A;  2EE1 A;  1I4X A;  5CV4 A;  1IYV A;  4H13 C;  3K5L A;  4XDX A;  3S1M B;  2O4X A;  1LTB D;  4DF7 A;  3DMU A;  4M8A A;  4Q5V A;  1SMY C;  4XQQ A;  3H09 A;  1AW7 A;  2KJX A;  4WRD A;  3JAM L;  4A93 B;  2NWG A;  3QWN A;  5CGK A;  2X6G A;  3TZU A;  1TR5 A;  3BS1 A;  2MUY A;  3RZD B;  4IFD I;  4KKS A;  4C3I B;  3VA5 A;  3VA7 A;  3MC0 B;  3DM1 A;  2B8F A;  1OO9 B;  5ELB A;  3MXN A;  1B44 D;  5C4Z A;  2K01 A;  2E2D C;  1BUV T;  1DZ1 A;  4FF3 A;  1SJH D;  2J4X A;  3H0G B;  1NUC A;  1BOS A;  2IX0 A;  1GUG A;  2SEB D;  1EEF D;  5I2X A;  3KBX A;  1TWC B;  2NZ1 D;  3GTP B;  1S5C D;  1F2L A;  3MHB A;  5D14 A;  3TDQ A;  4QUF A;  2QDB A;  2Q8T A;  1TWG B;  1LT5 D;  1X3P A;  1CK1 A;  2RDH A;  1EFI D;  1PXU A;  2E74 C;  2K05 A;  1HTL D;  4KN4 C;  3P75 A;  5T1I A;  1STG A;  2XRS D;  1JR0 D;  3GTG B;  2XWJ B;  1KNA A;  4IFD G;  3PUV A;  2WAQ B;  5EBD A;  1CT1 D;  3RUZ A;  4DNR B;  1EOT A;  2EVB A;  3J81 L;  2B2T A;  3NK9 A;  5FK9 C;  1CA6 A;  3QOL A;  2HCI A;  1TQO A;  3K5N A;  1TT2 A;  1LTT D;  5KNB A;  4Y7N B;  1PFN A;  1UAP A;  1SYD A;  1KNE A;  1WVL A;  2NBF A;  2CVR A;  1BNZ A;  1OXU A;  3GTJ B;  2WKC A;  3DUZ A;  3I4L A;  4P2C B;  3GTM B;  4V0B A;  2E2J B;  1GHK A;  3KUP A;  1RF2 D;  3S1N B;  1K8M A;  1ZYR C;  3V05 A;  1IL8 A;  1GOZ A;  5EPK A;  1NR4 A;  1B4O A;  5FKA C;  1SNO A;  3D6C A;  1TY0 A;  2JEA I;  3K58 A;  1IKL A;  1STH A;  1SXT A;  4K5X A;  1YNJ C;  4KY6 A;  3S17 B;  3O13 A;  4PV1 C;  1JIC A;  3H91 A;  1Q12 A;  1JCK B;  1LT3 D;  3EVQ A;  1NAP A;  1KDB A;  2K04 A;  1L0X B;  2WV6 D;  3K59 A;  2Z4H A;  5DEH A;  1Y1W B;  1TWA B;  2ICE C;  2B2Y A;  2F3W A;  4J1M A;  5CYU A;  1WTW A;  5EKL A;  2MGS A;  3NQI A;  1SE3 A;  4CJ0 B;  3PUZ A;  2MP1 A;  1Y8N B;  2F0O A;  1XWE A;  3VYR A;  2DN8 A;  4HCS A;  4NP5 A;  4IUP A;  3KBG A;  2TMP A;  3Q22 A;  4CJ2 C;  4DA2 A;  3L9A X;  1OXV A;  1A2T A;  1A3T A;  5FO9 B;  4ABN A;  2A6H C;  1HUM A;  1SYC A;  2SNS A;  3PV0 A;  4I65 A;  5M5Y B;  1ESR A;  3VYT A;  1LTS D;  2ENB A;  2WP8 J;  4M1U B;  3E5S A;  1XXG A;  4C56 C;  2SOB A;  5M9O A;  3VR3 A;  2B2U A;  4KK7 A;  1YNJ D;  2DY8 A;  3AB9 A;  1B9M A;  4I7Z C;  3SK4 A;  4RCO A;  2EY1 A;  4Z9C B;  2NVT B;  3PIP 3;  4HMJ A;  3T51 B;  4CKC A;  1GUS A;  1LO5 D;  4Q0F A;  5C5M A;  3FMC A;  4OL7 A;  3SXH A;  5HGT A;  3IFT A;  1QWY A;  3I4M B;  3H3V C;  3U9S A;  2C9O A;  1TS5 A;  5J1Z A;  5KNC A;  1K83 B;  2PCF B;  1EY6 A;  3HG9 A;  3D3R A;  3RD4 A;  5EJW A;  3BG3 A;  1EQV A;  1A15 A;  4A3J B;  1B50 A;  2SDF A;  4FXD A;  4DAV A;  1T5X D;  5CC4 A;  3OOC A;  2F03 A;  2IJ0 A;  1QNK A;  1EWH A;  4ILW A;  4LJZ C;  1RKN A;  2I07 B;  4OIJ A;  4XXE A;  2BA0 A;  5JPN C;  4MHE A;  3L7Z C;  4DAP A;  3JAM E;  1D2B A;  5C3E B;  1LAC A;  2NN6 H;  1JE4 A;  5C0X G;  4F7X A;  2LMC B;  2FHT A;  3PUW A;  1DXM A;  2IW3 A;  5D3I B;  1BR9 A;  1VMC A;  1ESF A;  2EOT A;  2X6L A;  4KHZ A;  5ELD A;  1W6K A;  1GXD C;  2AWO A;  5D65 A;  1SBB B;  1U4M A;  4KY7 A;  3GO5 A;  3X3M A;  4PMC A;  2R93 B;  4HED A;  1I4P A;  3ITP A;  1SFO B;  3NPP A;  5IGC A;  2KEE A;  3NUC A;  2RSO A;  2E2H B;  3TP6 A;  1CI3 M;  4TSS A;  2AQ1 B;  2M9V A;  3LNN A;  1QNU A;  3HOV B;  3NTH A;  2EXZ A;  1QE6 A;  1QOH A;  1M8A A;  2F0M A;  2J7Z A;  1EY0 A;  4OHJ A;  2XRQ D;  3QO2 A;  4H44 C;  4J8Q A;  3SK5 A;  4RWS C;  3SVM A;  2EYO A;  2NYZ D;  1HPC A;  3CHB D;  2F0J A;  1SNM A;  5JEA J;  3IFD A;  3GTK B;  2E2I B;  1D1I A;  1EY9 A;  2GA4 B;  3HGB A;  4HSP A;  2F0N A;  2WB1 B;  1STN A;  2D62 A;  1EIH A;  4K6L A;  4RGO S;  1EWC A;  3D4R A;  3SK8 A;  2XSC A;  4FF2 A;  2KA7 A;  4QMG A;  1EZ8 A;  1FR3 A;  4C3I G;  1O78 A;  2EJG C;  3K5O A;  5E4X A;  4A3I B;  3URY A;  5EQ0 A;  1JWM D;  1AZQ A;  3HOU B;  2IPK D;  4IAL A;  4F88 A;  3C1F A;  4CGY B;  2F0H A;  1C8C A;  1G91 A;  1SND A;  5IGF A;  4FXK C;  1EY4 A;  3CRK C;  3A8K E;  1JOO A;  2A69 D;  2F4I A;  1E2V A;  4DXG A;  2O5I C;  1E0B A;  1FNV A;  3OSO A;  4MN3 A;  2AWN A;  4ZKB B;  4QF4 A;  2XIW A;  2IX3 A;  3E6Z X;  1TKW B;  4KV6 A;  3DHQ A;  2PQE A;  4C3J B;  5IOC A;  1AP0 A;  1LV9 A;  2K5D A;  1WD1 A;  4O1N A;  3S14 B;  1V43 A;  2LFN A;  1I4G A;  2ZXR A;  1VCI A;  2R7Z B;  1ILP A;  4C1N K;  1WTP A;  5COY A;  1RTN A;  4TKO B;  3A8J E;  1KDC A;  4FVM A;  2A74 C;  2A5H A;  2DNC A;  3VR2 A;  2A68 C;  4TQU S;  1PYW D;  1MBY A;  1X3Q A;  3I4N B;  1BCP D;  3BDO A;  2KOL A;  1Y69 U;  2D9U A;  3OMG A;  2EYF A;  2KVM A;  1V1O A;  5ELF A;  5CMD A;  1O7L A;  4X3U A;  4G7O C;  1ENF A;  2CQA A;  1WTV A;  1Z47 A;  1PTO C;  1TS2 A;  4MIU A;  4QB4 A;  1DM0 B;  2B8G A;  2E76 C;  1BBX C;  3SHL A;  3MEH A;  2I46 A;  4JBW A;  2ZXO A;  3A7L A;  1LT6 D;  2JA8 B;  3LWE A;  2F0P A;  4G57 A;  3KLR A;  3OHX C;  2PZU A;  1KDA A;  2KCC A;  3EQL C;  3QG1 A;  4K14 A;  1CHP D;  1F9R A;  2L4N A;  1LTA D;  3K0Y A;  5C44 B;  2KUM A;  4IUT A;  2B39 A;  3E0J A;  1Q3L A;  3TME A;  5LHY 1;  3S2H B;  2LY7 A;  2BE5 C;  3G7L A;  2ICI A;  5DM6 3;  5I6W A;  4IFD H;  4A3G B;  3J7A F;  1HRJ A;  2YU9 B;  2B2W C;  4C3J G;  4HN7 A;  3I8Z A;  1CHQ D;  1OXS C;  4K8I A;  2EYL A;  1G2T A;  2QIL A;  4IUQ A;  3IAY A;  3M85 A;  2A6E D;  4CKE A;  5BN5 A;  5I9O A;  4KMU C;  3NWT A;  5LL6 S;  5KYI A;  2KED A;  3T4A C;  1RDP D;  4C3H B;  1DJR D;  1HA6 A;  2F0U A;  2K5Q A;  1HQM C;  3MZ5 A;  1BCP B;  1DCZ A;  5FLX L;  4XT1 B;  1GUT A;  1DOM A;  1D5X C;  1RCV D;  2NTT A;  2KHS A;  2IL8 A;  2R3Z A;  3AMU A;  3K6O A;  2VB3 X;  3SK6 A;  3RMH A;  3W2D A;  2F1M A;  2OT2 A;  4V19 0;  2PZW A;  2EZV A;  3ND8 A;  1BO0 A;  1ENC A;  2N55 A;  2KQ3 A;  1ONL A;  4B08 A;  3WDN A;  4S3S A;  4GZY C;  1I4R A;  4C1N I;  5JEA G;  4RHS A;  5CV5 A;  1H9K A;  1U4L A;  3K57 A;  3HZX A;  3BZD B;  3R2I A;  4K2L A;  1HQR D;  1V1P A;  1TS4 A;  4HMI A;  1JB3 A;  4DK0 A;  2H1E A;  4IZ8 A;  1D5Z C;  1U4R A;  1VF5 C;  4KI0 A;  4NW2 A;  3HOX B;  1ZEQ X;  1KLG D;  5IT9 E;  1IW7 C;  1SDF A;  5M5W B;  2RDG A;  1FNW A;  4EQN A;  3PUY A;  1CQF A;  3C3L A;  1ZXT A;  3C2P A;  4HCE A;  3PO2 B;  5IIF A;  5JPM C;  1A2U A;  2VB2 X;  2L0C A;  5JAV A;  2B2T C;  2EYM A;  1LT4 D;  4ZAI A;  5K36 H;  2EYP A;  1EYA A;  3N6R A;  4RKL A;  4BY7 B;  1HCZ A;  4NDX A;  2PYK A;  2F0S A;  1WD0 A;  5KIX A;  4CJ1 B;  3HRZ C;  1DOL A;  2NB0 A;  5E3F A;  1EYD A;  4KTA A;  1GJX A;  4ZUJ A;  3M4Y A;  5K5P A;  2NVQ B;  3D31 A;  3FPU B;  4KKT A;  1SNC A;  5ELC A;  4EQP A;  3S15 B;  1WTQ A;  1SYG A;  3SEB A;  1D1K A;  2PPB C;  3GTL B;  1HA5 A;  2HDL A;  1I4Q A;  1JWS D;  3PO3 B;  3NXW A;  1PDQ A;  2F0F A;  3Q6S A;  1PTO B;  3BYT B;  1VF7 A;  3GV3 A;  4KD3 A;  4BBR B;  4CBV A;  5CV7 A;  4A3D B;  4FO2 A;  5BN3 A;  4PQX A;  2JEB I;  2WIN B;  3D4D A;  3MAQ A;  4WOR A;  4RA8 A;  1LAB A;  1SAP A;  1BCP F;  3J80 L;  1MGS A;  1GUO A;  4BY1 B;  3DEO A;  4XYQ A;  1KAA A;  4G7Z C;  2RDF A;  2HQE A;  3S1Q B;  4PMW A;  4K6D A;  3NBI A;  3I72 A;  1CFM A;  5JVG 3;  4DXF A;  1GUW A;  4KKU A;  4FP5 D;  3T13 A;  1D5M C;  1G8Z D;  3S2D B;  4DGZ A;  5CBE E;  1LLR D;  2BE5 D;  3TSS A;  4QUC A;  5KRU A;  1EQT A;  2CW0 D;  2O2L D;  1VDZ A;  3IKJ A;  3J80 E;  2ZT9 C;  2IT1 A;  4NMZ A;  1KLU D;  1TVX A;  4BWG B;  1LTI D;  4HTH A;  3CQZ B;  1TWH B;  2NN6 G;  1MSG A;  1RTO A;  1HFN A;  3OIQ A;  1SSO A;  3BVM A;  3GP7 A;  1BCP C;  4KJO A;  2B2Y C;  2Z1C A;  1NCV A;  1STA A;  4CHT B;  4IUR A;  2BOS A;  1SYF A;  4NKL A;  3ONA B;  1ZYR D;  2F0E A;  4ZK9 B;  3SE0 A;  5FOB B;  3WOF A;  4DK1 A;  1OXX K;  4ME5 A;  3G6J B;  1B2T A;  1U9R A;  3PUX A;  2K6A A;  2NN6 I;  1HTP A;  1HUN A;  1D6E C;  3Q23 A;  2JP1 A;  5M3M B;  2JSO A;  1UNS A;  1H9S B;  1HXY D;  2HUG A;  3RLF A;  1DYQ A;  1ICW A;  4RGT A;  1EIG A;  1G2S A;  4RHR A;  1Q8I A;  2BCO A;  1YNN C;  1S4Z A;  2MPM A;  5G3L D;  4WFN 3;  1EY7 A;  1V1P B;  5IGG A;  3T56 B;  1IW7 D;  1RJT A;  5C4X B;  2HCC A;  3IL8 A;  1Z6H A;  3AU7 A;  2EYH A;  1QB5 D;  3QJY A;  1MSH A;  2K32 A;  1NSN S;  2RBM A;  3NWS A;  2LKV A;  1CZW A;  3SDZ A;  4A3B B;  3QB3 A;  3BVG A;  3HEJ A;  2AUJ D;  2FMM A;  3C1E A;  3TZD A;  4IQZ A;  5A2Q L;  2WAC A;  2F0K A;  3V96 A;  2KCN A;  2JA7 B;  3CKI B;  4J6H A;  4XQJ A;  4EQO A;  5C0X I;  4X3S A;  5KEE A;  1ET9 A;  2F0W A;  4E6I A;  5C5L A;  4QCL A;  5I2Y A;  1BQQ T;  1G6Z A;  3CU7 A;  2VNU D;  1YNN D;  4IFD J;  2KEC A;  2EYJ A;  1PZK D;  3DWP A;  1EY5 A;  1DON A;  1TS3 A;  4X3T A;  1SE2 A;  3HOW B;  4IUV A;  2VXW A;  2JYO A;  1JOQ A;  1MI2 A;  4WJW A;  5EPJ A;  1S5B D;  5C6A A;  4ZKC B;  1T5E A;  3NHH A;  4X3K A;  3TN2 A;  3A7A B;  1J8I A;  5FLX E;  2Y0S B;  1LTG D;  1A3V A;  1RHP A;  3ZYY X;  5BN4 A;  3QOJ A;  2JXM B;  4OIK A;  5M5X B;  4KJN A;  3M3Y B;  1H9S A;  4DFA A;  2AQ2 B;  4L8J A;  4N9P A;  1IYU A;  2OF1 A;  4U67 3;  5F2D A;  3NE5 B;  2PW7 A;  1K8O A;  3V2T A;  3Q0A A;  3NQT A;  3R93 A;  3U9O A;  3S1R B;  4FF4 A;  3R3O A;  4RAU C;  3A8I E;  1F9S A;  5AFW A;  1DOK A;  3MXU A;  1XYI A;  3DWQ A;  4DU9 A;  2AUK A;  1Y8O B;  5C0X J;  2A69 C;  2CW0 C;  2B2W A;  5I6Y A;  1R4P B;  3OIP A;  1JQY D;  5C3X A;  3C46 A;  4N9T A;  1S5F D;  2WII B;  3KLS A;  1TY2 A;  1LTR D;  1U4P A;  4FYD A;  2K28 A;  3M7N A;  1QCB D;  3X3N A;  1F77 A;  1WTR A;  2F0Q A;  4LMQ D;  1F2Y A;  1STB A;  2O5J C;  1WCM B;  3BVZ A;  3I3C A;  4F87 A;  2F0G A;  2J0T D;  2L1B A;  3ERO A;  1CQV A;  5J39 A;  5C4H A;  2B2V A;  3ERQ A;  3I73 A;  3A54 A;  2NVX B;  1ET6 A;  2FFK B;  2PW5 A;  4LK1 C;  4FF1 A;  2PZT A;  4K5W A;  1H9R A;  5COR A;  1PRT F;  1O80 A;  4LAA A;  1KAB A;  2C5C A;  1STY A;  3NTI A;  5TSS A;  3HOY B;  1C4Q A;  4H0L C;  3EJI A;  1Q90 A;  1EY8 A;  3MVV A;  3T16 A;  3FPP A;  2L11 A;  4A3M B;  1S5E D;  1EL0 A;  3FEW X;  3TP7 A;  3NTK A;  3LWU A;  4DNT B;  2D2C C;  2PO4 A;  1QIL A;  1E2W A;  4O42 A;  1B1Z A;  3WOE A;  5FO8 B;  5JJZ A;  1AEX A;  1A6X A;  1TU2 B;  1PFB A;  4K2K A;  2F0L A;  3DEP A;  2K03 A;  3OMC A;  4R8N A;  3S16 B;  3CRL C;  1CZG A;  3LX0 A;  2QF7 A;  1PTO H;  3DWA A;  5I9P A;  2Q8R E;  1AFP A;  1R4Q B;  3MXP A;  1Q1B A;  2EJM A;  2AQ3 B;  4A3F B;  1B9N A;  1EZ6 A;  3MWY W;  4PNY A;  2JA5 B;  1J9O A;  5CR3 A;  1AZP A;  4EVO A;  4ZYS A;  2OEO A;  1OXT A;  2A6H D;  3P1H A;  5JVH 3;  3MFG A;  2JA6 B;  4KHV A;  4R9W A;  3H94 A;  2MHV A;  4DAY A;  3A56 A;  1CA5 A;  4QIW B;  1BXT A;  2XN9 C;  2LS0 1;  2F0D A;  1GHJ A;  2RA4 A;  5CV8 A;  4BA1 I;  1Y8P B;  4B9W A;  1H9J A;  5I4D A;  2L9H A;  3VYU A;  4OO1 I;  3D6W A;  2L12 A;  4K5V A;  2RVL A;  2QEJ C;  4ODG A;  1TII D;  5EKI A;  5C3W A;  2K1B A;  2FMC A;  4BA2 I;  2A73 B;  2F0V A;  5CV9 A;  4RH6 A;  3F2U A;  4C2M B;  4ULL A;  3M7G A;  2QCP X;  1BDO A;  4FXG C;  1R9T B;  1IKM A;  1B3A A;  3GTQ B;  1TWF B;  3J7Y W;  1I6H B;  2B2U C;  3W3A A;  1AN8 A;  5EBC A;  3VR4 A;  3H6M A;  3DXJ C;  1GUN A;  2ZXP A;  5IT9 L;  4A3K B;  3FRP B;  3P20 A;  2K7V A;  2TSS A;  3GV6 A;  2JE6 I;  3NP8 A;  2N88 A;  4IN3 A;  5JEA H;  3NBH A;  3ND9 A;  1FYC A;  1FGB D;  1F2M A;  1IHZ A;  1ROD A;  4ZRZ A;  4B9X A;  4ZQ3 A;  1UEA B;  1Y1V B;  1Q1E A;  4UAI A;  1BF4 A;  1SNQ A;  4EGV A;  1PTO F;  3BDC A;  2NUC A;  1XX8 A;  4OGQ C;  5E1F A;  2IWH A;  2BA1 A;  4XYO A;  1EEI D;  2EDG A;  1UUP A;  3M4O B;  4L63 B;  5C0X H;  5KYL A;  2K5W A;  3I91 A;  2XWB B;  4HR7 B;  4ZUI A;  5A35 A;  1JOK A;  5KGU A;  2E75 C;  1NR2 A;  4FNF A;  4DN4 M;  1O7Z A;  4IUN A;  2F0T A;  3KF8 A;  2RSN A;  3R2T A;  4TRD A;  2V4D A;  3KK7 A;  1SJE D;  2F0I A;  2FJ2 A;  4L6T B;  3I70 A;  4BBS B;  1PRT B;  3VR6 A;  5KND A;  1PZJ D;  4G4K A;  3J81 E;  4YIJ A;  1MD2 D;  5IGB A;  4RGM A;  2EPB A;  4KY5 A;  2XVS A;  2SNM A;  5CBA E;  2DY7 A;  2A68 D;  5K36 G;  1ENA A;  3KLS X;  1HFG A;  2R92 B;  5JOB A;  2Z8L A;  4ZLT F;  2G9D A;  2EJF C;  4A3E B;  3BDL A;  3MFY A;  5DM7 3;  5IGE A;  2RKS A;  1M4V A;  4XIG S;  2L55 A;  4KD4 A;  3Q24 A;  5IOD A;  2EY5 A;  3UI2 A;  3A55 A;  3VR5 A;  5DNF A;  4KN7 C;  3HOZ B;  5M3F B;  1O7Y A;  2H4O A;  1X32 A;  4R8I A;  3VYS A;  3GQB A;  3NSW A;  5DAU A;  4F8M A;  2VUM B;  3TBI B;  4JK1 C;  1HHV A;  1SEB D;  3FKI B;  3EA6 A;  1JWU D;  1W6J A;  3P7J A;  4HAE A;  2YYZ A;  3TP5 A;  5J22 A;  2R6G A;  1PLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...