1R4QB

Shiga toxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
b'TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHT cytotoxin A subunit
publication title Structure of Shiga Toxin Type 2 (Stx2) from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Shigella dysenteriae
molecule tags Toxin
total genus 18
structure length 69
sequence length 69
chains with identical sequence C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2003-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1r4qB00
1CZWA 4M1UB 1D1IA 4ULLA 2XSCA 1C48A 1QOHA 1CQFA 4P2CB 2C5CA 1CZGA 1R4PB 3MXGA 1C4QA 2GA4B 1QNUA 1R4QB 1BOSA 2BOSA 1D1KA 1DM0B
chains in the Genus database with same CATH superfamily
3R2IA 4IALA 1SMXA 4R8NA 3JC66 4JW0A 5ISRA 5AJ3L 1QILA 3JAME 1NSNS 3S9WA 2A5HA 4JV5L 2PI2E 4Z9CB 2AUKA 5FLMG 2B2WC 2EYMA 5IGEA 4DV5L 1AH9A 2VQFQ 2PNHA 3NENA 2BE5D 1LTTD 2PMZE 5ELEA 1D6EC 3CQZB 1YVCA 3MZ5A 1Z7TA 4A3MG 2JA8G 1SNOA 2KHJA 1HQMC 5IYCH 1LT5D 1STHA 4A76A 1VDZA 5EPJA 4A3BH 1M4VA 3OWFA 3PUYA 4L5TA 3TSSA 1Q82C 1RIPA 1GVPA 3KF8A 4IUTA 2HHHL 1N32L 3GTKH 1EUJA 1D2BA 4MTNA 5EBCA 1VQHA 5I9OA 1BCPD 2F0TA 3O13A 1ONLA 2N88A 2QF7A 3RLOA 3K5NA 2RDGA 2XGTA 4M1UB 5I2XA 3J7A5 3NP8A 1BR9A 1H9JA 4APVA 1KNEA 4X6AH 2XVSA 1UAPA 2F0FA 2IWHA 3S14B 2K4KA 1BDOA 4DF7A 4A3FB 1JOOA 3K7AH 1C7YA 1HZ9A 1PHJA 3CXCA 1Q86C 4S3SA 4N9TA 1LO5D 3AQQA 5C4JB 2IX1A 4BBRH 3KJPA 1S5CD 1S40A 4F88A 1TWCB 2CKZB 3PGZA 2MO1A 3AFPA 4BWGB 3S1RH 4DV7L 5C5MA 1FGBD 1F77A 3KOJA 1UNSA 2F0OA 4L5SA 4OX9Q 1EYGA 3B6YA 4NW2A 4KJNA 1YNXA 1SJED 1VQJA 3R2TA 3FKIH 4ZRZA 2FHTA 2ZTCA 3URYA 4JI0Q 1B7YB 2EJMA 2OQ0A 2PW5A 4A3EH 1QVFA 2GA4B 3VR3A 2JA6B 2JEBI 2A68C 2Q2TA 2B63B 1WTXA 2B2YC 3TZDA 2J0TD 2J4XA 4B3SL 3M3YH 3Q23A 4PMWA 3IKJA 1Z9FA 2PZTA 1QZGA 1Q1BA 3MXNA 4GKJL 4MNOA 3MVVA 2F0MA 3EIVA 4DKAC 5LMUL 1XPUA 1Y8PB 4POFA 2LSSA 3PUVA 1ESRA 2CFMA 1KIXA 4JCVE 1SE8A 2MUYA 4LFCL 2VUMH 4ZLTF 1RODA 1N9WA 4A75A 3BYTB 1J6QA 1HUMA 5ELCA 1AN8A 2JK8A 4C2MB 1KAAA 5C44G 4B3TL 1EYDA 5IYDH 4BBSH 1EIFA 1HNXQ 4C3IH 4JI1L 5IGCA 1WFQA 1FNVA 1LM0A 3GTMB 1SMYD 2NN6H 1XNQL 3H0GG 4HR7B 3BVGA 4A3DG 4FF4A 1C4QA 3OW2A 3SK6A 1QUQB 3A54A 2EVBA 4YIJA 4HIOA 3GTGB 4PNYA 5I9PA 3S2HB 1KD1C 4IUUA 1HUNA 2RSNA 1TXYA 1Q3LA 1HNZQ 4RA8A 1HNWQ 2RF4A 4RHRA 4K5VA 5JJIA 4QQBX 3K57A 3NBHA 3I4OA 3QO2A 5IIFA 3CHBD 4DV2Q 4AQYL 1G2SA 1U5KA 1UEAB 4A3KH 2G9DA 4A3JH 4DV4L 4HN7A 1CQVA 5IP9G 1UE5A 1WTRA 2K5NA 4H0LC 1K0SA 4KJOA 2L11A 2J7ZA 1DM0B 1JE4A 4LF9Q 4OWWB 3ICEA 2C35B 4LAAA 4KN7C 5CC4A 4RKBA 2XNAC 4KHPQ 1JJGA 5H1SE 4QJFA 2A74C 3MEFA 3J7YW 1TWAB 5DLQE 4BA1I 5HGTA 2F4VL 2JJQA 1N36Q 3HOWB 3KJOA 1SNPA 3HOZB 3DWAA 5M3FB 1EQVA 1VQIA 5IWAL 1IL2A 4JC0A 4IN3A 3PO3H 4DK3C 4IFDG 4K6LA 4ABNA 4C3JG 1EFID 1S5FD 1X32A 4XDXA 1Y14B 2EY2A 2RQXA 1V1PB 4JI7L 5IYBG 1G291 4A3GH 4DV0L 1IBKL 5FOBB 2BCOA 2A6EC 3G71A 1WTWA 5ELBA 1TIID 4BA2I 2JA5G 4DUYQ 2KHIA 2AMCB 1MGSA 4NKLA 3MFYA 1ILQA 4KMUC 3NSWA 1CKNB 1BBUA 1SLJA 2F0VA 3H6MA 3WWVA 1AZQA 1VQKA 3KDFA 2R7ZG 3D3RA 4DK1A 3OYYA 2UXBL 3NTKA 3J80i 5C0XJ 4QL5A 5D14A 4EQNA 1U4MA 2MPMA 2R61A 4X3KA 1WJJA 1VMCA 4DR7Q 1PTOH 4B9XA 2BA1A 1A2UA 1X54A 3U9OA 4DPGA 5J22A 1XMOQ 2UUCQ 1LTGD 4DNTB 1E22A 1ZXTA 1UWVA 2DY7A 4HMIA 2B2WA 2K14A 1LV9A 2DUDA 4KD4A 4L5QA 1EIGA 1B2TA 5C4XG 4V190 1WOCA 1PH8A 1HXYD 2F0IA 1G91A 1XWEA 5FLMH 2P5ZX 2WB1G 2UXCL 3ND9A 1K73C 3J7ZC 4JI0L 3UDGA 3D4RA 1SAPA 3RLFA 2D0OA 1SNCA 4LFAL 1E7ZA 4NXML 3LX0A 2IHFA 4IPDA 1YI2A 4IPCA 1TU2B 2IY5B 2EYFA 4A3MH 2JA8H 1P16A 2R93G 1VQ7A 2K6AA 1I4HA 1ET9A 2LY7A 4IUVA 3CP0A 2EYOA 3EBEA 1HJPA 2B8FA 4DAPA 1AE2A 1N8RC 2R92B 1SXTA 5EJWA 4LK1C 3J80E 5BN4A 5IP7G 4QB4A 1G51A 1E2VA 3N52A 3S1NB 4F8MA 4JI2Q 2NUCA 5KEEA 4R4OA 2ZXRA 1YNJC 3S1QB 5EBDA 2I5LX 4RH6A 3W1BA 4A93B 2ES2A 1BUVT 2E2JH 5T1GA 5ELNA 1PH2A 3L9AX 2JA7G 1EY5A 1CHPD 1I94Q 2BH2A 2F52A 1U0LA 2NVQB 5CBAE 1YZ6A 4KY6A 1HNWL 1MBYA 1Y1WB 5A35A 3GP7A 2UU9Q 3H91A 1BCPF 2B2YA 2KCMA 3U9SA 1IBMQ 3W1GA 2D9UA 4XYQA 1NAPA 4P71A 1VQDA 1X9NA 1Z6HA 4XYOA 1Y8OB 3NWTA 4X3UA 1PFMA 4NP5A 2BDNA 3STBD 1QOHA 1VQNA 5I4DA 2K5DA 3E9IA 1HTLD 5LMNW 4B3ML 2AUJD 4KHPL 1Y8NB 3SEBA 4GZYC 1QVGA 1GUWA 1VQ5A 1NR4A 2UXDL 4XQJA 4BY1G 3NK9A 1PTOF 1FJGL 2BA0A 4KKUA 3Q22A 4H02A 5C44H 2IJ0A 4CKBA 2EXZA 1WTHA 4DXGA 4LMQD 4A3FG 1GKHA 1Q90A 3RNUA 2QGQA 3VR5A 2E5LL 5BN5A 5C4HA 2A6HC 2Y0SB 4OGQC 4Q0FA 3H0GH 4LF7L 1SEBD 2EDGA 3TZUA 3S24A 1I50H 4FXGC 4A3DH 1LLRD 3AFQA 1A63A 1SNMA 1Z47A 2K75A 1OTCA 5KGUA 5CYUA 1ENCA 3K8AA 3A8IE 4IQZA 4JPBW 1ASYA 3TP6A 1X6OA 3BYYB 2UUAL 2QEXA 3I4NG 2I5HA 1JJ2A 1IHZA 1STBA 4LF8Q 4NXNQ 3T4AC 1BQQT 2JA6G 2RCFA 2Z6KC 4K6DA 1O7ZA 4QF4A 2O5JC 1A8VA 5CGKA 3MXGA 1QUQA 3MWYW 1TVXA 2VZAA 1R4QB 4DUZQ 5M5YB 4UP8A 3H3VH 2NBFA 1O7LA 3I4MG 1C8CA 2JQOA 2MGSA 4YCWA 5IP9H 5E7NA 1Q12A 1GHJA 4JYAQ 2B2VC 2PZWA 4J15A 2UUCL 4DR6L 1UEBA 5FLXc 4DR2Q 1A2TA 3DHQA 3CW2C 2D62A 1HH2P 1HZBA 4RHSA 4DR3Q 3RD4A 2H4OA 5M3MG 1A3UA 5KIXA 2Z4IA 1X3GA 3EROA 3MHBA 4R4QA 1I6HH 3HG9A 1CKOA 1EIHA 3J81c 1JR0D 4R4IA 3RUZA 5A2QE 3GD7A 1S5ED 1NJIC 2VB2X 4K2LA 3HOUB 4U68A 4DR5L 4IFDH 4CJ2C 4GOPB 4C3JH 3I2ZA 4DN4M 4CBVA 5ELDA 4CDFC 5IYBH 4UP7A 1CK1A 2F0DA 1NUCA 3K6OA 1BO0A 4JI4Q 2BDOA 3JAMi 3HS0C 2JA5H 4HJ8A 3I4LA 3RZDH 5CR3A 2JP1A 2WP8J 5KYLA 2ZJPA 4RKLA 4XT3B 1A62A 4TQUS 1PYSB 1HFGA 1V1PA 1CQFA 1RF2D 2B39A 4KKSA 2R7ZH 1TR5A 3D4DA 3U50C 4GOPC 3DM1A 1B50A 4G7OC 1WTQA 1S3OA 2LKVA 4NB3A 4LF4L 2LFNA 4G7HC 4B3RQ 2F3VA 2K5VA 3AYHB 1MIUA 4WJWA 1CKNA 3NUCA 3LGJA 2R6GA 1B53A 3MEHA 1CT1D 3CRKC 1XTDA 3SDZA 2K28A 2TMPA 1E1OA 3CD6A 2CW0C 2RVLA 1B9MA 3E9HA 5FLXL 5AFWA 4DV3L 3ULLA 1I5FA 1BXTA 3BVMA 3ER0A 1LABA 3FP9A 4ZUIA 1B9NA 4IPGA 5EPLA 3SR1A 4IO9A 5C4XH 3PIP3 4GN4B 1ET6A 3HOZG 3BDCA 1SJHD 1VQ6A 1FGUA 4G7ZC 1AFPA 3GTPB 4DK0A 4A3IG 5KNBA 1QNKA 2SOBA 3HKZB 1ENAA 4K0KL 3J81L 5FO7B 2KECA 2PZUA 4DGZA 4C1NK 4LUZA 5LMNQ 3V05A 5IT9c 1TS3A 4CKEA 3PIPA 3D6WA 1XMQQ 2WV6D 3HOYB 4C3HB 2NVYH 2KUMA 4MHEA 1PH3A 2IX0A 1N33L 4DXFA 1E3PA 3EFXD 1TT2A 5K36G 3R8BA 1OXTA 1HA5A 1SSOA 1HZCA 4KK7A 2WKDA 3D6CA 3A5ZB 2R93H 3QJYA 1JB7A 1KLUD 1EY0A 5E4WC 2D0PA 3I3CA 1HRJA 1TS5A 3PQIA 3V96A 4YCUA 1B4OA 2QDBA 4GNXB 3GTKB 3M9BA 2KCCA 2Z0SA 3BG3A 5IP7H 3PO2G 3VR2A 2OTJA 3LWEA 1LUZA 1NE3A 2B29A 1D1IA 3OW7A 1A0IA 2Z8LA 4HMJA 5D65A 3ULPA 1OXXK 4GLAC 1SRUA 2M9VA 3U58A 1BF4A 1I3QH 1CM9A 2E8GA 4DR4Q 1V1OA 2E2HH 1O80A 2L12A 4AYBG 4JI3L 2KHSA 4HEDA 3HOXG 4GNXC 1DGSA 4JI8Q 1E2WA 3K0XA 4BBRB 1XXGA 2Z4HA 2QA4A 2JA7H 3ZJYC 5I6WA 4L6TB 3CMAA 1F9PA 2IL8A 2ZXOA 4GKKQ 3CCJA 2C5CA 4HIMA 5GADC 1VQGA 3FKIB 4PZ7A 1KXLA 4H44C 4RGNA 4A3EB 3AMUA 1JORA 4ME5A 2A6ED 1B1ZA 1BKBA 1TWFH 2RA4A 4PZ6A 1MSGA 5CV8A 4ZKBB 5GROA 5IT9L 3UI2A 1H9MA 4HSPA 1KHIA 4QUCA 2PMZB 2AQ2B 1ZEQX 4JYAL 2FMMA 3M3YB 3MXUA 2NYZD 5EKLA 1GUGA 3KLSX 1GD7A 2IHEA 3ITPA 3RZOH 4N9PA 4C1NI 1G6ZA 1SE3A 4K8JA 3DWPA 4GS3A 1PRTF 1O7IA 4K2KA 3I73A 4QUFA 1H9SB 3DM3A 2VUMB 1BBXC 3CCSA 4BY1H 2NB0A 3QG1A 1W6JA 5JEAG 5GAHC 3FDTA 3E3XA 3KLRA 2VW9A 4BBSB 4Q5VA 4C3IB 1HHVA 1QVCA 3M7GA 4A3FH 3J7AF 1NCVA 1CA5A 2UUBL 3NQIA 3PF5A 4A93G 4R4TA 3FHWA 3TN2A 3RR5A 2E75C 4IOCA 1TWCH 3TS2A 4JI4L 2EE1A 2LXJA 2QKIC 4K8IA 5CBEE 3CCLA 3RN5A 4XQNA 2A1AA 2QDLA 5I6YA 4JI5L 1FNUA 2Z6KA 1HPCA 3I4NH 4HTHA 2XWBB 4ZKCB 1EYCA 2JA6H 1G8ZD 1SROA 4DV6Q 1H9RA 1YNNC 2ALYB 1QE6A 3CC7A 4A3LG 1Q8IA 1X3QA 1GUNA 1J5EL 4I65A 2F0UA 4A3KB 2B2VA 3KLWA 1M1KC 2DY8A 4B3RL 3LWUA 2FJ2A 2EYLA 4A3JB 3L7ZC 1FL0A 1JJCB 2ASBA 5G3LF 3K5MA 5JPNC 3I4MH 2AKWB 3CCMA 1TY2A 3EVQA 2Q8RE 1B8AA 5C0XI 1PH9A 1EIYB 2GVBA 1QJOA 3K80C 2AQ1B 4Y52H 2EY5A 1YEZA 1TKWB 4IJLA 3GTQH 5M3MH 5ELFA 2WAQB 3T1YQ 4JOIA 3MAQA 1TS2A 1E0BA 1JICA 4BXXG 1D1KA 1YNJD 1Y1VG 2NZ1D 3IAYA 1MJCA 1WD0A 1AZPA 4UAIA 3G48A 3PO3B 3OTOL 3GTLH 4X62Q 4L8JA 1GUTA 4FDBA 2AWOA 2PQEA 5LL6S 5IOCA 3HOVG 3NQTA 4FYDA 2HQEA 1JT8A 1SYCA 4JI6Q 2DGYA 2TSSA 5DAUA 2MJ8A 3OOCA 4A3GB 1JE5A 3PCOB 3VR4A 2K50A 2SNSA 2I46A 3KBXA 1JWMD 4H13C 5E1FA 2AHOB 4KI0A 3SE0A 2VQFL 1TWGH 1SE4A 1II3A 3DWQA 1I4XA 1RKNA 3I91A 4LFBQ 4GOPA 4WRDA 1UE7A 2IT1A 4HJAA 4P2CB 3FPPA 2OT2A 4NMZA 2F0WA 3CKIB 3I55A 4X65Q 4AYBE 1PTOB 1AP0A 4ALPA 5DEHA 1LT4D 1KC8C 3Q6SA 4DNIA 3U4ZA 1WTPA 1Y69U 2K03A 3QWNA 1KDBA 2HDLA 1PH4A 2N8NA 2FFKB 3GTJH 1AEXA 3CF5A 3A74A 1HA6A 1JWUD 1K8GA 1XNRQ 5FJ8G 3HOZH 2JYOA 2L5TA 1EYAA 3RMHA 4ZCKA 4A3IH 4XQQA 1VF5C 3GV6A 3HEJA 1PTOC 4LF6Q 4IJHA 3G7LA 3PUWA 4JBJA 2XRQD 3X3MA 4FNFA 4KY5A 1QZHA 4EVOA 1TWHH 3PF4A 3HRZC 4DAYA 5K36H 1GJXA 4LW1A 4OX9L 4A3MB 1EL0A 2EYJA 1WYDA 3D31A 4JBMA 3S17B 3L2PA 2KCTA 1KRSA 1J8IA 3CCVA 2O4XA 4MTKA 2MP1A 3WOFA 4HJ7A 1KDCA 2PNRC 1W3SA 3TEHB 2OWOA 1GUOA 2K04A 3CCQA 2IPKD 1HCZA 4OHJA 1PYWD 4PZ8A 4RGTA 1PFSA 3PO2H 3VR6A 3IL8A 1KLGD 3R3OA 2YTYA 2KBNA 3TQYA 3VDYA 1VQAA 2CHBD 1XPRA 2F0SA 3KYHC 1K8MA 5JOBA 3VYTA 3OMGA 1WD1A 4GNXA 3U4VA 1IKLA 1WCMG 4OELB 4MN3A 1D5ZC 3PUZA 3A55A 4BY7B 3F2DA 4WJ4A 3HOXH 2E2JB 1W6KA 1Q46A 1KTKA 1EY7A 3SHLA 3D4WA 3FRPB 2ICEC 2WKCA 1HNXL 4OIKA 3UDFA 1QWYA 1EOTA 2K5WA 3E0EA 3C46A 4JK1C 1K0RA 5CV4A 4YY3Q 3SK8A 1IBLQ 2NTTA 5C3EG 2EY6A 5EQ0A 3HOYG 3ERQA 4C3HG 3NWSA 1KAWA 3KF6B 3L3OC 3CCUA 1VQMA 3BS1A 4F87A 2NWGA 4KV6A 1K83H 5EKKA 5BR8Q 3T1HQ 1P8LA 3M4QA 1RTOA 4V0BA 5IYCG 3CCEA 2F03A 2L0CA 2PO4A 3S2DH 1IZ6A 1HNZL 1E1TA 4POGA 2PI2A 3H15A 4DR1Q 4QY7A 4EGVA 2B2UC 4DV2L 2KCNA 2CWAA 4J6HA 2H1EA 2RDHA 4KHVA 1X56A 2F3IA 4OO1G 5D3DA 3NXWA 1HQRD 3TP5A 5HURA 1VQBA 4O0AA 1PYBA 2IX3A 5JEAH 4LF9L 2ZM6Q 1HR0Q 1OXUA 2CW0D 4NDXA 3F2UA 2NVTB 1SNQA 4A93H 1G6PA 3H0GB 1Q7YC 1ZYRC 1H9SA 3M4OH 3W5OA 3D8GA 1I50B 2SNMA 4A3DB 3HGBA 3K0YA 1DZ1A 3PMFA 4N8X1 1K8AC 1N36L 2E2IH 4FF2A 5CV5A 5AJ3Q 1LTAD 3NELA 3DEOA 4JV5Q 3E0JA 5JJZA 1L0WA 3A5UA 4FVMA 2YTXA 5JVH3 3FKIG 3K5LA 4DV5Q 1R9TH 3AEVA 5KNDA 1AW7A 1FD7D 5M5XB 1C9OA 3H09A 4ZUJA 3MFGA 2A69C 2OCEA 4A3LH 4IFDJ 4J8QA 2KENA 1VQEA 5HGQA 2QEJC 4DUYL 2SEBD 2DNEA 1YITA 1I4QA 2K7VA 4X3SA 2Z6BA 2EPBA 1SN8A 4RG1A 4G4KA 5E4XA 1EZ6A 3TRZA 1PH6A 4P72A 5FO8B 1D5MC 1XX8A 3AB9A 4ID6A 2B63G 1V43A 5D3IB 1N32Q 4JBWA 2L55A 3S15H 3UE0A 1LTID 1X65A 2KVMA 3MTSA 4L63B 1I6HB 4ZQ3A 3SXHA 3A7LA 4DR7L 1NNXA 1CI3M 3ONAB 2X69A 3HFZB 1N34Q 4BXXH 2ICIA 1Y1VH 2VQEQ 1XMOL 3H3VC 2L1BA 1H95A 1RHPA 2MO0A 3D0FA 4UY8C 3JAMc 2R3ZA 3J81j 2I07B 2Q2HA 5JPMC 3W2DA 1GHKA 4C3JB 2KQ3A 3CPFA 1B70B 1LTRD 4OO1I 2YU9H 1STGA 3QOLA 3HOVH 2F3WA 2ZTEA 3OIQA 3MXPA 2KEDA 4K5WA 5CMDA 4JOIC 4FXKC 1V1QA 4DV7Q 2JA5B 1YJ9A 3WDNA 2VS1A 4R8IA 4R9WA 3E6ZX 1KABA 2FXQA 2AWNA 3RZDB 1NBWA 2OXPA 1X3EA 4Y7NB 1C48A 2I5MX 3TS0A 3F1ZA 1RDPD 3OIPA 2R7ZB 4FF3A 1HZAA 3C3LA 4ME3A 3ULJA 1PRTB 5M5WH 1ENFA 4X64Q 3NEMA 3X3NA 4B3SQ 4QIWB 1PZKD 1RCVD 2C9OA 4A3CG 4ZAIA 2A68D 1S5DD 5LMUQ 3I70A 1J9OA 1YHBA 4DU9A 2XRSD 3QOJA 5C3WA 3TP7A 3NPPA 5HY6A 1L1OB 4YHHQ 1WI5A 4HAEA 3QB3A 3S1MB 1EY6A 4RGOS 1X3FA 4AH6A 4RFBA 2K32A 3F8TA 4IUPA 5IGGA 5C4XB 3TDQA 5ELOA 1VQFA 4JI2L 1PRTC 3M4YA 2WB1B 1EEID 1D5XC 4HCEA 2B8GA 2PYKA 4JI1Q 1WTOA 3FVQA 4H7BA 2F0EA 1V9PA 1DXMA 5L37A 3J81i 1FYCA 1YHAA 2NVYB 4NPSA 1SDFA 4ZK9B 3JAML 1I94L 4QMGA 2K33A 4LF5Q 2MQHA 2EYHA 1L1OC 2Z9HA 3HOWG 4IZ8A 1Q1EA 1X55A 4DAYB 5FKAC 3A56A 3SVMA 4LWCA 1PH5A 1ILPA 5M3FG 1S72A 1NR2A 3GTOH 1PZID 3VA7A 2UU9L 1CHQD 1MKHA 1IBML 1YNND 3NTIA 3S16H 1EY8A 1VF7A 2NN6I 3IRBA 2QILA 4LNQA 2ATWA 4CHTB 3OPOA 5I2YA 2ZXPA 3CC2A 5TSSA 2F0KA 4IPHA 1CUKA 3SK5A 2N78A 3VYSA 5GAEC 2DN8A 5LHY1 2F1MA 3I90A 1XYIA 1F9RA 1KQSA 2PW7A 1ESFA 1RTNA 2RDFA 4DV4Q 2B2TC 4RMFA 4A3BB 3K58A 4PG3A 4QCLA 4DAVA 2E2HB 4I7AA 3I56A 1WCMH 2NVXH 1A3VA 1I6VC 4OXPA 5CORA 1VS0A 1DD2A 5JJLA 1T5EA 5FLXE 1FVIA 1ICFB 1SFOH 1VQ9A 3EN2A 2JA7B 1BVSA 2K01A 3GTPH 2K52A 2VXWA 2DNCA 3DMUA 3OSOA 3P75A 1EOVA 4KTAA 2F4VQ 1U4PA 2F0NA 1LYLA 3FEWX 5IWAQ 1VMPA 4IURA 1F9QA 5C3EH 3J81E 1PLFA 2CVRA 3K7AB 3NHHA 3HOYH 2HCIA 4C3HH 2EYPA 3FMCA 1TWFB 1SE2A 4JI7Q 4DV0Q 5EAYA 1IBKQ 3S1RB 3BU2A 3TMEA 2B2UA 1GXDC 1UE6A 4NXNL 4LF8L 1JWSD 4RWSC 5C0XG 3RZOB 1OO9B 4K5XA 3QR8A 1B3QA 3KF6A 1VQOA 4LJZC 2V1CC 2VL6A 3OMCA 3CQZH 2QW7A 4DUZL 3C1EA 3KK7A 4OO1H 1IW7C 2UXBQ 4EQ5A 4RGMA 1XTCD 1STEA 1N34L 4BY1B 1YJWA 4HIKA 1RL2A 2K5QA 2VQEL 1CA6A 1K28A 4DR2L 1H9KA 1OXSC 5LL6X 2R92G 1QG7A 1G2TA 2F4IA 2GN5A 4DR3L 5J39A 4BY7G 2E74C 2JSOA 1B3AA 4R1JA 5F2DA 1DONA 1QCBD 2EOTA 3OHXC 3VA5A 5J3BA 1VQPA 1KL9A 1PTOD 5CV9A 4UDUC 2XSCA 1F2ZA 3S14H 2UXCQ 2F0GA 3I4NB 4U673 4DAMA 4LFAQ 5C4JH 4NXMQ 3T53B 4O2DA 4X64L 1DYQA 2BOSA 4UHVA 5IT9E 4DNRB 1Y1WG 3PUXA 1SYDA 3I4MB 4X3TA 2WAQE 1WVLA 2M2LA 3HKSA 2SDFA 1OXVA 4JG2A 4YHHL 1DOMA 4N8FA 3PIO3 2ZJQA 2YV5A 4F7XA 2B63H 1YBYA 2F0LA 1EQTA 3WOEA 3F2BA 5M3MB 3GTQB 1IYUA 3T51B 3PV0A 2A19A 3A7AB 1VQ4A 4XTCS 1PV4A 1MD2D 3PIOA 2Q2IA 2OTLA 1X3PA 4IUNA 2PQAB 2CCZA 1YJNA 4HCSA 3W3AA 1JOKA 4GN3B 4TVAB 3GTLB 3K81C 1GM5A 4LF5L 3FPUB 2Q2UA 4KKTA 4XT1B 2GVAA 2XWJB 4C2MH 4P73A 5NUCA 4KY7A 4X66Q 1QB5D 4YWMA 1UUPA 1ASZA 1TWGB 5FO9B 1FR3A 2AQ3B 5LMNL 1PH7A 4YWKA 3GTMH 3TBIB 3ZYYX 2Y0SG 1XMQL 1LACA 3Q24A 4PV1C 5CV7A 5KYIA 2L9HA 1BCPB 3CC4A 2BE5C 3T56B 1JOQA 5IGDA 3G6EA 3KLSA 3UDXA 4CDEC 2ENBA 3RN2A 4L5RC 3GTGH 1EWIA 4CJ0B 3S2HH 2MHVA 3J80c 4R4CA 4HJ9A 1HR0W 4A3CH 2EXDA 1C0AA 2QCPX 2RKSA 2N3SA 2X6LA 1PDQA 3GV3A 3HP3A 4DA2A 3T13A 3EA6A 4CJ1B 1CTMA 4B3MQ 5DM63 4GLXA 1IL8A 1SYFA 5EPKA 2ZTDA 1KRTA 3T16A 3DLLA 3GTJB 1BCPC 1PVOA 1L0XB 4C56C 2UXDQ 5COYA 3C2PA 3G6JB 4PMBA 1UE1A 1AE3A 5DNFA 1SYGA 1FJGQ 4DR4L 3K5OA 5KRUA 4A4IA 2KA7A 1ZKOA 2HDMA 1I4RA 1ZYRD 3BDOA 4A3IB 2HIXA 2RHSB 1LTSD 5T1IA 4JI8L 5CV6A 4CKCA 1L1OA 1SYBA 4LUVA 3KUPA 3TP8A 4DV1Q 4HIDA 2E5LQ 4LF7Q 5GAGC 2KJXA 2EIFA 3I8ZA 1TWAH 1TWHB 2F0QA 1PMRA 3HOWH 4GKKL 1YIJA 2Q8TA 2HUGA 5M3FH 2Z1CA 2K05A 2A6HD 3DXJC 2EQSA 3HOUG 1K3BC 3E5SA 1GOZA 1O78A 2A69D 3EJIA 1Q81C 2UUAQ 1TY0A 1CZWA 1D7QA 4OWTB 3BZDB 2NTSA 3M4PA 3K59A 3PO2B 2B2TA 1S5BD 4FO2A 2JA8B 3RLNA 2HT1A 2KOLA 5GQOA 1T9HA 1T5XD 4JVZA 1SBBB 2NZHA 1ML0D 2HCCA 3J80L 1V8QA 4DR6Q 4AYBB 3A8JE 2G5DA 3OWEB 1NMGA 1LTBD 1PA6A 3HOXB 1F9SA 2EJFC 3SK4A 4XXEA 4TRDA 1STYA 3H3VI 4RAUC 1A15A 1MHWC 3BDLA 1XPOA 1JQYD 1I4GA 5C5LA 1STNA 1EQRA 3R93A 2A8VA 1CSPA 2CQAA 5IY0A 4OEMB 1EU3A 3TREA 5EGTA 4UPAA 4HSVA 3GQBA 5JEAJ 1DOLA 4ILWA 2N55A 4DR5Q 4K14A 3ERSX 1IXRA 2G9HD 2HIVA 5IE8A 4B08A 1CSQA 3GDEA 1MJEA 1SMYC 2I0QA 1K83B 4GLVB 2R7FA 4LUOA 3S17H 2MNAA 2JN4A 2NZOA 3C1FA 3HKZG 1EQQA 3S2DB 3CU7A 1SR3A 2FMCA 2K5HA 3HZXA 4BS9A 3KF8B 4OONA 4DV6L 4IFDI 5C0XH 3P1HA 2HD3A 2LMCB 5JJKA 1F2MA 2OF1A 2X6GA 4EQPA 1W2BA 3EQLC 3MC0B 1EWCA 4A3BG 3KBGA 3UE1A 3Q0AA 4LF4Q 2LS01 2Q8IB 3IFTA 1EY4A 4OL7A 1NMFA 1KNAA 4MIUA 2R92H 2R7DA 2IW3A 4BY7H 1BOSA 3T1YL 3G4SA 2A73B 1CFMA 2KEEA 3M4OB 1RD9D 1PRTD 2CWPA 4QGUA 2ZJRA 1M8AA 2XIWA 4PQXA 4KLKA 4X66L 2CH4W 4DV3Q 2F0JA 3H94A 1PXUA 2E2IB 4FXDA 2Y0SE 3S1NH 5C44B 4ODGA 1PFNA 1U4RA 1O7YA 3KFUA 1NY4A 4X62L 1BBWA 1TS4A 1R9TB 3IFDA 2D5DA 4K0KQ 3S1QH 4HJ5A 3BZCA 3V2TA 1DOKA 2B3GA 3P20A 1RJTA 4JI6L 2WINB 3LNNA 4BBRG 4KHZA 1WTVA 5J1ZA 3VYUA 1CKMA 4CDDC 2NVQH 1N33Q 4J1MA 1EEFD 3N6RA 1Y1WH 2DJGC 3MXNB 1PZJD 1JB3A 3ND8A 4LFBL 1A3TA 4O1NA 1ICWA 4A3EG 5DM73 4M8AA 3L0OA 5JVG3 1M90C 1EY9A 3S15B 1VCIA 2VY3A 4X65L 1L2FA 2N49A 4ZYSA 4MZ9A 4XIGS 4P75A 3SGIA 4AIMA 4G57A 4KN4C 3CRLC 4CGYB 2YTVA 1MI2A 2RSOA 2E2DC 5G3LD 1DJRD 5IODA 1Y1VB 2NVTH 3Q8DA 1B44D 4DV1L 2O5IC 1A6XA 5C6AA 4B9WA 4GN5A 2HHHQ 4JI3Q 2VUMG 4KD3A 1U9RA 1K8OA 2YU9B 4EX5A 3CCRA 3HOVB 1EZ8A 1PFBA 1XNRL 2FINB 1D8LA 1LT3D 1BNZA 2XN9C 4DK6C 3K7UC 5A2QL 5IGFA 1EWHA 5IYDG 3NTHA 4IUQA 4BBSG 4C3IG 5C3XA 2M00A 1TQOA 2PQAA 5M5XH 4LF6L 2PCFB 4OIJA 2L15A 2ZT9C 2VNUD 2RHQB 1DCZA 2NN6G 4E6IA 1KDAA 2WACA 2RBMA 3NBHB 3A0JA 4QIWE 2YYZA 5FK9C 3I72A 1R4PB 2K1BA 3BZKA 2HQLA 1IYJB 1PH1A 2F0HA 2JA9A 2F0PA 5M5WB 1NTGA 3BJUA 4WFN3 3MA2B 1VQ8A 4TSSA 5K5PA 1IYVA 2JE6I 5KNCA 1Q8KA 1SNDA 1L0YB 3DEPA 1IW7D 3PSIA 1LT6D 4DFAA 4O42A 2EY1A 2WB1E 5C4ZA 1E24A 4A3KG 5M5YH 4PMCA 4WJ3M 3CAMA 4A3JG 2MFIA 2D2CC 1LTLA 3GO5A 3DUZA 2LXKA 4P74A 5IGBA 4CDCC 4GKJQ 3QIAA 1F2LA 3J7AV 3VYRA 4OWXB 4ULLA 1K3RA 4RCNA 2UUBQ 2V4DA 2WAQG 2WFWA 2OQKA 1K9MC 4LFCQ 1GUSA 3HKZE 1STAA 2OEOA 3CPWA 4EQOA 2H5XA 1XJVA 1QNUA 4FP5D 2PPBC 2O2LD 2JEAI 4YY3L 3GTOB 1IBLL 2DJFC 5FJ8H 5JAVA 4B3TQ 3PO3G 1GO3E 3NE5B 2RCNA 2E76C 3HOUH 3S16B 3M7NA 1SYEA 4JI5Q 4Y7NH 3A8KE 2BH8A 1EU4A 1U4LA 1VQLA 4WORA 3T1HL 5BR8L 3KDFB 1XNQQ 3M85A 4A3GG 1HTPA 2EZVA 4UP9A 5M9OA 1FNWA 4YWLA 2XTIA 1YHQA 1J5EQ 2ID0A 4RCOA 2R93B 4DR1L 1JC7A 2CH4A 1IKMA 1MSHA 1HFNA 3P7JA 1I4PA 4YCVA 3STBC 4FF1A 1WCMB 4TKOB 2NVXB 3S1MH 2CQOA 3BVZA 3I7FA 2JXMB 1VQCA 1S4ZA 3NBIA 4AQYQ 1SFOB 1JMCA 3AU7A 2ZM6L 1CZGA 1HR0L 2EJGC 2WIIB 3F2CA 1F2YA 3CMEA 4JBKA 1JCKB 1I3QB 3UDIA 1EFWA 5EKIA 5C3EB 4I7ZC 1E2ZA 2L4NA 2VB3X 4IOAA 3OTOQ 5E3FA 5BN3A
chains in the Genus database with same CATH topology
3R2IA 4IALA 4R8NA 5ISRA 1QILA 3JAME 1NSNS 3S9WA 2A5HA 4Z9CB 2AUKA 2B2WC 2EYMA 5IGEA 2BE5D 1LTTD 5ELEA 1D6EC 3CQZB 3MZ5A 1Z7TA 1SNOA 1HQMC 1LT5D 1STHA 1VDZA 5EPJA 1M4VA 3OWFA 3PUYA 3TSSA 3KF8A 4IUTA 1D2BA 5EBCA 5I9OA 1BCPD 2F0TA 3O13A 1ONLA 2N88A 2QF7A 3K5NA 2RDGA 4M1UB 5I2XA 3NP8A 1BR9A 1H9JA 1KNEA 2XVSA 1UAPA 2F0FA 2IWHA 3S14B 1BDOA 4DF7A 4A3FB 1JOOA 4S3SA 4N9TA 1LO5D 5C4JB 2IX1A 1S5CD 4F88A 1TWCB 4BWGB 5C5MA 1FGBD 1F77A 1UNSA 2F0OA 4NW2A 4KJNA 1SJED 3R2TA 4ZRZA 2FHTA 3URYA 2EJMA 2PW5A 2GA4B 3VR3A 2JA6B 2JEBI 2A68C 2B63B 1WTXA 2B2YC 3TZDA 2J0TD 2J4XA 3Q23A 4PMWA 3IKJA 2PZTA 1Q1BA 3MXNA 3MVVA 2F0MA 1Y8PB 3PUVA 1ESRA 2MUYA 4ZLTF 1RODA 3BYTB 1HUMA 5ELCA 1AN8A 4C2MB 1KAAA 1EYDA 5IGCA 1FNVA 3GTMB 1SMYD 2NN6H 4HR7B 3BVGA 4FF4A 1C4QA 3SK6A 3A54A 2EVBA 4YIJA 3GTGB 4PNYA 5I9PA 3S2HB 4IUUA 1HUNA 2RSNA 1Q3LA 4RA8A 4RHRA 4K5VA 3K57A 3NBHA 3QO2A 5IIFA 3CHBD 1G2SA 1UEAB 2G9DA 4HN7A 1CQVA 1WTRA 4H0LC 4KJOA 2L11A 2J7ZA 1DM0B 1JE4A 4LAAA 4KN7C 5CC4A 4RKBA 2XNAC 2A74C 3J7YW 1TWAB 4BA1I 5HGTA 3HOWB 1SNPA 3HOZB 3DWAA 5M3FB 1EQVA 4IN3A 4IFDG 4K6LA 4ABNA 4C3JG 1EFID 1S5FD 1X32A 4XDXA 2EY2A 2RQXA 1V1PB 1G291 5FOBB 2BCOA 2A6EC 1WTWA 5ELBA 1TIID 4BA2I 1MGSA 4NKLA 3MFYA 1ILQA 4KMUC 3NSWA 2F0VA 3H6MA 1AZQA 3D3RA 4DK1A 3NTKA 5C0XJ 5D14A 4EQNA 1U4MA 2MPMA 2R61A 4X3KA 1VMCA 1PTOH 4B9XA 2BA1A 1A2UA 3U9OA 5J22A 1LTGD 4DNTB 1ZXTA 2DY7A 4HMIA 2B2WA 1LV9A 4KD4A 1EIGA 1B2TA 4V190 1HXYD 2F0IA 1G91A 1XWEA 3ND9A 3D4RA 1SAPA 3RLFA 1SNCA 3LX0A 1TU2B 2EYFA 2K6AA 1I4HA 1ET9A 2LY7A 4IUVA 2EYOA 2B8FA 4DAPA 2R92B 1SXTA 5EJWA 4LK1C 3J80E 5BN4A 4QB4A 1E2VA 3N52A 3S1NB 4F8MA 2NUCA 5KEEA 2ZXRA 1YNJC 3S1QB 5EBDA 4RH6A 4A93B 1BUVT 5T1GA 3L9AX 1EY5A 1CHPD 2NVQB 5CBAE 4KY6A 1MBYA 1Y1WB 5A35A 3GP7A 3H91A 1BCPF 2B2YA 3U9SA 2D9UA 4XYQA 1NAPA 1Z6HA 4XYOA 1Y8OB 3NWTA 4X3UA 1PFMA 4NP5A 2BDNA 1QOHA 5I4DA 2K5DA 1HTLD 2AUJD 1Y8NB 3SEBA 4GZYC 1GUWA 1NR4A 4XQJA 3NK9A 1PTOF 2BA0A 4KKUA 3Q22A 2IJ0A 4CKBA 2EXZA 4DXGA 4LMQD 1Q90A 3VR5A 5BN5A 5C4HA 2A6HC 2Y0SB 4OGQC 4Q0FA 1SEBD 2EDGA 3TZUA 4FXGC 1LLRD 1SNMA 1Z47A 5KGUA 5CYUA 1ENCA 3A8IE 4IQZA 3TP6A 3BYYB 1IHZA 1STBA 3T4AC 1BQQT 4K6DA 4QF4A 1O7ZA 2O5JC 5CGKA 3MXGA 3MWYW 1TVXA 1R4QB 5M5YB 2NBFA 1O7LA 1C8CA 2MGSA 1Q12A 1GHJA 2B2VC 2PZWA 1A2TA 3DHQA 2D62A 4RHSA 3RD4A 2H4OA 1A3UA 5KIXA 2Z4IA 3EROA 3MHBA 3HG9A 1EIHA 1JR0D 3RUZA 5A2QE 3GD7A 1S5ED 2VB2X 4K2LA 3HOUB 4U68A 4IFDH 4CJ2C 4DN4M 4CBVA 5ELDA 1CK1A 2F0DA 1NUCA 3K6OA 1BO0A 2BDOA 3HS0C 3I4LA 5CR3A 2JP1A 2WP8J 5KYLA 4RKLA 4XT3B 4TQUS 1HFGA 1V1PA 1CQFA 1RF2D 2B39A 4KKSA 1TR5A 3D4DA 3DM1A 1B50A 4G7OC 1WTQA 2LKVA 2LFNA 4G7HC 2F3VA 4WJWA 3NUCA 2R6GA 1B53A 3MEHA 1CT1D 3SDZA 3CRKC 1IKMA 2K28A 2TMPA 2CW0C 2RVLA 1B9MA 5FLXL 5AFWA 1BXTA 3BVMA 4ZUIA 1LABA 1B9NA 5EPLA 3SR1A 3PIP3 1ET6A 3BDCA 1SJHD 4G7ZC 1AFPA 3GTPB 4DK0A 5KNBA 1QNKA 2SOBA 3HKZB 1ENAA 3J81L 5FO7B 2KECA 2PZUA 4DGZA 4C1NK 3V05A 1TS3A 4CKEA 3D6WA 2WV6D 3HOYB 4C3HB 2KUMA 4MHEA 2IX0A 4DXFA 3EFXD 1TT2A 5K36G 3R8BA 1OXTA 1HA5A 1SSOA 4KK7A 2WKDA 3D6CA 3QJYA 1KLUD 1EY0A 5E4WC 3I3CA 1HRJA 1TS5A 3V96A 1B4OA 2QDBA 3GTKB 2KCCA 3BG3A 3VR2A 3LWEA 1D1IA 3OW7A 2Z8LA 4HMJA 5D65A 1OXXK 2M9VA 1BF4A 1CM9A 1V1OA 1O80A 2L12A 2KHSA 4HEDA 1E2WA 4BBRB 1XXGA 2Z4HA 5I6WA 4L6TB 1F9PA 2IL8A 2ZXOA 2C5CA 3FKIB 4H44C 4RGNA 4A3EB 3AMUA 1JORA 4ME5A 2A6ED 1B1ZA 2RA4A 1MSGA 5CV8A 4ZKBB 5IT9L 3UI2A 1H9MA 4HSPA 4QUCA 2PMZB 2AQ2B 1ZEQX 3M3YB 2FMMA 3MXUA 2NYZD 5EKLA 1GUGA 3KLSX 3ITPA 4N9PA 4C1NI 1G6ZA 1SE3A 4K8JA 3DWPA 1PRTF 4K2KA 3I73A 4QUFA 1H9SB 2VUMB 1BBXC 2NB0A 3QG1A 1W6JA 5JEAG 3FDTA 3KLRA 4BBSB 4Q5VA 4C3IB 1HHVA 3M7GA 3J7AF 1NCVA 1CA5A 3NQIA 3TN2A 2E75C 2EE1A 2QKIC 4K8IA 5CBEE 4XQNA 5I6YA 1FNUA 1HPCA 4HTHA 2XWBB 4ZKCB 1EYCA 1G8ZD 1H9RA 1YNNC 1QE6A 1Q8IA 1X3QA 1GUNA 4I65A 2F0UA 4A3KB 2B2VA 2DY8A 3LWUA 2FJ2A 2EYLA 4A3JB 3L7ZC 5G3LF 3K5MA 5JPNC 1TY2A 3EVQA 2Q8RE 5C0XI 1QJOA 2AQ1B 2EY5A 1TKWB 5ELFA 2WAQB 3MAQA 1TS2A 1E0BA 1JICA 1D1KA 1YNJD 2NZ1D 3IAYA 1WD0A 1AZPA 4UAIA 3PO3B 4L8JA 1GUTA 2AWOA 2PQEA 5LL6S 5IOCA 3NQTA 4FYDA 2HQEA 1SYCA 2TSSA 5DAUA 2MJ8A 3OOCA 4A3GB 3VR4A 2SNSA 2I46A 3KBXA 1JWMD 4H13C 5E1FA 4KI0A 3SE0A 1SE4A 1II3A 3DWQA 1I4XA 1RKNA 3I91A 4WRDA 2IT1A 4P2CB 3FPPA 2OT2A 4NMZA 2F0WA 3CKIB 1PTOB 1AP0A 5DEHA 1LT4D 3Q6SA 1WTPA 1Y69U 2K03A 3QWNA 1KDBA 2HDLA 2FFKB 1AEXA 1HA6A 1JWUD 2JYOA 2L5TA 1EYAA 3RMHA 4XQQA 1VF5C 3GV6A 3HEJA 1PTOC 3G7LA 3PUWA 2XRQD 3X3MA 4FNFA 4KY5A 4EVOA 3HRZC 4DAYA 5K36H 1GJXA 4A3MB 1EL0A 2EYJA 3D31A 3S17B 1J8IA 2O4XA 2MP1A 3WOFA 1KDCA 2PNRC 1GUOA 2K04A 2IPKD 1HCZA 4OHJA 1PYWD 4RGTA 3VR6A 3IL8A 1KLGD 3R3OA 2CHBD 2F0SA 1K8MA 5JOBA 3VYTA 3OMGA 1WD1A 1IKLA 4MN3A 1D5ZC 3PUZA 3A55A 4BY7B 2E2JB 1W6KA 1KTKA 1EY7A 3SHLA 3D4WA 3FRPB 2ICEC 2WKCA 4OIKA 1QWYA 1EOTA 2K5WA 3C46A 4JK1C 5CV4A 3SK8A 2NTTA 2EY6A 5EQ0A 3ERQA 4C3HG 3NWSA 3L3OC 3BS1A 4F87A 2NWGA 4KV6A 5EKKA 1RTOA 4V0BA 2F03A 2L0CA 2PO4A 4EGVA 2B2UC 2KCNA 4J6HA 2H1EA 2RDHA 4KHVA 4OO1G 5D3DA 3NXWA 1HQRD 3TP5A 5HURA 2IX3A 5JEAH 1OXUA 2CW0D 4NDXA 3F2UA 2NVTB 1SNQA 3H0GB 1ZYRC 1H9SA 3D8GA 1I50B 2SNMA 4A3DB 3HGBA 3K0YA 1DZ1A 3PMFA 4FF2A 5CV5A 1LTAD 3DEOA 3E0JA 5JJZA 4FVMA 5JVH3 3K5LA 5KNDA 1AW7A 1FD7D 5M5XB 3H09A 4ZUJA 3MFGA 2A69C 4IFDJ 4J8QA 2QEJC 2SEBD 2DNEA 1I4QA 2K7VA 4X3SA 2EPBA 4G4KA 5E4XA 1EZ6A 5FO8B 1D5MC 1XX8A 3AB9A 4ID6A 1V43A 5D3IB 4JBWA 2L55A 1LTID 2KVMA 3MTSA 4L63B 1I6HB 4ZQ3A 3SXHA 3A7LA 1CI3M 3ONAB 2X69A 2ICIA 3H3VC 2L1BA 1RHPA 2R3ZA 2I07B 5JPMC 1GHKA 3W2DA 4C3JB 2KQ3A 1LTRD 4OO1I 1STGA 3QOLA 2F3WA 3OIQA 3MXPA 2KEDA 4K5WA 5CMDA 4FXKC 2JA5B 3WDNA 4R8IA 4R9WA 3E6ZX 1KABA 3RZDB 2AWNA 2OXPA 4Y7NB 1C48A 1RDPD 3OIPA 2R7ZB 4FF3A 3C3LA 1PRTB 1ENFA 3X3NA 4QIWB 1PZKD 1RCVD 2C9OA 4ZAIA 2A68D 1S5DD 3I70A 1J9OA 4DU9A 2XRSD 3QOJA 5C3WA 3TP7A 3NPPA 4HAEA 3QB3A 3S1MB 1EY6A 4RGOS 4RFBA 2K32A 4IUPA 5IGGA 5C4XB 3TDQA 1PRTC 3M4YA 2WB1B 1EEID 1D5XC 4HCEA 2B8GA 2PYKA 1WTOA 3FVQA 4H7BA 2F0EA 1DXMA 1FYCA 2NVYB 4ZK9B 3JAML 1SDFA 4QMGA 2K33A 2EYHA 4IZ8A 1Q1EA 3SVMA 1ILPA 5FKAC 3A56A 1NR2A 1PZID 3VA7A 1CHQD 1YNND 3NTIA 1EY8A 1VF7A 2NN6I 2QILA 4CHTB 3OPOA 5I2YA 2ZXPA 5TSSA 2F0KA 3SK5A 3VYSA 2DN8A 5LHY1 2F1MA 3I90A 1XYIA 1F9RA 2PW7A 1ESFA 1RTNA 2RDFA 2B2TC 4A3BB 3K58A 4QCLA 4DAVA 2E2HB 1A3VA 1I6VC 5CORA 1DD2A 1T5EA 5FLXE 2JA7B 2K01A 2VXWA 2DNCA 3DMUA 3OSOA 3P75A 4KTAA 1U4PA 2F0NA 3FEWX 1VMPA 4IURA 1F9QA 3J81E 1PLFA 2CVRA 3K7AB 3NHHA 2HCIA 2EYPA 3FMCA 1TWFB 1SE2A 3S1RB 3TMEA 2B2UA 1GXDC 1JWSD 4RWSC 5C0XG 3RZOB 1OO9B 4K5XA 4LJZC 3OMCA 3C1EA 3KK7A 4OO1H 1IW7C 4RGMA 1XTCD 1STEA 4BY1B 2K5QA 1CA6A 1H9KA 1OXSC 5LL6X 1G2TA 1QG7A 2F4IA 5J39A 2E74C 2JSOA 1B3AA 5F2DA 1DONA 1QCBD 2EOTA 3OHXC 3VA5A 1PTOD 5CV9A 4UDUC 2XSCA 1F2ZA 2F0GA 3I4NB 4U673 3T53B 1DYQA 2BOSA 5IT9E 4DNRB 3PUXA 1SYDA 3I4MB 4X3TA 1WVLA 2M2LA 2SDFA 1OXVA 1DOMA 3PIO3 4F7XA 2F0LA 1EQTA 3WOEA 3GTQB 5M3MB 1IYUA 3T51B 3PV0A 3A7AB 4XTCS 1MD2D 1X3PA 4IUNA 4HCSA 3W3AA 1JOKA 3GTLB 3FPUB 4KKTA 4XT1B 2XWJB 5NUCA 4KY7A 1QB5D 1UUPA 1TWGB 5FO9B 1FR3A 2AQ3B 3TBIB 3ZYYX 1LACA 3Q24A 4PV1C 5CV7A 5KYIA 2L9HA 1BCPB 2BE5C 3T56B 1JOQA 5IGDA 3KLSA 2ENBA 4CJ0B 2MHVA 2QCPX 2RKSA 2X6LA 3GV3A 1PDQA 3HP3A 4DA2A 3T13A 3EA6A 4CJ1B 1CTMA 5DM63 1IL8A 1SYFA 5EPKA 3T16A 3GTJB 1BCPC 1L0XB 4C56C 5COYA 3C2PA 3G6JB 4PMBA 5DNFA 1SYGA 3K5OA 5KRUA 2KA7A 1ZKOA 2HDMA 1I4RA 1ZYRD 3BDOA 4A3IB 1LTSD 5T1IA 5CV6A 4CKCA 1SYBA 3TP8A 3KUPA 2KJXA 3I8ZA 1TWHB 2F0QA 1PMRA 2Q8TA 2HUGA 2Z1CA 2K05A 2A6HD 3DXJC 3E5SA 1GOZA 1O78A 2A69D 3EJIA 1TY0A 1CZWA 3BZDB 2NTSA 3K59A 3PO2B 2B2TA 1S5BD 4FO2A 2JA8B 2KOLA 1T5XD 1SBBB 1ML0D 2HCCA 3J80L 1V8QA 4AYBB 3A8JE 3OWEB 1LTBD 3HOXB 1F9SA 2EJFC 3SK4A 4XXEA 4TRDA 1STYA 4RAUC 1A15A 3BDLA 1JQYD 1I4GA 5C5LA 1STNA 3R93A 2CQAA 1EU3A 5EGTA 4HSVA 3GQBA 5JEAJ 1DOLA 4ILWA 2N55A 4K14A 2G9HD 4B08A 1SMYC 1K83B 3C1FA 3S2DB 3CU7A 2FMCA 3HZXA 4BS9A 4IFDI 5C0XH 3P1HA 2LMCB 1F2MA 2OF1A 2X6GA 4EQPA 3EQLC 3MC0B 1EWCA 3KBGA 3Q0AA 2LS01 2Q8IB 3IFTA 1EY4A 4OL7A 1KNAA 4MIUA 2IW3A 1BOSA 2A73B 1CFMA 2KEEA 3M4OB 1RD9D 1PRTD 1M8AA 2XIWA 4PQXA 2F0JA 3H94A 1PXUA 2E2IB 4FXDA 5C44B 4ODGA 1PFNA 1U4RA 1O7YA 1TS4A 1R9TB 3IFDA 2D5DA 3V2TA 1DOKA 3P20A 1RJTA 2WINB 3LNNA 4KHZA 1WTVA 5J1ZA 3VYUA 4J1MA 1EEFD 3N6RA 1PZJD 1JB3A 3ND8A 1A3TA 4O1NA 1ICWA 5DM73 4M8AA 5JVG3 1EY9A 3S15B 1VCIA 4ZYSA 4XIGS 4G57A 4KN4C 3CRLC 4CGYB 1MI2A 2RSOA 2E2DC 5G3LD 1DJRD 5IODA 1Y1VB 1B44D 2O5IC 1A6XA 5C6AA 4B9WA 4KD3A 1U9RA 1K8OA 2YU9B 3HOVB 1EZ8A 1PFBA 2FINB 1LT3D 1BNZA 2XN9C 5A2QL 5IGFA 1EWHA 3NTHA 4IUQA 4C3IG 5C3XA 2M00A 1TQOA 2PCFB 4OIJA 2ZT9C 2VNUD 1DCZA 2NN6G 4E6IA 1KDAA 2WACA 2RBMA 2YYZA 5FK9C 3I72A 1R4PB 2K1BA 2F0HA 2F0PA 5M5WB 4WFN3 3MA2B 4TSSA 5K5PA 1IYVA 2JE6I 5KNCA 1SNDA 1L0YB 3DEPA 1IW7D 1LT6D 4DFAA 4O42A 2EY1A 5C4ZA 4PMCA 2D2CC 3GO5A 3DUZA 5IGBA 3QIAA 1F2LA 3J7AV 3VYRA 4ULLA 4RCNA 2V4DA 1GUSA 1STAA 2OEOA 4EQOA 1QNUA 4FP5D 2PPBC 2O2LD 2JEAI 3GTOB 5JAVA 3NE5B 2E76C 3S16B 3M7NA 1SYEA 3A8KE 1EU4A 1U4LA 4WORA 3M85A 1HTPA 2EZVA 5M9OA 1FNWA 2ID0A 4RCOA 2R93B 1JC7A 1MSHA 1HFNA 3P7JA 1I4PA 4FF1A 1WCMB 4TKOB 2NVXB 3BVZA 2JXMB 3NBIA 1S4ZA 1SFOB 3AU7A 1CZGA 2EJGC 2WIIB 1F2YA 1JCKB 1I3QB 5EKIA 5C3EB 4I7ZC 1E2ZA 2L4NA 2VB3X 5E3FA 5BN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZW A;  4M1U B;  1D1I A;  4ULL A;  2XSC A;  1C48 A;  1QOH A;  1CQF A;  4P2C B;  2C5C A;  1CZG A;  1R4P B;  3MXG A;  1C4Q A;  2GA4 B;  1QNU A;  1R4Q B;  1BOS A;  2BOS A;  1D1K A;  1DM0 B; 
#chains in the Genus database with same CATH topology
 3R2I A;  4IAL A;  1SMX A;  4R8N A;  3JC6 6;  4JW0 A;  5ISR A;  5AJ3 L;  1QIL A;  3JAM E;  1NSN S;  3S9W A;  2A5H A;  4JV5 L;  2PI2 E;  4Z9C B;  2AUK A;  5FLM G;  2B2W C;  2EYM A;  5IGE A;  4DV5 L;  1AH9 A;  2VQF Q;  2PNH A;  3NEN A;  2BE5 D;  1LTT D;  2PMZ E;  5ELE A;  1D6E C;  3CQZ B;  1YVC A;  3MZ5 A;  1Z7T A;  4A3M G;  2JA8 G;  1SNO A;  2KHJ A;  1HQM C;  5IYC H;  1LT5 D;  1STH A;  4A76 A;  1VDZ A;  5EPJ A;  4A3B H;  1M4V A;  3OWF A;  3PUY A;  4L5T A;  3TSS A;  1Q82 C;  1RIP A;  1GVP A;  3KF8 A;  4IUT A;  2HHH L;  1N32 L;  3GTK H;  1EUJ A;  1D2B A;  4MTN A;  5EBC A;  1VQH A;  5I9O A;  1BCP D;  2F0T A;  3O13 A;  1ONL A;  2N88 A;  2QF7 A;  3RLO A;  3K5N A;  2RDG A;  2XGT A;  4M1U B;  5I2X A;  3J7A 5;  3NP8 A;  1BR9 A;  1H9J A;  4APV A;  1KNE A;  4X6A H;  2XVS A;  1UAP A;  2F0F A;  2IWH A;  3S14 B;  2K4K A;  1BDO A;  4DF7 A;  4A3F B;  1JOO A;  3K7A H;  1C7Y A;  1HZ9 A;  1PHJ A;  3CXC A;  1Q86 C;  4S3S A;  4N9T A;  1LO5 D;  3AQQ A;  5C4J B;  2IX1 A;  4BBR H;  3KJP A;  1S5C D;  1S40 A;  4F88 A;  1TWC B;  2CKZ B;  3PGZ A;  2MO1 A;  3AFP A;  4BWG B;  3S1R H;  4DV7 L;  5C5M A;  1FGB D;  1F77 A;  3KOJ A;  1UNS A;  2F0O A;  4L5S A;  4OX9 Q;  1EYG A;  3B6Y A;  4NW2 A;  4KJN A;  1YNX A;  1SJE D;  1VQJ A;  3R2T A;  3FKI H;  4ZRZ A;  2FHT A;  2ZTC A;  3URY A;  4JI0 Q;  1B7Y B;  2EJM A;  2OQ0 A;  2PW5 A;  4A3E H;  1QVF A;  2GA4 B;  3VR3 A;  2JA6 B;  2JEB I;  2A68 C;  2Q2T A;  2B63 B;  1WTX A;  2B2Y C;  3TZD A;  2J0T D;  2J4X A;  4B3S L;  3M3Y H;  3Q23 A;  4PMW A;  3IKJ A;  1Z9F A;  2PZT A;  1QZG A;  1Q1B A;  3MXN A;  4GKJ L;  4MNO A;  3MVV A;  2F0M A;  3EIV A;  4DKA C;  5LMU L;  1XPU A;  1Y8P B;  4POF A;  2LSS A;  3PUV A;  1ESR A;  2CFM A;  1KIX A;  4JCV E;  1SE8 A;  2MUY A;  4LFC L;  2VUM H;  4ZLT F;  1ROD A;  1N9W A;  4A75 A;  3BYT B;  1J6Q A;  1HUM A;  5ELC A;  1AN8 A;  2JK8 A;  4C2M B;  1KAA A;  5C44 G;  4B3T L;  1EYD A;  5IYD H;  4BBS H;  1EIF A;  1HNX Q;  4C3I H;  4JI1 L;  5IGC A;  1WFQ A;  1FNV A;  1LM0 A;  3GTM B;  1SMY D;  2NN6 H;  1XNQ L;  3H0G G;  4HR7 B;  3BVG A;  4A3D G;  4FF4 A;  1C4Q A;  3OW2 A;  3SK6 A;  1QUQ B;  3A54 A;  2EVB A;  4YIJ A;  4HIO A;  3GTG B;  4PNY A;  5I9P A;  3S2H B;  1KD1 C;  4IUU A;  1HUN A;  2RSN A;  1TXY A;  1Q3L A;  1HNZ Q;  4RA8 A;  1HNW Q;  2RF4 A;  4RHR A;  4K5V A;  5JJI A;  4QQB X;  3K57 A;  3NBH A;  3I4O A;  3QO2 A;  5IIF A;  3CHB D;  4DV2 Q;  4AQY L;  1G2S A;  1U5K A;  1UEA B;  4A3K H;  2G9D A;  4A3J H;  4DV4 L;  4HN7 A;  1CQV A;  5IP9 G;  1UE5 A;  1WTR A;  2K5N A;  4H0L C;  1K0S A;  4KJO A;  2L11 A;  2J7Z A;  1DM0 B;  1JE4 A;  4LF9 Q;  4OWW B;  3ICE A;  2C35 B;  4LAA A;  4KN7 C;  5CC4 A;  4RKB A;  2XNA C;  4KHP Q;  1JJG A;  5H1S E;  4QJF A;  2A74 C;  3MEF A;  3J7Y W;  1TWA B;  5DLQ E;  4BA1 I;  5HGT A;  2F4V L;  2JJQ A;  1N36 Q;  3HOW B;  3KJO A;  1SNP A;  3HOZ B;  3DWA A;  5M3F B;  1EQV A;  1VQI A;  5IWA L;  1IL2 A;  4JC0 A;  4IN3 A;  3PO3 H;  4DK3 C;  4IFD G;  4K6L A;  4ABN A;  4C3J G;  1EFI D;  1S5F D;  1X32 A;  4XDX A;  1Y14 B;  2EY2 A;  2RQX A;  1V1P B;  4JI7 L;  5IYB G;  1G29 1;  4A3G H;  4DV0 L;  1IBK L;  5FOB B;  2BCO A;  2A6E C;  3G71 A;  1WTW A;  5ELB A;  1TII D;  4BA2 I;  2JA5 G;  4DUY Q;  2KHI A;  2AMC B;  1MGS A;  4NKL A;  3MFY A;  1ILQ A;  4KMU C;  3NSW A;  1CKN B;  1BBU A;  1SLJ A;  2F0V A;  3H6M A;  3WWV A;  1AZQ A;  1VQK A;  3KDF A;  2R7Z G;  3D3R A;  4DK1 A;  3OYY A;  2UXB L;  3NTK A;  3J80 i;  5C0X J;  4QL5 A;  5D14 A;  4EQN A;  1U4M A;  2MPM A;  2R61 A;  4X3K A;  1WJJ A;  1VMC A;  4DR7 Q;  1PTO H;  4B9X A;  2BA1 A;  1A2U A;  1X54 A;  3U9O A;  4DPG A;  5J22 A;  1XMO Q;  2UUC Q;  1LTG D;  4DNT B;  1E22 A;  1ZXT A;  1UWV A;  2DY7 A;  4HMI A;  2B2W A;  2K14 A;  1LV9 A;  2DUD A;  4KD4 A;  4L5Q A;  1EIG A;  1B2T A;  5C4X G;  4V19 0;  1WOC A;  1PH8 A;  1HXY D;  2F0I A;  1G91 A;  1XWE A;  5FLM H;  2P5Z X;  2WB1 G;  2UXC L;  3ND9 A;  1K73 C;  3J7Z C;  4JI0 L;  3UDG A;  3D4R A;  1SAP A;  3RLF A;  2D0O A;  1SNC A;  4LFA L;  1E7Z A;  4NXM L;  3LX0 A;  2IHF A;  4IPD A;  1YI2 A;  4IPC A;  1TU2 B;  2IY5 B;  2EYF A;  4A3M H;  2JA8 H;  1P16 A;  2R93 G;  1VQ7 A;  2K6A A;  1I4H A;  1ET9 A;  2LY7 A;  4IUV A;  3CP0 A;  2EYO A;  3EBE A;  1HJP A;  2B8F A;  4DAP A;  1AE2 A;  1N8R C;  2R92 B;  1SXT A;  5EJW A;  4LK1 C;  3J80 E;  5BN4 A;  5IP7 G;  4QB4 A;  1G51 A;  1E2V A;  3N52 A;  3S1N B;  4F8M A;  4JI2 Q;  2NUC A;  5KEE A;  4R4O A;  2ZXR A;  1YNJ C;  3S1Q B;  5EBD A;  2I5L X;  4RH6 A;  3W1B A;  4A93 B;  2ES2 A;  1BUV T;  2E2J H;  5T1G A;  5ELN A;  1PH2 A;  3L9A X;  2JA7 G;  1EY5 A;  1CHP D;  1I94 Q;  2BH2 A;  2F52 A;  1U0L A;  2NVQ B;  5CBA E;  1YZ6 A;  4KY6 A;  1HNW L;  1MBY A;  1Y1W B;  5A35 A;  3GP7 A;  2UU9 Q;  3H91 A;  1BCP F;  2B2Y A;  2KCM A;  3U9S A;  1IBM Q;  3W1G A;  2D9U A;  4XYQ A;  1NAP A;  4P71 A;  1VQD A;  1X9N A;  1Z6H A;  4XYO A;  1Y8O B;  3NWT A;  4X3U A;  1PFM A;  4NP5 A;  2BDN A;  3STB D;  1QOH A;  1VQN A;  5I4D A;  2K5D A;  3E9I A;  1HTL D;  5LMN W;  4B3M L;  2AUJ D;  4KHP L;  1Y8N B;  3SEB A;  4GZY C;  1QVG A;  1GUW A;  1VQ5 A;  1NR4 A;  2UXD L;  4XQJ A;  4BY1 G;  3NK9 A;  1PTO F;  1FJG L;  2BA0 A;  4KKU A;  3Q22 A;  4H02 A;  5C44 H;  2IJ0 A;  4CKB A;  2EXZ A;  1WTH A;  4DXG A;  4LMQ D;  4A3F G;  1GKH A;  1Q90 A;  3RNU A;  2QGQ A;  3VR5 A;  2E5L L;  5BN5 A;  5C4H A;  2A6H C;  2Y0S B;  4OGQ C;  4Q0F A;  3H0G H;  4LF7 L;  1SEB D;  2EDG A;  3TZU A;  3S24 A;  1I50 H;  4FXG C;  4A3D H;  1LLR D;  3AFQ A;  1A63 A;  1SNM A;  1Z47 A;  2K75 A;  1OTC A;  5KGU A;  5CYU A;  1ENC A;  3K8A A;  3A8I E;  4IQZ A;  4JPB W;  1ASY A;  3TP6 A;  1X6O A;  3BYY B;  2UUA L;  2QEX A;  3I4N G;  2I5H A;  1JJ2 A;  1IHZ A;  1STB A;  4LF8 Q;  4NXN Q;  3T4A C;  1BQQ T;  2JA6 G;  2RCF A;  2Z6K C;  4K6D A;  1O7Z A;  4QF4 A;  2O5J C;  1A8V A;  5CGK A;  3MXG A;  1QUQ A;  3MWY W;  1TVX A;  2VZA A;  1R4Q B;  4DUZ Q;  5M5Y B;  4UP8 A;  3H3V H;  2NBF A;  1O7L A;  3I4M G;  1C8C A;  2JQO A;  2MGS A;  4YCW A;  5IP9 H;  5E7N A;  1Q12 A;  1GHJ A;  4JYA Q;  2B2V C;  2PZW A;  4J15 A;  2UUC L;  4DR6 L;  1UEB A;  5FLX c;  4DR2 Q;  1A2T A;  3DHQ A;  3CW2 C;  2D62 A;  1HH2 P;  1HZB A;  4RHS A;  4DR3 Q;  3RD4 A;  2H4O A;  5M3M G;  1A3U A;  5KIX A;  2Z4I A;  1X3G A;  3ERO A;  3MHB A;  4R4Q A;  1I6H H;  3HG9 A;  1CKO A;  1EIH A;  3J81 c;  1JR0 D;  4R4I A;  3RUZ A;  5A2Q E;  3GD7 A;  1S5E D;  1NJI C;  2VB2 X;  4K2L A;  3HOU B;  4U68 A;  4DR5 L;  4IFD H;  4CJ2 C;  4GOP B;  4C3J H;  3I2Z A;  4DN4 M;  4CBV A;  5ELD A;  4CDF C;  5IYB H;  4UP7 A;  1CK1 A;  2F0D A;  1NUC A;  3K6O A;  1BO0 A;  4JI4 Q;  2BDO A;  3JAM i;  3HS0 C;  2JA5 H;  4HJ8 A;  3I4L A;  3RZD H;  5CR3 A;  2JP1 A;  2WP8 J;  5KYL A;  2ZJP A;  4RKL A;  4XT3 B;  1A62 A;  4TQU S;  1PYS B;  1HFG A;  1V1P A;  1CQF A;  1RF2 D;  2B39 A;  4KKS A;  2R7Z H;  1TR5 A;  3D4D A;  3U50 C;  4GOP C;  3DM1 A;  1B50 A;  4G7O C;  1WTQ A;  1S3O A;  2LKV A;  4NB3 A;  4LF4 L;  2LFN A;  4G7H C;  4B3R Q;  2F3V A;  2K5V A;  3AYH B;  1MIU A;  4WJW A;  1CKN A;  3NUC A;  3LGJ A;  2R6G A;  1B53 A;  3MEH A;  1CT1 D;  3CRK C;  1XTD A;  3SDZ A;  2K28 A;  2TMP A;  1E1O A;  3CD6 A;  2CW0 C;  2RVL A;  1B9M A;  3E9H A;  5FLX L;  5AFW A;  4DV3 L;  3ULL A;  1I5F A;  1BXT A;  3BVM A;  3ER0 A;  1LAB A;  3FP9 A;  4ZUI A;  1B9N A;  4IPG A;  5EPL A;  3SR1 A;  4IO9 A;  5C4X H;  3PIP 3;  4GN4 B;  1ET6 A;  3HOZ G;  3BDC A;  1SJH D;  1VQ6 A;  1FGU A;  4G7Z C;  1AFP A;  3GTP B;  4DK0 A;  4A3I G;  5KNB A;  1QNK A;  2SOB A;  3HKZ B;  1ENA A;  4K0K L;  3J81 L;  5FO7 B;  2KEC A;  2PZU A;  4DGZ A;  4C1N K;  4LUZ A;  5LMN Q;  3V05 A;  5IT9 c;  1TS3 A;  4CKE A;  3PIP A;  3D6W A;  1XMQ Q;  2WV6 D;  3HOY B;  4C3H B;  2NVY H;  2KUM A;  4MHE A;  1PH3 A;  2IX0 A;  1N33 L;  4DXF A;  1E3P A;  3EFX D;  1TT2 A;  5K36 G;  3R8B A;  1OXT A;  1HA5 A;  1SSO A;  1HZC A;  4KK7 A;  2WKD A;  3D6C A;  3A5Z B;  2R93 H;  3QJY A;  1JB7 A;  1KLU D;  1EY0 A;  5E4W C;  2D0P A;  3I3C A;  1HRJ A;  1TS5 A;  3PQI A;  3V96 A;  4YCU A;  1B4O A;  2QDB A;  4GNX B;  3GTK B;  3M9B A;  2KCC A;  2Z0S A;  3BG3 A;  5IP7 H;  3PO2 G;  3VR2 A;  2OTJ A;  3LWE A;  1LUZ A;  1NE3 A;  2B29 A;  1D1I A;  3OW7 A;  1A0I A;  2Z8L A;  4HMJ A;  5D65 A;  3ULP A;  1OXX K;  4GLA C;  1SRU A;  2M9V A;  3U58 A;  1BF4 A;  1I3Q H;  1CM9 A;  2E8G A;  4DR4 Q;  1V1O A;  2E2H H;  1O80 A;  2L12 A;  4AYB G;  4JI3 L;  2KHS A;  4HED A;  3HOX G;  4GNX C;  1DGS A;  4JI8 Q;  1E2W A;  3K0X A;  4BBR B;  1XXG A;  2Z4H A;  2QA4 A;  2JA7 H;  3ZJY C;  5I6W A;  4L6T B;  3CMA A;  1F9P A;  2IL8 A;  2ZXO A;  4GKK Q;  3CCJ A;  2C5C A;  4HIM A;  5GAD C;  1VQG A;  3FKI B;  4PZ7 A;  1KXL A;  4H44 C;  4RGN A;  4A3E B;  3AMU A;  1JOR A;  4ME5 A;  2A6E D;  1B1Z A;  1BKB A;  1TWF H;  2RA4 A;  4PZ6 A;  1MSG A;  5CV8 A;  4ZKB B;  5GRO A;  5IT9 L;  3UI2 A;  1H9M A;  4HSP A;  1KHI A;  4QUC A;  2PMZ B;  2AQ2 B;  1ZEQ X;  4JYA L;  2FMM A;  3M3Y B;  3MXU A;  2NYZ D;  5EKL A;  1GUG A;  3KLS X;  1GD7 A;  2IHE A;  3ITP A;  3RZO H;  4N9P A;  4C1N I;  1G6Z A;  1SE3 A;  4K8J A;  3DWP A;  4GS3 A;  1PRT F;  1O7I A;  4K2K A;  3I73 A;  4QUF A;  1H9S B;  3DM3 A;  2VUM B;  1BBX C;  3CCS A;  4BY1 H;  2NB0 A;  3QG1 A;  1W6J A;  5JEA G;  5GAH C;  3FDT A;  3E3X A;  3KLR A;  2VW9 A;  4BBS B;  4Q5V A;  4C3I B;  1HHV A;  1QVC A;  3M7G A;  4A3F H;  3J7A F;  1NCV A;  1CA5 A;  2UUB L;  3NQI A;  3PF5 A;  4A93 G;  4R4T A;  3FHW A;  3TN2 A;  3RR5 A;  2E75 C;  4IOC A;  1TWC H;  3TS2 A;  4JI4 L;  2EE1 A;  2LXJ A;  2QKI C;  4K8I A;  5CBE E;  3CCL A;  3RN5 A;  4XQN A;  2A1A A;  2QDL A;  5I6Y A;  4JI5 L;  1FNU A;  2Z6K A;  1HPC A;  3I4N H;  4HTH A;  2XWB B;  4ZKC B;  1EYC A;  2JA6 H;  1G8Z D;  1SRO A;  4DV6 Q;  1H9R A;  1YNN C;  2ALY B;  1QE6 A;  3CC7 A;  4A3L G;  1Q8I A;  1X3Q A;  1GUN A;  1J5E L;  4I65 A;  2F0U A;  4A3K B;  2B2V A;  3KLW A;  1M1K C;  2DY8 A;  4B3R L;  3LWU A;  2FJ2 A;  2EYL A;  4A3J B;  3L7Z C;  1FL0 A;  1JJC B;  2ASB A;  5G3L F;  3K5M A;  5JPN C;  3I4M H;  2AKW B;  3CCM A;  1TY2 A;  3EVQ A;  2Q8R E;  1B8A A;  5C0X I;  1PH9 A;  1EIY B;  2GVB A;  1QJO A;  3K80 C;  2AQ1 B;  4Y52 H;  2EY5 A;  1YEZ A;  1TKW B;  4IJL A;  3GTQ H;  5M3M H;  5ELF A;  2WAQ B;  3T1Y Q;  4JOI A;  3MAQ A;  1TS2 A;  1E0B A;  1JIC A;  4BXX G;  1D1K A;  1YNJ D;  1Y1V G;  2NZ1 D;  3IAY A;  1MJC A;  1WD0 A;  1AZP A;  4UAI A;  3G48 A;  3PO3 B;  3OTO L;  3GTL H;  4X62 Q;  4L8J A;  1GUT A;  4FDB A;  2AWO A;  2PQE A;  5LL6 S;  5IOC A;  3HOV G;  3NQT A;  4FYD A;  2HQE A;  1JT8 A;  1SYC A;  4JI6 Q;  2DGY A;  2TSS A;  5DAU A;  2MJ8 A;  3OOC A;  4A3G B;  1JE5 A;  3PCO B;  3VR4 A;  2K50 A;  2SNS A;  2I46 A;  3KBX A;  1JWM D;  4H13 C;  5E1F A;  2AHO B;  4KI0 A;  3SE0 A;  2VQF L;  1TWG H;  1SE4 A;  1II3 A;  3DWQ A;  1I4X A;  1RKN A;  3I91 A;  4LFB Q;  4GOP A;  4WRD A;  1UE7 A;  2IT1 A;  4HJA A;  4P2C B;  3FPP A;  2OT2 A;  4NMZ A;  2F0W A;  3CKI B;  3I55 A;  4X65 Q;  4AYB E;  1PTO B;  1AP0 A;  4ALP A;  5DEH A;  1LT4 D;  1KC8 C;  3Q6S A;  4DNI A;  3U4Z A;  1WTP A;  1Y69 U;  2K03 A;  3QWN A;  1KDB A;  2HDL A;  1PH4 A;  2N8N A;  2FFK B;  3GTJ H;  1AEX A;  3CF5 A;  3A74 A;  1HA6 A;  1JWU D;  1K8G A;  1XNR Q;  5FJ8 G;  3HOZ H;  2JYO A;  2L5T A;  1EYA A;  3RMH A;  4ZCK A;  4A3I H;  4XQQ A;  1VF5 C;  3GV6 A;  3HEJ A;  1PTO C;  4LF6 Q;  4IJH A;  3G7L A;  3PUW A;  4JBJ A;  2XRQ D;  3X3M A;  4FNF A;  4KY5 A;  1QZH A;  4EVO A;  1TWH H;  3PF4 A;  3HRZ C;  4DAY A;  5K36 H;  1GJX A;  4LW1 A;  4OX9 L;  4A3M B;  1EL0 A;  2EYJ A;  1WYD A;  3D31 A;  4JBM A;  3S17 B;  3L2P A;  2KCT A;  1KRS A;  1J8I A;  3CCV A;  2O4X A;  4MTK A;  2MP1 A;  3WOF A;  4HJ7 A;  1KDC A;  2PNR C;  1W3S A;  3TEH B;  2OWO A;  1GUO A;  2K04 A;  3CCQ A;  2IPK D;  1HCZ A;  4OHJ A;  1PYW D;  4PZ8 A;  4RGT A;  1PFS A;  3PO2 H;  3VR6 A;  3IL8 A;  1KLG D;  3R3O A;  2YTY A;  2KBN A;  3TQY A;  3VDY A;  1VQA A;  2CHB D;  1XPR A;  2F0S A;  3KYH C;  1K8M A;  5JOB A;  3VYT A;  3OMG A;  1WD1 A;  4GNX A;  3U4V A;  1IKL A;  1WCM G;  4OEL B;  4MN3 A;  1D5Z C;  3PUZ A;  3A55 A;  4BY7 B;  3F2D A;  4WJ4 A;  3HOX H;  2E2J B;  1W6K A;  1Q46 A;  1KTK A;  1EY7 A;  3SHL A;  3D4W A;  3FRP B;  2ICE C;  2WKC A;  1HNX L;  4OIK A;  3UDF A;  1QWY A;  1EOT A;  2K5W A;  3E0E A;  3C46 A;  4JK1 C;  1K0R A;  5CV4 A;  4YY3 Q;  3SK8 A;  1IBL Q;  2NTT A;  5C3E G;  2EY6 A;  5EQ0 A;  3HOY G;  3ERQ A;  4C3H G;  3NWS A;  1KAW A;  3KF6 B;  3L3O C;  3CCU A;  1VQM A;  3BS1 A;  4F87 A;  2NWG A;  4KV6 A;  1K83 H;  5EKK A;  5BR8 Q;  3T1H Q;  1P8L A;  3M4Q A;  1RTO A;  4V0B A;  5IYC G;  3CCE A;  2F03 A;  2L0C A;  2PO4 A;  3S2D H;  1IZ6 A;  1HNZ L;  1E1T A;  4POG A;  2PI2 A;  3H15 A;  4DR1 Q;  4QY7 A;  4EGV A;  2B2U C;  4DV2 L;  2KCN A;  2CWA A;  4J6H A;  2H1E A;  2RDH A;  4KHV A;  1X56 A;  2F3I A;  4OO1 G;  5D3D A;  3NXW A;  1HQR D;  3TP5 A;  5HUR A;  1VQB A;  4O0A A;  1PYB A;  2IX3 A;  5JEA H;  4LF9 L;  2ZM6 Q;  1HR0 Q;  1OXU A;  2CW0 D;  4NDX A;  3F2U A;  2NVT B;  1SNQ A;  4A93 H;  1G6P A;  3H0G B;  1Q7Y C;  1ZYR C;  1H9S A;  3M4O H;  3W5O A;  3D8G A;  1I50 B;  2SNM A;  4A3D B;  3HGB A;  3K0Y A;  1DZ1 A;  3PMF A;  4N8X 1;  1K8A C;  1N36 L;  2E2I H;  4FF2 A;  5CV5 A;  5AJ3 Q;  1LTA D;  3NEL A;  3DEO A;  4JV5 Q;  3E0J A;  5JJZ A;  1L0W A;  3A5U A;  4FVM A;  2YTX A;  5JVH 3;  3FKI G;  3K5L A;  4DV5 Q;  1R9T H;  3AEV A;  5KND A;  1AW7 A;  1FD7 D;  5M5X B;  1C9O A;  3H09 A;  4ZUJ A;  3MFG A;  2A69 C;  2OCE A;  4A3L H;  4IFD J;  4J8Q A;  2KEN A;  1VQE A;  5HGQ A;  2QEJ C;  4DUY L;  2SEB D;  2DNE A;  1YIT A;  1I4Q A;  2K7V A;  4X3S A;  2Z6B A;  2EPB A;  1SN8 A;  4RG1 A;  4G4K A;  5E4X A;  1EZ6 A;  3TRZ A;  1PH6 A;  4P72 A;  5FO8 B;  1D5M C;  1XX8 A;  3AB9 A;  4ID6 A;  2B63 G;  1V43 A;  5D3I B;  1N32 Q;  4JBW A;  2L55 A;  3S15 H;  3UE0 A;  1LTI D;  1X65 A;  2KVM A;  3MTS A;  4L63 B;  1I6H B;  4ZQ3 A;  3SXH A;  3A7L A;  4DR7 L;  1NNX A;  1CI3 M;  3ONA B;  2X69 A;  3HFZ B;  1N34 Q;  4BXX H;  2ICI A;  1Y1V H;  2VQE Q;  1XMO L;  3H3V C;  2L1B A;  1H95 A;  1RHP A;  2MO0 A;  3D0F A;  4UY8 C;  3JAM c;  2R3Z A;  3J81 j;  2I07 B;  2Q2H A;  5JPM C;  3W2D A;  1GHK A;  4C3J B;  2KQ3 A;  3CPF A;  1B70 B;  1LTR D;  4OO1 I;  2YU9 H;  1STG A;  3QOL A;  3HOV H;  2F3W A;  2ZTE A;  3OIQ A;  3MXP A;  2KED A;  4K5W A;  5CMD A;  4JOI C;  4FXK C;  1V1Q A;  4DV7 Q;  2JA5 B;  1YJ9 A;  3WDN A;  2VS1 A;  4R8I A;  4R9W A;  3E6Z X;  1KAB A;  2FXQ A;  2AWN A;  3RZD B;  1NBW A;  2OXP A;  1X3E A;  4Y7N B;  1C48 A;  2I5M X;  3TS0 A;  3F1Z A;  1RDP D;  3OIP A;  2R7Z B;  4FF3 A;  1HZA A;  3C3L A;  4ME3 A;  3ULJ A;  1PRT B;  5M5W H;  1ENF A;  4X64 Q;  3NEM A;  3X3N A;  4B3S Q;  4QIW B;  1PZK D;  1RCV D;  2C9O A;  4A3C G;  4ZAI A;  2A68 D;  1S5D D;  5LMU Q;  3I70 A;  1J9O A;  1YHB A;  4DU9 A;  2XRS D;  3QOJ A;  5C3W A;  3TP7 A;  3NPP A;  5HY6 A;  1L1O B;  4YHH Q;  1WI5 A;  4HAE A;  3QB3 A;  3S1M B;  1EY6 A;  4RGO S;  1X3F A;  4AH6 A;  4RFB A;  2K32 A;  3F8T A;  4IUP A;  5IGG A;  5C4X B;  3TDQ A;  5ELO A;  1VQF A;  4JI2 L;  1PRT C;  3M4Y A;  2WB1 B;  1EEI D;  1D5X C;  4HCE A;  2B8G A;  2PYK A;  4JI1 Q;  1WTO A;  3FVQ A;  4H7B A;  2F0E A;  1V9P A;  1DXM A;  5L37 A;  3J81 i;  1FYC A;  1YHA A;  2NVY B;  4NPS A;  1SDF A;  4ZK9 B;  3JAM L;  1I94 L;  4QMG A;  2K33 A;  4LF5 Q;  2MQH A;  2EYH A;  1L1O C;  2Z9H A;  3HOW G;  4IZ8 A;  1Q1E A;  1X55 A;  4DAY B;  5FKA C;  3A56 A;  3SVM A;  4LWC A;  1PH5 A;  1ILP A;  5M3F G;  1S72 A;  1NR2 A;  3GTO H;  1PZI D;  3VA7 A;  2UU9 L;  1CHQ D;  1MKH A;  1IBM L;  1YNN D;  3NTI A;  3S16 H;  1EY8 A;  1VF7 A;  2NN6 I;  3IRB A;  2QIL A;  4LNQ A;  2ATW A;  4CHT B;  3OPO A;  5I2Y A;  2ZXP A;  3CC2 A;  5TSS A;  2F0K A;  4IPH A;  1CUK A;  3SK5 A;  2N78 A;  3VYS A;  5GAE C;  2DN8 A;  5LHY 1;  2F1M A;  3I90 A;  1XYI A;  1F9R A;  1KQS A;  2PW7 A;  1ESF A;  1RTN A;  2RDF A;  4DV4 Q;  2B2T C;  4RMF A;  4A3B B;  3K58 A;  4PG3 A;  4QCL A;  4DAV A;  2E2H B;  4I7A A;  3I56 A;  1WCM H;  2NVX H;  1A3V A;  1I6V C;  4OXP A;  5COR A;  1VS0 A;  1DD2 A;  5JJL A;  1T5E A;  5FLX E;  1FVI A;  1ICF B;  1SFO H;  1VQ9 A;  3EN2 A;  2JA7 B;  1BVS A;  2K01 A;  3GTP H;  2K52 A;  2VXW A;  2DNC A;  3DMU A;  3OSO A;  3P75 A;  1EOV A;  4KTA A;  2F4V Q;  1U4P A;  2F0N A;  1LYL A;  3FEW X;  5IWA Q;  1VMP A;  4IUR A;  1F9Q A;  5C3E H;  3J81 E;  1PLF A;  2CVR A;  3K7A B;  3NHH A;  3HOY H;  2HCI A;  4C3H H;  2EYP A;  3FMC A;  1TWF B;  1SE2 A;  4JI7 Q;  4DV0 Q;  5EAY A;  1IBK Q;  3S1R B;  3BU2 A;  3TME A;  2B2U A;  1GXD C;  1UE6 A;  4NXN L;  4LF8 L;  1JWS D;  4RWS C;  5C0X G;  3RZO B;  1OO9 B;  4K5X A;  3QR8 A;  1B3Q A;  3KF6 A;  1VQO A;  4LJZ C;  2V1C C;  2VL6 A;  3OMC A;  3CQZ H;  2QW7 A;  4DUZ L;  3C1E A;  3KK7 A;  4OO1 H;  1IW7 C;  2UXB Q;  4EQ5 A;  4RGM A;  1XTC D;  1STE A;  1N34 L;  4BY1 B;  1YJW A;  4HIK A;  1RL2 A;  2K5Q A;  2VQE L;  1CA6 A;  1K28 A;  4DR2 L;  1H9K A;  1OXS C;  5LL6 X;  2R92 G;  1QG7 A;  1G2T A;  2F4I A;  2GN5 A;  4DR3 L;  5J39 A;  4BY7 G;  2E74 C;  2JSO A;  1B3A A;  4R1J A;  5F2D A;  1DON A;  1QCB D;  2EOT A;  3OHX C;  3VA5 A;  5J3B A;  1VQP A;  1KL9 A;  1PTO D;  5CV9 A;  4UDU C;  2XSC A;  1F2Z A;  3S14 H;  2UXC Q;  2F0G A;  3I4N B;  4U67 3;  4DAM A;  4LFA Q;  5C4J H;  4NXM Q;  3T53 B;  4O2D A;  4X64 L;  1DYQ A;  2BOS A;  4UHV A;  5IT9 E;  4DNR B;  1Y1W G;  3PUX A;  1SYD A;  3I4M B;  4X3T A;  2WAQ E;  1WVL A;  2M2L A;  3HKS A;  2SDF A;  1OXV A;  4JG2 A;  4YHH L;  1DOM A;  4N8F A;  3PIO 3;  2ZJQ A;  2YV5 A;  4F7X A;  2B63 H;  1YBY A;  2F0L A;  1EQT A;  3WOE A;  3F2B A;  5M3M B;  3GTQ B;  1IYU A;  3T51 B;  3PV0 A;  2A19 A;  3A7A B;  1VQ4 A;  4XTC S;  1PV4 A;  1MD2 D;  3PIO A;  2Q2I A;  2OTL A;  1X3P A;  4IUN A;  2PQA B;  2CCZ A;  1YJN A;  4HCS A;  3W3A A;  1JOK A;  4GN3 B;  4TVA B;  3GTL B;  3K81 C;  1GM5 A;  4LF5 L;  3FPU B;  2Q2U A;  4KKT A;  4XT1 B;  2GVA A;  2XWJ B;  4C2M H;  4P73 A;  5NUC A;  4KY7 A;  4X66 Q;  1QB5 D;  4YWM A;  1UUP A;  1ASZ A;  1TWG B;  5FO9 B;  1FR3 A;  2AQ3 B;  5LMN L;  1PH7 A;  4YWK A;  3GTM H;  3TBI B;  3ZYY X;  2Y0S G;  1XMQ L;  1LAC A;  3Q24 A;  4PV1 C;  5CV7 A;  5KYI A;  2L9H A;  1BCP B;  3CC4 A;  2BE5 C;  3T56 B;  1JOQ A;  5IGD A;  3G6E A;  3KLS A;  3UDX A;  4CDE C;  2ENB A;  3RN2 A;  4L5R C;  3GTG H;  1EWI A;  4CJ0 B;  3S2H H;  2MHV A;  3J80 c;  4R4C A;  4HJ9 A;  1HR0 W;  4A3C H;  2EXD A;  1C0A A;  2QCP X;  2RKS A;  2N3S A;  2X6L A;  1PDQ A;  3GV3 A;  3HP3 A;  4DA2 A;  3T13 A;  3EA6 A;  4CJ1 B;  1CTM A;  4B3M Q;  5DM6 3;  4GLX A;  1IL8 A;  1SYF A;  5EPK A;  2ZTD A;  1KRT A;  3T16 A;  3DLL A;  3GTJ B;  1BCP C;  1PVO A;  1L0X B;  4C56 C;  2UXD Q;  5COY A;  3C2P A;  3G6J B;  4PMB A;  1UE1 A;  1AE3 A;  5DNF A;  1SYG A;  1FJG Q;  4DR4 L;  3K5O A;  5KRU A;  4A4I A;  2KA7 A;  1ZKO A;  2HDM A;  1I4R A;  1ZYR D;  3BDO A;  4A3I B;  2HIX A;  2RHS B;  1LTS D;  5T1I A;  4JI8 L;  5CV6 A;  4CKC A;  1L1O A;  1SYB A;  4LUV A;  3KUP A;  3TP8 A;  4DV1 Q;  4HID A;  2E5L Q;  4LF7 Q;  5GAG C;  2KJX A;  2EIF A;  3I8Z A;  1TWA H;  1TWH B;  2F0Q A;  1PMR A;  3HOW H;  4GKK L;  1YIJ A;  2Q8T A;  2HUG A;  5M3F H;  2Z1C A;  2K05 A;  2A6H D;  3DXJ C;  2EQS A;  3HOU G;  1K3B C;  3E5S A;  1GOZ A;  1O78 A;  2A69 D;  3EJI A;  1Q81 C;  2UUA Q;  1TY0 A;  1CZW A;  1D7Q A;  4OWT B;  3BZD B;  2NTS A;  3M4P A;  3K59 A;  3PO2 B;  2B2T A;  1S5B D;  4FO2 A;  2JA8 B;  3RLN A;  2HT1 A;  2KOL A;  5GQO A;  1T9H A;  1T5X D;  4JVZ A;  1SBB B;  2NZH A;  1ML0 D;  2HCC A;  3J80 L;  1V8Q A;  4DR6 Q;  4AYB B;  3A8J E;  2G5D A;  3OWE B;  1NMG A;  1LTB D;  1PA6 A;  3HOX B;  1F9S A;  2EJF C;  3SK4 A;  4XXE A;  4TRD A;  1STY A;  3H3V I;  4RAU C;  1A15 A;  1MHW C;  3BDL A;  1XPO A;  1JQY D;  1I4G A;  5C5L A;  1STN A;  1EQR A;  3R93 A;  2A8V A;  1CSP A;  2CQA A;  5IY0 A;  4OEM B;  1EU3 A;  3TRE A;  5EGT A;  4UPA A;  4HSV A;  3GQB A;  5JEA J;  1DOL A;  4ILW A;  2N55 A;  4DR5 Q;  4K14 A;  3ERS X;  1IXR A;  2G9H D;  2HIV A;  5IE8 A;  4B08 A;  1CSQ A;  3GDE A;  1MJE A;  1SMY C;  2I0Q A;  1K83 B;  4GLV B;  2R7F A;  4LUO A;  3S17 H;  2MNA A;  2JN4 A;  2NZO A;  3C1F A;  3HKZ G;  1EQQ A;  3S2D B;  3CU7 A;  1SR3 A;  2FMC A;  2K5H A;  3HZX A;  4BS9 A;  3KF8 B;  4OON A;  4DV6 L;  4IFD I;  5C0X H;  3P1H A;  2HD3 A;  2LMC B;  5JJK A;  1F2M A;  2OF1 A;  2X6G A;  4EQP A;  1W2B A;  3EQL C;  3MC0 B;  1EWC A;  4A3B G;  3KBG A;  3UE1 A;  3Q0A A;  4LF4 Q;  2LS0 1;  2Q8I B;  3IFT A;  1EY4 A;  4OL7 A;  1NMF A;  1KNA A;  4MIU A;  2R92 H;  2R7D A;  2IW3 A;  4BY7 H;  1BOS A;  3T1Y L;  3G4S A;  2A73 B;  1CFM A;  2KEE A;  3M4O B;  1RD9 D;  1PRT D;  2CWP A;  4QGU A;  2ZJR A;  1M8A A;  2XIW A;  4PQX A;  4KLK A;  4X66 L;  2CH4 W;  4DV3 Q;  2F0J A;  3H94 A;  1PXU A;  2E2I B;  4FXD A;  2Y0S E;  3S1N H;  5C44 B;  4ODG A;  1PFN A;  1U4R A;  1O7Y A;  3KFU A;  1NY4 A;  4X62 L;  1BBW A;  1TS4 A;  1R9T B;  3IFD A;  2D5D A;  4K0K Q;  3S1Q H;  4HJ5 A;  3BZC A;  3V2T A;  1DOK A;  2B3G A;  3P20 A;  1RJT A;  4JI6 L;  2WIN B;  3LNN A;  4BBR G;  4KHZ A;  1WTV A;  5J1Z A;  3VYU A;  1CKM A;  4CDD C;  2NVQ H;  1N33 Q;  4J1M A;  1EEF D;  3N6R A;  1Y1W H;  2DJG C;  3MXN B;  1PZJ D;  1JB3 A;  3ND8 A;  4LFB L;  1A3T A;  4O1N A;  1ICW A;  4A3E G;  5DM7 3;  4M8A A;  3L0O A;  5JVG 3;  1M90 C;  1EY9 A;  3S15 B;  1VCI A;  2VY3 A;  4X65 L;  1L2F A;  2N49 A;  4ZYS A;  4MZ9 A;  4XIG S;  4P75 A;  3SGI A;  4AIM A;  4G57 A;  4KN4 C;  3CRL C;  4CGY B;  2YTV A;  1MI2 A;  2RSO A;  2E2D C;  5G3L D;  1DJR D;  5IOD A;  1Y1V B;  2NVT H;  3Q8D A;  1B44 D;  4DV1 L;  2O5I C;  1A6X A;  5C6A A;  4B9W A;  4GN5 A;  2HHH Q;  4JI3 Q;  2VUM G;  4KD3 A;  1U9R A;  1K8O A;  2YU9 B;  4EX5 A;  3CCR A;  3HOV B;  1EZ8 A;  1PFB A;  1XNR L;  2FIN B;  1D8L A;  1LT3 D;  1BNZ A;  2XN9 C;  4DK6 C;  3K7U C;  5A2Q L;  5IGF A;  1EWH A;  5IYD G;  3NTH A;  4IUQ A;  4BBS G;  4C3I G;  5C3X A;  2M00 A;  1TQO A;  2PQA A;  5M5X H;  4LF6 L;  2PCF B;  4OIJ A;  2L15 A;  2ZT9 C;  2VNU D;  2RHQ B;  1DCZ A;  2NN6 G;  4E6I A;  1KDA A;  2WAC A;  2RBM A;  3NBH B;  3A0J A;  4QIW E;  2YYZ A;  5FK9 C;  3I72 A;  1R4P B;  2K1B A;  3BZK A;  2HQL A;  1IYJ B;  1PH1 A;  2F0H A;  2JA9 A;  2F0P A;  5M5W B;  1NTG A;  3BJU A;  4WFN 3;  3MA2 B;  1VQ8 A;  4TSS A;  5K5P A;  1IYV A;  2JE6 I;  5KNC A;  1Q8K A;  1SND A;  1L0Y B;  3DEP A;  1IW7 D;  3PSI A;  1LT6 D;  4DFA A;  4O42 A;  2EY1 A;  2WB1 E;  5C4Z A;  1E24 A;  4A3K G;  5M5Y H;  4PMC A;  4WJ3 M;  3CAM A;  4A3J G;  2MFI A;  2D2C C;  1LTL A;  3GO5 A;  3DUZ A;  2LXK A;  4P74 A;  5IGB A;  4CDC C;  4GKJ Q;  3QIA A;  1F2L A;  3J7A V;  3VYR A;  4OWX B;  4ULL A;  1K3R A;  4RCN A;  2UUB Q;  2V4D A;  2WAQ G;  2WFW A;  2OQK A;  1K9M C;  4LFC Q;  1GUS A;  3HKZ E;  1STA A;  2OEO A;  3CPW A;  4EQO A;  2H5X A;  1XJV A;  1QNU A;  4FP5 D;  2PPB C;  2O2L D;  2JEA I;  4YY3 L;  3GTO B;  1IBL L;  2DJF C;  5FJ8 H;  5JAV A;  4B3T Q;  3PO3 G;  1GO3 E;  3NE5 B;  2RCN A;  2E76 C;  3HOU H;  3S16 B;  3M7N A;  1SYE A;  4JI5 Q;  4Y7N H;  3A8K E;  2BH8 A;  1EU4 A;  1U4L A;  1VQL A;  4WOR A;  3T1H L;  5BR8 L;  3KDF B;  1XNQ Q;  3M85 A;  4A3G G;  1HTP A;  2EZV A;  4UP9 A;  5M9O A;  1FNW A;  4YWL A;  2XTI A;  1YHQ A;  1J5E Q;  2ID0 A;  4RCO A;  2R93 B;  4DR1 L;  1JC7 A;  2CH4 A;  1IKM A;  1MSH A;  1HFN A;  3P7J A;  1I4P A;  4YCV A;  3STB C;  4FF1 A;  1WCM B;  4TKO B;  2NVX B;  3S1M H;  2CQO A;  3BVZ A;  3I7F A;  2JXM B;  1VQC A;  1S4Z A;  3NBI A;  4AQY Q;  1SFO B;  1JMC A;  3AU7 A;  2ZM6 L;  1CZG A;  1HR0 L;  2EJG C;  2WII B;  3F2C A;  1F2Y A;  3CME A;  4JBK A;  1JCK B;  1I3Q B;  3UDI A;  1EFW A;  5EKI A;  5C3E B;  4I7Z C;  1E2Z A;  2L4N A;  2VB3 X;  4IOA A;  3OTO Q;  5E3F A;  5BN3 A; 
#chains in the Genus database with same CATH homology
 3R2I A;  4IAL A;  4R8N A;  5ISR A;  1QIL A;  3JAM E;  1NSN S;  3S9W A;  2A5H A;  4Z9C B;  2AUK A;  2B2W C;  2EYM A;  5IGE A;  2BE5 D;  1LTT D;  5ELE A;  1D6E C;  3CQZ B;  3MZ5 A;  1Z7T A;  1SNO A;  1HQM C;  1LT5 D;  1STH A;  1VDZ A;  5EPJ A;  1M4V A;  3OWF A;  3PUY A;  3TSS A;  3KF8 A;  4IUT A;  1D2B A;  5EBC A;  5I9O A;  1BCP D;  2F0T A;  3O13 A;  1ONL A;  2N88 A;  2QF7 A;  3K5N A;  2RDG A;  4M1U B;  5I2X A;  3NP8 A;  1BR9 A;  1H9J A;  1KNE A;  2XVS A;  1UAP A;  2F0F A;  2IWH A;  3S14 B;  1BDO A;  4DF7 A;  4A3F B;  1JOO A;  4S3S A;  4N9T A;  1LO5 D;  5C4J B;  2IX1 A;  1S5C D;  4F88 A;  1TWC B;  4BWG B;  5C5M A;  1FGB D;  1F77 A;  1UNS A;  2F0O A;  4NW2 A;  4KJN A;  1SJE D;  3R2T A;  4ZRZ A;  2FHT A;  3URY A;  2EJM A;  2PW5 A;  2GA4 B;  3VR3 A;  2JA6 B;  2JEB I;  2A68 C;  2B63 B;  1WTX A;  2B2Y C;  3TZD A;  2J0T D;  2J4X A;  3Q23 A;  4PMW A;  3IKJ A;  2PZT A;  1Q1B A;  3MXN A;  3MVV A;  2F0M A;  1Y8P B;  3PUV A;  1ESR A;  2MUY A;  4ZLT F;  1ROD A;  3BYT B;  1HUM A;  5ELC A;  1AN8 A;  4C2M B;  1KAA A;  1EYD A;  5IGC A;  1FNV A;  3GTM B;  1SMY D;  2NN6 H;  4HR7 B;  3BVG A;  4FF4 A;  1C4Q A;  3SK6 A;  3A54 A;  2EVB A;  4YIJ A;  3GTG B;  4PNY A;  5I9P A;  3S2H B;  4IUU A;  1HUN A;  2RSN A;  1Q3L A;  4RA8 A;  4RHR A;  4K5V A;  3K57 A;  3NBH A;  3QO2 A;  5IIF A;  3CHB D;  1G2S A;  1UEA B;  2G9D A;  4HN7 A;  1CQV A;  1WTR A;  4H0L C;  4KJO A;  2L11 A;  2J7Z A;  1DM0 B;  1JE4 A;  4LAA A;  4KN7 C;  5CC4 A;  4RKB A;  2XNA C;  2A74 C;  3J7Y W;  1TWA B;  4BA1 I;  5HGT A;  3HOW B;  1SNP A;  3HOZ B;  3DWA A;  5M3F B;  1EQV A;  4IN3 A;  4IFD G;  4K6L A;  4ABN A;  4C3J G;  1EFI D;  1S5F D;  1X32 A;  4XDX A;  2EY2 A;  2RQX A;  1V1P B;  1G29 1;  5FOB B;  2BCO A;  2A6E C;  1WTW A;  5ELB A;  1TII D;  4BA2 I;  1MGS A;  4NKL A;  3MFY A;  1ILQ A;  4KMU C;  3NSW A;  2F0V A;  3H6M A;  1AZQ A;  3D3R A;  4DK1 A;  3NTK A;  5C0X J;  5D14 A;  4EQN A;  1U4M A;  2MPM A;  2R61 A;  4X3K A;  1VMC A;  1PTO H;  4B9X A;  2BA1 A;  1A2U A;  3U9O A;  5J22 A;  1LTG D;  4DNT B;  1ZXT A;  2DY7 A;  4HMI A;  2B2W A;  1LV9 A;  4KD4 A;  1EIG A;  1B2T A;  4V19 0;  1HXY D;  2F0I A;  1G91 A;  1XWE A;  3ND9 A;  3D4R A;  1SAP A;  3RLF A;  1SNC A;  3LX0 A;  1TU2 B;  2EYF A;  2K6A A;  1I4H A;  1ET9 A;  2LY7 A;  4IUV A;  2EYO A;  2B8F A;  4DAP A;  2R92 B;  1SXT A;  5EJW A;  4LK1 C;  3J80 E;  5BN4 A;  4QB4 A;  1E2V A;  3N52 A;  3S1N B;  4F8M A;  2NUC A;  5KEE A;  2ZXR A;  1YNJ C;  3S1Q B;  5EBD A;  4RH6 A;  4A93 B;  1BUV T;  5T1G A;  3L9A X;  1EY5 A;  1CHP D;  2NVQ B;  5CBA E;  4KY6 A;  1MBY A;  1Y1W B;  5A35 A;  3GP7 A;  3H91 A;  1BCP F;  2B2Y A;  3U9S A;  2D9U A;  4XYQ A;  1NAP A;  1Z6H A;  4XYO A;  1Y8O B;  3NWT A;  4X3U A;  1PFM A;  4NP5 A;  2BDN A;  1QOH A;  5I4D A;  2K5D A;  1HTL D;  2AUJ D;  1Y8N B;  3SEB A;  4GZY C;  1GUW A;  1NR4 A;  4XQJ A;  3NK9 A;  1PTO F;  2BA0 A;  4KKU A;  3Q22 A;  2IJ0 A;  4CKB A;  2EXZ A;  4DXG A;  4LMQ D;  1Q90 A;  3VR5 A;  5BN5 A;  5C4H A;  2A6H C;  2Y0S B;  4OGQ C;  4Q0F A;  1SEB D;  2EDG A;  3TZU A;  4FXG C;  1LLR D;  1SNM A;  1Z47 A;  5KGU A;  5CYU A;  1ENC A;  3A8I E;  4IQZ A;  3TP6 A;  3BYY B;  1IHZ A;  1STB A;  3T4A C;  1BQQ T;  4K6D A;  4QF4 A;  1O7Z A;  2O5J C;  5CGK A;  3MXG A;  3MWY W;  1TVX A;  1R4Q B;  5M5Y B;  2NBF A;  1O7L A;  1C8C A;  2MGS A;  1Q12 A;  1GHJ A;  2B2V C;  2PZW A;  1A2T A;  3DHQ A;  2D62 A;  4RHS A;  3RD4 A;  2H4O A;  1A3U A;  5KIX A;  2Z4I A;  3ERO A;  3MHB A;  3HG9 A;  1EIH A;  1JR0 D;  3RUZ A;  5A2Q E;  3GD7 A;  1S5E D;  2VB2 X;  4K2L A;  3HOU B;  4U68 A;  4IFD H;  4CJ2 C;  4DN4 M;  4CBV A;  5ELD A;  1CK1 A;  2F0D A;  1NUC A;  3K6O A;  1BO0 A;  2BDO A;  3HS0 C;  3I4L A;  5CR3 A;  2JP1 A;  2WP8 J;  5KYL A;  4RKL A;  4XT3 B;  4TQU S;  1HFG A;  1V1P A;  1CQF A;  1RF2 D;  2B39 A;  4KKS A;  1TR5 A;  3D4D A;  3DM1 A;  1B50 A;  4G7O C;  1WTQ A;  2LKV A;  2LFN A;  4G7H C;  2F3V A;  4WJW A;  3NUC A;  2R6G A;  1B53 A;  3MEH A;  1CT1 D;  3SDZ A;  3CRK C;  1IKM A;  2K28 A;  2TMP A;  2CW0 C;  2RVL A;  1B9M A;  5FLX L;  5AFW A;  1BXT A;  3BVM A;  4ZUI A;  1LAB A;  1B9N A;  5EPL A;  3SR1 A;  3PIP 3;  1ET6 A;  3BDC A;  1SJH D;  4G7Z C;  1AFP A;  3GTP B;  4DK0 A;  5KNB A;  1QNK A;  2SOB A;  3HKZ B;  1ENA A;  3J81 L;  5FO7 B;  2KEC A;  2PZU A;  4DGZ A;  4C1N K;  3V05 A;  1TS3 A;  4CKE A;  3D6W A;  2WV6 D;  3HOY B;  4C3H B;  2KUM A;  4MHE A;  2IX0 A;  4DXF A;  3EFX D;  1TT2 A;  5K36 G;  3R8B A;  1OXT A;  1HA5 A;  1SSO A;  4KK7 A;  2WKD A;  3D6C A;  3QJY A;  1KLU D;  1EY0 A;  5E4W C;  3I3C A;  1HRJ A;  1TS5 A;  3V96 A;  1B4O A;  2QDB A;  3GTK B;  2KCC A;  3BG3 A;  3VR2 A;  3LWE A;  1D1I A;  3OW7 A;  2Z8L A;  4HMJ A;  5D65 A;  1OXX K;  2M9V A;  1BF4 A;  1CM9 A;  1V1O A;  1O80 A;  2L12 A;  2KHS A;  4HED A;  1E2W A;  4BBR B;  1XXG A;  2Z4H A;  5I6W A;  4L6T B;  1F9P A;  2IL8 A;  2ZXO A;  2C5C A;  3FKI B;  4H44 C;  4RGN A;  4A3E B;  3AMU A;  1JOR A;  4ME5 A;  2A6E D;  1B1Z A;  2RA4 A;  1MSG A;  5CV8 A;  4ZKB B;  5IT9 L;  3UI2 A;  1H9M A;  4HSP A;  4QUC A;  2PMZ B;  2AQ2 B;  1ZEQ X;  3M3Y B;  2FMM A;  3MXU A;  2NYZ D;  5EKL A;  1GUG A;  3KLS X;  3ITP A;  4N9P A;  4C1N I;  1G6Z A;  1SE3 A;  4K8J A;  3DWP A;  1PRT F;  4K2K A;  3I73 A;  4QUF A;  1H9S B;  2VUM B;  1BBX C;  2NB0 A;  3QG1 A;  1W6J A;  5JEA G;  3FDT A;  3KLR A;  4BBS B;  4Q5V A;  4C3I B;  1HHV A;  3M7G A;  3J7A F;  1NCV A;  1CA5 A;  3NQI A;  3TN2 A;  2E75 C;  2EE1 A;  2QKI C;  4K8I A;  5CBE E;  4XQN A;  5I6Y A;  1FNU A;  1HPC A;  4HTH A;  2XWB B;  4ZKC B;  1EYC A;  1G8Z D;  1H9R A;  1YNN C;  1QE6 A;  1Q8I A;  1X3Q A;  1GUN A;  4I65 A;  2F0U A;  4A3K B;  2B2V A;  2DY8 A;  3LWU A;  2FJ2 A;  2EYL A;  4A3J B;  3L7Z C;  5G3L F;  3K5M A;  5JPN C;  1TY2 A;  3EVQ A;  2Q8R E;  5C0X I;  1QJO A;  2AQ1 B;  2EY5 A;  1TKW B;  5ELF A;  2WAQ B;  3MAQ A;  1TS2 A;  1E0B A;  1JIC A;  1D1K A;  1YNJ D;  2NZ1 D;  3IAY A;  1WD0 A;  1AZP A;  4UAI A;  3PO3 B;  4L8J A;  1GUT A;  2AWO A;  2PQE A;  5LL6 S;  5IOC A;  3NQT A;  4FYD A;  2HQE A;  1SYC A;  2TSS A;  5DAU A;  2MJ8 A;  3OOC A;  4A3G B;  3VR4 A;  2SNS A;  2I46 A;  3KBX A;  1JWM D;  4H13 C;  5E1F A;  4KI0 A;  3SE0 A;  1SE4 A;  1II3 A;  3DWQ A;  1I4X A;  1RKN A;  3I91 A;  4WRD A;  2IT1 A;  4P2C B;  3FPP A;  2OT2 A;  4NMZ A;  2F0W A;  3CKI B;  1PTO B;  1AP0 A;  5DEH A;  1LT4 D;  3Q6S A;  1WTP A;  1Y69 U;  2K03 A;  3QWN A;  1KDB A;  2HDL A;  2FFK B;  1AEX A;  1HA6 A;  1JWU D;  2JYO A;  2L5T A;  1EYA A;  3RMH A;  4XQQ A;  1VF5 C;  3GV6 A;  3HEJ A;  1PTO C;  3G7L A;  3PUW A;  2XRQ D;  3X3M A;  4FNF A;  4KY5 A;  4EVO A;  3HRZ C;  4DAY A;  5K36 H;  1GJX A;  4A3M B;  1EL0 A;  2EYJ A;  3D31 A;  3S17 B;  1J8I A;  2O4X A;  2MP1 A;  3WOF A;  1KDC A;  2PNR C;  1GUO A;  2K04 A;  2IPK D;  1HCZ A;  4OHJ A;  1PYW D;  4RGT A;  3VR6 A;  3IL8 A;  1KLG D;  3R3O A;  2CHB D;  2F0S A;  1K8M A;  5JOB A;  3VYT A;  3OMG A;  1WD1 A;  1IKL A;  4MN3 A;  1D5Z C;  3PUZ A;  3A55 A;  4BY7 B;  2E2J B;  1W6K A;  1KTK A;  1EY7 A;  3SHL A;  3D4W A;  3FRP B;  2ICE C;  2WKC A;  4OIK A;  1QWY A;  1EOT A;  2K5W A;  3C46 A;  4JK1 C;  5CV4 A;  3SK8 A;  2NTT A;  2EY6 A;  5EQ0 A;  3ERQ A;  4C3H G;  3NWS A;  3L3O C;  3BS1 A;  4F87 A;  2NWG A;  4KV6 A;  5EKK A;  1RTO A;  4V0B A;  2F03 A;  2L0C A;  2PO4 A;  4EGV A;  2B2U C;  2KCN A;  4J6H A;  2H1E A;  2RDH A;  4KHV A;  4OO1 G;  5D3D A;  3NXW A;  1HQR D;  3TP5 A;  5HUR A;  2IX3 A;  5JEA H;  1OXU A;  2CW0 D;  4NDX A;  3F2U A;  2NVT B;  1SNQ A;  3H0G B;  1ZYR C;  1H9S A;  3D8G A;  1I50 B;  2SNM A;  4A3D B;  3HGB A;  3K0Y A;  1DZ1 A;  3PMF A;  4FF2 A;  5CV5 A;  1LTA D;  3DEO A;  3E0J A;  5JJZ A;  4FVM A;  5JVH 3;  3K5L A;  5KND A;  1AW7 A;  1FD7 D;  5M5X B;  3H09 A;  4ZUJ A;  3MFG A;  2A69 C;  4IFD J;  4J8Q A;  2QEJ C;  2SEB D;  2DNE A;  1I4Q A;  2K7V A;  4X3S A;  2EPB A;  4G4K A;  5E4X A;  1EZ6 A;  5FO8 B;  1D5M C;  1XX8 A;  3AB9 A;  4ID6 A;  1V43 A;  5D3I B;  4JBW A;  2L55 A;  1LTI D;  2KVM A;  3MTS A;  4L63 B;  1I6H B;  4ZQ3 A;  3SXH A;  3A7L A;  1CI3 M;  3ONA B;  2X69 A;  2ICI A;  3H3V C;  2L1B A;  1RHP A;  2R3Z A;  2I07 B;  5JPM C;  1GHK A;  3W2D A;  4C3J B;  2KQ3 A;  1LTR D;  4OO1 I;  1STG A;  3QOL A;  2F3W A;  3OIQ A;  3MXP A;  2KED A;  4K5W A;  5CMD A;  4FXK C;  2JA5 B;  3WDN A;  4R8I A;  4R9W A;  3E6Z X;  1KAB A;  3RZD B;  2AWN A;  2OXP A;  4Y7N B;  1C48 A;  1RDP D;  3OIP A;  2R7Z B;  4FF3 A;  3C3L A;  1PRT B;  1ENF A;  3X3N A;  4QIW B;  1PZK D;  1RCV D;  2C9O A;  4ZAI A;  2A68 D;  1S5D D;  3I70 A;  1J9O A;  4DU9 A;  2XRS D;  3QOJ A;  5C3W A;  3TP7 A;  3NPP A;  4HAE A;  3QB3 A;  3S1M B;  1EY6 A;  4RGO S;  4RFB A;  2K32 A;  4IUP A;  5IGG A;  5C4X B;  3TDQ A;  1PRT C;  3M4Y A;  2WB1 B;  1EEI D;  1D5X C;  4HCE A;  2B8G A;  2PYK A;  1WTO A;  3FVQ A;  4H7B A;  2F0E A;  1DXM A;  1FYC A;  2NVY B;  4ZK9 B;  3JAM L;  1SDF A;  4QMG A;  2K33 A;  2EYH A;  4IZ8 A;  1Q1E A;  3SVM A;  1ILP A;  5FKA C;  3A56 A;  1NR2 A;  1PZI D;  3VA7 A;  1CHQ D;  1YNN D;  3NTI A;  1EY8 A;  1VF7 A;  2NN6 I;  2QIL A;  4CHT B;  3OPO A;  5I2Y A;  2ZXP A;  5TSS A;  2F0K A;  3SK5 A;  3VYS A;  2DN8 A;  5LHY 1;  2F1M A;  3I90 A;  1XYI A;  1F9R A;  2PW7 A;  1ESF A;  1RTN A;  2RDF A;  2B2T C;  4A3B B;  3K58 A;  4QCL A;  4DAV A;  2E2H B;  1A3V A;  1I6V C;  5COR A;  1DD2 A;  1T5E A;  5FLX E;  2JA7 B;  2K01 A;  2VXW A;  2DNC A;  3DMU A;  3OSO A;  3P75 A;  4KTA A;  1U4P A;  2F0N A;  3FEW X;  1VMP A;  4IUR A;  1F9Q A;  3J81 E;  1PLF A;  2CVR A;  3K7A B;  3NHH A;  2HCI A;  2EYP A;  3FMC A;  1TWF B;  1SE2 A;  3S1R B;  3TME A;  2B2U A;  1GXD C;  1JWS D;  4RWS C;  5C0X G;  3RZO B;  1OO9 B;  4K5X A;  4LJZ C;  3OMC A;  3C1E A;  3KK7 A;  4OO1 H;  1IW7 C;  4RGM A;  1XTC D;  1STE A;  4BY1 B;  2K5Q A;  1CA6 A;  1H9K A;  1OXS C;  5LL6 X;  1G2T A;  1QG7 A;  2F4I A;  5J39 A;  2E74 C;  2JSO A;  1B3A A;  5F2D A;  1DON A;  1QCB D;  2EOT A;  3OHX C;  3VA5 A;  1PTO D;  5CV9 A;  4UDU C;  2XSC A;  1F2Z A;  2F0G A;  3I4N B;  4U67 3;  3T53 B;  1DYQ A;  2BOS A;  5IT9 E;  4DNR B;  3PUX A;  1SYD A;  3I4M B;  4X3T A;  1WVL A;  2M2L A;  2SDF A;  1OXV A;  1DOM A;  3PIO 3;  4F7X A;  2F0L A;  1EQT A;  3WOE A;  3GTQ B;  5M3M B;  1IYU A;  3T51 B;  3PV0 A;  3A7A B;  4XTC S;  1MD2 D;  1X3P A;  4IUN A;  4HCS A;  3W3A A;  1JOK A;  3GTL B;  3FPU B;  4KKT A;  4XT1 B;  2XWJ B;  5NUC A;  4KY7 A;  1QB5 D;  1UUP A;  1TWG B;  5FO9 B;  1FR3 A;  2AQ3 B;  3TBI B;  3ZYY X;  1LAC A;  3Q24 A;  4PV1 C;  5CV7 A;  5KYI A;  2L9H A;  1BCP B;  2BE5 C;  3T56 B;  1JOQ A;  5IGD A;  3KLS A;  2ENB A;  4CJ0 B;  2MHV A;  2QCP X;  2RKS A;  2X6L A;  3GV3 A;  1PDQ A;  3HP3 A;  4DA2 A;  3T13 A;  3EA6 A;  4CJ1 B;  1CTM A;  5DM6 3;  1IL8 A;  1SYF A;  5EPK A;  3T16 A;  3GTJ B;  1BCP C;  1L0X B;  4C56 C;  5COY A;  3C2P A;  3G6J B;  4PMB A;  5DNF A;  1SYG A;  3K5O A;  5KRU A;  2KA7 A;  1ZKO A;  2HDM A;  1I4R A;  1ZYR D;  3BDO A;  4A3I B;  1LTS D;  5T1I A;  5CV6 A;  4CKC A;  1SYB A;  3TP8 A;  3KUP A;  2KJX A;  3I8Z A;  1TWH B;  2F0Q A;  1PMR A;  2Q8T A;  2HUG A;  2Z1C A;  2K05 A;  2A6H D;  3DXJ C;  3E5S A;  1GOZ A;  1O78 A;  2A69 D;  3EJI A;  1TY0 A;  1CZW A;  3BZD B;  2NTS A;  3K59 A;  3PO2 B;  2B2T A;  1S5B D;  4FO2 A;  2JA8 B;  2KOL A;  1T5X D;  1SBB B;  1ML0 D;  2HCC A;  3J80 L;  1V8Q A;  4AYB B;  3A8J E;  3OWE B;  1LTB D;  3HOX B;  1F9S A;  2EJF C;  3SK4 A;  4XXE A;  4TRD A;  1STY A;  4RAU C;  1A15 A;  3BDL A;  1JQY D;  1I4G A;  5C5L A;  1STN A;  3R93 A;  2CQA A;  1EU3 A;  5EGT A;  4HSV A;  3GQB A;  5JEA J;  1DOL A;  4ILW A;  2N55 A;  4K14 A;  2G9H D;  4B08 A;  1SMY C;  1K83 B;  3C1F A;  3S2D B;  3CU7 A;  2FMC A;  3HZX A;  4BS9 A;  4IFD I;  5C0X H;  3P1H A;  2LMC B;  1F2M A;  2OF1 A;  2X6G A;  4EQP A;  3EQL C;  3MC0 B;  1EWC A;  3KBG A;  3Q0A A;  2LS0 1;  2Q8I B;  3IFT A;  1EY4 A;  4OL7 A;  1KNA A;  4MIU A;  2IW3 A;  1BOS A;  2A73 B;  1CFM A;  2KEE A;  3M4O B;  1RD9 D;  1PRT D;  1M8A A;  2XIW A;  4PQX A;  2F0J A;  3H94 A;  1PXU A;  2E2I B;  4FXD A;  5C44 B;  4ODG A;  1PFN A;  1U4R A;  1O7Y A;  1TS4 A;  1R9T B;  3IFD A;  2D5D A;  3V2T A;  1DOK A;  3P20 A;  1RJT A;  2WIN B;  3LNN A;  4KHZ A;  1WTV A;  5J1Z A;  3VYU A;  4J1M A;  1EEF D;  3N6R A;  1PZJ D;  1JB3 A;  3ND8 A;  1A3T A;  4O1N A;  1ICW A;  5DM7 3;  4M8A A;  5JVG 3;  1EY9 A;  3S15 B;  1VCI A;  4ZYS A;  4XIG S;  4G57 A;  4KN4 C;  3CRL C;  4CGY B;  1MI2 A;  2RSO A;  2E2D C;  5G3L D;  1DJR D;  5IOD A;  1Y1V B;  1B44 D;  2O5I C;  1A6X A;  5C6A A;  4B9W A;  4KD3 A;  1U9R A;  1K8O A;  2YU9 B;  3HOV B;  1EZ8 A;  1PFB A;  2FIN B;  1LT3 D;  1BNZ A;  2XN9 C;  5A2Q L;  5IGF A;  1EWH A;  3NTH A;  4IUQ A;  4C3I G;  5C3X A;  2M00 A;  1TQO A;  2PCF B;  4OIJ A;  2ZT9 C;  2VNU D;  1DCZ A;  2NN6 G;  4E6I A;  1KDA A;  2WAC A;  2RBM A;  2YYZ A;  5FK9 C;  3I72 A;  1R4P B;  2K1B A;  2F0H A;  2F0P A;  5M5W B;  4WFN 3;  3MA2 B;  4TSS A;  5K5P A;  1IYV A;  2JE6 I;  5KNC A;  1SND A;  1L0Y B;  3DEP A;  1IW7 D;  1LT6 D;  4DFA A;  4O42 A;  2EY1 A;  5C4Z A;  4PMC A;  2D2C C;  3GO5 A;  3DUZ A;  5IGB A;  3QIA A;  1F2L A;  3J7A V;  3VYR A;  4ULL A;  4RCN A;  2V4D A;  1GUS A;  1STA A;  2OEO A;  4EQO A;  1QNU A;  4FP5 D;  2PPB C;  2O2L D;  2JEA I;  3GTO B;  5JAV A;  3NE5 B;  2E76 C;  3S16 B;  3M7N A;  1SYE A;  3A8K E;  1EU4 A;  1U4L A;  4WOR A;  3M85 A;  1HTP A;  2EZV A;  5M9O A;  1FNW A;  2ID0 A;  4RCO A;  2R93 B;  1JC7 A;  1MSH A;  1HFN A;  3P7J A;  1I4P A;  4FF1 A;  1WCM B;  4TKO B;  2NVX B;  3BVZ A;  2JXM B;  3NBI A;  1S4Z A;  1SFO B;  3AU7 A;  1CZG A;  2EJG C;  2WII B;  1F2Y A;  1JCK B;  1I3Q B;  5EKI A;  5C3E B;  4I7Z C;  1E2Z A;  2L4N A;  2VB3 X;  5E3F A;  5BN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...