1R4VA

1.9a crystal structure of protein aq328 from aquifex aeolicus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
151
Chain Sequence
ETMLRPKGFDKLDHYFRTELDIDLTDETIELLLNSVKAAFGKLFYGAEQRARWNGRDFIALADLNITKALEEHIKNFQKIEQDMGVDELLEYIAFIPPVEMNVGEDLKSEYRNIMGGLLLMHADVIKKATGERKPSREAMEFVAQIVDKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AQ_328
publication title The crystal structure of Aq_328 from the hyperthermophilic bacteria Aquifex aeolicus shows an ancestral histone fold.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 48
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2003-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09123 DUF1931 Domain of unknown function (DUF1931)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1r4vA00
4UUZA 5AV5A 2PYOD 4WU8C 2F8NK 4AWLB 1P3AA 5AVCC 4AWLC 4XUJA 2PYOB 5BO0B 1ID3C 4NE6A 5JA4B 4KHAA 2IO5B 5GT0C 5C3IB 4ZUXB 5CPIA 4CAYA 4ZUXC 5CPKA 5B32B 5B31B 4Z66C 5GT3A 3O62D 5B32C 5B31C 3REHC 5B1MA 4H9RB 5B40C 3B6FD 1P3KD 4YM6A 5GXQA 3UTAC 3B6FB 5AV6B 1P3KB 4E45A 5AV6C 3NQJA 3X1SC 4HGAB 3UTBD 5B33A 3MGRB 5BNXA 3AZFC 5AV9D 1S32A 3UTBB 1H3OB 3MGPC 3RELD 2CV5D 5AV9B 3AZHA 3VH6A 5AY8C 4J8XA 3VH5T 5G49B 2PYOA 5BO0A 4LD9D 2FJ7D 3MNNB 3WA9D 3MNNC 1JFIB 3AZND 4LD9B 4YS3C 1EQZC 2NQBD 4H9PA 3WA9B 5DNMB 4H9RA 5DNMC 2NQBB 3KUYD 3O62A 3AV2D 3A6NC 1KX3B 5BS7C 3B6FA 3AFAD 1KX3C 3B6GB 5B2IB 3X1TC 1HQ3B 5CP6B 3WKJB 5B24C 1P3OB 1HQ3C 3W97D 4WZSB 1P3OC 3AZMD 3WKJC 3AN2D 1P3GA 5B2JB 4JJND 3W97B 1N1JA 5B2JC 3UTBA 4E44A 3AZMB 5AV9A 4JJNB 3RELA 4J8VC 2CV5A 5G49A 3KXBD 3LELD 3KXBB 3LZ1D 1P3PB 3MGQD 1JFIA 1P3PC 4LD9A 1P34D 3NQUA 2FJ7A 3WA9A 3LZ1B 3C1BB 3MGQB 1WWSA 4KUDC 3AZNA 3C1BC 3AV1D 1P34B 1P3LC 2NQBA 2F8NH 3AV1B 3KUYA 3AV2A 1BH9A 4H9QB 3AFAA 1M18C 3AZGB 3W97A 3AZGC 3AZMA 3AN2A 1M19C 4JJNA 3AZKD 3W96C 5JRGC 3VH6T 1AOID 3AZKB 3W99D 3TU4C 3KXBA 1AOIB 3B0DB 5FUGB 3KWQC 4H9SA 3B0DC 3LELA 5E5AB 3R45B 5E5AC 5BNVB 3X1VD 3LZ1A 3MGQA 4H9OB 1P34A 4ZBJC 1M1AD 3AZLD 1F66B 4Z5TD 3MVDC 3AV1A 1F66C 3UT9B 3REKB 5B0ZB 4Z5TB 3REKC 5B0ZC 5BT1D 4R8PD 4X23B 5F99B 4X23C 1P3IB 1P3IC 4G92B 5B1LB 2AROD 1F1EA 4G92C 5B1LC 3AZID 5AVBB 3AZKA 4WU8D 5AVBC 1P3AC 2F8ND 3AZIB 3AZJB 1AOIA 3W99A 3AZJC 4WU8B 4CSRB 2F8NB 3WTPA 5AVCB 2RVQC 3R45A 5GT0D 1ID3B 4G91B 4ZUXD 4G91C 4Z66D 5GT0B 3X1VA 5B32D 5B31D 3REHD 5B40D 4Z66B 4DRBA 4QLCC 3REHB 1M1AA 3AZLA 2BYMA 4M6BA 4Z5TA 5B40B 3UTAD 1ULYA 3REIC 1KX5B 5AV6D 3X1SD 3UTAB 1KX5C 3AZEC 3MGRD 4R8PA 3X1SB 3VH6W 3MGPD 3AZHC 1U35B 3AZFB 4KGCB 2AROA 1U35C 1B6WA 2JSSA 4WU9B 3WAAC 4J8UC 5AY8D 4KGCC 3MGPB 1A7WA 3AZIA 4WU9C 4Z2MG 4WU8A 5AY8B 2F8NA 2NZDC 3MNND 5JA4A 5GT0A 5DNNB 4ZUXA 2YFWB 3X1UB 4YS3B 5DNMD 4Z66A 5DNNC 1EQZB 3X1UC 5B32A 5B31A 3REHA 3A6ND 5B40A 4WNNB 1KX3D 3X1TD 3B6GD 3A6NB 5B2ID 3B0CT 5B24D 1P3GC 1HQ3D 5CP6D 3UTAA 3WKJD 1P3OD 3X1TB 5AV6A 1P3KA 5B24B 3X1SA 5B2JD 1BH8B 3MGRA 3MGPA 4J8VD 1H3OA 5AY8A 4J8VB 1KX4C 1P3PD 1P3MB 3MNNA 4J8WB 1P3MC 3C1BD 2YFWA 4KUDD 1P3LD 4J8WC 4KUDB 1P3LB 5DNMA 4WNNA 3MGSB 3A6NA 1ZLAC 3MGSC 5BS7A 1KX3A 5GSUB 3X1TA 1M18D 3B6GA 5GSUC 1HTAA 5B2IA 5CPJB 3REJC 1HQ3A 5CP6A 3AZGD 5CPJC 3WKJA 1BH8A 1P3OA 4H9NB 2BYKB 1M18B 5AV8C 3LZ0B 1M19D 2CWEA 3LZ0C 5B2JA 3W96D 1M19B 5B0YB 4XZQC 5B0YC 3TU4D 3VH5W 5JRGB 4J8VA 3W98B 3W96B 3W98C 3KWQD 3TU4B 3AZIC 4DRAA 5E5AD 3KWQB 1P3PA 1P3FB 1TAFB 4KUDA 1P3FC 3C1BA 3MVDD 1P3LA 4ZBJB 1F66D 2F8NG 3MVDB 3UT9D 3REKD 5B0ZD 1BFMA 3C1CC 4X23D 1TZYC 5F99D 1M18A 2BYKA 4H9QA 1P3ID 3V9RB 3B0BA 2HIOC 5B32G 5B31G 5B1LD 3AZGA 1P3BB 1M19A 3LJAC 3AYWC 1P3BC 4UUZB 3W96A 5AVBD 5AV5B 1P3AD 5AV5C 3WTPC 1B67A 3AZJD 1P3AB 2RVQD 4XUJC 3KWQA 5AVCD 5FUGA 1ID3D 4NE3A 5E5AA 5CPIB 4NE5A 5BNVA 5CPIC 5GT3B 5CPKC 1M1AC 5GT3C 4H9OA 4QLCD 5B1MC 3MVDA 1F66A 5CHLB 4YM6B 5GXQB 4QLCB 3REID 4YM6C 1Q9CA 5GXQC 3UT9A 3REKA 5B0ZA 1KX5D 3REIB 3NQJB 3AZED 5BNXB 5B33C 4X23A 5F99A 3AZHD 1S32B 3AZEB 1P3IA 1S32C 1U35D 3WTPE 3AZFD 4KGCD 1WWIA 5B1LA 4J8UD 3WAAD 4WU9D 3AZHB 4Z2MH 4J8XB 3WAAB 4J8UB 5AVBA 4J8XC 3KSYA 2NZDD 2PYOC 3AZJA 4CSRA 2IO5C 2NZDB 5C3IC 5AVCA 4H9PB 1ID3A 5DNND 3X1UD 4YS3D 1EQZD 3O62B 3O62C 4QLCA 4NFTA 1P3GD 3B6FC 3REIA 1P3KC 4HGAC 1P3GB 1KX5A 3MGRC 4WV4B 1N1JB 3AZEA 3UTBC 2LY8A 5AV9C 3RELB 1U35A 2CV5B 3AZFA 4KGCA 3RELC 4J8UA 3WAAA 4WU9A 2CV5C 1KX4D 2NZDA 1KX4B 3NQUB 2FJ7B 1P3MD 4LD9C 4J8WD 2FJ7C 3WA9C 3AZNB 3AZNC 2NQBC 5DNNA 3X1UA 4YS3A 1EQZA 3KUYB 3AV2B 1ZLAD 1BH9B 3MGSD 3KUYC 3AV2C 3B6GC 5B2IC 5CP6C 5GSUD 3AFAB 1ZLAB 3AFAC 3REJD 5CPJD 5AV8D 4EO5B 3W97C 3REJB 3LZ0D 3AN2B 4EO5C 3AZMC 5B24A 3AN2C 5AV8B 2L5AA 4JJNC 5B0YD 4XZQD 5JRGD 3W98D 4XZQB 3KXBC 1KX4A 3LELB 4H9SC 3LELC 3LZ1C 3MGQC 1P3FD 1P34C 1P3MA 4J8WA 3AV1C 3B0CW 1ZLAA 3MGSA 3C1CD 1TZYD 5KDMB 5GSUA 3REJA 2HIOD 3C1CB 5CPJA 1TZYB 5AV8A 4H9NA 3LJAD 3AYWD 2HIOB 3LZ0A 1P3BD 5AV5D 3AZKC 3WTPD 3LJAB 3AYWB 4XZQA 5B0YA 2YFVB 1R4VA 1AOIC 5JRGA 3W99B 3W98A 3VH5A 4XUJD 3WTPB 3W99C 3TU4A 4XUJB 5CPID 4KHAB 2HUEB 3X1VB 5CPKD 5GT3D 2HUEC 3X1VC 5B1MD 4CAYB 1P3FA 1TAFA 5CPKB 1M1AB 3AZLB 2BYMB 3UT9C 5B1MB 3AZLC 4Z5TC 4YM6D 5GXQD 5KDMA 5F99C 1KU5A 3C1CA 5B33D 1TZYA 5BT1C 4R8PB 4R8PC 1S32D 2HIOA 3V9RA 5B33B 2AROB 2AROC 3LJAA 3AYWA 1P3BA 4J8XD 2YFVA
chains in the Genus database with same CATH superfamily
4UUZA 2UWXA 5AV5A 2PYOD 4WU8C 2F8NK 4AWLB 1P3AA 5AVCC 4AWLC 4XUJA 2PYOB 5BO0B 1ID3C 4NE6A 5JA4B 4KHAA 2IO5B 5GT0C 5C3IB 4ZUXB 5CPIA 4CAYA 4ZUXC 5CPKA 5B32B 5B31B 4Z66C 5GT3A 3O62D 5B32C 5B31C 3REHC 5B1MA 4H9RB 5B40C 3B6FD 1Z2CB 1P3KD 2G5IC 4YM6A 5GXQA 3UTAC 3B6FB 5AV6B 2Y2KA 1P3KB 4E45A 5AV6C 3NQJA 3X1SC 4HGAB 3UTBD 5B33A 3MGRB 5BNXA 3AZFC 5AV9D 1S32A 2BG1A 3UTBB 1H3OB 3MGPC 3RELD 2CV5D 5AV9B 3AZHA 3VH6A 5AY8C 4J8XA 3VH5T 5G49B 2PYOA 5BO0A 3H0LC 4LD9D 2FJ7D 3MNNB 3WA9D 3MNNC 1JFIB 3AZND 4WJ3C 4LD9B 4YS3C 1EQZC 2NQBD 4H9PA 3WA9B 5DNMB 4H9RA 5DNMC 2NQBB 3KUYD 3O62A 3AV2D 3H0MC 3A6NC 1KX3B 5BS7C 3B6FA 3AFAD 1KX3C 3B6GB 5B2IB 3X1TC 1HQ3B 5CP6B 3WKJB 5B24C 1P3OB 1HQ3C 3W97D 4WZSB 1P3OC 3AZMD 3WKJC 3AN2D 1P3GA 5B2JB 4JJND 3W97B 1N1JA 5B2JC 3UTBA 4E44A 3IP4C 3AZMB 5AV9A 4JJNB 3RELA 4J8VC 2CV5A 5G49A 3KXBD 2JE5A 3KFUG 3LELD 3KXBB 2RIQA 3LZ1D 1P3PB 3MGQD 1JFIA 1P3PC 4LD9A 1P34D 3NQUA 2FJ7A 3WA9A 3LZ1B 3C1BB 3MGQB 1WWSA 4KUDC 3AZNA 3C1BC 3AV1D 1P34B 1P3LC 2NQBA 2F8NH 3AV1B 3KUYA 3AV2A 1BH9A 4H9QB 3AFAA 1M18C 3AZGB 3W97A 3AZGC 3AZMA 3AN2A 1M19C 4JJNA 3AZKD 3W96C 5JRGC 3VH6T 1AOID 3AZKB 3W99D 3TU4C 3KXBA 1AOIB 3B0DB 5FUGB 3KWQC 4H9SA 3B0DC 3EPLA 3LELA 4DQYB 5E5AB 3R45B 5E5AC 3F6TA 5BNVB 3X1VD 3LZ1A 3MGQA 4H9OB 1P34A 4ZBJC 1M1AD 3AZLD 1F66B 4Z5TD 3MVDC 3AV1A 1F66C 2DQNC 3UT9B 3REKB 5B0ZB 4Z5TB 3REKC 5B0ZC 5BT1D 4R8PD 4X23B 5F99B 4X23C 1P3IB 1P3IC 4G92B 5B1LB 2AROD 1F1EA 4G92C 5B1LC 3AZID 5AVBB 3AZKA 4WU8D 5AVBC 1P3AC 2F8ND 3AZIB 3AZJB 1AOIA 3W99A 3AZJC 4WU8B 4CSRB 2F8NB 3WTPA 5AVCB 2RVQC 3R45A 5GT0D 1ID3B 4G91B 4ZUXD 4G91C 4Z66D 5GT0B 3X1VA 5B32D 5B31D 3REHD 5B40D 4Z66B 4DRBA 4QLCC 3REHB 1M1AA 3AZLA 2BYMA 4M6BA 4Z5TA 5B40B 3UTAD 1ULYA 3REIC 1T3UA 1KX5B 5AV6D 3X1SD 3UTAB 1KX5C 3AZEC 3MGRD 4R8PA 3X1SB 3VH6W 3MGPD 3AZHC 1U35B 3AZFB 4KGCB 2AROA 1U35C 1B6WA 2JSSA 4WU9B 3WAAC 4J8UC 5AY8D 4KGCC 3MGPB 1A7WA 3AZIA 4WU9C 4Z2MG 4WU8A 5AY8B 2F8NA 3EPJA 2NZDC 3MNND 5JA4A 5GT0A 5DNNB 4ZUXA 2YFWB 3X1UB 4YS3B 5DNMD 4Z66A 5DNNC 1EQZB 3X1UC 5B32A 5B31A 3REHA 3A6ND 5B40A 4WNNB 1KX3D 3X1TD 3B6GD 3A6NB 5B2ID 3B0CT 5B24D 1P3GC 1HQ3D 5CP6D 3UTAA 2VQRA 1P3OD 3WKJD 3X1TB 5AV6A 1P3KA 5B24B 3X1SA 5B2JD 1BH8B 3MGRA 3MGPA 4J8VD 1H3OA 5AY8A 4J8VB 1KX4C 2FFFB 1P3PD 1P3MB 3MNNA 4J8WB 1P3MC 3C1BD 2YFWA 4KUDD 1P3LD 4J8WC 4KUDB 1P3LB 5DNMA 3A1IA 4WNNA 3A1KA 3MGSB 3A6NA 1ZLAC 3MGSC 2ZY2A 5BS7A 1KX3A 5GSUB 3X1TA 1M18D 3B6GA 5GSUC 1HTAA 5B2IA 5CPJB 3REJC 1HQ3A 5CP6A 3AZGD 5CPJC 3WKJA 1BH8A 1P3OA 4H9NB 2BYKB 1M18B 5AV8C 3LZ0B 1M19D 2CWEA 3LZ0C 5B2JA 3W96D 1M19B 5B0YB 4XZQC 5B0YC 3TU4D 3VH5W 5JRGB 4J8VA 3W98B 3W96B 3W98C 1PZRA 3KWQD 2Y2LA 3TU4B 3AZIC 4DRAA 5E5AD 3KWQB 1P3PA 1P3FB 1TAFB 4KUDA 1P3FC 2Y2IA 3MVDD 3C1BA 1P3LA 4ZBJB 1F66D 2F8NG 3MVDB 3UT9D 3REKD 5B0ZD 2ZY4A 1BFMA 3C1CC 4X23D 1TZYC 5F99D 1M18A 2BYKA 4H9QA 2ZY5A 1P3ID 3V9RB 3B0BA 2G5HC 2HIOC 5B32G 5B31G 5B1LD 3AZGA 1P3BB 1M19A 3LJAC 3AYWC 1P3BC 4UUZB 3W96A 5AVBD 5AV5B 1P3AD 5AV5C 3WTPC 1B67A 3AZJD 1P3AB 2ZM5A 2RVQD 4XUJC 3KWQA 3EPKA 5AVCD 5FUGA 1ID3D 4NE3A 5E5AA 5CPIB 4NE5A 5BNVA 5CPIC 5GT3B 5CPKC 1M1AC 5GT3C 4H9OA 4QLCD 5B1MC 3MVDA 1F66A 5CHLB 4YM6B 5GXQB 4QLCB 3REID 2F2AC 4YM6C 1Q9CA 5GXQC 2JCHA 3UT9A 3REKA 5B0ZA 2W8SA 1KX5D 3REIB 3NQJB 3AZED 2Y2PA 5BNXB 5B33C 4X23A 5F99A 3AZHD 1S32B 3AZEB 1P3IA 2Y2NA 3EG5B 1S32C 1U35D 3WTPE 3AZFD 4KGCD 1WWIA 5B1LA 4J8UD 3WAAD 4WU9D 3AZHB 4Z2MH 4J8XB 3WAAB 4J8UB 5AVBA 4J8XC 3KSYA 2NZDD 2Y2MA 2PYOC 3AZJA 4CSRA 2IO5C 2ZY3A 2NZDB 5C3IC 5AVCA 4H9PB 1ID3A 5DNND 3X1UD 4YS3D 1EQZD 3O62B 3H0RC 3O62C 4QLCA 4NFTA 1P3GD 3B6FC 3REIA 1P3KC 2Y2OA 4HGAC 1P3GB 1KX5A 3MGRC 3FDDA 4WV4B 1N1JB 3AZEA 3UTBC 2LY8A 5AV9C 3RELB 1U35A 2CV5B 3AZFA 4KGCA 3RELC 4J8UA 3WAAA 4WU9A 2CV5C 1KX4D 2NZDA 1KX4B 3NQUB 2FJ7B 1P3MD 4LD9C 4J8WD 2FJ7C 3WA9C 3AZNB 3AZNC 2NQBC 5DNNA 3X1UA 4YS3A 1EQZA 3KUYB 3AV2B 1ZLAD 1BH9B 3MGSD 3KUYC 3AV2C 3B6GC 5B2IC 5CP6C 5GSUD 3AFAB 1ZLAB 3AFAC 3REJD 5CPJD 5AV8D 2XD5A 4EO5B 3W97C 3REJB 3LZ0D 3AN2B 4EO5C 3AZMC 1W2EA 5B24A 3AN2C 5AV8B 2L5AA 4JJNC 5B0YD 2Y2HA 4XZQD 5JRGD 3W98D 4XZQB 3KXBC 1KX4A 2J8PA 3LELB 4H9SC 3LELC 3LZ1C 3MGQC 1P3FD 2XD1A 1P34C 1P3MA 4J8WA 3P5JB 3AV1C 3AL0C 3B0CW 1ZLAA 3MGSA 3C1CD 1TZYD 2Y2JA 5KDMB 5GSUA 3EPHA 3REJA 2HIOD 3C1CB 5CPJA 1TZYB 5AV8A 4H9NA 3LJAD 3AYWD 2HIOB 3LZ0A 1P3BD 5AV5D 3AZKC 3WTPD 3LJAB 3AYWB 4XZQA 5B0YA 2YFVB 1R4VA 1AOIC 5JRGA 3W99B 3W98A 3VH5A 4XUJD 3WTPB 3W99C 4UPKA 3TU4A 2Y2GA 4XUJB 5CPID 4KHAB 2HUEB 3X1VB 5CPKD 5GT3D 2HUEC 3X1VC 5B1MD 4CAYB 1P3FA 1TAFA 5CPKB 1M1AB 3AZLB 2BYMB 3UT9C 5B1MB 3AZLC 4Z5TC 4YM6D 5GXQD 5KDMA 2DF4C 5F99C 1KU5A 3C1CA 5B33D 1TZYA 5BT1C 4R8PB 4R8PC 1S32D 2HIOA 3V9RA 5B33B 2AROB 2AROC 2Y2QA 3LJAA 3AYWA 1P3BA 4J8XD 2YFVA
chains in the Genus database with same CATH topology
4UUZA 2UWXA 5AV5A 2PYOD 4WU8C 2F8NK 4AWLB 1P3AA 5AVCC 4AWLC 4XUJA 2PYOB 5BO0B 1ID3C 4NE6A 5JA4B 4KHAA 2IO5B 5GT0C 5C3IB 4ZUXB 5CPIA 4CAYA 4ZUXC 5CPKA 5B32B 5B31B 4Z66C 5GT3A 3O62D 5B32C 5B31C 3REHC 5B1MA 4H9RB 5B40C 3B6FD 1Z2CB 1P3KD 2G5IC 4YM6A 5GXQA 3UTAC 3B6FB 5AV6B 2Y2KA 1P3KB 4E45A 5AV6C 3NQJA 3X1SC 4HGAB 3UTBD 5B33A 3MGRB 5BNXA 3AZFC 5AV9D 1S32A 2BG1A 3UTBB 1H3OB 3MGPC 3RELD 2CV5D 5AV9B 3AZHA 3VH6A 5AY8C 4J8XA 3VH5T 5G49B 2PYOA 5BO0A 3H0LC 4LD9D 2FJ7D 3MNNB 3WA9D 3MNNC 1JFIB 3AZND 4WJ3C 4LD9B 4YS3C 1EQZC 2NQBD 4H9PA 3WA9B 5DNMB 4H9RA 5DNMC 2NQBB 3KUYD 3O62A 3AV2D 3H0MC 3A6NC 1KX3B 5BS7C 3B6FA 3AFAD 1KX3C 3B6GB 5B2IB 3X1TC 1HQ3B 5CP6B 3WKJB 5B24C 1P3OB 1HQ3C 3W97D 4WZSB 1P3OC 3AZMD 3WKJC 3AN2D 1P3GA 5B2JB 4JJND 3W97B 1N1JA 5B2JC 3UTBA 4E44A 3IP4C 3AZMB 5AV9A 4JJNB 3RELA 4J8VC 2CV5A 5G49A 3KXBD 2JE5A 3KFUG 3LELD 3KXBB 2RIQA 3LZ1D 1P3PB 3MGQD 1JFIA 1P3PC 4LD9A 1P34D 3NQUA 2FJ7A 3WA9A 3LZ1B 3C1BB 3MGQB 1WWSA 4KUDC 3AZNA 3C1BC 3AV1D 1P34B 1P3LC 2NQBA 2F8NH 3AV1B 3KUYA 3AV2A 1BH9A 4H9QB 3AFAA 1M18C 3AZGB 3W97A 3AZGC 3AZMA 3AN2A 1M19C 4JJNA 3AZKD 3W96C 5JRGC 3VH6T 1AOID 3AZKB 3W99D 3TU4C 3KXBA 1AOIB 3B0DB 5FUGB 3KWQC 4H9SA 3B0DC 3EPLA 3LELA 4DQYB 5E5AB 3R45B 5E5AC 3F6TA 5BNVB 3X1VD 3LZ1A 3MGQA 4H9OB 1P34A 4ZBJC 1M1AD 3AZLD 1F66B 4Z5TD 3MVDC 3AV1A 1F66C 2DQNC 3UT9B 3REKB 5B0ZB 4Z5TB 3REKC 5B0ZC 5BT1D 4R8PD 4X23B 5F99B 4X23C 1P3IB 1P3IC 4G92B 5B1LB 2AROD 1F1EA 4G92C 5B1LC 3AZID 5AVBB 3AZKA 4WU8D 5AVBC 1P3AC 2F8ND 3AZIB 3AZJB 1AOIA 3W99A 3AZJC 4WU8B 4CSRB 2F8NB 3WTPA 5AVCB 2RVQC 3R45A 5GT0D 1ID3B 4G91B 4ZUXD 4G91C 4Z66D 5GT0B 3X1VA 5B32D 5B31D 3REHD 5B40D 4Z66B 4DRBA 4QLCC 3REHB 1M1AA 3AZLA 2BYMA 4M6BA 4Z5TA 5B40B 3UTAD 1ULYA 3REIC 1T3UA 1KX5B 5AV6D 3X1SD 3UTAB 1KX5C 3AZEC 3MGRD 4R8PA 3X1SB 3VH6W 3MGPD 3AZHC 1U35B 3AZFB 4KGCB 2AROA 1U35C 1B6WA 2JSSA 4WU9B 3WAAC 4J8UC 5AY8D 4KGCC 3MGPB 1A7WA 3AZIA 4WU9C 4Z2MG 4WU8A 5AY8B 2F8NA 3EPJA 2NZDC 3MNND 5JA4A 5GT0A 5DNNB 4ZUXA 2YFWB 3X1UB 4YS3B 5DNMD 4Z66A 5DNNC 1EQZB 3X1UC 5B32A 5B31A 3REHA 3A6ND 5B40A 4WNNB 1KX3D 3X1TD 3B6GD 3A6NB 5B2ID 3B0CT 5B24D 1P3GC 1HQ3D 5CP6D 3UTAA 2VQRA 1P3OD 3WKJD 3X1TB 5AV6A 1P3KA 5B24B 3X1SA 5B2JD 1BH8B 3MGRA 3MGPA 4J8VD 1H3OA 5AY8A 4J8VB 1KX4C 2FFFB 1P3PD 1P3MB 3MNNA 4J8WB 1P3MC 3C1BD 2YFWA 4KUDD 1P3LD 4J8WC 4KUDB 1P3LB 5DNMA 3A1IA 4WNNA 3A1KA 3MGSB 3A6NA 1ZLAC 3MGSC 2ZY2A 5BS7A 1KX3A 5GSUB 3X1TA 1M18D 3B6GA 5GSUC 1HTAA 5B2IA 5CPJB 3REJC 1HQ3A 5CP6A 3AZGD 5CPJC 3WKJA 1BH8A 1P3OA 4H9NB 2BYKB 1M18B 5AV8C 3LZ0B 1M19D 2CWEA 3LZ0C 5B2JA 3W96D 1M19B 5B0YB 4XZQC 5B0YC 3TU4D 3VH5W 5JRGB 4J8VA 3W98B 3W96B 3W98C 1PZRA 3KWQD 2Y2LA 3TU4B 3AZIC 4DRAA 5E5AD 3KWQB 1P3PA 1P3FB 1TAFB 4KUDA 1P3FC 2Y2IA 3MVDD 3C1BA 1P3LA 4ZBJB 1F66D 2F8NG 3MVDB 3UT9D 3REKD 5B0ZD 2ZY4A 1BFMA 3C1CC 4X23D 1TZYC 5F99D 1M18A 2BYKA 4H9QA 2ZY5A 1P3ID 3V9RB 3B0BA 2G5HC 2HIOC 5B32G 5B31G 5B1LD 3AZGA 1P3BB 1M19A 3LJAC 3AYWC 1P3BC 4UUZB 3W96A 5AVBD 5AV5B 1P3AD 5AV5C 3WTPC 1B67A 3AZJD 1P3AB 2ZM5A 2RVQD 4XUJC 3KWQA 3EPKA 5AVCD 5FUGA 1ID3D 4NE3A 5E5AA 5CPIB 4NE5A 5BNVA 5CPIC 5GT3B 5CPKC 1M1AC 5GT3C 4H9OA 4QLCD 5B1MC 3MVDA 1F66A 5CHLB 4YM6B 5GXQB 4QLCB 3REID 2F2AC 4YM6C 1Q9CA 5GXQC 2JCHA 3UT9A 3REKA 5B0ZA 2W8SA 1KX5D 3REIB 3NQJB 3AZED 2Y2PA 5BNXB 5B33C 4X23A 5F99A 3AZHD 1S32B 3AZEB 1P3IA 2Y2NA 3EG5B 1S32C 1U35D 3WTPE 3AZFD 4KGCD 1WWIA 5B1LA 4J8UD 3WAAD 4WU9D 3AZHB 4Z2MH 4J8XB 3WAAB 4J8UB 5AVBA 4J8XC 3KSYA 2NZDD 2Y2MA 2PYOC 3AZJA 4CSRA 2IO5C 2ZY3A 2NZDB 5C3IC 5AVCA 4H9PB 1ID3A 5DNND 3X1UD 4YS3D 1EQZD 3O62B 3H0RC 3O62C 4QLCA 4NFTA 1P3GD 3B6FC 3REIA 1P3KC 2Y2OA 4HGAC 1P3GB 1KX5A 3MGRC 3FDDA 4WV4B 1N1JB 3AZEA 3UTBC 2LY8A 5AV9C 3RELB 1U35A 2CV5B 3AZFA 4KGCA 3RELC 4J8UA 3WAAA 4WU9A 2CV5C 1KX4D 2NZDA 1KX4B 3NQUB 2FJ7B 1P3MD 4LD9C 4J8WD 2FJ7C 3WA9C 3AZNB 3AZNC 2NQBC 5DNNA 3X1UA 4YS3A 1EQZA 3KUYB 3AV2B 1ZLAD 1BH9B 3MGSD 3KUYC 3AV2C 3B6GC 5B2IC 5CP6C 5GSUD 3AFAB 1ZLAB 3AFAC 3REJD 5CPJD 5AV8D 2XD5A 4EO5B 3W97C 3REJB 3LZ0D 3AN2B 4EO5C 3AZMC 1W2EA 5B24A 3AN2C 5AV8B 2L5AA 4JJNC 5B0YD 2Y2HA 4XZQD 5JRGD 3W98D 4XZQB 3KXBC 1KX4A 2J8PA 3LELB 4H9SC 3LELC 3LZ1C 3MGQC 1P3FD 2XD1A 1P34C 1P3MA 4J8WA 3P5JB 3AV1C 3AL0C 3B0CW 1ZLAA 3MGSA 3C1CD 1TZYD 2Y2JA 5KDMB 5GSUA 3EPHA 3REJA 2HIOD 3C1CB 5CPJA 1TZYB 5AV8A 4H9NA 3LJAD 3AYWD 2HIOB 3LZ0A 1P3BD 5AV5D 3AZKC 3WTPD 3LJAB 3AYWB 4XZQA 5B0YA 2YFVB 1R4VA 1AOIC 5JRGA 3W99B 3W98A 3VH5A 4XUJD 3WTPB 3W99C 4UPKA 3TU4A 2Y2GA 4XUJB 5CPID 4KHAB 2HUEB 3X1VB 5CPKD 5GT3D 2HUEC 3X1VC 5B1MD 4CAYB 1P3FA 1TAFA 5CPKB 1M1AB 3AZLB 2BYMB 3UT9C 5B1MB 3AZLC 4Z5TC 4YM6D 5GXQD 5KDMA 2DF4C 5F99C 1KU5A 3C1CA 5B33D 1TZYA 5BT1C 4R8PB 4R8PC 1S32D 2HIOA 3V9RA 5B33B 2AROB 2AROC 2Y2QA 3LJAA 3AYWA 1P3BA 4J8XD 2YFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUZ A;  5AV5 A;  2PYO D;  4WU8 C;  2F8N K;  4AWL B;  1P3A A;  5AVC C;  4AWL C;  4XUJ A;  2PYO B;  5BO0 B;  1ID3 C;  4NE6 A;  5JA4 B;  4KHA A;  2IO5 B;  5GT0 C;  5C3I B;  4ZUX B;  5CPI A;  4CAY A;  4ZUX C;  5CPK A;  5B32 B;  5B31 B;  4Z66 C;  5GT3 A;  3O62 D;  5B32 C;  5B31 C;  3REH C;  5B1M A;  4H9R B;  5B40 C;  3B6F D;  1P3K D;  4YM6 A;  5GXQ A;  3UTA C;  3B6F B;  5AV6 B;  1P3K B;  4E45 A;  5AV6 C;  3NQJ A;  3X1S C;  4HGA B;  3UTB D;  5B33 A;  3MGR B;  5BNX A;  3AZF C;  5AV9 D;  1S32 A;  3UTB B;  1H3O B;  3MGP C;  3REL D;  2CV5 D;  5AV9 B;  3AZH A;  3VH6 A;  5AY8 C;  4J8X A;  3VH5 T;  5G49 B;  2PYO A;  5BO0 A;  4LD9 D;  2FJ7 D;  3MNN B;  3WA9 D;  3MNN C;  1JFI B;  3AZN D;  4LD9 B;  4YS3 C;  1EQZ C;  2NQB D;  4H9P A;  3WA9 B;  5DNM B;  4H9R A;  5DNM C;  2NQB B;  3KUY D;  3O62 A;  3AV2 D;  3A6N C;  1KX3 B;  5BS7 C;  3B6F A;  3AFA D;  1KX3 C;  3B6G B;  5B2I B;  3X1T C;  1HQ3 B;  5CP6 B;  3WKJ B;  5B24 C;  1P3O B;  1HQ3 C;  3W97 D;  4WZS B;  1P3O C;  3AZM D;  3WKJ C;  3AN2 D;  1P3G A;  5B2J B;  4JJN D;  3W97 B;  1N1J A;  5B2J C;  3UTB A;  4E44 A;  3AZM B;  5AV9 A;  4JJN B;  3REL A;  4J8V C;  2CV5 A;  5G49 A;  3KXB D;  3LEL D;  3KXB B;  3LZ1 D;  1P3P B;  3MGQ D;  1JFI A;  1P3P C;  4LD9 A;  1P34 D;  3NQU A;  2FJ7 A;  3WA9 A;  3LZ1 B;  3C1B B;  3MGQ B;  1WWS A;  4KUD C;  3AZN A;  3C1B C;  3AV1 D;  1P34 B;  1P3L C;  2NQB A;  2F8N H;  3AV1 B;  3KUY A;  3AV2 A;  1BH9 A;  4H9Q B;  3AFA A;  1M18 C;  3AZG B;  3W97 A;  3AZG C;  3AZM A;  3AN2 A;  1M19 C;  4JJN A;  3AZK D;  3W96 C;  5JRG C;  3VH6 T;  1AOI D;  3AZK B;  3W99 D;  3TU4 C;  3KXB A;  1AOI B;  3B0D B;  5FUG B;  3KWQ C;  4H9S A;  3B0D C;  3LEL A;  5E5A B;  3R45 B;  5E5A C;  5BNV B;  3X1V D;  3LZ1 A;  3MGQ A;  4H9O B;  1P34 A;  4ZBJ C;  1M1A D;  3AZL D;  1F66 B;  4Z5T D;  3MVD C;  3AV1 A;  1F66 C;  3UT9 B;  3REK B;  5B0Z B;  4Z5T B;  3REK C;  5B0Z C;  5BT1 D;  4R8P D;  4X23 B;  5F99 B;  4X23 C;  1P3I B;  1P3I C;  4G92 B;  5B1L B;  2ARO D;  1F1E A;  4G92 C;  5B1L C;  3AZI D;  5AVB B;  3AZK A;  4WU8 D;  5AVB C;  1P3A C;  2F8N D;  3AZI B;  3AZJ B;  1AOI A;  3W99 A;  3AZJ C;  4WU8 B;  4CSR B;  2F8N B;  3WTP A;  5AVC B;  2RVQ C;  3R45 A;  5GT0 D;  1ID3 B;  4G91 B;  4ZUX D;  4G91 C;  4Z66 D;  5GT0 B;  3X1V A;  5B32 D;  5B31 D;  3REH D;  5B40 D;  4Z66 B;  4DRB A;  4QLC C;  3REH B;  1M1A A;  3AZL A;  2BYM A;  4M6B A;  4Z5T A;  5B40 B;  3UTA D;  1ULY A;  3REI C;  1KX5 B;  5AV6 D;  3X1S D;  3UTA B;  1KX5 C;  3AZE C;  3MGR D;  4R8P A;  3X1S B;  3VH6 W;  3MGP D;  3AZH C;  1U35 B;  3AZF B;  4KGC B;  2ARO A;  1U35 C;  1B6W A;  2JSS A;  4WU9 B;  3WAA C;  4J8U C;  5AY8 D;  4KGC C;  3MGP B;  1A7W A;  3AZI A;  4WU9 C;  4Z2M G;  4WU8 A;  5AY8 B;  2F8N A;  2NZD C;  3MNN D;  5JA4 A;  5GT0 A;  5DNN B;  4ZUX A;  2YFW B;  3X1U B;  4YS3 B;  5DNM D;  4Z66 A;  5DNN C;  1EQZ B;  3X1U C;  5B32 A;  5B31 A;  3REH A;  3A6N D;  5B40 A;  4WNN B;  1KX3 D;  3X1T D;  3B6G D;  3A6N B;  5B2I D;  3B0C T;  5B24 D;  1P3G C;  1HQ3 D;  5CP6 D;  3UTA A;  3WKJ D;  1P3O D;  3X1T B;  5AV6 A;  1P3K A;  5B24 B;  3X1S A;  5B2J D;  1BH8 B;  3MGR A;  3MGP A;  4J8V D;  1H3O A;  5AY8 A;  4J8V B;  1KX4 C;  1P3P D;  1P3M B;  3MNN A;  4J8W B;  1P3M C;  3C1B D;  2YFW A;  4KUD D;  1P3L D;  4J8W C;  4KUD B;  1P3L B;  5DNM A;  4WNN A;  3MGS B;  3A6N A;  1ZLA C;  3MGS C;  5BS7 A;  1KX3 A;  5GSU B;  3X1T A;  1M18 D;  3B6G A;  5GSU C;  1HTA A;  5B2I A;  5CPJ B;  3REJ C;  1HQ3 A;  5CP6 A;  3AZG D;  5CPJ C;  3WKJ A;  1BH8 A;  1P3O A;  4H9N B;  2BYK B;  1M18 B;  5AV8 C;  3LZ0 B;  1M19 D;  2CWE A;  3LZ0 C;  5B2J A;  3W96 D;  1M19 B;  5B0Y B;  4XZQ C;  5B0Y C;  3TU4 D;  3VH5 W;  5JRG B;  4J8V A;  3W98 B;  3W96 B;  3W98 C;  3KWQ D;  3TU4 B;  3AZI C;  4DRA A;  5E5A D;  3KWQ B;  1P3P A;  1P3F B;  1TAF B;  4KUD A;  1P3F C;  3C1B A;  3MVD D;  1P3L A;  4ZBJ B;  1F66 D;  2F8N G;  3MVD B;  3UT9 D;  3REK D;  5B0Z D;  1BFM A;  3C1C C;  4X23 D;  1TZY C;  5F99 D;  1M18 A;  2BYK A;  4H9Q A;  1P3I D;  3V9R B;  3B0B A;  2HIO C;  5B32 G;  5B31 G;  5B1L D;  3AZG A;  1P3B B;  1M19 A;  3LJA C;  3AYW C;  1P3B C;  4UUZ B;  3W96 A;  5AVB D;  5AV5 B;  1P3A D;  5AV5 C;  3WTP C;  1B67 A;  3AZJ D;  1P3A B;  2RVQ D;  4XUJ C;  3KWQ A;  5AVC D;  5FUG A;  1ID3 D;  4NE3 A;  5E5A A;  5CPI B;  4NE5 A;  5BNV A;  5CPI C;  5GT3 B;  5CPK C;  1M1A C;  5GT3 C;  4H9O A;  4QLC D;  5B1M C;  3MVD A;  1F66 A;  5CHL B;  4YM6 B;  5GXQ B;  4QLC B;  3REI D;  4YM6 C;  1Q9C A;  5GXQ C;  3UT9 A;  3REK A;  5B0Z A;  1KX5 D;  3REI B;  3NQJ B;  3AZE D;  5BNX B;  5B33 C;  4X23 A;  5F99 A;  3AZH D;  1S32 B;  3AZE B;  1P3I A;  1S32 C;  1U35 D;  3WTP E;  3AZF D;  4KGC D;  1WWI A;  5B1L A;  4J8U D;  3WAA D;  4WU9 D;  3AZH B;  4Z2M H;  4J8X B;  3WAA B;  4J8U B;  5AVB A;  4J8X C;  3KSY A;  2NZD D;  2PYO C;  3AZJ A;  4CSR A;  2IO5 C;  2NZD B;  5C3I C;  5AVC A;  4H9P B;  1ID3 A;  5DNN D;  3X1U D;  4YS3 D;  1EQZ D;  3O62 B;  3O62 C;  4QLC A;  4NFT A;  1P3G D;  3B6F C;  3REI A;  1P3K C;  4HGA C;  1P3G B;  1KX5 A;  3MGR C;  4WV4 B;  1N1J B;  3AZE A;  3UTB C;  2LY8 A;  5AV9 C;  3REL B;  1U35 A;  2CV5 B;  3AZF A;  4KGC A;  3REL C;  4J8U A;  3WAA A;  4WU9 A;  2CV5 C;  1KX4 D;  2NZD A;  1KX4 B;  3NQU B;  2FJ7 B;  1P3M D;  4LD9 C;  4J8W D;  2FJ7 C;  3WA9 C;  3AZN B;  3AZN C;  2NQB C;  5DNN A;  3X1U A;  4YS3 A;  1EQZ A;  3KUY B;  3AV2 B;  1ZLA D;  1BH9 B;  3MGS D;  3KUY C;  3AV2 C;  3B6G C;  5B2I C;  5CP6 C;  5GSU D;  3AFA B;  1ZLA B;  3AFA C;  3REJ D;  5CPJ D;  5AV8 D;  4EO5 B;  3W97 C;  3REJ B;  3LZ0 D;  3AN2 B;  4EO5 C;  3AZM C;  5B24 A;  3AN2 C;  5AV8 B;  2L5A A;  4JJN C;  5B0Y D;  4XZQ D;  5JRG D;  3W98 D;  4XZQ B;  3KXB C;  1KX4 A;  3LEL B;  4H9S C;  3LEL C;  3LZ1 C;  3MGQ C;  1P3F D;  1P34 C;  1P3M A;  4J8W A;  3AV1 C;  3B0C W;  1ZLA A;  3MGS A;  3C1C D;  1TZY D;  5KDM B;  5GSU A;  3REJ A;  2HIO D;  3C1C B;  5CPJ A;  1TZY B;  5AV8 A;  4H9N A;  3LJA D;  3AYW D;  2HIO B;  3LZ0 A;  1P3B D;  5AV5 D;  3AZK C;  3WTP D;  3LJA B;  3AYW B;  4XZQ A;  5B0Y A;  2YFV B;  1R4V A;  1AOI C;  5JRG A;  3W99 B;  3W98 A;  3VH5 A;  4XUJ D;  3WTP B;  3W99 C;  3TU4 A;  4XUJ B;  5CPI D;  4KHA B;  2HUE B;  3X1V B;  5CPK D;  5GT3 D;  2HUE C;  3X1V C;  5B1M D;  4CAY B;  1P3F A;  1TAF A;  5CPK B;  1M1A B;  3AZL B;  2BYM B;  3UT9 C;  5B1M B;  3AZL C;  4Z5T C;  4YM6 D;  5GXQ D;  5KDM A;  5F99 C;  1KU5 A;  3C1C A;  5B33 D;  1TZY A;  5BT1 C;  4R8P B;  4R8P C;  1S32 D;  2HIO A;  3V9R A;  5B33 B;  2ARO B;  2ARO C;  3LJA A;  3AYW A;  1P3B A;  4J8X D;  2YFV A; 
#chains in the Genus database with same CATH topology
 4UUZ A;  2UWX A;  5AV5 A;  2PYO D;  4WU8 C;  2F8N K;  4AWL B;  1P3A A;  5AVC C;  4AWL C;  4XUJ A;  2PYO B;  5BO0 B;  1ID3 C;  4NE6 A;  5JA4 B;  4KHA A;  2IO5 B;  5GT0 C;  5C3I B;  4ZUX B;  5CPI A;  4CAY A;  4ZUX C;  5CPK A;  5B32 B;  5B31 B;  4Z66 C;  5GT3 A;  3O62 D;  5B32 C;  5B31 C;  3REH C;  5B1M A;  4H9R B;  5B40 C;  3B6F D;  1Z2C B;  1P3K D;  2G5I C;  4YM6 A;  5GXQ A;  3UTA C;  3B6F B;  5AV6 B;  2Y2K A;  1P3K B;  4E45 A;  5AV6 C;  3NQJ A;  3X1S C;  4HGA B;  3UTB D;  5B33 A;  3MGR B;  5BNX A;  3AZF C;  5AV9 D;  1S32 A;  2BG1 A;  3UTB B;  1H3O B;  3MGP C;  3REL D;  2CV5 D;  5AV9 B;  3AZH A;  3VH6 A;  5AY8 C;  4J8X A;  3VH5 T;  5G49 B;  2PYO A;  5BO0 A;  3H0L C;  4LD9 D;  2FJ7 D;  3MNN B;  3WA9 D;  3MNN C;  1JFI B;  3AZN D;  4WJ3 C;  4LD9 B;  4YS3 C;  1EQZ C;  2NQB D;  4H9P A;  3WA9 B;  5DNM B;  4H9R A;  5DNM C;  2NQB B;  3KUY D;  3O62 A;  3AV2 D;  3H0M C;  3A6N C;  1KX3 B;  5BS7 C;  3B6F A;  3AFA D;  1KX3 C;  3B6G B;  5B2I B;  3X1T C;  1HQ3 B;  5CP6 B;  3WKJ B;  5B24 C;  1P3O B;  1HQ3 C;  3W97 D;  4WZS B;  1P3O C;  3AZM D;  3WKJ C;  3AN2 D;  1P3G A;  5B2J B;  4JJN D;  3W97 B;  1N1J A;  5B2J C;  3UTB A;  4E44 A;  3IP4 C;  3AZM B;  5AV9 A;  4JJN B;  3REL A;  4J8V C;  2CV5 A;  5G49 A;  3KXB D;  2JE5 A;  3KFU G;  3LEL D;  3KXB B;  2RIQ A;  3LZ1 D;  1P3P B;  3MGQ D;  1JFI A;  1P3P C;  4LD9 A;  1P34 D;  3NQU A;  2FJ7 A;  3WA9 A;  3LZ1 B;  3C1B B;  3MGQ B;  1WWS A;  4KUD C;  3AZN A;  3C1B C;  3AV1 D;  1P34 B;  1P3L C;  2NQB A;  2F8N H;  3AV1 B;  3KUY A;  3AV2 A;  1BH9 A;  4H9Q B;  3AFA A;  1M18 C;  3AZG B;  3W97 A;  3AZG C;  3AZM A;  3AN2 A;  1M19 C;  4JJN A;  3AZK D;  3W96 C;  5JRG C;  3VH6 T;  1AOI D;  3AZK B;  3W99 D;  3TU4 C;  3KXB A;  1AOI B;  3B0D B;  5FUG B;  3KWQ C;  4H9S A;  3B0D C;  3EPL A;  3LEL A;  4DQY B;  5E5A B;  3R45 B;  5E5A C;  3F6T A;  5BNV B;  3X1V D;  3LZ1 A;  3MGQ A;  4H9O B;  1P34 A;  4ZBJ C;  1M1A D;  3AZL D;  1F66 B;  4Z5T D;  3MVD C;  3AV1 A;  1F66 C;  2DQN C;  3UT9 B;  3REK B;  5B0Z B;  4Z5T B;  3REK C;  5B0Z C;  5BT1 D;  4R8P D;  4X23 B;  5F99 B;  4X23 C;  1P3I B;  1P3I C;  4G92 B;  5B1L B;  2ARO D;  1F1E A;  4G92 C;  5B1L C;  3AZI D;  5AVB B;  3AZK A;  4WU8 D;  5AVB C;  1P3A C;  2F8N D;  3AZI B;  3AZJ B;  1AOI A;  3W99 A;  3AZJ C;  4WU8 B;  4CSR B;  2F8N B;  3WTP A;  5AVC B;  2RVQ C;  3R45 A;  5GT0 D;  1ID3 B;  4G91 B;  4ZUX D;  4G91 C;  4Z66 D;  5GT0 B;  3X1V A;  5B32 D;  5B31 D;  3REH D;  5B40 D;  4Z66 B;  4DRB A;  4QLC C;  3REH B;  1M1A A;  3AZL A;  2BYM A;  4M6B A;  4Z5T A;  5B40 B;  3UTA D;  1ULY A;  3REI C;  1T3U A;  1KX5 B;  5AV6 D;  3X1S D;  3UTA B;  1KX5 C;  3AZE C;  3MGR D;  4R8P A;  3X1S B;  3VH6 W;  3MGP D;  3AZH C;  1U35 B;  3AZF B;  4KGC B;  2ARO A;  1U35 C;  1B6W A;  2JSS A;  4WU9 B;  3WAA C;  4J8U C;  5AY8 D;  4KGC C;  3MGP B;  1A7W A;  3AZI A;  4WU9 C;  4Z2M G;  4WU8 A;  5AY8 B;  2F8N A;  3EPJ A;  2NZD C;  3MNN D;  5JA4 A;  5GT0 A;  5DNN B;  4ZUX A;  2YFW B;  3X1U B;  4YS3 B;  5DNM D;  4Z66 A;  5DNN C;  1EQZ B;  3X1U C;  5B32 A;  5B31 A;  3REH A;  3A6N D;  5B40 A;  4WNN B;  1KX3 D;  3X1T D;  3B6G D;  3A6N B;  5B2I D;  3B0C T;  5B24 D;  1P3G C;  1HQ3 D;  5CP6 D;  3UTA A;  2VQR A;  1P3O D;  3WKJ D;  3X1T B;  5AV6 A;  1P3K A;  5B24 B;  3X1S A;  5B2J D;  1BH8 B;  3MGR A;  3MGP A;  4J8V D;  1H3O A;  5AY8 A;  4J8V B;  1KX4 C;  2FFF B;  1P3P D;  1P3M B;  3MNN A;  4J8W B;  1P3M C;  3C1B D;  2YFW A;  4KUD D;  1P3L D;  4J8W C;  4KUD B;  1P3L B;  5DNM A;  3A1I A;  4WNN A;  3A1K A;  3MGS B;  3A6N A;  1ZLA C;  3MGS C;  2ZY2 A;  5BS7 A;  1KX3 A;  5GSU B;  3X1T A;  1M18 D;  3B6G A;  5GSU C;  1HTA A;  5B2I A;  5CPJ B;  3REJ C;  1HQ3 A;  5CP6 A;  3AZG D;  5CPJ C;  3WKJ A;  1BH8 A;  1P3O A;  4H9N B;  2BYK B;  1M18 B;  5AV8 C;  3LZ0 B;  1M19 D;  2CWE A;  3LZ0 C;  5B2J A;  3W96 D;  1M19 B;  5B0Y B;  4XZQ C;  5B0Y C;  3TU4 D;  3VH5 W;  5JRG B;  4J8V A;  3W98 B;  3W96 B;  3W98 C;  1PZR A;  3KWQ D;  2Y2L A;  3TU4 B;  3AZI C;  4DRA A;  5E5A D;  3KWQ B;  1P3P A;  1P3F B;  1TAF B;  4KUD A;  1P3F C;  2Y2I A;  3MVD D;  3C1B A;  1P3L A;  4ZBJ B;  1F66 D;  2F8N G;  3MVD B;  3UT9 D;  3REK D;  5B0Z D;  2ZY4 A;  1BFM A;  3C1C C;  4X23 D;  1TZY C;  5F99 D;  1M18 A;  2BYK A;  4H9Q A;  2ZY5 A;  1P3I D;  3V9R B;  3B0B A;  2G5H C;  2HIO C;  5B32 G;  5B31 G;  5B1L D;  3AZG A;  1P3B B;  1M19 A;  3LJA C;  3AYW C;  1P3B C;  4UUZ B;  3W96 A;  5AVB D;  5AV5 B;  1P3A D;  5AV5 C;  3WTP C;  1B67 A;  3AZJ D;  1P3A B;  2ZM5 A;  2RVQ D;  4XUJ C;  3KWQ A;  3EPK A;  5AVC D;  5FUG A;  1ID3 D;  4NE3 A;  5E5A A;  5CPI B;  4NE5 A;  5BNV A;  5CPI C;  5GT3 B;  5CPK C;  1M1A C;  5GT3 C;  4H9O A;  4QLC D;  5B1M C;  3MVD A;  1F66 A;  5CHL B;  4YM6 B;  5GXQ B;  4QLC B;  3REI D;  2F2A C;  4YM6 C;  1Q9C A;  5GXQ C;  2JCH A;  3UT9 A;  3REK A;  5B0Z A;  2W8S A;  1KX5 D;  3REI B;  3NQJ B;  3AZE D;  2Y2P A;  5BNX B;  5B33 C;  4X23 A;  5F99 A;  3AZH D;  1S32 B;  3AZE B;  1P3I A;  2Y2N A;  3EG5 B;  1S32 C;  1U35 D;  3WTP E;  3AZF D;  4KGC D;  1WWI A;  5B1L A;  4J8U D;  3WAA D;  4WU9 D;  3AZH B;  4Z2M H;  4J8X B;  3WAA B;  4J8U B;  5AVB A;  4J8X C;  3KSY A;  2NZD D;  2Y2M A;  2PYO C;  3AZJ A;  4CSR A;  2IO5 C;  2ZY3 A;  2NZD B;  5C3I C;  5AVC A;  4H9P B;  1ID3 A;  5DNN D;  3X1U D;  4YS3 D;  1EQZ D;  3O62 B;  3H0R C;  3O62 C;  4QLC A;  4NFT A;  1P3G D;  3B6F C;  3REI A;  1P3K C;  2Y2O A;  4HGA C;  1P3G B;  1KX5 A;  3MGR C;  3FDD A;  4WV4 B;  1N1J B;  3AZE A;  3UTB C;  2LY8 A;  5AV9 C;  3REL B;  1U35 A;  2CV5 B;  3AZF A;  4KGC A;  3REL C;  4J8U A;  3WAA A;  4WU9 A;  2CV5 C;  1KX4 D;  2NZD A;  1KX4 B;  3NQU B;  2FJ7 B;  1P3M D;  4LD9 C;  4J8W D;  2FJ7 C;  3WA9 C;  3AZN B;  3AZN C;  2NQB C;  5DNN A;  3X1U A;  4YS3 A;  1EQZ A;  3KUY B;  3AV2 B;  1ZLA D;  1BH9 B;  3MGS D;  3KUY C;  3AV2 C;  3B6G C;  5B2I C;  5CP6 C;  5GSU D;  3AFA B;  1ZLA B;  3AFA C;  3REJ D;  5CPJ D;  5AV8 D;  2XD5 A;  4EO5 B;  3W97 C;  3REJ B;  3LZ0 D;  3AN2 B;  4EO5 C;  3AZM C;  1W2E A;  5B24 A;  3AN2 C;  5AV8 B;  2L5A A;  4JJN C;  5B0Y D;  2Y2H A;  4XZQ D;  5JRG D;  3W98 D;  4XZQ B;  3KXB C;  1KX4 A;  2J8P A;  3LEL B;  4H9S C;  3LEL C;  3LZ1 C;  3MGQ C;  1P3F D;  2XD1 A;  1P34 C;  1P3M A;  4J8W A;  3P5J B;  3AV1 C;  3AL0 C;  3B0C W;  1ZLA A;  3MGS A;  3C1C D;  1TZY D;  2Y2J A;  5KDM B;  5GSU A;  3EPH A;  3REJ A;  2HIO D;  3C1C B;  5CPJ A;  1TZY B;  5AV8 A;  4H9N A;  3LJA D;  3AYW D;  2HIO B;  3LZ0 A;  1P3B D;  5AV5 D;  3AZK C;  3WTP D;  3LJA B;  3AYW B;  4XZQ A;  5B0Y A;  2YFV B;  1R4V A;  1AOI C;  5JRG A;  3W99 B;  3W98 A;  3VH5 A;  4XUJ D;  3WTP B;  3W99 C;  4UPK A;  3TU4 A;  2Y2G A;  4XUJ B;  5CPI D;  4KHA B;  2HUE B;  3X1V B;  5CPK D;  5GT3 D;  2HUE C;  3X1V C;  5B1M D;  4CAY B;  1P3F A;  1TAF A;  5CPK B;  1M1A B;  3AZL B;  2BYM B;  3UT9 C;  5B1M B;  3AZL C;  4Z5T C;  4YM6 D;  5GXQ D;  5KDM A;  2DF4 C;  5F99 C;  1KU5 A;  3C1C A;  5B33 D;  1TZY A;  5BT1 C;  4R8P B;  4R8P C;  1S32 D;  2HIO A;  3V9R A;  5B33 B;  2ARO B;  2ARO C;  2Y2Q A;  3LJA A;  3AYW A;  1P3B A;  4J8X D;  2YFV A; 
#chains in the Genus database with same CATH homology
 4UUZ A;  2UWX A;  5AV5 A;  2PYO D;  4WU8 C;  2F8N K;  4AWL B;  1P3A A;  5AVC C;  4AWL C;  4XUJ A;  2PYO B;  5BO0 B;  1ID3 C;  4NE6 A;  5JA4 B;  4KHA A;  2IO5 B;  5GT0 C;  5C3I B;  4ZUX B;  5CPI A;  4CAY A;  4ZUX C;  5CPK A;  5B32 B;  5B31 B;  4Z66 C;  5GT3 A;  3O62 D;  5B32 C;  5B31 C;  3REH C;  5B1M A;  4H9R B;  5B40 C;  3B6F D;  1Z2C B;  1P3K D;  2G5I C;  4YM6 A;  5GXQ A;  3UTA C;  3B6F B;  5AV6 B;  2Y2K A;  1P3K B;  4E45 A;  5AV6 C;  3NQJ A;  3X1S C;  4HGA B;  3UTB D;  5B33 A;  3MGR B;  5BNX A;  3AZF C;  5AV9 D;  1S32 A;  2BG1 A;  3UTB B;  1H3O B;  3MGP C;  3REL D;  2CV5 D;  5AV9 B;  3AZH A;  3VH6 A;  5AY8 C;  4J8X A;  3VH5 T;  5G49 B;  2PYO A;  5BO0 A;  3H0L C;  4LD9 D;  2FJ7 D;  3MNN B;  3WA9 D;  3MNN C;  1JFI B;  3AZN D;  4WJ3 C;  4LD9 B;  4YS3 C;  1EQZ C;  2NQB D;  4H9P A;  3WA9 B;  5DNM B;  4H9R A;  5DNM C;  2NQB B;  3KUY D;  3O62 A;  3AV2 D;  3H0M C;  3A6N C;  1KX3 B;  5BS7 C;  3B6F A;  3AFA D;  1KX3 C;  3B6G B;  5B2I B;  3X1T C;  1HQ3 B;  5CP6 B;  3WKJ B;  5B24 C;  1P3O B;  1HQ3 C;  3W97 D;  4WZS B;  1P3O C;  3AZM D;  3WKJ C;  3AN2 D;  1P3G A;  5B2J B;  4JJN D;  3W97 B;  1N1J A;  5B2J C;  3UTB A;  4E44 A;  3IP4 C;  3AZM B;  5AV9 A;  4JJN B;  3REL A;  4J8V C;  2CV5 A;  5G49 A;  3KXB D;  2JE5 A;  3KFU G;  3LEL D;  3KXB B;  2RIQ A;  3LZ1 D;  1P3P B;  3MGQ D;  1JFI A;  1P3P C;  4LD9 A;  1P34 D;  3NQU A;  2FJ7 A;  3WA9 A;  3LZ1 B;  3C1B B;  3MGQ B;  1WWS A;  4KUD C;  3AZN A;  3C1B C;  3AV1 D;  1P34 B;  1P3L C;  2NQB A;  2F8N H;  3AV1 B;  3KUY A;  3AV2 A;  1BH9 A;  4H9Q B;  3AFA A;  1M18 C;  3AZG B;  3W97 A;  3AZG C;  3AZM A;  3AN2 A;  1M19 C;  4JJN A;  3AZK D;  3W96 C;  5JRG C;  3VH6 T;  1AOI D;  3AZK B;  3W99 D;  3TU4 C;  3KXB A;  1AOI B;  3B0D B;  5FUG B;  3KWQ C;  4H9S A;  3B0D C;  3EPL A;  3LEL A;  4DQY B;  5E5A B;  3R45 B;  5E5A C;  3F6T A;  5BNV B;  3X1V D;  3LZ1 A;  3MGQ A;  4H9O B;  1P34 A;  4ZBJ C;  1M1A D;  3AZL D;  1F66 B;  4Z5T D;  3MVD C;  3AV1 A;  1F66 C;  2DQN C;  3UT9 B;  3REK B;  5B0Z B;  4Z5T B;  3REK C;  5B0Z C;  5BT1 D;  4R8P D;  4X23 B;  5F99 B;  4X23 C;  1P3I B;  1P3I C;  4G92 B;  5B1L B;  2ARO D;  1F1E A;  4G92 C;  5B1L C;  3AZI D;  5AVB B;  3AZK A;  4WU8 D;  5AVB C;  1P3A C;  2F8N D;  3AZI B;  3AZJ B;  1AOI A;  3W99 A;  3AZJ C;  4WU8 B;  4CSR B;  2F8N B;  3WTP A;  5AVC B;  2RVQ C;  3R45 A;  5GT0 D;  1ID3 B;  4G91 B;  4ZUX D;  4G91 C;  4Z66 D;  5GT0 B;  3X1V A;  5B32 D;  5B31 D;  3REH D;  5B40 D;  4Z66 B;  4DRB A;  4QLC C;  3REH B;  1M1A A;  3AZL A;  2BYM A;  4M6B A;  4Z5T A;  5B40 B;  3UTA D;  1ULY A;  3REI C;  1T3U A;  1KX5 B;  5AV6 D;  3X1S D;  3UTA B;  1KX5 C;  3AZE C;  3MGR D;  4R8P A;  3X1S B;  3VH6 W;  3MGP D;  3AZH C;  1U35 B;  3AZF B;  4KGC B;  2ARO A;  1U35 C;  1B6W A;  2JSS A;  4WU9 B;  3WAA C;  4J8U C;  5AY8 D;  4KGC C;  3MGP B;  1A7W A;  3AZI A;  4WU9 C;  4Z2M G;  4WU8 A;  5AY8 B;  2F8N A;  3EPJ A;  2NZD C;  3MNN D;  5JA4 A;  5GT0 A;  5DNN B;  4ZUX A;  2YFW B;  3X1U B;  4YS3 B;  5DNM D;  4Z66 A;  5DNN C;  1EQZ B;  3X1U C;  5B32 A;  5B31 A;  3REH A;  3A6N D;  5B40 A;  4WNN B;  1KX3 D;  3X1T D;  3B6G D;  3A6N B;  5B2I D;  3B0C T;  5B24 D;  1P3G C;  1HQ3 D;  5CP6 D;  3UTA A;  2VQR A;  1P3O D;  3WKJ D;  3X1T B;  5AV6 A;  1P3K A;  5B24 B;  3X1S A;  5B2J D;  1BH8 B;  3MGR A;  3MGP A;  4J8V D;  1H3O A;  5AY8 A;  4J8V B;  1KX4 C;  2FFF B;  1P3P D;  1P3M B;  3MNN A;  4J8W B;  1P3M C;  3C1B D;  2YFW A;  4KUD D;  1P3L D;  4J8W C;  4KUD B;  1P3L B;  5DNM A;  3A1I A;  4WNN A;  3A1K A;  3MGS B;  3A6N A;  1ZLA C;  3MGS C;  2ZY2 A;  5BS7 A;  1KX3 A;  5GSU B;  3X1T A;  1M18 D;  3B6G A;  5GSU C;  1HTA A;  5B2I A;  5CPJ B;  3REJ C;  1HQ3 A;  5CP6 A;  3AZG D;  5CPJ C;  3WKJ A;  1BH8 A;  1P3O A;  4H9N B;  2BYK B;  1M18 B;  5AV8 C;  3LZ0 B;  1M19 D;  2CWE A;  3LZ0 C;  5B2J A;  3W96 D;  1M19 B;  5B0Y B;  4XZQ C;  5B0Y C;  3TU4 D;  3VH5 W;  5JRG B;  4J8V A;  3W98 B;  3W96 B;  3W98 C;  1PZR A;  3KWQ D;  2Y2L A;  3TU4 B;  3AZI C;  4DRA A;  5E5A D;  3KWQ B;  1P3P A;  1P3F B;  1TAF B;  4KUD A;  1P3F C;  2Y2I A;  3MVD D;  3C1B A;  1P3L A;  4ZBJ B;  1F66 D;  2F8N G;  3MVD B;  3UT9 D;  3REK D;  5B0Z D;  2ZY4 A;  1BFM A;  3C1C C;  4X23 D;  1TZY C;  5F99 D;  1M18 A;  2BYK A;  4H9Q A;  2ZY5 A;  1P3I D;  3V9R B;  3B0B A;  2G5H C;  2HIO C;  5B32 G;  5B31 G;  5B1L D;  3AZG A;  1P3B B;  1M19 A;  3LJA C;  3AYW C;  1P3B C;  4UUZ B;  3W96 A;  5AVB D;  5AV5 B;  1P3A D;  5AV5 C;  3WTP C;  1B67 A;  3AZJ D;  1P3A B;  2ZM5 A;  2RVQ D;  4XUJ C;  3KWQ A;  3EPK A;  5AVC D;  5FUG A;  1ID3 D;  4NE3 A;  5E5A A;  5CPI B;  4NE5 A;  5BNV A;  5CPI C;  5GT3 B;  5CPK C;  1M1A C;  5GT3 C;  4H9O A;  4QLC D;  5B1M C;  3MVD A;  1F66 A;  5CHL B;  4YM6 B;  5GXQ B;  4QLC B;  3REI D;  2F2A C;  4YM6 C;  1Q9C A;  5GXQ C;  2JCH A;  3UT9 A;  3REK A;  5B0Z A;  2W8S A;  1KX5 D;  3REI B;  3NQJ B;  3AZE D;  2Y2P A;  5BNX B;  5B33 C;  4X23 A;  5F99 A;  3AZH D;  1S32 B;  3AZE B;  1P3I A;  2Y2N A;  3EG5 B;  1S32 C;  1U35 D;  3WTP E;  3AZF D;  4KGC D;  1WWI A;  5B1L A;  4J8U D;  3WAA D;  4WU9 D;  3AZH B;  4Z2M H;  4J8X B;  3WAA B;  4J8U B;  5AVB A;  4J8X C;  3KSY A;  2NZD D;  2Y2M A;  2PYO C;  3AZJ A;  4CSR A;  2IO5 C;  2ZY3 A;  2NZD B;  5C3I C;  5AVC A;  4H9P B;  1ID3 A;  5DNN D;  3X1U D;  4YS3 D;  1EQZ D;  3O62 B;  3H0R C;  3O62 C;  4QLC A;  4NFT A;  1P3G D;  3B6F C;  3REI A;  1P3K C;  2Y2O A;  4HGA C;  1P3G B;  1KX5 A;  3MGR C;  3FDD A;  4WV4 B;  1N1J B;  3AZE A;  3UTB C;  2LY8 A;  5AV9 C;  3REL B;  1U35 A;  2CV5 B;  3AZF A;  4KGC A;  3REL C;  4J8U A;  3WAA A;  4WU9 A;  2CV5 C;  1KX4 D;  2NZD A;  1KX4 B;  3NQU B;  2FJ7 B;  1P3M D;  4LD9 C;  4J8W D;  2FJ7 C;  3WA9 C;  3AZN B;  3AZN C;  2NQB C;  5DNN A;  3X1U A;  4YS3 A;  1EQZ A;  3KUY B;  3AV2 B;  1ZLA D;  1BH9 B;  3MGS D;  3KUY C;  3AV2 C;  3B6G C;  5B2I C;  5CP6 C;  5GSU D;  3AFA B;  1ZLA B;  3AFA C;  3REJ D;  5CPJ D;  5AV8 D;  2XD5 A;  4EO5 B;  3W97 C;  3REJ B;  3LZ0 D;  3AN2 B;  4EO5 C;  3AZM C;  1W2E A;  5B24 A;  3AN2 C;  5AV8 B;  2L5A A;  4JJN C;  5B0Y D;  2Y2H A;  4XZQ D;  5JRG D;  3W98 D;  4XZQ B;  3KXB C;  1KX4 A;  2J8P A;  3LEL B;  4H9S C;  3LEL C;  3LZ1 C;  3MGQ C;  1P3F D;  2XD1 A;  1P34 C;  1P3M A;  4J8W A;  3P5J B;  3AV1 C;  3AL0 C;  3B0C W;  1ZLA A;  3MGS A;  3C1C D;  1TZY D;  2Y2J A;  5KDM B;  5GSU A;  3EPH A;  3REJ A;  2HIO D;  3C1C B;  5CPJ A;  1TZY B;  5AV8 A;  4H9N A;  3LJA D;  3AYW D;  2HIO B;  3LZ0 A;  1P3B D;  5AV5 D;  3AZK C;  3WTP D;  3LJA B;  3AYW B;  4XZQ A;  5B0Y A;  2YFV B;  1R4V A;  1AOI C;  5JRG A;  3W99 B;  3W98 A;  3VH5 A;  4XUJ D;  3WTP B;  3W99 C;  4UPK A;  3TU4 A;  2Y2G A;  4XUJ B;  5CPI D;  4KHA B;  2HUE B;  3X1V B;  5CPK D;  5GT3 D;  2HUE C;  3X1V C;  5B1M D;  4CAY B;  1P3F A;  1TAF A;  5CPK B;  1M1A B;  3AZL B;  2BYM B;  3UT9 C;  5B1M B;  3AZL C;  4Z5T C;  4YM6 D;  5GXQ D;  5KDM A;  2DF4 C;  5F99 C;  1KU5 A;  3C1C A;  5B33 D;  1TZY A;  5BT1 C;  4R8P B;  4R8P C;  1S32 D;  2HIO A;  3V9R A;  5B33 B;  2ARO B;  2ARO C;  2Y2Q A;  3LJA A;  3AYW A;  1P3B A;  4J8X D;  2YFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...