1R4VA

1.9a crystal structure of protein aq328 from aquifex aeolicus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
151
Chain Sequence
b'ETMLRPKGFDKLDHYFRTELDIDLTDETIELLLNSVKAAFGKLFYGAEQRARWNGRDFIALADLNITKALEEHIKNFQKIEQDMGVDELLEYIAFIPPVEMNVGEDLKSEYRNIMGGLLLMHADVIKKATGERKPSREAMEFVAQIVDKVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AQ_328
molecule tags Structural genomics, unknown function
source organism Aquifex aeolicus
publication title The crystal structure of Aq_328 from the hyperthermophilic bacteria Aquifex aeolicus shows an ancestral histone fold.
pubmed doi rcsb
total genus 48
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2003-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09123 DUF1931 Domain of unknown function (DUF1931)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1r4vA00
3AZIC 1P3KC 5B40C 2IO5C 4NE6A 3VH6T 5E5AC 3KUYA 3MGSD 5AVCB 2BYMB 3W98C 4JJNB 4H9RA 2CV5A 1P34A 3WA9D 1M1AA 5JRGB 3KWQA 3REJD 3R45B 3AZHB 5FUGA 3LELD 5CPJA 3AV2C 5BT1C 5B2IB 5DNNA 3C1BB 4QLCC 3AZGA 5B1MC 3REJC 3MNNB 1ZLAC 3WA9C 4Z66C 3WAAD 3A6NB 5GT0A 4ZUXA 1P3AC 4WU9C 3W99B 3AZKB 5AV6D 3O62C 4NE5A 3AZKC 5AY8A 5C3IB 1EQZB 5FUGB 4KUDD 4LD9A 2FJ7B 4KGCA 3VH6W 4X23A 3AFAA 5AV9D 1P3LC 5AV8A 5BNXB 1KX5C 5E5AA 1ZLAB 3C1BC 2HIOD 1P3BC 1P3AB 2NQBC 3REHA 3WTPC 2NQBA 3W96A 3WTPD 4DRAA 3LJAD 4H9PB 3V9RB 5GT3A 4YM6A 3C1BD 5B2IC 3AZHC 5AV5D 1M18C 5AV9C 1P3LD 1BFMA 2FJ7A 4KGCB 5AY8C 1JFIA 3AYWA 1P3IA 3AN2B 3X1VA 4J8UB 3AFAB 1F66C 4EO5B 5CP6C 1AOIC 4KUDC 5B24A 3REKD 4E45A 5E5AB 4XUJD 1ZLAA 3B6FA 4H9SA 3UTBA 3AZIB 5GT0C 4Z5TA 4H9OB 4ZUXC 5CPKA 1P3AA 2IO5B 1P3OD 1HQ3B 3W96B 3X1SA 3LZ1B 4QLCA 3AZGC 5AVBC 5GXQB 5GSUC 3O62A 5BT1D 5B31G 4CSRA 1TZYC 3AV2D 4AWLB 4J8UA 3AN2A 5AV9A 3X1VB 5B1LA 1TZYD 5B32C 3AV1A 1P3FC 1KX5B 3WKJA 3B0DC 1M19A 1B67A 1P3FB 3UTAA 4H9SC 1BH8B 5AVBD 5GXQA 5AV6B 5GXQC 3UT9C 3TU4B 3O62B 3AYWC 3UT9A 3X1TD 1M1AB 2F8NH 1M18A 2LY8A 3AZID 4ZBJB 3AZED 4H9QA 5GT3C 5CPJB 3MVDC 1KX4D 4X23C 5B2IA 4J8UC 3WKJB 5AV5C 4KHAB 4WU8D 1U35B 3AZJC 3UTAB 4EO5C 5GXQD 5CP6B 1BH9B 5B2JB 3A6NA 4XZQD 3AZLD 1P3MA 5JRGC 1S32B 2CWEA 5B31A 4WU8A 1KX5D 3MVDB 3AN2D 3AV2A 3X1UB 3KXBC 3MGQA 4R8PD 1P3PD 3WKJC 3NQJA 3VH5T 4LD9C 3AV1C 4XZQA 5B32G 3AZLA 4ZBJC 1P3KB 4E44A 2AROD 3MGQD 2F8NK 5AV6C 2NZDA 2HUEC 1ID3B 5BS7A 3MGSB 4J8VB 4G92C 3X1TB 1HQ3D 4Z66D 3UTBD 4H9RB 2AROA 3REIA 1U35D 3A6NC 4H9PA 3V9RA 3R45A 5BO0B 5B31B 4WU8B 4WU9B 2PYOC 1KX4B 1TAFA 5F99B 4AWLC 3AV1D 1P3IB 4DRBA 5KDMA 2YFVB 1P3PC 3C1BA 3X1VC 1P3MD 2NZDB 2CV5D 4H9OA 4NE3A 3AZFD 5AVBB 5CPKB 3WAAB 1HQ3C 3VH6A 3KSYA 3LZ1A 3W98B 2HIOA 4J8XB 5CPIA 4WV4B 3KUYD 5BO0A 4Z5TD 3VH5W 4Z2MH 3VH5A 3B6FD 3AZFA 1AOIB 5AV9B 3AZEC 3AFAC 4H9NA 2F8NB 3W97C 5B1LD 5BNVB 5B0YC 1P3FA 4WU9D 3WAAA 3LZ0C 1P3AD 5B0ZB 4XZQC 3AZLC 3WAAC 3WA9A 3W98A 4XUJA 1ZLAD 3LJAB 4Z66A 3MGPD 1P3ID 1P3OA 4R8PA 5CHLB 1P3FD 3AZFB 5CPKD 5B33D 4CAYA 2NZDD 3LELA 3AFAD 1P3LB 1P3PB 2PYOB 3MGPA 4G91B 1WWIA 1R4VA 3WTPA 4KHAA 1B6WA 3B6FC 3AZIA 4Z5TB 1ID3C 3KUYB 3W98D 1P3BA 3UT9D 5B0YA 1HQ3A 4G92B 3MGSC 4YM6C 3W99C 2HUEB 3LZ1D 4Z66B 3AZFC 1P3MC 5B24D 3AZEA 3REKC 5B1MB 3AV2B 3X1VD 3REJB 3NQJB 3AV1B 5B33C 4XZQB 5B0ZC 2YFWA 5B2ID 5DNMB 3AZLB 1M19B 1ULYA 3MGPC 1N1JB 3AZJB 5GSUD 5B0YB 5B2JC 1U35C 4JJNC 3REHD 3X1TA 1P3OC 3TU4A 3W99A 4ZUXD 5GT0D 3MGRC 1TZYA 4HGAB 5B1LC 4XUJC 1M1AD 4LD9D 4X23B 2RVQC 4R8PC 3WKJD 2YFWB 3W97A 5BNXA 2FJ7D 4YS3C 5BS7C 1N1JA 5CPJD 3X1SD 3KUYC 5B31D 3AZMC 5CPIC 5AVCA 2HIOB 2NQBD 4UUZA 2CV5C 1TZYB 5F99C 2HIOC 5DNMD 3AZHA 4QLCD 3MVDA 4WNNB 4WU8C 4J8WD 3B6GD 1KX4C 1Q9CA 5B32B 3NQUB 5GT3D 3AZGB 2F8NA 2PYOD 1P3KA 3AZKD 5B24C 1ID3A 3AYWD 3LZ1C 4J8VC 5G49B 5AV5A 4J8XD 1KX3D 4XUJB 4YM6D 2AROB 4YS3B 3REIB 4UUZB 3LJAA 4KGCC 1P3OB 3W96D 4LD9B 3B0CW 1TAFB 4HGAC 5F99A 5B40D 1F66B 5JA4B 4CAYB 5KDMB 5B32A 3NQUA 5B1LB 3KXBD 1P3PA 3AN2C 5DNMC 1KX5A 5F99D 3WTPB 4J8WB 3B6GB 3UTAC 3REHB 3AZNC 3WTPE 5AV5B 5G49A 1BH8A 3RELB 1P34D 4YS3A 3AZGD 5AV6A 5GT3B 3LZ0D 5CPJC 3MNND 3REKB 2RVQD 1F66A 4J8UD 5C3IC 1P3KD 3AYWB 1M1AC 1JFIB 4X23D 1AOID 4H9QB 3REJA 1EQZC 3B6FB 5DNND 5BNVA 1M18D 4J8WA 3B6GA 3REID 1U35A 4Z5TC 4M6BA 3X1SB 3WA9B 5AVCD 2BYMA 2BYKA 3KWQC 3UTAD 3AZNB 1M19D 1S32C 5B32D 1P3LA 5AV8D 1S32D 3W96C 3LZ0B 3W97B 4KGCD 1A7WA 3X1UD 5AVCC 3O62D 3A6ND 3MNNA 1HTAA 4J8VA 3TU4D 4J8XC 5GT0B 4ZUXB 4J8VD 1ID3D 3AZNA 5GSUA 1M18B 2AROC 3AZEB 5B1MD 1EQZA 1KX4A 2JSSA 4Z2MG 5CP6D 5B40B 1F66D 4KUDA 5CPKC 3B0CT 1P3IC 5DNMA 3AZHD 5CP6A 3AZJA 2L5AA 3B0BA 5AVBA 1BH9A 3B0DB 5B2JA 1P34C 2NQBB 3AZND 3RELD 3AZMD 1P3MB 5B31C 4J8XA 5JRGA 3KWQB 3X1SC 5CPIB 1S32A 1P3BD 3W97D 5E5AD 5JA4A 3C1CB 1AOIA 5DNNB 1H3OA 3UTBB 3X1TC 3MGSA 1KX3C 3RELC 5B0ZA 4JJND 3REHC 3AZKA 3MGRB 3X1UC 3KXBB 5AY8B 4WU9A 3REKA 4WNNA 2F8NG 5B0ZD 4CSRB 3C1CA 5AV8C 3LELB 2YFVA 5B33B 4J8WC 3B6GC 1WWSA 5AV8B 3LELC 3MGPB 1P3GD 1M19C 1H3OB 3KWQD 3UTBC 1P3BB 5CPID 1KU5A 3W99D 3TU4C 3MGRA 3KXBA 3MGQC 4YM6B 4YS3D 2BYKB 3AZMA 1KX3B 1F1EA 3REIC 3UT9B 2FJ7C 5DNNC 2F8ND 1P3GC 5B1MA 1EQZD 1P3GA 5B33A 2NZDC 5B24B 4H9NB 3C1CC 5AY8D 3MGRD 3LZ0A 4G91C 3MNNC 5JRGD 4NFTA 3RELA 4WZSB 4QLCB 3LJAC 5B2JD 3AZJD 4JJNA 1P34B 2CV5B 3AZMB 1KX3A 5GSUB 5B0YD 4R8PB 3C1CD 3MVDD 1P3GB 3X1UA 3MGQB 5B40A 2PYOA 4KUDB
chains in the Genus database with same CATH superfamily
3AZIC 1P3KC 5B40C 2IO5C 4NE6A 3VH6T 5E5AC 3KUYA 3MGSD 5AVCB 2BYMB 3W98C 4JJNB 4H9RA 2CV5A 1P34A 3WA9D 1M1AA 5JRGB 3KWQA 3REJD 3R45B 3AZHB 5FUGA 3LELD 5CPJA 3AV2C 5BT1C 5B2IB 5DNNA 3C1BB 2UWXA 4QLCC 3AZGA 5B1MC 3REJC 3MNNB 1ZLAC 3WA9C 4Z66C 3WAAD 3A6NB 5GT0A 4ZUXA 1P3AC 4WU9C 3W99B 3AZKB 5AV6D 3O62C 4NE5A 3AZKC 5AY8A 5C3IB 1EQZB 5FUGB 4KUDD 4LD9A 2FJ7B 4KGCA 3VH6W 4X23A 3AFAA 5AV9D 1P3LC 5AV8A 5BNXB 1KX5C 5E5AA 1ZLAB 3C1BC 2HIOD 1P3BC 1P3AB 2NQBC 3REHA 3WTPC 2NQBA 3W96A 3WTPD 4DRAA 3LJAD 4H9PB 3V9RB 5GT3A 4YM6A 3C1BD 5B2IC 3AZHC 5AV5D 1M18C 5AV9C 1P3LD 3EPHA 1BFMA 2FJ7A 4KGCB 5AY8C 1JFIA 3AYWA 1P3IA 2F2AC 3AN2B 2Y2QA 4J8UB 3AFAB 3X1VA 1F66C 4EO5B 5CP6C 1AOIC 4KUDC 5B24A 3REKD 4E45A 5E5AB 4XUJD 1ZLAA 3B6FA 4H9SA 3UTBA 3AZIB 5GT0C 4Z5TA 4H9OB 4ZUXC 5CPKA 1P3AA 2IO5B 1P3OD 1HQ3B 3W96B 3X1SA 3LZ1B 4QLCA 3AZGC 5AVBC 5GXQB 5GSUC 3O62A 5BT1D 5B31G 4CSRA 2Y2JA 1TZYC 3AV2D 4AWLB 4J8UA 3AN2A 5AV9A 3X1VB 5B1LA 1TZYD 5B32C 3AV1A 1W2EA 1T3UA 1P3FC 1KX5B 3WKJA 3B0DC 1M19A 1B67A 1P3FB 3UTAA 4H9SC 1BH8B 5AVBD 5GXQA 5AV6B 5GXQC 3UT9C 3TU4B 3O62B 3AYWC 3UT9A 3X1TD 1M1AB 2F8NH 1M18A 2LY8A 3AZID 4ZBJB 3AZED 4H9QA 5GT3C 5CPJB 3MVDC 1KX4D 4X23C 5B2IA 4J8UC 2BG1A 3WKJB 3H0LC 4KHAB 5AV5C 3EPLA 4WU8D 1U35B 3AZJC 3UTAB 4EO5C 5GXQD 2ZY4A 5CP6B 1BH9B 5B2JB 3A6NA 4XZQD 3AZLD 1P3MA 5JRGC 1S32B 2CWEA 5B31A 4WU8A 1KX5D 3MVDB 3AN2D 3AV2A 3X1UB 3KXBC 3MGQA 4R8PD 1P3PD 3WKJC 3NQJA 3VH5T 4LD9C 3AV1C 2G5IC 4XZQA 5B32G 3AZLA 4ZBJC 1P3KB 4E44A 2AROD 3MGQD 2F8NK 5AV6C 2NZDA 2HUEC 1ID3B 5BS7A 3MGSB 4J8VB 4G92C 3X1TB 1HQ3D 4Z66D 3UTBD 2Y2GA 4H9RB 2AROA 3REIA 1U35D 3A6NC 3H0RC 4H9PA 3V9RA 3R45A 5BO0B 5B31B 4WU8B 4WU9B 2PYOC 1KX4B 1TAFA 5F99B 4AWLC 3AV1D 1P3IB 4DRBA 5KDMA 2YFVB 1P3PC 3FDDA 3C1BA 3X1VC 1P3MD 2NZDB 2CV5D 4H9OA 4NE3A 3AZFD 5AVBB 5CPKB 3WAAB 1HQ3C 3VH6A 3KSYA 3LZ1A 3W98B 3EG5B 2HIOA 4J8XB 5CPIA 2VQRA 4WV4B 3KUYD 5BO0A 4Z5TD 3VH5W 4Z2MH 3VH5A 3B6FD 3AZFA 1AOIB 5AV9B 3AZEC 3AFAC 4H9NA 2F8NB 3W97C 5B1LD 5BNVB 5B0YC 2DF4C 2W8SA 1P3FA 4WU9D 3WAAA 3LZ0C 1P3AD 5B0ZB 4XZQC 3AZLC 3WAAC 3WA9A 3W98A 4XUJA 1ZLAD 3LJAB 4Z66A 3MGPD 1P3ID 1P3OA 4R8PA 5CHLB 1P3FD 2DQNC 3AZFB 5B33D 5CPKD 4CAYA 2NZDD 3LELA 3AFAD 1P3LB 1P3PB 2PYOB 3MGPA 4G91B 1WWIA 2XD1A 1R4VA 3WTPA 4KHAA 1B6WA 3B6FC 3AZIA 4Z5TB 1ID3C 3KUYB 3W98D 1P3BA 3UT9D 5B0YA 1HQ3A 4G92B 3MGSC 4YM6C 3W99C 2HUEB 3LZ1D 4Z66B 3AZFC 3A1IA 1P3MC 5B24D 3AZEA 3REKC 2JE5A 5B1MB 3AV2B 3X1VD 3REJB 3NQJB 3AV1B 5B33C 4XZQB 5B0ZC 2YFWA 2ZY3A 5B2ID 2G5HC 5DNMB 1ULYA 3MGPC 3AZLB 1M19B 1N1JB 3AZJB 5GSUD 5B0YB 5B2JC 1U35C 4JJNC 3REHD 3X1TA 1P3OC 3TU4A 3W99A 4ZUXD 5GT0D 3MGRC 1TZYA 4HGAB 2JCHA 5B1LC 4XUJC 1PZRA 1M1AD 4LD9D 4X23B 3KFUG 2RVQC 4R8PC 3WKJD 2YFWB 3W97A 5BNXA 2FJ7D 4YS3C 5BS7C 1N1JA 5CPJD 3X1SD 3KUYC 5B31D 3AZMC 5CPIC 3EPKA 5AVCA 2Y2HA 2HIOB 2NQBD 4UUZA 2CV5C 1TZYB 5F99C 2HIOC 5DNMD 3AZHA 4QLCD 3MVDA 4WNNB 4WU8C 4J8WD 3B6GD 1KX4C 1Q9CA 5B32B 3NQUB 5GT3D 3P5JB 3AZGB 2F8NA 2PYOD 1P3KA 3A1KA 3AZKD 5B24C 1ID3A 3AYWD 3LZ1C 4J8VC 5G49B 5AV5A 4J8XD 1KX3D 4XUJB 4YM6D 2AROB 4YS3B 3REIB 4UUZB 3LJAA 4KGCC 1P3OB 3W96D 4LD9B 3B0CW 1TAFB 4HGAC 5F99A 5B40D 1F66B 5JA4B 4CAYB 4UPKA 5KDMB 5B32A 3NQUA 5B1LB 3KXBD 1P3PA 3AN2C 5DNMC 2XD5A 1KX5A 5F99D 3WTPB 4J8WB 3B6GB 3UTAC 3REHB 3AZNC 5AV5B 5G49A 3WTPE 1BH8A 3RELB 1P34D 4YS3A 3AZGD 5AV6A 5GT3B 3LZ0D 5CPJC 3H0MC 3MNND 3REKB 2RVQD 1F66A 4J8UD 5C3IC 1P3KD 3AYWB 1M1AC 1JFIB 3AL0C 4X23D 1AOID 4H9QB 3REJA 1EQZC 2Y2IA 3B6FB 5DNND 5BNVA 1M18D 4J8WA 3B6GA 3REID 1U35A 4Z5TC 4M6BA 3X1SB 3WA9B 5AVCD 2BYMA 4WJ3C 2BYKA 3KWQC 3UTAD 3AZNB 1M19D 1S32C 5B32D 1P3LA 5AV8D 1S32D 2Y2MA 3W96C 3LZ0B 3W97B 4KGCD 1A7WA 3X1UD 5AVCC 3O62D 3A6ND 3MNNA 1HTAA 4J8VA 3TU4D 4J8XC 5GT0B 4ZUXB 4J8VD 1ID3D 2Y2PA 3AZNA 5GSUA 2ZY5A 1M18B 2AROC 3AZEB 5B1MD 1EQZA 1KX4A 2JSSA 4Z2MG 5CP6D 5B40B 1F66D 4KUDA 5CPKC 3B0CT 1P3IC 5DNMA 3AZHD 2ZY2A 5CP6A 3AZJA 2L5AA 3B0BA 5AVBA 1BH9A 3B0DB 5B2JA 1P34C 2J8PA 2NQBB 2Y2OA 3AZND 3RELD 3AZMD 1P3MB 5B31C 2Y2KA 5JRGA 3KWQB 4J8XA 3X1SC 5CPIB 1S32A 1P3BD 3W97D 5E5AD 5JA4A 3C1CB 1AOIA 5DNNB 1H3OA 3UTBB 3X1TC 3MGSA 1KX3C 3RELC 5B0ZA 2Y2LA 4JJND 3REHC 4DQYB 2RIQA 3AZKA 3MGRB 3X1UC 3KXBB 5AY8B 4WU9A 3REKA 4WNNA 2F8NG 5B0ZD 4CSRB 3C1CA 5AV8C 3LELB 2YFVA 5B33B 4J8WC 3B6GC 1WWSA 5AV8B 3LELC 3MGPB 1P3GD 1M19C 1H3OB 3KWQD 3UTBC 1P3BB 5CPID 1KU5A 3W99D 3TU4C 3MGRA 2ZM5A 3KXBA 3MGQC 3IP4C 4YM6B 4YS3D 2BYKB 3AZMA 1KX3B 1F1EA 3REIC 3UT9B 3EPJA 2FJ7C 5DNNC 2F8ND 1P3GC 5B1MA 1EQZD 1P3GA 2FFFB 5B33A 2NZDC 5B24B 4H9NB 3C1CC 5AY8D 3MGRD 3LZ0A 4G91C 3MNNC 5JRGD 4NFTA 3RELA 4WZSB 4QLCB 2Y2NA 3LJAC 5B2JD 3AZJD 4JJNA 1P34B 2CV5B 3AZMB 1KX3A 5GSUB 5B0YD 4R8PB 3F6TA 3C1CD 3MVDD 1Z2CB 1P3GB 3X1UA 3MGQB 5B40A 2PYOA 4KUDB
chains in the Genus database with same CATH topology
3AZIC 1P3KC 5B40C 2IO5C 4NE6A 3VH6T 5E5AC 3KUYA 3MGSD 5AVCB 2BYMB 3W98C 4JJNB 4H9RA 2CV5A 1P34A 3WA9D 1M1AA 5JRGB 3KWQA 3REJD 3R45B 3AZHB 5FUGA 3LELD 5CPJA 3AV2C 5BT1C 5B2IB 5DNNA 3C1BB 2UWXA 4QLCC 3AZGA 5B1MC 3REJC 3MNNB 1ZLAC 3WA9C 4Z66C 3WAAD 3A6NB 5GT0A 4ZUXA 1P3AC 4WU9C 3W99B 3AZKB 5AV6D 3O62C 4NE5A 3AZKC 5AY8A 5C3IB 1EQZB 5FUGB 4KUDD 4LD9A 2FJ7B 4KGCA 3VH6W 4X23A 3AFAA 5AV9D 1P3LC 5AV8A 5BNXB 1KX5C 5E5AA 1ZLAB 3C1BC 2HIOD 1P3BC 1P3AB 2NQBC 3REHA 3WTPC 2NQBA 3W96A 3WTPD 4DRAA 3LJAD 4H9PB 3V9RB 5GT3A 4YM6A 3C1BD 5B2IC 3AZHC 5AV5D 1M18C 5AV9C 1P3LD 3EPHA 1BFMA 2FJ7A 4KGCB 5AY8C 1JFIA 3AYWA 1P3IA 2F2AC 3AN2B 2Y2QA 4J8UB 3AFAB 3X1VA 1F66C 4EO5B 5CP6C 1AOIC 4KUDC 5B24A 3REKD 4E45A 5E5AB 4XUJD 1ZLAA 3B6FA 4H9SA 3UTBA 3AZIB 5GT0C 4Z5TA 4H9OB 4ZUXC 5CPKA 1P3AA 2IO5B 1P3OD 1HQ3B 3W96B 3X1SA 3LZ1B 4QLCA 3AZGC 5AVBC 5GXQB 5GSUC 3O62A 5BT1D 5B31G 4CSRA 2Y2JA 1TZYC 3AV2D 4AWLB 4J8UA 3AN2A 5AV9A 3X1VB 5B1LA 1TZYD 5B32C 3AV1A 1W2EA 1T3UA 1P3FC 1KX5B 3WKJA 3B0DC 1M19A 1B67A 1P3FB 3UTAA 4H9SC 1BH8B 5AVBD 5GXQA 5AV6B 5GXQC 3UT9C 3TU4B 3O62B 3AYWC 3UT9A 3X1TD 1M1AB 2F8NH 1M18A 2LY8A 3AZID 4ZBJB 3AZED 4H9QA 5GT3C 5CPJB 3MVDC 1KX4D 4X23C 5B2IA 4J8UC 2BG1A 3WKJB 3H0LC 4KHAB 5AV5C 3EPLA 4WU8D 1U35B 3AZJC 3UTAB 4EO5C 5GXQD 2ZY4A 5CP6B 1BH9B 5B2JB 3A6NA 4XZQD 3AZLD 1P3MA 5JRGC 1S32B 2CWEA 5B31A 4WU8A 1KX5D 3MVDB 3AN2D 3AV2A 3X1UB 3KXBC 3MGQA 4R8PD 1P3PD 3WKJC 3NQJA 3VH5T 4LD9C 3AV1C 2G5IC 4XZQA 5B32G 3AZLA 4ZBJC 1P3KB 4E44A 2AROD 3MGQD 2F8NK 5AV6C 2NZDA 2HUEC 1ID3B 5BS7A 3MGSB 4J8VB 4G92C 3X1TB 1HQ3D 4Z66D 3UTBD 2Y2GA 4H9RB 2AROA 3REIA 1U35D 3A6NC 3H0RC 4H9PA 3V9RA 3R45A 5BO0B 5B31B 4WU8B 4WU9B 2PYOC 1KX4B 1TAFA 5F99B 4AWLC 3AV1D 1P3IB 4DRBA 5KDMA 2YFVB 1P3PC 3FDDA 3C1BA 3X1VC 1P3MD 2NZDB 2CV5D 4H9OA 4NE3A 3AZFD 5AVBB 5CPKB 3WAAB 1HQ3C 3VH6A 3KSYA 3LZ1A 3W98B 3EG5B 2HIOA 4J8XB 5CPIA 2VQRA 4WV4B 3KUYD 5BO0A 4Z5TD 3VH5W 4Z2MH 3VH5A 3B6FD 3AZFA 1AOIB 5AV9B 3AZEC 3AFAC 4H9NA 2F8NB 3W97C 5B1LD 5BNVB 5B0YC 2DF4C 2W8SA 1P3FA 4WU9D 3WAAA 3LZ0C 1P3AD 5B0ZB 4XZQC 3AZLC 3WAAC 3WA9A 3W98A 4XUJA 1ZLAD 3LJAB 4Z66A 3MGPD 1P3ID 1P3OA 4R8PA 5CHLB 1P3FD 2DQNC 3AZFB 5B33D 5CPKD 4CAYA 2NZDD 3LELA 3AFAD 1P3LB 1P3PB 2PYOB 3MGPA 4G91B 1WWIA 2XD1A 1R4VA 3WTPA 4KHAA 1B6WA 3B6FC 3AZIA 4Z5TB 1ID3C 3KUYB 3W98D 1P3BA 3UT9D 5B0YA 1HQ3A 4G92B 3MGSC 4YM6C 3W99C 2HUEB 3LZ1D 4Z66B 3AZFC 3A1IA 1P3MC 5B24D 3AZEA 3REKC 2JE5A 5B1MB 3AV2B 3X1VD 3REJB 3NQJB 3AV1B 5B33C 4XZQB 5B0ZC 2YFWA 2ZY3A 5B2ID 2G5HC 5DNMB 1ULYA 3MGPC 3AZLB 1M19B 1N1JB 3AZJB 5GSUD 5B0YB 5B2JC 1U35C 4JJNC 3REHD 3X1TA 1P3OC 3TU4A 3W99A 4ZUXD 5GT0D 3MGRC 1TZYA 4HGAB 2JCHA 5B1LC 4XUJC 1PZRA 1M1AD 4LD9D 4X23B 3KFUG 2RVQC 4R8PC 3WKJD 2YFWB 3W97A 5BNXA 2FJ7D 4YS3C 5BS7C 1N1JA 5CPJD 3X1SD 3KUYC 5B31D 3AZMC 5CPIC 3EPKA 5AVCA 2Y2HA 2HIOB 2NQBD 4UUZA 2CV5C 1TZYB 5F99C 2HIOC 5DNMD 3AZHA 4QLCD 3MVDA 4WNNB 4WU8C 4J8WD 3B6GD 1KX4C 1Q9CA 5B32B 3NQUB 5GT3D 3P5JB 3AZGB 2F8NA 2PYOD 1P3KA 3A1KA 3AZKD 5B24C 1ID3A 3AYWD 3LZ1C 4J8VC 5G49B 5AV5A 4J8XD 1KX3D 4XUJB 4YM6D 2AROB 4YS3B 3REIB 4UUZB 3LJAA 4KGCC 1P3OB 3W96D 4LD9B 3B0CW 1TAFB 4HGAC 5F99A 5B40D 1F66B 5JA4B 4CAYB 4UPKA 5KDMB 5B32A 3NQUA 5B1LB 3KXBD 1P3PA 3AN2C 5DNMC 2XD5A 1KX5A 5F99D 3WTPB 4J8WB 3B6GB 3UTAC 3REHB 3AZNC 5AV5B 5G49A 3WTPE 1BH8A 3RELB 1P34D 4YS3A 3AZGD 5AV6A 5GT3B 3LZ0D 5CPJC 3H0MC 3MNND 3REKB 2RVQD 1F66A 4J8UD 5C3IC 1P3KD 3AYWB 1M1AC 1JFIB 3AL0C 4X23D 1AOID 4H9QB 3REJA 1EQZC 2Y2IA 3B6FB 5DNND 5BNVA 1M18D 4J8WA 3B6GA 3REID 1U35A 4Z5TC 4M6BA 3X1SB 3WA9B 5AVCD 2BYMA 4WJ3C 2BYKA 3KWQC 3UTAD 3AZNB 1M19D 1S32C 5B32D 1P3LA 5AV8D 1S32D 2Y2MA 3W96C 3LZ0B 3W97B 4KGCD 1A7WA 3X1UD 5AVCC 3O62D 3A6ND 3MNNA 1HTAA 4J8VA 3TU4D 4J8XC 5GT0B 4ZUXB 4J8VD 1ID3D 2Y2PA 3AZNA 5GSUA 2ZY5A 1M18B 2AROC 3AZEB 5B1MD 1EQZA 1KX4A 2JSSA 4Z2MG 5CP6D 5B40B 1F66D 4KUDA 5CPKC 3B0CT 1P3IC 5DNMA 3AZHD 2ZY2A 5CP6A 3AZJA 2L5AA 3B0BA 5AVBA 1BH9A 3B0DB 5B2JA 1P34C 2J8PA 2NQBB 2Y2OA 3AZND 3RELD 3AZMD 1P3MB 5B31C 2Y2KA 5JRGA 3KWQB 4J8XA 3X1SC 5CPIB 1S32A 1P3BD 3W97D 5E5AD 5JA4A 3C1CB 1AOIA 5DNNB 1H3OA 3UTBB 3X1TC 3MGSA 1KX3C 3RELC 5B0ZA 2Y2LA 4JJND 3REHC 4DQYB 2RIQA 3AZKA 3MGRB 3X1UC 3KXBB 5AY8B 4WU9A 3REKA 4WNNA 2F8NG 5B0ZD 4CSRB 3C1CA 5AV8C 3LELB 2YFVA 5B33B 4J8WC 3B6GC 1WWSA 5AV8B 3LELC 3MGPB 1P3GD 1M19C 1H3OB 3KWQD 3UTBC 1P3BB 5CPID 1KU5A 3W99D 3TU4C 3MGRA 2ZM5A 3KXBA 3MGQC 3IP4C 4YM6B 4YS3D 2BYKB 3AZMA 1KX3B 1F1EA 3REIC 3UT9B 3EPJA 2FJ7C 5DNNC 2F8ND 1P3GC 5B1MA 1EQZD 1P3GA 2FFFB 5B33A 2NZDC 5B24B 4H9NB 3C1CC 5AY8D 3MGRD 3LZ0A 4G91C 3MNNC 5JRGD 4NFTA 3RELA 4WZSB 4QLCB 2Y2NA 3LJAC 5B2JD 3AZJD 4JJNA 1P34B 2CV5B 3AZMB 1KX3A 5GSUB 5B0YD 4R8PB 3F6TA 3C1CD 3MVDD 1Z2CB 1P3GB 3X1UA 3MGQB 5B40A 2PYOA 4KUDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZI C;  1P3K C;  5B40 C;  2IO5 C;  4NE6 A;  3VH6 T;  5E5A C;  3KUY A;  3MGS D;  5AVC B;  2BYM B;  3W98 C;  4JJN B;  4H9R A;  2CV5 A;  1P34 A;  3WA9 D;  1M1A A;  5JRG B;  3KWQ A;  3REJ D;  3R45 B;  3AZH B;  5FUG A;  3LEL D;  5CPJ A;  3AV2 C;  5BT1 C;  5B2I B;  5DNN A;  3C1B B;  4QLC C;  3AZG A;  5B1M C;  3REJ C;  3MNN B;  1ZLA C;  3WA9 C;  4Z66 C;  3WAA D;  3A6N B;  5GT0 A;  4ZUX A;  1P3A C;  4WU9 C;  3W99 B;  3AZK B;  5AV6 D;  3O62 C;  4NE5 A;  3AZK C;  5AY8 A;  5C3I B;  1EQZ B;  5FUG B;  4KUD D;  4LD9 A;  2FJ7 B;  4KGC A;  3VH6 W;  4X23 A;  3AFA A;  5AV9 D;  1P3L C;  5AV8 A;  5BNX B;  1KX5 C;  5E5A A;  1ZLA B;  3C1B C;  2HIO D;  1P3B C;  1P3A B;  2NQB C;  3REH A;  3WTP C;  2NQB A;  3W96 A;  3WTP D;  4DRA A;  3LJA D;  4H9P B;  3V9R B;  5GT3 A;  4YM6 A;  3C1B D;  5B2I C;  3AZH C;  5AV5 D;  1M18 C;  5AV9 C;  1P3L D;  1BFM A;  2FJ7 A;  4KGC B;  5AY8 C;  1JFI A;  3AYW A;  1P3I A;  3AN2 B;  3X1V A;  4J8U B;  3AFA B;  1F66 C;  4EO5 B;  5CP6 C;  1AOI C;  4KUD C;  5B24 A;  3REK D;  4E45 A;  5E5A B;  4XUJ D;  1ZLA A;  3B6F A;  4H9S A;  3UTB A;  3AZI B;  5GT0 C;  4Z5T A;  4H9O B;  4ZUX C;  5CPK A;  1P3A A;  2IO5 B;  1P3O D;  1HQ3 B;  3W96 B;  3X1S A;  3LZ1 B;  4QLC A;  3AZG C;  5AVB C;  5GXQ B;  5GSU C;  3O62 A;  5BT1 D;  5B31 G;  4CSR A;  1TZY C;  3AV2 D;  4AWL B;  4J8U A;  3AN2 A;  5AV9 A;  3X1V B;  5B1L A;  1TZY D;  5B32 C;  3AV1 A;  1P3F C;  1KX5 B;  3WKJ A;  3B0D C;  1M19 A;  1B67 A;  1P3F B;  3UTA A;  4H9S C;  1BH8 B;  5AVB D;  5GXQ A;  5AV6 B;  5GXQ C;  3UT9 C;  3TU4 B;  3O62 B;  3AYW C;  3UT9 A;  3X1T D;  1M1A B;  2F8N H;  1M18 A;  2LY8 A;  3AZI D;  4ZBJ B;  3AZE D;  4H9Q A;  5GT3 C;  5CPJ B;  3MVD C;  1KX4 D;  4X23 C;  5B2I A;  4J8U C;  3WKJ B;  5AV5 C;  4KHA B;  4WU8 D;  1U35 B;  3AZJ C;  3UTA B;  4EO5 C;  5GXQ D;  5CP6 B;  1BH9 B;  5B2J B;  3A6N A;  4XZQ D;  3AZL D;  1P3M A;  5JRG C;  1S32 B;  2CWE A;  5B31 A;  4WU8 A;  1KX5 D;  3MVD B;  3AN2 D;  3AV2 A;  3X1U B;  3KXB C;  3MGQ A;  4R8P D;  1P3P D;  3WKJ C;  3NQJ A;  3VH5 T;  4LD9 C;  3AV1 C;  4XZQ A;  5B32 G;  3AZL A;  4ZBJ C;  1P3K B;  4E44 A;  2ARO D;  3MGQ D;  2F8N K;  5AV6 C;  2NZD A;  2HUE C;  1ID3 B;  5BS7 A;  3MGS B;  4J8V B;  4G92 C;  3X1T B;  1HQ3 D;  4Z66 D;  3UTB D;  4H9R B;  2ARO A;  3REI A;  1U35 D;  3A6N C;  4H9P A;  3V9R A;  3R45 A;  5BO0 B;  5B31 B;  4WU8 B;  4WU9 B;  2PYO C;  1KX4 B;  1TAF A;  5F99 B;  4AWL C;  3AV1 D;  1P3I B;  4DRB A;  5KDM A;  2YFV B;  1P3P C;  3C1B A;  3X1V C;  1P3M D;  2NZD B;  2CV5 D;  4H9O A;  4NE3 A;  3AZF D;  5AVB B;  5CPK B;  3WAA B;  1HQ3 C;  3VH6 A;  3KSY A;  3LZ1 A;  3W98 B;  2HIO A;  4J8X B;  5CPI A;  4WV4 B;  3KUY D;  5BO0 A;  4Z5T D;  3VH5 W;  4Z2M H;  3VH5 A;  3B6F D;  3AZF A;  1AOI B;  5AV9 B;  3AZE C;  3AFA C;  4H9N A;  2F8N B;  3W97 C;  5B1L D;  5BNV B;  5B0Y C;  1P3F A;  4WU9 D;  3WAA A;  3LZ0 C;  1P3A D;  5B0Z B;  4XZQ C;  3AZL C;  3WAA C;  3WA9 A;  3W98 A;  4XUJ A;  1ZLA D;  3LJA B;  4Z66 A;  3MGP D;  1P3I D;  1P3O A;  4R8P A;  5CHL B;  1P3F D;  3AZF B;  5CPK D;  5B33 D;  4CAY A;  2NZD D;  3LEL A;  3AFA D;  1P3L B;  1P3P B;  2PYO B;  3MGP A;  4G91 B;  1WWI A;  1R4V A;  3WTP A;  4KHA A;  1B6W A;  3B6F C;  3AZI A;  4Z5T B;  1ID3 C;  3KUY B;  3W98 D;  1P3B A;  3UT9 D;  5B0Y A;  1HQ3 A;  4G92 B;  3MGS C;  4YM6 C;  3W99 C;  2HUE B;  3LZ1 D;  4Z66 B;  3AZF C;  1P3M C;  5B24 D;  3AZE A;  3REK C;  5B1M B;  3AV2 B;  3X1V D;  3REJ B;  3NQJ B;  3AV1 B;  5B33 C;  4XZQ B;  5B0Z C;  2YFW A;  5B2I D;  5DNM B;  3AZL B;  1M19 B;  1ULY A;  3MGP C;  1N1J B;  3AZJ B;  5GSU D;  5B0Y B;  5B2J C;  1U35 C;  4JJN C;  3REH D;  3X1T A;  1P3O C;  3TU4 A;  3W99 A;  4ZUX D;  5GT0 D;  3MGR C;  1TZY A;  4HGA B;  5B1L C;  4XUJ C;  1M1A D;  4LD9 D;  4X23 B;  2RVQ C;  4R8P C;  3WKJ D;  2YFW B;  3W97 A;  5BNX A;  2FJ7 D;  4YS3 C;  5BS7 C;  1N1J A;  5CPJ D;  3X1S D;  3KUY C;  5B31 D;  3AZM C;  5CPI C;  5AVC A;  2HIO B;  2NQB D;  4UUZ A;  2CV5 C;  1TZY B;  5F99 C;  2HIO C;  5DNM D;  3AZH A;  4QLC D;  3MVD A;  4WNN B;  4WU8 C;  4J8W D;  3B6G D;  1KX4 C;  1Q9C A;  5B32 B;  3NQU B;  5GT3 D;  3AZG B;  2F8N A;  2PYO D;  1P3K A;  3AZK D;  5B24 C;  1ID3 A;  3AYW D;  3LZ1 C;  4J8V C;  5G49 B;  5AV5 A;  4J8X D;  1KX3 D;  4XUJ B;  4YM6 D;  2ARO B;  4YS3 B;  3REI B;  4UUZ B;  3LJA A;  4KGC C;  1P3O B;  3W96 D;  4LD9 B;  3B0C W;  1TAF B;  4HGA C;  5F99 A;  5B40 D;  1F66 B;  5JA4 B;  4CAY B;  5KDM B;  5B32 A;  3NQU A;  5B1L B;  3KXB D;  1P3P A;  3AN2 C;  5DNM C;  1KX5 A;  5F99 D;  3WTP B;  4J8W B;  3B6G B;  3UTA C;  3REH B;  3AZN C;  3WTP E;  5AV5 B;  5G49 A;  1BH8 A;  3REL B;  1P34 D;  4YS3 A;  3AZG D;  5AV6 A;  5GT3 B;  3LZ0 D;  5CPJ C;  3MNN D;  3REK B;  2RVQ D;  1F66 A;  4J8U D;  5C3I C;  1P3K D;  3AYW B;  1M1A C;  1JFI B;  4X23 D;  1AOI D;  4H9Q B;  3REJ A;  1EQZ C;  3B6F B;  5DNN D;  5BNV A;  1M18 D;  4J8W A;  3B6G A;  3REI D;  1U35 A;  4Z5T C;  4M6B A;  3X1S B;  3WA9 B;  5AVC D;  2BYM A;  2BYK A;  3KWQ C;  3UTA D;  3AZN B;  1M19 D;  1S32 C;  5B32 D;  1P3L A;  5AV8 D;  1S32 D;  3W96 C;  3LZ0 B;  3W97 B;  4KGC D;  1A7W A;  3X1U D;  5AVC C;  3O62 D;  3A6N D;  3MNN A;  1HTA A;  4J8V A;  3TU4 D;  4J8X C;  5GT0 B;  4ZUX B;  4J8V D;  1ID3 D;  3AZN A;  5GSU A;  1M18 B;  2ARO C;  3AZE B;  5B1M D;  1EQZ A;  1KX4 A;  2JSS A;  4Z2M G;  5CP6 D;  5B40 B;  1F66 D;  4KUD A;  5CPK C;  3B0C T;  1P3I C;  5DNM A;  3AZH D;  5CP6 A;  3AZJ A;  2L5A A;  3B0B A;  5AVB A;  1BH9 A;  3B0D B;  5B2J A;  1P34 C;  2NQB B;  3AZN D;  3REL D;  3AZM D;  1P3M B;  5B31 C;  4J8X A;  5JRG A;  3KWQ B;  3X1S C;  5CPI B;  1S32 A;  1P3B D;  3W97 D;  5E5A D;  5JA4 A;  3C1C B;  1AOI A;  5DNN B;  1H3O A;  3UTB B;  3X1T C;  3MGS A;  1KX3 C;  3REL C;  5B0Z A;  4JJN D;  3REH C;  3AZK A;  3MGR B;  3X1U C;  3KXB B;  5AY8 B;  4WU9 A;  3REK A;  4WNN A;  2F8N G;  5B0Z D;  4CSR B;  3C1C A;  5AV8 C;  3LEL B;  2YFV A;  5B33 B;  4J8W C;  3B6G C;  1WWS A;  5AV8 B;  3LEL C;  3MGP B;  1P3G D;  1M19 C;  1H3O B;  3KWQ D;  3UTB C;  1P3B B;  5CPI D;  1KU5 A;  3W99 D;  3TU4 C;  3MGR A;  3KXB A;  3MGQ C;  4YM6 B;  4YS3 D;  2BYK B;  3AZM A;  1KX3 B;  1F1E A;  3REI C;  3UT9 B;  2FJ7 C;  5DNN C;  2F8N D;  1P3G C;  5B1M A;  1EQZ D;  1P3G A;  5B33 A;  2NZD C;  5B24 B;  4H9N B;  3C1C C;  5AY8 D;  3MGR D;  3LZ0 A;  4G91 C;  3MNN C;  5JRG D;  4NFT A;  3REL A;  4WZS B;  4QLC B;  3LJA C;  5B2J D;  3AZJ D;  4JJN A;  1P34 B;  2CV5 B;  3AZM B;  1KX3 A;  5GSU B;  5B0Y D;  4R8P B;  3C1C D;  3MVD D;  1P3G B;  3X1U A;  3MGQ B;  5B40 A;  2PYO A;  4KUD B; 
#chains in the Genus database with same CATH topology
 3AZI C;  1P3K C;  5B40 C;  2IO5 C;  4NE6 A;  3VH6 T;  5E5A C;  3KUY A;  3MGS D;  5AVC B;  2BYM B;  3W98 C;  4JJN B;  4H9R A;  2CV5 A;  1P34 A;  3WA9 D;  1M1A A;  5JRG B;  3KWQ A;  3REJ D;  3R45 B;  3AZH B;  5FUG A;  3LEL D;  5CPJ A;  3AV2 C;  5BT1 C;  5B2I B;  5DNN A;  3C1B B;  2UWX A;  4QLC C;  3AZG A;  5B1M C;  3REJ C;  3MNN B;  1ZLA C;  3WA9 C;  4Z66 C;  3WAA D;  3A6N B;  5GT0 A;  4ZUX A;  1P3A C;  4WU9 C;  3W99 B;  3AZK B;  5AV6 D;  3O62 C;  4NE5 A;  3AZK C;  5AY8 A;  5C3I B;  1EQZ B;  5FUG B;  4KUD D;  4LD9 A;  2FJ7 B;  4KGC A;  3VH6 W;  4X23 A;  3AFA A;  5AV9 D;  1P3L C;  5AV8 A;  5BNX B;  1KX5 C;  5E5A A;  1ZLA B;  3C1B C;  2HIO D;  1P3B C;  1P3A B;  2NQB C;  3REH A;  3WTP C;  2NQB A;  3W96 A;  3WTP D;  4DRA A;  3LJA D;  4H9P B;  3V9R B;  5GT3 A;  4YM6 A;  3C1B D;  5B2I C;  3AZH C;  5AV5 D;  1M18 C;  5AV9 C;  1P3L D;  3EPH A;  1BFM A;  2FJ7 A;  4KGC B;  5AY8 C;  1JFI A;  3AYW A;  1P3I A;  2F2A C;  3AN2 B;  2Y2Q A;  4J8U B;  3AFA B;  3X1V A;  1F66 C;  4EO5 B;  5CP6 C;  1AOI C;  4KUD C;  5B24 A;  3REK D;  4E45 A;  5E5A B;  4XUJ D;  1ZLA A;  3B6F A;  4H9S A;  3UTB A;  3AZI B;  5GT0 C;  4Z5T A;  4H9O B;  4ZUX C;  5CPK A;  1P3A A;  2IO5 B;  1P3O D;  1HQ3 B;  3W96 B;  3X1S A;  3LZ1 B;  4QLC A;  3AZG C;  5AVB C;  5GXQ B;  5GSU C;  3O62 A;  5BT1 D;  5B31 G;  4CSR A;  2Y2J A;  1TZY C;  3AV2 D;  4AWL B;  4J8U A;  3AN2 A;  5AV9 A;  3X1V B;  5B1L A;  1TZY D;  5B32 C;  3AV1 A;  1W2E A;  1T3U A;  1P3F C;  1KX5 B;  3WKJ A;  3B0D C;  1M19 A;  1B67 A;  1P3F B;  3UTA A;  4H9S C;  1BH8 B;  5AVB D;  5GXQ A;  5AV6 B;  5GXQ C;  3UT9 C;  3TU4 B;  3O62 B;  3AYW C;  3UT9 A;  3X1T D;  1M1A B;  2F8N H;  1M18 A;  2LY8 A;  3AZI D;  4ZBJ B;  3AZE D;  4H9Q A;  5GT3 C;  5CPJ B;  3MVD C;  1KX4 D;  4X23 C;  5B2I A;  4J8U C;  2BG1 A;  3WKJ B;  3H0L C;  4KHA B;  5AV5 C;  3EPL A;  4WU8 D;  1U35 B;  3AZJ C;  3UTA B;  4EO5 C;  5GXQ D;  2ZY4 A;  5CP6 B;  1BH9 B;  5B2J B;  3A6N A;  4XZQ D;  3AZL D;  1P3M A;  5JRG C;  1S32 B;  2CWE A;  5B31 A;  4WU8 A;  1KX5 D;  3MVD B;  3AN2 D;  3AV2 A;  3X1U B;  3KXB C;  3MGQ A;  4R8P D;  1P3P D;  3WKJ C;  3NQJ A;  3VH5 T;  4LD9 C;  3AV1 C;  2G5I C;  4XZQ A;  5B32 G;  3AZL A;  4ZBJ C;  1P3K B;  4E44 A;  2ARO D;  3MGQ D;  2F8N K;  5AV6 C;  2NZD A;  2HUE C;  1ID3 B;  5BS7 A;  3MGS B;  4J8V B;  4G92 C;  3X1T B;  1HQ3 D;  4Z66 D;  3UTB D;  2Y2G A;  4H9R B;  2ARO A;  3REI A;  1U35 D;  3A6N C;  3H0R C;  4H9P A;  3V9R A;  3R45 A;  5BO0 B;  5B31 B;  4WU8 B;  4WU9 B;  2PYO C;  1KX4 B;  1TAF A;  5F99 B;  4AWL C;  3AV1 D;  1P3I B;  4DRB A;  5KDM A;  2YFV B;  1P3P C;  3FDD A;  3C1B A;  3X1V C;  1P3M D;  2NZD B;  2CV5 D;  4H9O A;  4NE3 A;  3AZF D;  5AVB B;  5CPK B;  3WAA B;  1HQ3 C;  3VH6 A;  3KSY A;  3LZ1 A;  3W98 B;  3EG5 B;  2HIO A;  4J8X B;  5CPI A;  2VQR A;  4WV4 B;  3KUY D;  5BO0 A;  4Z5T D;  3VH5 W;  4Z2M H;  3VH5 A;  3B6F D;  3AZF A;  1AOI B;  5AV9 B;  3AZE C;  3AFA C;  4H9N A;  2F8N B;  3W97 C;  5B1L D;  5BNV B;  5B0Y C;  2DF4 C;  2W8S A;  1P3F A;  4WU9 D;  3WAA A;  3LZ0 C;  1P3A D;  5B0Z B;  4XZQ C;  3AZL C;  3WAA C;  3WA9 A;  3W98 A;  4XUJ A;  1ZLA D;  3LJA B;  4Z66 A;  3MGP D;  1P3I D;  1P3O A;  4R8P A;  5CHL B;  1P3F D;  2DQN C;  3AZF B;  5B33 D;  5CPK D;  4CAY A;  2NZD D;  3LEL A;  3AFA D;  1P3L B;  1P3P B;  2PYO B;  3MGP A;  4G91 B;  1WWI A;  2XD1 A;  1R4V A;  3WTP A;  4KHA A;  1B6W A;  3B6F C;  3AZI A;  4Z5T B;  1ID3 C;  3KUY B;  3W98 D;  1P3B A;  3UT9 D;  5B0Y A;  1HQ3 A;  4G92 B;  3MGS C;  4YM6 C;  3W99 C;  2HUE B;  3LZ1 D;  4Z66 B;  3AZF C;  3A1I A;  1P3M C;  5B24 D;  3AZE A;  3REK C;  2JE5 A;  5B1M B;  3AV2 B;  3X1V D;  3REJ B;  3NQJ B;  3AV1 B;  5B33 C;  4XZQ B;  5B0Z C;  2YFW A;  2ZY3 A;  5B2I D;  2G5H C;  5DNM B;  1ULY A;  3MGP C;  3AZL B;  1M19 B;  1N1J B;  3AZJ B;  5GSU D;  5B0Y B;  5B2J C;  1U35 C;  4JJN C;  3REH D;  3X1T A;  1P3O C;  3TU4 A;  3W99 A;  4ZUX D;  5GT0 D;  3MGR C;  1TZY A;  4HGA B;  2JCH A;  5B1L C;  4XUJ C;  1PZR A;  1M1A D;  4LD9 D;  4X23 B;  3KFU G;  2RVQ C;  4R8P C;  3WKJ D;  2YFW B;  3W97 A;  5BNX A;  2FJ7 D;  4YS3 C;  5BS7 C;  1N1J A;  5CPJ D;  3X1S D;  3KUY C;  5B31 D;  3AZM C;  5CPI C;  3EPK A;  5AVC A;  2Y2H A;  2HIO B;  2NQB D;  4UUZ A;  2CV5 C;  1TZY B;  5F99 C;  2HIO C;  5DNM D;  3AZH A;  4QLC D;  3MVD A;  4WNN B;  4WU8 C;  4J8W D;  3B6G D;  1KX4 C;  1Q9C A;  5B32 B;  3NQU B;  5GT3 D;  3P5J B;  3AZG B;  2F8N A;  2PYO D;  1P3K A;  3A1K A;  3AZK D;  5B24 C;  1ID3 A;  3AYW D;  3LZ1 C;  4J8V C;  5G49 B;  5AV5 A;  4J8X D;  1KX3 D;  4XUJ B;  4YM6 D;  2ARO B;  4YS3 B;  3REI B;  4UUZ B;  3LJA A;  4KGC C;  1P3O B;  3W96 D;  4LD9 B;  3B0C W;  1TAF B;  4HGA C;  5F99 A;  5B40 D;  1F66 B;  5JA4 B;  4CAY B;  4UPK A;  5KDM B;  5B32 A;  3NQU A;  5B1L B;  3KXB D;  1P3P A;  3AN2 C;  5DNM C;  2XD5 A;  1KX5 A;  5F99 D;  3WTP B;  4J8W B;  3B6G B;  3UTA C;  3REH B;  3AZN C;  5AV5 B;  5G49 A;  3WTP E;  1BH8 A;  3REL B;  1P34 D;  4YS3 A;  3AZG D;  5AV6 A;  5GT3 B;  3LZ0 D;  5CPJ C;  3H0M C;  3MNN D;  3REK B;  2RVQ D;  1F66 A;  4J8U D;  5C3I C;  1P3K D;  3AYW B;  1M1A C;  1JFI B;  3AL0 C;  4X23 D;  1AOI D;  4H9Q B;  3REJ A;  1EQZ C;  2Y2I A;  3B6F B;  5DNN D;  5BNV A;  1M18 D;  4J8W A;  3B6G A;  3REI D;  1U35 A;  4Z5T C;  4M6B A;  3X1S B;  3WA9 B;  5AVC D;  2BYM A;  4WJ3 C;  2BYK A;  3KWQ C;  3UTA D;  3AZN B;  1M19 D;  1S32 C;  5B32 D;  1P3L A;  5AV8 D;  1S32 D;  2Y2M A;  3W96 C;  3LZ0 B;  3W97 B;  4KGC D;  1A7W A;  3X1U D;  5AVC C;  3O62 D;  3A6N D;  3MNN A;  1HTA A;  4J8V A;  3TU4 D;  4J8X C;  5GT0 B;  4ZUX B;  4J8V D;  1ID3 D;  2Y2P A;  3AZN A;  5GSU A;  2ZY5 A;  1M18 B;  2ARO C;  3AZE B;  5B1M D;  1EQZ A;  1KX4 A;  2JSS A;  4Z2M G;  5CP6 D;  5B40 B;  1F66 D;  4KUD A;  5CPK C;  3B0C T;  1P3I C;  5DNM A;  3AZH D;  2ZY2 A;  5CP6 A;  3AZJ A;  2L5A A;  3B0B A;  5AVB A;  1BH9 A;  3B0D B;  5B2J A;  1P34 C;  2J8P A;  2NQB B;  2Y2O A;  3AZN D;  3REL D;  3AZM D;  1P3M B;  5B31 C;  2Y2K A;  5JRG A;  3KWQ B;  4J8X A;  3X1S C;  5CPI B;  1S32 A;  1P3B D;  3W97 D;  5E5A D;  5JA4 A;  3C1C B;  1AOI A;  5DNN B;  1H3O A;  3UTB B;  3X1T C;  3MGS A;  1KX3 C;  3REL C;  5B0Z A;  2Y2L A;  4JJN D;  3REH C;  4DQY B;  2RIQ A;  3AZK A;  3MGR B;  3X1U C;  3KXB B;  5AY8 B;  4WU9 A;  3REK A;  4WNN A;  2F8N G;  5B0Z D;  4CSR B;  3C1C A;  5AV8 C;  3LEL B;  2YFV A;  5B33 B;  4J8W C;  3B6G C;  1WWS A;  5AV8 B;  3LEL C;  3MGP B;  1P3G D;  1M19 C;  1H3O B;  3KWQ D;  3UTB C;  1P3B B;  5CPI D;  1KU5 A;  3W99 D;  3TU4 C;  3MGR A;  2ZM5 A;  3KXB A;  3MGQ C;  3IP4 C;  4YM6 B;  4YS3 D;  2BYK B;  3AZM A;  1KX3 B;  1F1E A;  3REI C;  3UT9 B;  3EPJ A;  2FJ7 C;  5DNN C;  2F8N D;  1P3G C;  5B1M A;  1EQZ D;  1P3G A;  2FFF B;  5B33 A;  2NZD C;  5B24 B;  4H9N B;  3C1C C;  5AY8 D;  3MGR D;  3LZ0 A;  4G91 C;  3MNN C;  5JRG D;  4NFT A;  3REL A;  4WZS B;  4QLC B;  2Y2N A;  3LJA C;  5B2J D;  3AZJ D;  4JJN A;  1P34 B;  2CV5 B;  3AZM B;  1KX3 A;  5GSU B;  5B0Y D;  4R8P B;  3F6T A;  3C1C D;  3MVD D;  1Z2C B;  1P3G B;  3X1U A;  3MGQ B;  5B40 A;  2PYO A;  4KUD B; 
#chains in the Genus database with same CATH homology
 3AZI C;  1P3K C;  5B40 C;  2IO5 C;  4NE6 A;  3VH6 T;  5E5A C;  3KUY A;  3MGS D;  5AVC B;  2BYM B;  3W98 C;  4JJN B;  4H9R A;  2CV5 A;  1P34 A;  3WA9 D;  1M1A A;  5JRG B;  3KWQ A;  3REJ D;  3R45 B;  3AZH B;  5FUG A;  3LEL D;  5CPJ A;  3AV2 C;  5BT1 C;  5B2I B;  5DNN A;  3C1B B;  2UWX A;  4QLC C;  3AZG A;  5B1M C;  3REJ C;  3MNN B;  1ZLA C;  3WA9 C;  4Z66 C;  3WAA D;  3A6N B;  5GT0 A;  4ZUX A;  1P3A C;  4WU9 C;  3W99 B;  3AZK B;  5AV6 D;  3O62 C;  4NE5 A;  3AZK C;  5AY8 A;  5C3I B;  1EQZ B;  5FUG B;  4KUD D;  4LD9 A;  2FJ7 B;  4KGC A;  3VH6 W;  4X23 A;  3AFA A;  5AV9 D;  1P3L C;  5AV8 A;  5BNX B;  1KX5 C;  5E5A A;  1ZLA B;  3C1B C;  2HIO D;  1P3B C;  1P3A B;  2NQB C;  3REH A;  3WTP C;  2NQB A;  3W96 A;  3WTP D;  4DRA A;  3LJA D;  4H9P B;  3V9R B;  5GT3 A;  4YM6 A;  3C1B D;  5B2I C;  3AZH C;  5AV5 D;  1M18 C;  5AV9 C;  1P3L D;  3EPH A;  1BFM A;  2FJ7 A;  4KGC B;  5AY8 C;  1JFI A;  3AYW A;  1P3I A;  2F2A C;  3AN2 B;  2Y2Q A;  4J8U B;  3AFA B;  3X1V A;  1F66 C;  4EO5 B;  5CP6 C;  1AOI C;  4KUD C;  5B24 A;  3REK D;  4E45 A;  5E5A B;  4XUJ D;  1ZLA A;  3B6F A;  4H9S A;  3UTB A;  3AZI B;  5GT0 C;  4Z5T A;  4H9O B;  4ZUX C;  5CPK A;  1P3A A;  2IO5 B;  1P3O D;  1HQ3 B;  3W96 B;  3X1S A;  3LZ1 B;  4QLC A;  3AZG C;  5AVB C;  5GXQ B;  5GSU C;  3O62 A;  5BT1 D;  5B31 G;  4CSR A;  2Y2J A;  1TZY C;  3AV2 D;  4AWL B;  4J8U A;  3AN2 A;  5AV9 A;  3X1V B;  5B1L A;  1TZY D;  5B32 C;  3AV1 A;  1W2E A;  1T3U A;  1P3F C;  1KX5 B;  3WKJ A;  3B0D C;  1M19 A;  1B67 A;  1P3F B;  3UTA A;  4H9S C;  1BH8 B;  5AVB D;  5GXQ A;  5AV6 B;  5GXQ C;  3UT9 C;  3TU4 B;  3O62 B;  3AYW C;  3UT9 A;  3X1T D;  1M1A B;  2F8N H;  1M18 A;  2LY8 A;  3AZI D;  4ZBJ B;  3AZE D;  4H9Q A;  5GT3 C;  5CPJ B;  3MVD C;  1KX4 D;  4X23 C;  5B2I A;  4J8U C;  2BG1 A;  3WKJ B;  3H0L C;  4KHA B;  5AV5 C;  3EPL A;  4WU8 D;  1U35 B;  3AZJ C;  3UTA B;  4EO5 C;  5GXQ D;  2ZY4 A;  5CP6 B;  1BH9 B;  5B2J B;  3A6N A;  4XZQ D;  3AZL D;  1P3M A;  5JRG C;  1S32 B;  2CWE A;  5B31 A;  4WU8 A;  1KX5 D;  3MVD B;  3AN2 D;  3AV2 A;  3X1U B;  3KXB C;  3MGQ A;  4R8P D;  1P3P D;  3WKJ C;  3NQJ A;  3VH5 T;  4LD9 C;  3AV1 C;  2G5I C;  4XZQ A;  5B32 G;  3AZL A;  4ZBJ C;  1P3K B;  4E44 A;  2ARO D;  3MGQ D;  2F8N K;  5AV6 C;  2NZD A;  2HUE C;  1ID3 B;  5BS7 A;  3MGS B;  4J8V B;  4G92 C;  3X1T B;  1HQ3 D;  4Z66 D;  3UTB D;  2Y2G A;  4H9R B;  2ARO A;  3REI A;  1U35 D;  3A6N C;  3H0R C;  4H9P A;  3V9R A;  3R45 A;  5BO0 B;  5B31 B;  4WU8 B;  4WU9 B;  2PYO C;  1KX4 B;  1TAF A;  5F99 B;  4AWL C;  3AV1 D;  1P3I B;  4DRB A;  5KDM A;  2YFV B;  1P3P C;  3FDD A;  3C1B A;  3X1V C;  1P3M D;  2NZD B;  2CV5 D;  4H9O A;  4NE3 A;  3AZF D;  5AVB B;  5CPK B;  3WAA B;  1HQ3 C;  3VH6 A;  3KSY A;  3LZ1 A;  3W98 B;  3EG5 B;  2HIO A;  4J8X B;  5CPI A;  2VQR A;  4WV4 B;  3KUY D;  5BO0 A;  4Z5T D;  3VH5 W;  4Z2M H;  3VH5 A;  3B6F D;  3AZF A;  1AOI B;  5AV9 B;  3AZE C;  3AFA C;  4H9N A;  2F8N B;  3W97 C;  5B1L D;  5BNV B;  5B0Y C;  2DF4 C;  2W8S A;  1P3F A;  4WU9 D;  3WAA A;  3LZ0 C;  1P3A D;  5B0Z B;  4XZQ C;  3AZL C;  3WAA C;  3WA9 A;  3W98 A;  4XUJ A;  1ZLA D;  3LJA B;  4Z66 A;  3MGP D;  1P3I D;  1P3O A;  4R8P A;  5CHL B;  1P3F D;  2DQN C;  3AZF B;  5B33 D;  5CPK D;  4CAY A;  2NZD D;  3LEL A;  3AFA D;  1P3L B;  1P3P B;  2PYO B;  3MGP A;  4G91 B;  1WWI A;  2XD1 A;  1R4V A;  3WTP A;  4KHA A;  1B6W A;  3B6F C;  3AZI A;  4Z5T B;  1ID3 C;  3KUY B;  3W98 D;  1P3B A;  3UT9 D;  5B0Y A;  1HQ3 A;  4G92 B;  3MGS C;  4YM6 C;  3W99 C;  2HUE B;  3LZ1 D;  4Z66 B;  3AZF C;  3A1I A;  1P3M C;  5B24 D;  3AZE A;  3REK C;  2JE5 A;  5B1M B;  3AV2 B;  3X1V D;  3REJ B;  3NQJ B;  3AV1 B;  5B33 C;  4XZQ B;  5B0Z C;  2YFW A;  2ZY3 A;  5B2I D;  2G5H C;  5DNM B;  1ULY A;  3MGP C;  3AZL B;  1M19 B;  1N1J B;  3AZJ B;  5GSU D;  5B0Y B;  5B2J C;  1U35 C;  4JJN C;  3REH D;  3X1T A;  1P3O C;  3TU4 A;  3W99 A;  4ZUX D;  5GT0 D;  3MGR C;  1TZY A;  4HGA B;  2JCH A;  5B1L C;  4XUJ C;  1PZR A;  1M1A D;  4LD9 D;  4X23 B;  3KFU G;  2RVQ C;  4R8P C;  3WKJ D;  2YFW B;  3W97 A;  5BNX A;  2FJ7 D;  4YS3 C;  5BS7 C;  1N1J A;  5CPJ D;  3X1S D;  3KUY C;  5B31 D;  3AZM C;  5CPI C;  3EPK A;  5AVC A;  2Y2H A;  2HIO B;  2NQB D;  4UUZ A;  2CV5 C;  1TZY B;  5F99 C;  2HIO C;  5DNM D;  3AZH A;  4QLC D;  3MVD A;  4WNN B;  4WU8 C;  4J8W D;  3B6G D;  1KX4 C;  1Q9C A;  5B32 B;  3NQU B;  5GT3 D;  3P5J B;  3AZG B;  2F8N A;  2PYO D;  1P3K A;  3A1K A;  3AZK D;  5B24 C;  1ID3 A;  3AYW D;  3LZ1 C;  4J8V C;  5G49 B;  5AV5 A;  4J8X D;  1KX3 D;  4XUJ B;  4YM6 D;  2ARO B;  4YS3 B;  3REI B;  4UUZ B;  3LJA A;  4KGC C;  1P3O B;  3W96 D;  4LD9 B;  3B0C W;  1TAF B;  4HGA C;  5F99 A;  5B40 D;  1F66 B;  5JA4 B;  4CAY B;  4UPK A;  5KDM B;  5B32 A;  3NQU A;  5B1L B;  3KXB D;  1P3P A;  3AN2 C;  5DNM C;  2XD5 A;  1KX5 A;  5F99 D;  3WTP B;  4J8W B;  3B6G B;  3UTA C;  3REH B;  3AZN C;  5AV5 B;  5G49 A;  3WTP E;  1BH8 A;  3REL B;  1P34 D;  4YS3 A;  3AZG D;  5AV6 A;  5GT3 B;  3LZ0 D;  5CPJ C;  3H0M C;  3MNN D;  3REK B;  2RVQ D;  1F66 A;  4J8U D;  5C3I C;  1P3K D;  3AYW B;  1M1A C;  1JFI B;  3AL0 C;  4X23 D;  1AOI D;  4H9Q B;  3REJ A;  1EQZ C;  2Y2I A;  3B6F B;  5DNN D;  5BNV A;  1M18 D;  4J8W A;  3B6G A;  3REI D;  1U35 A;  4Z5T C;  4M6B A;  3X1S B;  3WA9 B;  5AVC D;  2BYM A;  4WJ3 C;  2BYK A;  3KWQ C;  3UTA D;  3AZN B;  1M19 D;  1S32 C;  5B32 D;  1P3L A;  5AV8 D;  1S32 D;  2Y2M A;  3W96 C;  3LZ0 B;  3W97 B;  4KGC D;  1A7W A;  3X1U D;  5AVC C;  3O62 D;  3A6N D;  3MNN A;  1HTA A;  4J8V A;  3TU4 D;  4J8X C;  5GT0 B;  4ZUX B;  4J8V D;  1ID3 D;  2Y2P A;  3AZN A;  5GSU A;  2ZY5 A;  1M18 B;  2ARO C;  3AZE B;  5B1M D;  1EQZ A;  1KX4 A;  2JSS A;  4Z2M G;  5CP6 D;  5B40 B;  1F66 D;  4KUD A;  5CPK C;  3B0C T;  1P3I C;  5DNM A;  3AZH D;  2ZY2 A;  5CP6 A;  3AZJ A;  2L5A A;  3B0B A;  5AVB A;  1BH9 A;  3B0D B;  5B2J A;  1P34 C;  2J8P A;  2NQB B;  2Y2O A;  3AZN D;  3REL D;  3AZM D;  1P3M B;  5B31 C;  2Y2K A;  5JRG A;  3KWQ B;  4J8X A;  3X1S C;  5CPI B;  1S32 A;  1P3B D;  3W97 D;  5E5A D;  5JA4 A;  3C1C B;  1AOI A;  5DNN B;  1H3O A;  3UTB B;  3X1T C;  3MGS A;  1KX3 C;  3REL C;  5B0Z A;  2Y2L A;  4JJN D;  3REH C;  4DQY B;  2RIQ A;  3AZK A;  3MGR B;  3X1U C;  3KXB B;  5AY8 B;  4WU9 A;  3REK A;  4WNN A;  2F8N G;  5B0Z D;  4CSR B;  3C1C A;  5AV8 C;  3LEL B;  2YFV A;  5B33 B;  4J8W C;  3B6G C;  1WWS A;  5AV8 B;  3LEL C;  3MGP B;  1P3G D;  1M19 C;  1H3O B;  3KWQ D;  3UTB C;  1P3B B;  5CPI D;  1KU5 A;  3W99 D;  3TU4 C;  3MGR A;  2ZM5 A;  3KXB A;  3MGQ C;  3IP4 C;  4YM6 B;  4YS3 D;  2BYK B;  3AZM A;  1KX3 B;  1F1E A;  3REI C;  3UT9 B;  3EPJ A;  2FJ7 C;  5DNN C;  2F8N D;  1P3G C;  5B1M A;  1EQZ D;  1P3G A;  2FFF B;  5B33 A;  2NZD C;  5B24 B;  4H9N B;  3C1C C;  5AY8 D;  3MGR D;  3LZ0 A;  4G91 C;  3MNN C;  5JRG D;  4NFT A;  3REL A;  4WZS B;  4QLC B;  2Y2N A;  3LJA C;  5B2J D;  3AZJ D;  4JJN A;  1P34 B;  2CV5 B;  3AZM B;  1KX3 A;  5GSU B;  5B0Y D;  4R8P B;  3F6T A;  3C1C D;  3MVD D;  1Z2C B;  1P3G B;  3X1U A;  3MGQ B;  5B40 A;  2PYO A;  4KUD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...