1R4VA

1.9a crystal structure of protein aq328 from aquifex aeolicus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
151
Chain Sequence
b'ETMLRPKGFDKLDHYFRTELDIDLTDETIELLLNSVKAAFGKLFYGAEQRARWNGRDFIALADLNITKALEEHIKNFQKIEQDMGVDELLEYIAFIPPVEMNVGEDLKSEYRNIMGGLLLMHADVIKKATGERKPSREAMEFVAQIVDKVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AQ_328
publication title The crystal structure of Aq_328 from the hyperthermophilic bacteria Aquifex aeolicus shows an ancestral histone fold.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 48
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2003-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09123 DUF1931 Domain of unknown function (DUF1931)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1r4vA00
4J8VD 3AFAA 2PYOD 3RELB 5B2IC 5AY8A 1M18A 5B33C 4WNNA 3WTPC 4J8UA 3AZLD 1F66C 4YM6B 3AZKD 3A6NC 3W96C 3TU4D 4R8PA 2YFVB 3NQJB 2HIOD 2NQBC 4J8VA 2BYKA 3R45A 1P3MD 1P3BA 5GXQC 2PYOA 3X1VB 3AZLA 5F99B 3AZFB 5AVBB 5AV5B 3AZKA 1A7WA 3TU4A 1TZYB 4YS3C 3AFAB 4KGCD 3REKD 2HIOA 1M18B 2F8NG 1P3MA 1P34D 4CSRA 3LZ0D 2FJ7C 5BS7C 4NE5A 5G49B 5B2JC 4JJND 4R8PB 3AZHD 3AZEC 4Z66D 4J8WA 4J8VB 1F1EA 2BYKB 2BYMA 3R45B 5B0ZC 1P3BB 1M19D 3REKA 4XUJD 3KWQC 2PYOB 4KGCA 1BFMA 3X1SD 3MVDA 1P34A 3LZ0A 3AZKB 4JJNA 1P3LC 2L5AA 4XZQD 1U35D 3AYWC 4Z66A 2HIOB 3X1TC 4Z5TD 3X1UC 1KX5C 2RVQD 5B1LC 5DNNB 4XUJA 4CSRB 3LELD 3C1CD 4G92C 3AV1C 1AOIC 4NFTA 3X1SA 3B6GD 3REHD 3MGSC 4HGAB 3O62D 4H9SA 1HTAA 2CV5D 3B0DB 4J8WB 4XZQA 2BYMB 4KGCB 1M1AD 3REKB 5B32D 4G91B 4Z5TA 5CPJC 4Z2MH 3W99D 1N1JA 2F8NK 3MVDB 3WAAC 1P34B 3LELA 3C1CA 3B6FD 1P3OD 3AV2C 5AVCC 4JJNB 3B6GA 3REHA 3AZJC 5B40C 3W97D 3C1BC 2CV5A 1WWIA 3LJAD 4Z66B 1P3FC 1M1AA 4CAYB 3UTBC 4XUJB 3UT9C 3AZGD 3AZMD 3UTAD 1R4VA 3B6FA 1P3OA 3LZ1C 3A6ND 3W96D 4XZQB 3RELD 5CP6B 3LJAA 3AZIC 4UUZA 4Z5TB 5GSUD 4YM6D 1N1JB 4J8XD 3LELB 3C1CB 4QLCD 3AZGA 3B6GB 3REHB 3AZMA 1B67A 3UTAA 5B31C 3V9RA 3WKJC 2CV5B 3AZNC 3A6NA 3W96A 1M1AB 3AN2C 3MGQC 5F99D 5GSUA 4YM6A 3MGPC 5AVBD 4J8XA 3VH5A 1Q9CA 1TZYD 4QLCA 1P3OB 4E44A 5B0YD 1JFIB 4WU8D 4LD9D 1WWSA 3LJAB 4UUZB 3MNNC 1P3KC 3KXBD 5F99A 3AZGB 4ZUXC 3AZMB 3UTAB 3V9RB 2IO5C 4NE3A 5B0YA 3A6NB 3W96B 5DNMC 4WU8A 1P3BD 4LD9A 2F8ND 5GSUB 1EQZC 4J8XB 3X1TD 5G49A 5B0ZA 3KXBA 4QLCB 3AV1D 3VH5W 3KUYD 1HQ3D 2HUEC 3MGSD 4AWLB 4X23C 5E5AC 1P3LA 5DNND 5B24D 5CPIC 4YS3B 3WA9D 2F8NA 5GT0C 5AV9D 1ZLAC 3X1TA 1S32C 4J8WD 1P3IC 3AV1A 5B0YB 2FJ7B 3KUYA 1HQ3A 4WU8B 3MGSA 4LD9B 3C1BD 3MVDD 1P3PC 5DNNA 5B24A 3WA9A 5BT1C 5B0ZB 5AV9A 3KXBB 5CPKC 3KSYA 1BH9A 1ID3D 2F8NH 5AVCA 5GT3C 5BO0A 1P3GD 1P3LB 1KU5A 2F8NB 3C1BA 3X1TB 1P3FA 3X1VC 5B1LB 2CWEA 3AZFC 1KX4C 3AV1B 1P3AD 3KUYB 1HQ3B 5CP6D 3MGSB 3MGRD 1ID3A 4WU9D 3AFAC 1P3GA 4CAYA 5B24B 5AY8C 1M18C 3WA9B 4J8UC 4E45A 5AV9B 1ULYA 3MGQD 3B0CW 3MGPD 4KUDD 4R8PC 1BH9B 2AROD 5AVCB 1P3AA 1KX3C 5BO0B 5B40B 5CP6A 3MGRA 3VH6W 3C1BB 4J8VC 4WU9A 3AZNA 3W98D 1P3FB 3AZLC 1BH8A 5JRGD 3MGQA 1P3KD 3AZKC 3MGPA 3TU4C 4KUDA 2AROA 1ID3B 5B31G 5B1MD 3LZ1B 1P3GB 2HIOC 5B2ID 1P3MC 5B33D 3W98A 1F66D 3WTPD 5BNXA 3MNNA 4HGAC 5AV8C 1JFIA 4ZBJC 5JRGA 4EO5B 1P3KA 1P3AB 1TAFA 5CHLB 3MGRB 1B6WA 4WU9B 5B1MA 3AZNB 3REKC 2NQBD 4G91C 5DNMA 5GXQD 5KDMA 5B2IA 5B33A 1P34C 1BH8B 3WTPA 3MGQB 3LZ0C 3AN2B 1F66A 4JJNC 3MGPB 4H9OA 4KUDB 3AZHC 2AROB 3REJC 4YS3D 3REIC 5C3IC 5AV6C 1M19C 2YFWA 4XUJC 2NQBA 3W98B 5E5AA 5GXQA 3X1SC 5BNXB 1P3PD 3MNNB 2FJ7D 5B2JD 3VH5T 4H9SC 5JRGB 1P3KB 4ZUXB 1TAFB 3AZED 1U35C 2IO5B 1S32A 5B1MB 4YS3A 5GT3D 5B0ZD 5DNMB 4Z5TC 5KDMB 2RVQC 3KWQD 5B2IB 5B33B 1F66B 3WTPB 3LELC 3C1CC 5JA4A 1P3PA 4H9OB 3REHC 4M6BA 2FJ7A 5BS7A 5B2JA 3O62C 1P3LD 2CV5C 3AYWD 2HUEB 3AZEA 1M1AC 2YFWB 3X1UD 1KX5D 5B1LD 5B32C 5E5AB 5GT3A 2NQBB 5GXQB 3KWQA 3W99C 2LY8A 1AOID 3B6FC 1P3OC 1H3OA 3W97C 1S32B 3LJAC 1P3IB 3AYWA 1KX3D 3WTPE 5CPJD 3X1UA 1KX5A 5B1LA 2NZDC 5JA4B 3AZGC 1P3PB 3WAAD 3AZMC 1AOIA 3AV2D 5AVCD 3UTAC 5B2JB 3AZJD 5B40D 5CPKB 3AZEB 3RELC 1P3FD 5GT3B 1KX3A 3UTBD 5GSUC 4YM6C 3KWQB 4J8XC 3UT9D 3B0CT 5CPJA 4QLCC 3WAAA 1H3OB 3AV2A 3VH6A 3LZ1D 3AZJA 5B40A 5AV8D 4AWLC 1KX4B 3VH6T 3AYWB 3AZID 3X1UB 1KX5B 5F99C 3UTBA 5AY8B 5AVBC 4G92B 4DRBA 5AV5C 3UT9A 4WNNB 4J8UB 1AOIB 1TZYC 3WKJD 5B31D 5B0YC 3AZND 4WU8C 3LZ1A 4LD9C 5AV8A 3REJD 4NE6A 4H9PA 3REID 1KX3B 3AZIA 3AN2D 5CPJB 5AV6D 3KXBC 3WAAB 3AV2B 3AZLB 3AZJB 3WKJA 5B31A 3TU4B 1P3BC 2PYOC 4H9QA 3AZHA 3REJA 4KHAA 3MNND 3REIA 3UTBB 3AN2A 3UT9B 4ZUXD 5AV6A 1P3MB 1M19A 3KUYC 1HQ3C 4Z2MG 5AV8B 3NQUA 4ZBJB 5DNMD 5BNVA 4H9PB 4DRAA 5DNNC 5B24C 3AZIB 3WA9C 2JSSA 1U35A 1EQZD 5AV9C 3B0DC 4ZUXA 4J8WC 3WKJB 5B31B 3LZ0B 4KGCC 4X23D 4H9QB 4WV4B 3AZHB 5E5AD 3O62A 4KHAB 3REJB 5CPID 3REIB 5C3IB 3MVDC 5GT0D 1EQZA 5AV6B 1ZLAD 1M19B 5B32A 2NZDD 1S32D 3X1SB 3W99A 4Z66C 1P3ID 3NQUB 5BNVB 1ID3C 1P3GC 4X23A 4H9NA 4H9RA 3W97A 1U35B 5CPIA 5FUGA 5BT1D 5GT0A 5CPKD 5B32G 1ZLAA 4XZQC 4EO5C 2NZDA 1P3AC 5CP6C 1P3IA 4WZSB 3MGRC 3O62B 4WU9C 3B6GC 3RELA 1EQZB 3X1VD 5B32B 3AZFD 5CPKA 1KX4D 3W99B 4KUDC 5AV5D 2AROC 3B6FB 4X23B 2YFVA 4H9NB 4H9RB 3AFAD 3W97B 3NQJA 5CPIB 5AY8D 1M18D 5FUGB 3W98C 4J8UD 5GT0B 3B0BA 1ZLAB 3X1VA 5JRGC 2NZDB 3AZFA 4R8PD 1KX4A 5AVBA 5AV5A 1TZYA 5B1MC
chains in the Genus database with same CATH superfamily
4J8VD 3AFAA 2PYOD 3RELB 5B2IC 5AY8A 1M18A 5B33C 4WNNA 3WTPC 4J8UA 3AZLD 1F66C 4YM6B 3AZKD 3A6NC 3W96C 3TU4D 4R8PA 2YFVB 3NQJB 2HIOD 2NQBC 4J8VA 2BYKA 3R45A 1P3MD 1P3BA 5GXQC 2PYOA 3X1VB 3AZLA 5F99B 3AZFB 2XD1A 5AVBB 5AV5B 3AZKA 2JE5A 1A7WA 3TU4A 1TZYB 4YS3C 3AFAB 4KGCD 3REKD 2HIOA 3EPLA 1M18B 2F8NG 1P3MA 1P34D 4CSRA 3LZ0D 2FJ7C 5BS7C 4NE5A 5G49B 5B2JC 4JJND 4R8PB 3AZHD 3AZEC 4Z66D 4J8WA 4J8VB 1F1EA 2BYKB 2BYMA 3R45B 5B0ZC 1P3BB 1M19D 3REKA 4XUJD 3KWQC 2PYOB 4KGCA 1BFMA 3X1SD 1W2EA 3MVDA 1P34A 3LZ0A 3AZKB 2DF4C 4JJNA 1P3LC 2L5AA 4XZQD 1U35D 3AYWC 4Z66A 2HIOB 3X1TC 4Z5TD 3X1UC 1KX5C 2RVQD 5B1LC 5DNNB 4XUJA 4CSRB 3LELD 3C1CD 4G92C 3AV1C 1AOIC 4NFTA 3X1SA 3B6GD 3REHD 2ZY4A 3MGSC 4HGAB 3O62D 4H9SA 1HTAA 2CV5D 3B0DB 4J8WB 4XZQA 2BYMB 4KGCB 1M1AD 3REKB 5B32D 4G91B 4Z5TA 5CPJC 4Z2MH 3W99D 1N1JA 2F8NK 3MVDB 2W8SA 3WAAC 1P34B 3LELA 3C1CA 3B6FD 1P3OD 2G5IC 5AVCC 4JJNB 3AV2C 3REHA 3B6GA 3AZJC 5B40C 3W97D 3C1BC 2CV5A 1WWIA 3LJAD 4Z66B 1P3FC 2Y2IA 1M1AA 4CAYB 3UTBC 4XUJB 3UT9C 3AZGD 3AZMD 3UTAD 1R4VA 3B6FA 1P3OA 3LZ1C 4WJ3C 3A6ND 3W96D 4XZQB 2ZY2A 3RELD 5CP6B 3LJAA 3AZIC 4UUZA 4Z5TB 5GSUD 4YM6D 1N1JB 4J8XD 3LELB 3C1CB 4QLCD 3AZGA 3B6GB 3REHB 3AZMA 1B67A 3UTAA 5B31C 3V9RA 3WKJC 2CV5B 3AZNC 3A6NA 3W96A 3EPHA 1M1AB 3AN2C 3MGQC 5F99D 5GSUA 4YM6A 3MGPC 5AVBD 4J8XA 3VH5A 1Q9CA 1TZYD 2Y2PA 4QLCA 1P3OB 4E44A 5B0YD 1JFIB 3A1KA 4WU8D 4LD9D 1WWSA 3LJAB 4UUZB 3MNNC 2ZY3A 3KXBD 1P3KC 5F99A 3AZGB 4ZUXC 3AZMB 3UTAB 3V9RB 2IO5C 4NE3A 5B0YA 3A6NB 3W96B 3IP4C 5DNMC 4WU8A 1P3BD 4LD9A 2F8ND 5GSUB 1EQZC 4J8XB 3EG5B 3X1TD 5G49A 5B0ZA 3KXBA 4QLCB 3AV1D 3VH5W 3KUYD 1HQ3D 2HUEC 3MGSD 4AWLB 4X23C 5E5AC 1P3LA 5DNND 5B24D 5CPIC 4YS3B 3WA9D 2F8NA 5GT0C 5AV9D 2ZM5A 2Y2QA 1ZLAC 3X1TA 2Y2NA 1S32C 4J8WD 1P3IC 3AV1A 5B0YB 2FJ7B 3KUYA 2FFFB 1HQ3A 4WU8B 3MGSA 4LD9B 3C1BD 3MVDD 1P3PC 5DNNA 5B24A 2BG1A 3WA9A 5BT1C 3H0RC 5B0ZB 5AV9A 3KXBB 5CPKC 3KSYA 1BH9A 1ID3D 2F8NH 5AVCA 5GT3C 5BO0A 1P3GD 1P3LB 1KU5A 2F8NB 3C1BA 1PZRA 3X1TB 1P3FA 3X1VC 5B1LB 2CWEA 3KFUG 3AZFC 1KX4C 3AV1B 1P3AD 3KUYB 1HQ3B 5CP6D 3MGSB 3MGRD 1ID3A 4WU9D 3AFAC 1P3GA 4CAYA 5B24B 2DQNC 5AY8C 1M18C 3WA9B 4J8UC 4E45A 5AV9B 1ULYA 3MGQD 3B0CW 3MGPD 4KUDD 4R8PC 1BH9B 2AROD 5AVCB 1P3AA 1KX3C 5BO0B 5B40B 5CP6A 3MGRA 3VH6W 3C1BB 4J8VC 4WU9A 3AZNA 3W98D 1P3FB 3AZLC 1BH8A 2Y2MA 5JRGD 3MGQA 3AZKC 1P3KD 3MGPA 2Y2OA 3TU4C 4KUDA 3F6TA 2AROA 1ID3B 5B31G 5B1MD 2Y2JA 3LZ1B 1P3GB 2HIOC 3H0MC 5B2ID 1P3MC 5B33D 2Y2KA 3W98A 1F66D 3WTPD 3P5JB 5BNXA 3MNNA 4HGAC 5AV8C 1JFIA 4ZBJC 5JRGA 4EO5B 1P3KA 1P3AB 1TAFA 5CHLB 3MGRB 3AL0C 1B6WA 4WU9B 5B1MA 3AZNB 3REKC 2NQBD 4G91C 5DNMA 5GXQD 5KDMA 2VQRA 5B2IA 5B33A 1P34C 1BH8B 3WTPA 3MGQB 3LZ0C 3AN2B 1F66A 4JJNC 3MGPB 4H9OA 4KUDB 3AZHC 2AROB 3REJC 4YS3D 3REIC 5C3IC 5AV6C 1M19C 2YFWA 4XUJC 2NQBA 3W98B 5E5AA 2Y2HA 5GXQA 3X1SC 5BNXB 1P3PD 3MNNB 2FJ7D 5B2JD 3VH5T 4H9SC 5JRGB 1P3KB 4ZUXB 1TAFB 2UWXA 3AZED 1U35C 2IO5B 1S32A 5B1MB 4YS3A 5GT3D 5B0ZD 5DNMB 4Z5TC 5KDMB 2RVQC 3KWQD 5B2IB 5B33B 1F66B 3WTPB 3LELC 3C1CC 5JA4A 1P3PA 4H9OB 3REHC 4M6BA 2Y2GA 3EPKA 2FJ7A 5BS7A 5B2JA 3O62C 1P3LD 2CV5C 3AYWD 2HUEB 3AZEA 1M1AC 2YFWB 3X1UD 1KX5D 5B1LD 5B32C 5E5AB 5GT3A 2NQBB 5GXQB 3KWQA 3W99C 2LY8A 1AOID 3B6FC 1P3OC 3EPJA 2J8PA 1H3OA 3H0LC 3W97C 1S32B 3LJAC 1P3IB 3AYWA 1KX3D 3WTPE 5CPJD 3X1UA 1KX5A 5B1LA 2NZDC 5JA4B 3AZGC 1P3PB 3WAAD 3AZMC 1AOIA 3AV2D 5AVCD 3UTAC 5B2JB 3AZJD 5B40D 5CPKB 4DQYB 3FDDA 3AZEB 3RELC 1P3FD 5GT3B 1KX3A 3UTBD 5GSUC 4YM6C 3KWQB 4J8XC 3UT9D 3B0CT 5CPJA 4QLCC 3WAAA 1H3OB 3AV2A 3VH6A 3LZ1D 3AZJA 5B40A 5AV8D 4AWLC 1KX4B 3VH6T 3AYWB 1Z2CB 3AZID 3X1UB 1KX5B 5F99C 2JCHA 3UTBA 5AY8B 5AVBC 4G92B 4DRBA 5AV5C 3UT9A 4WNNB 4J8UB 1AOIB 1TZYC 3WKJD 5B31D 5B0YC 2F2AC 3AZND 4WU8C 3LZ1A 4LD9C 5AV8A 3REJD 4NE6A 2G5HC 3A1IA 4H9PA 3REID 1KX3B 3AZIA 3AN2D 5CPJB 5AV6D 3KXBC 3WAAB 3AV2B 3AZLB 3AZJB 3WKJA 5B31A 3TU4B 1P3BC 2PYOC 4H9QA 3AZHA 3REJA 4KHAA 3MNND 3REIA 3UTBB 3AN2A 3UT9B 4ZUXD 5AV6A 1P3MB 1M19A 3KUYC 1HQ3C 4Z2MG 5AV8B 3NQUA 4ZBJB 5DNMD 5BNVA 2ZY5A 4H9PB 4DRAA 5DNNC 5B24C 3AZIB 3WA9C 2JSSA 1U35A 1EQZD 5AV9C 3B0DC 4ZUXA 4J8WC 3WKJB 5B31B 3LZ0B 4KGCC 4X23D 4H9QB 4WV4B 3AZHB 5E5AD 3O62A 4KHAB 3REJB 5CPID 3REIB 5C3IB 3MVDC 5GT0D 1EQZA 5AV6B 2RIQA 1T3UA 1M19B 1ZLAD 5B32A 2NZDD 1S32D 3X1SB 3W99A 4Z66C 1P3ID 3NQUB 5BNVB 1ID3C 1P3GC 4X23A 4H9NA 4H9RA 3W97A 1U35B 5CPIA 5FUGA 5BT1D 5GT0A 5CPKD 5B32G 2Y2LA 1ZLAA 4XZQC 4EO5C 2NZDA 1P3AC 5CP6C 1P3IA 4WZSB 3MGRC 3O62B 4WU9C 3B6GC 3RELA 1EQZB 3X1VD 5B32B 3AZFD 5CPKA 1KX4D 3W99B 4KUDC 5AV5D 2AROC 3B6FB 4X23B 2YFVA 4H9NB 4H9RB 3AFAD 3W97B 3NQJA 5CPIB 5AY8D 4UPKA 5FUGB 1M18D 3W98C 4J8UD 2XD5A 5GT0B 3B0BA 1ZLAB 3X1VA 5JRGC 2NZDB 3AZFA 4R8PD 1KX4A 5AVBA 5AV5A 1TZYA 5B1MC
chains in the Genus database with same CATH topology
4J8VD 3AFAA 2PYOD 3RELB 5B2IC 5AY8A 1M18A 5B33C 4WNNA 3WTPC 4J8UA 3AZLD 1F66C 4YM6B 3AZKD 3A6NC 3W96C 3TU4D 4R8PA 2YFVB 3NQJB 2HIOD 2NQBC 4J8VA 2BYKA 3R45A 1P3MD 1P3BA 5GXQC 2PYOA 3X1VB 3AZLA 5F99B 3AZFB 2XD1A 5AVBB 5AV5B 3AZKA 2JE5A 1A7WA 3TU4A 1TZYB 4YS3C 3AFAB 4KGCD 3REKD 2HIOA 3EPLA 1M18B 2F8NG 1P3MA 1P34D 4CSRA 3LZ0D 2FJ7C 5BS7C 4NE5A 5G49B 5B2JC 4JJND 4R8PB 3AZHD 3AZEC 4Z66D 4J8WA 4J8VB 1F1EA 2BYKB 2BYMA 3R45B 5B0ZC 1P3BB 1M19D 3REKA 4XUJD 3KWQC 2PYOB 4KGCA 1BFMA 3X1SD 1W2EA 3MVDA 1P34A 3LZ0A 3AZKB 2DF4C 4JJNA 1P3LC 2L5AA 4XZQD 1U35D 3AYWC 4Z66A 2HIOB 3X1TC 4Z5TD 3X1UC 1KX5C 2RVQD 5B1LC 5DNNB 4XUJA 4CSRB 3LELD 3C1CD 4G92C 3AV1C 1AOIC 4NFTA 3X1SA 3B6GD 3REHD 2ZY4A 3MGSC 4HGAB 3O62D 4H9SA 1HTAA 2CV5D 3B0DB 4J8WB 4XZQA 2BYMB 4KGCB 1M1AD 3REKB 5B32D 4G91B 4Z5TA 5CPJC 4Z2MH 3W99D 1N1JA 2F8NK 3MVDB 2W8SA 3WAAC 1P34B 3LELA 3C1CA 3B6FD 1P3OD 2G5IC 5AVCC 4JJNB 3AV2C 3REHA 3B6GA 3AZJC 5B40C 3W97D 3C1BC 2CV5A 1WWIA 3LJAD 4Z66B 1P3FC 2Y2IA 1M1AA 4CAYB 3UTBC 4XUJB 3UT9C 3AZGD 3AZMD 3UTAD 1R4VA 3B6FA 1P3OA 3LZ1C 4WJ3C 3A6ND 3W96D 4XZQB 2ZY2A 3RELD 5CP6B 3LJAA 3AZIC 4UUZA 4Z5TB 5GSUD 4YM6D 1N1JB 4J8XD 3LELB 3C1CB 4QLCD 3AZGA 3B6GB 3REHB 3AZMA 1B67A 3UTAA 5B31C 3V9RA 3WKJC 2CV5B 3AZNC 3A6NA 3W96A 3EPHA 1M1AB 3AN2C 3MGQC 5F99D 5GSUA 4YM6A 3MGPC 5AVBD 4J8XA 3VH5A 1Q9CA 1TZYD 2Y2PA 4QLCA 1P3OB 4E44A 5B0YD 1JFIB 3A1KA 4WU8D 4LD9D 1WWSA 3LJAB 4UUZB 3MNNC 2ZY3A 3KXBD 1P3KC 5F99A 3AZGB 4ZUXC 3AZMB 3UTAB 3V9RB 2IO5C 4NE3A 5B0YA 3A6NB 3W96B 3IP4C 5DNMC 4WU8A 1P3BD 4LD9A 2F8ND 5GSUB 1EQZC 4J8XB 3EG5B 3X1TD 5G49A 5B0ZA 3KXBA 4QLCB 3AV1D 3VH5W 3KUYD 1HQ3D 2HUEC 3MGSD 4AWLB 4X23C 5E5AC 1P3LA 5DNND 5B24D 5CPIC 4YS3B 3WA9D 2F8NA 5GT0C 5AV9D 2ZM5A 2Y2QA 1ZLAC 3X1TA 2Y2NA 1S32C 4J8WD 1P3IC 3AV1A 5B0YB 2FJ7B 3KUYA 2FFFB 1HQ3A 4WU8B 3MGSA 4LD9B 3C1BD 3MVDD 1P3PC 5DNNA 5B24A 2BG1A 3WA9A 5BT1C 3H0RC 5B0ZB 5AV9A 3KXBB 5CPKC 3KSYA 1BH9A 1ID3D 2F8NH 5AVCA 5GT3C 5BO0A 1P3GD 1P3LB 1KU5A 2F8NB 3C1BA 1PZRA 3X1TB 1P3FA 3X1VC 5B1LB 2CWEA 3KFUG 3AZFC 1KX4C 3AV1B 1P3AD 3KUYB 1HQ3B 5CP6D 3MGSB 3MGRD 1ID3A 4WU9D 3AFAC 1P3GA 4CAYA 5B24B 2DQNC 5AY8C 1M18C 3WA9B 4J8UC 4E45A 5AV9B 1ULYA 3MGQD 3B0CW 3MGPD 4KUDD 4R8PC 1BH9B 2AROD 5AVCB 1P3AA 1KX3C 5BO0B 5B40B 5CP6A 3MGRA 3VH6W 3C1BB 4J8VC 4WU9A 3AZNA 3W98D 1P3FB 3AZLC 1BH8A 2Y2MA 5JRGD 3MGQA 3AZKC 1P3KD 3MGPA 2Y2OA 3TU4C 4KUDA 3F6TA 2AROA 1ID3B 5B31G 5B1MD 2Y2JA 3LZ1B 1P3GB 2HIOC 3H0MC 5B2ID 1P3MC 5B33D 2Y2KA 3W98A 1F66D 3WTPD 3P5JB 5BNXA 3MNNA 4HGAC 5AV8C 1JFIA 4ZBJC 5JRGA 4EO5B 1P3KA 1P3AB 1TAFA 5CHLB 3MGRB 3AL0C 1B6WA 4WU9B 5B1MA 3AZNB 3REKC 2NQBD 4G91C 5DNMA 5GXQD 5KDMA 2VQRA 5B2IA 5B33A 1P34C 1BH8B 3WTPA 3MGQB 3LZ0C 3AN2B 1F66A 4JJNC 3MGPB 4H9OA 4KUDB 3AZHC 2AROB 3REJC 4YS3D 3REIC 5C3IC 5AV6C 1M19C 2YFWA 4XUJC 2NQBA 3W98B 5E5AA 2Y2HA 5GXQA 3X1SC 5BNXB 1P3PD 3MNNB 2FJ7D 5B2JD 3VH5T 4H9SC 5JRGB 1P3KB 4ZUXB 1TAFB 2UWXA 3AZED 1U35C 2IO5B 1S32A 5B1MB 4YS3A 5GT3D 5B0ZD 5DNMB 4Z5TC 5KDMB 2RVQC 3KWQD 5B2IB 5B33B 1F66B 3WTPB 3LELC 3C1CC 5JA4A 1P3PA 4H9OB 3REHC 4M6BA 2Y2GA 3EPKA 2FJ7A 5BS7A 5B2JA 3O62C 1P3LD 2CV5C 3AYWD 2HUEB 3AZEA 1M1AC 2YFWB 3X1UD 1KX5D 5B1LD 5B32C 5E5AB 5GT3A 2NQBB 5GXQB 3KWQA 3W99C 2LY8A 1AOID 3B6FC 1P3OC 3EPJA 2J8PA 1H3OA 3H0LC 3W97C 1S32B 3LJAC 1P3IB 3AYWA 1KX3D 3WTPE 5CPJD 3X1UA 1KX5A 5B1LA 2NZDC 5JA4B 3AZGC 1P3PB 3WAAD 3AZMC 1AOIA 3AV2D 5AVCD 3UTAC 5B2JB 3AZJD 5B40D 5CPKB 4DQYB 3FDDA 3AZEB 3RELC 1P3FD 5GT3B 1KX3A 3UTBD 5GSUC 4YM6C 3KWQB 4J8XC 3UT9D 3B0CT 5CPJA 4QLCC 3WAAA 1H3OB 3AV2A 3VH6A 3LZ1D 3AZJA 5B40A 5AV8D 4AWLC 1KX4B 3VH6T 3AYWB 1Z2CB 3AZID 3X1UB 1KX5B 5F99C 2JCHA 3UTBA 5AY8B 5AVBC 4G92B 4DRBA 5AV5C 3UT9A 4WNNB 4J8UB 1AOIB 1TZYC 3WKJD 5B31D 5B0YC 2F2AC 3AZND 4WU8C 3LZ1A 4LD9C 5AV8A 3REJD 4NE6A 2G5HC 3A1IA 4H9PA 3REID 1KX3B 3AZIA 3AN2D 5CPJB 5AV6D 3KXBC 3WAAB 3AV2B 3AZLB 3AZJB 3WKJA 5B31A 3TU4B 1P3BC 2PYOC 4H9QA 3AZHA 3REJA 4KHAA 3MNND 3REIA 3UTBB 3AN2A 3UT9B 4ZUXD 5AV6A 1P3MB 1M19A 3KUYC 1HQ3C 4Z2MG 5AV8B 3NQUA 4ZBJB 5DNMD 5BNVA 2ZY5A 4H9PB 4DRAA 5DNNC 5B24C 3AZIB 3WA9C 2JSSA 1U35A 1EQZD 5AV9C 3B0DC 4ZUXA 4J8WC 3WKJB 5B31B 3LZ0B 4KGCC 4X23D 4H9QB 4WV4B 3AZHB 5E5AD 3O62A 4KHAB 3REJB 5CPID 3REIB 5C3IB 3MVDC 5GT0D 1EQZA 5AV6B 2RIQA 1T3UA 1M19B 1ZLAD 5B32A 2NZDD 1S32D 3X1SB 3W99A 4Z66C 1P3ID 3NQUB 5BNVB 1ID3C 1P3GC 4X23A 4H9NA 4H9RA 3W97A 1U35B 5CPIA 5FUGA 5BT1D 5GT0A 5CPKD 5B32G 2Y2LA 1ZLAA 4XZQC 4EO5C 2NZDA 1P3AC 5CP6C 1P3IA 4WZSB 3MGRC 3O62B 4WU9C 3B6GC 3RELA 1EQZB 3X1VD 5B32B 3AZFD 5CPKA 1KX4D 3W99B 4KUDC 5AV5D 2AROC 3B6FB 4X23B 2YFVA 4H9NB 4H9RB 3AFAD 3W97B 3NQJA 5CPIB 5AY8D 4UPKA 5FUGB 1M18D 3W98C 4J8UD 2XD5A 5GT0B 3B0BA 1ZLAB 3X1VA 5JRGC 2NZDB 3AZFA 4R8PD 1KX4A 5AVBA 5AV5A 1TZYA 5B1MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8V D;  3AFA A;  2PYO D;  3REL B;  5B2I C;  5AY8 A;  1M18 A;  5B33 C;  4WNN A;  3WTP C;  4J8U A;  3AZL D;  1F66 C;  4YM6 B;  3AZK D;  3A6N C;  3W96 C;  3TU4 D;  4R8P A;  2YFV B;  3NQJ B;  2HIO D;  2NQB C;  4J8V A;  2BYK A;  3R45 A;  1P3M D;  1P3B A;  5GXQ C;  2PYO A;  3X1V B;  3AZL A;  5F99 B;  3AZF B;  5AVB B;  5AV5 B;  3AZK A;  1A7W A;  3TU4 A;  1TZY B;  4YS3 C;  3AFA B;  4KGC D;  3REK D;  2HIO A;  1M18 B;  2F8N G;  1P3M A;  1P34 D;  4CSR A;  3LZ0 D;  2FJ7 C;  5BS7 C;  4NE5 A;  5G49 B;  5B2J C;  4JJN D;  4R8P B;  3AZH D;  3AZE C;  4Z66 D;  4J8W A;  4J8V B;  1F1E A;  2BYK B;  2BYM A;  3R45 B;  5B0Z C;  1P3B B;  1M19 D;  3REK A;  4XUJ D;  3KWQ C;  2PYO B;  4KGC A;  1BFM A;  3X1S D;  3MVD A;  1P34 A;  3LZ0 A;  3AZK B;  4JJN A;  1P3L C;  2L5A A;  4XZQ D;  1U35 D;  3AYW C;  4Z66 A;  2HIO B;  3X1T C;  4Z5T D;  3X1U C;  1KX5 C;  2RVQ D;  5B1L C;  5DNN B;  4XUJ A;  4CSR B;  3LEL D;  3C1C D;  4G92 C;  3AV1 C;  1AOI C;  4NFT A;  3X1S A;  3B6G D;  3REH D;  3MGS C;  4HGA B;  3O62 D;  4H9S A;  1HTA A;  2CV5 D;  3B0D B;  4J8W B;  4XZQ A;  2BYM B;  4KGC B;  1M1A D;  3REK B;  5B32 D;  4G91 B;  4Z5T A;  5CPJ C;  4Z2M H;  3W99 D;  1N1J A;  2F8N K;  3MVD B;  3WAA C;  1P34 B;  3LEL A;  3C1C A;  3B6F D;  1P3O D;  3AV2 C;  5AVC C;  4JJN B;  3B6G A;  3REH A;  3AZJ C;  5B40 C;  3W97 D;  3C1B C;  2CV5 A;  1WWI A;  3LJA D;  4Z66 B;  1P3F C;  1M1A A;  4CAY B;  3UTB C;  4XUJ B;  3UT9 C;  3AZG D;  3AZM D;  3UTA D;  1R4V A;  3B6F A;  1P3O A;  3LZ1 C;  3A6N D;  3W96 D;  4XZQ B;  3REL D;  5CP6 B;  3LJA A;  3AZI C;  4UUZ A;  4Z5T B;  5GSU D;  4YM6 D;  1N1J B;  4J8X D;  3LEL B;  3C1C B;  4QLC D;  3AZG A;  3B6G B;  3REH B;  3AZM A;  1B67 A;  3UTA A;  5B31 C;  3V9R A;  3WKJ C;  2CV5 B;  3AZN C;  3A6N A;  3W96 A;  1M1A B;  3AN2 C;  3MGQ C;  5F99 D;  5GSU A;  4YM6 A;  3MGP C;  5AVB D;  4J8X A;  3VH5 A;  1Q9C A;  1TZY D;  4QLC A;  1P3O B;  4E44 A;  5B0Y D;  1JFI B;  4WU8 D;  4LD9 D;  1WWS A;  3LJA B;  4UUZ B;  3MNN C;  1P3K C;  3KXB D;  5F99 A;  3AZG B;  4ZUX C;  3AZM B;  3UTA B;  3V9R B;  2IO5 C;  4NE3 A;  5B0Y A;  3A6N B;  3W96 B;  5DNM C;  4WU8 A;  1P3B D;  4LD9 A;  2F8N D;  5GSU B;  1EQZ C;  4J8X B;  3X1T D;  5G49 A;  5B0Z A;  3KXB A;  4QLC B;  3AV1 D;  3VH5 W;  3KUY D;  1HQ3 D;  2HUE C;  3MGS D;  4AWL B;  4X23 C;  5E5A C;  1P3L A;  5DNN D;  5B24 D;  5CPI C;  4YS3 B;  3WA9 D;  2F8N A;  5GT0 C;  5AV9 D;  1ZLA C;  3X1T A;  1S32 C;  4J8W D;  1P3I C;  3AV1 A;  5B0Y B;  2FJ7 B;  3KUY A;  1HQ3 A;  4WU8 B;  3MGS A;  4LD9 B;  3C1B D;  3MVD D;  1P3P C;  5DNN A;  5B24 A;  3WA9 A;  5BT1 C;  5B0Z B;  5AV9 A;  3KXB B;  5CPK C;  3KSY A;  1BH9 A;  1ID3 D;  2F8N H;  5AVC A;  5GT3 C;  5BO0 A;  1P3G D;  1P3L B;  1KU5 A;  2F8N B;  3C1B A;  3X1T B;  1P3F A;  3X1V C;  5B1L B;  2CWE A;  3AZF C;  1KX4 C;  3AV1 B;  1P3A D;  3KUY B;  1HQ3 B;  5CP6 D;  3MGS B;  3MGR D;  1ID3 A;  4WU9 D;  3AFA C;  1P3G A;  4CAY A;  5B24 B;  5AY8 C;  1M18 C;  3WA9 B;  4J8U C;  4E45 A;  5AV9 B;  1ULY A;  3MGQ D;  3B0C W;  3MGP D;  4KUD D;  4R8P C;  1BH9 B;  2ARO D;  5AVC B;  1P3A A;  1KX3 C;  5BO0 B;  5B40 B;  5CP6 A;  3MGR A;  3VH6 W;  3C1B B;  4J8V C;  4WU9 A;  3AZN A;  3W98 D;  1P3F B;  3AZL C;  1BH8 A;  5JRG D;  3MGQ A;  1P3K D;  3AZK C;  3MGP A;  3TU4 C;  4KUD A;  2ARO A;  1ID3 B;  5B31 G;  5B1M D;  3LZ1 B;  1P3G B;  2HIO C;  5B2I D;  1P3M C;  5B33 D;  3W98 A;  1F66 D;  3WTP D;  5BNX A;  3MNN A;  4HGA C;  5AV8 C;  1JFI A;  4ZBJ C;  5JRG A;  4EO5 B;  1P3K A;  1P3A B;  1TAF A;  5CHL B;  3MGR B;  1B6W A;  4WU9 B;  5B1M A;  3AZN B;  3REK C;  2NQB D;  4G91 C;  5DNM A;  5GXQ D;  5KDM A;  5B2I A;  5B33 A;  1P34 C;  1BH8 B;  3WTP A;  3MGQ B;  3LZ0 C;  3AN2 B;  1F66 A;  4JJN C;  3MGP B;  4H9O A;  4KUD B;  3AZH C;  2ARO B;  3REJ C;  4YS3 D;  3REI C;  5C3I C;  5AV6 C;  1M19 C;  2YFW A;  4XUJ C;  2NQB A;  3W98 B;  5E5A A;  5GXQ A;  3X1S C;  5BNX B;  1P3P D;  3MNN B;  2FJ7 D;  5B2J D;  3VH5 T;  4H9S C;  5JRG B;  1P3K B;  4ZUX B;  1TAF B;  3AZE D;  1U35 C;  2IO5 B;  1S32 A;  5B1M B;  4YS3 A;  5GT3 D;  5B0Z D;  5DNM B;  4Z5T C;  5KDM B;  2RVQ C;  3KWQ D;  5B2I B;  5B33 B;  1F66 B;  3WTP B;  3LEL C;  3C1C C;  5JA4 A;  1P3P A;  4H9O B;  3REH C;  4M6B A;  2FJ7 A;  5BS7 A;  5B2J A;  3O62 C;  1P3L D;  2CV5 C;  3AYW D;  2HUE B;  3AZE A;  1M1A C;  2YFW B;  3X1U D;  1KX5 D;  5B1L D;  5B32 C;  5E5A B;  5GT3 A;  2NQB B;  5GXQ B;  3KWQ A;  3W99 C;  2LY8 A;  1AOI D;  3B6F C;  1P3O C;  1H3O A;  3W97 C;  1S32 B;  3LJA C;  1P3I B;  3AYW A;  1KX3 D;  3WTP E;  5CPJ D;  3X1U A;  1KX5 A;  5B1L A;  2NZD C;  5JA4 B;  3AZG C;  1P3P B;  3WAA D;  3AZM C;  1AOI A;  3AV2 D;  5AVC D;  3UTA C;  5B2J B;  3AZJ D;  5B40 D;  5CPK B;  3AZE B;  3REL C;  1P3F D;  5GT3 B;  1KX3 A;  3UTB D;  5GSU C;  4YM6 C;  3KWQ B;  4J8X C;  3UT9 D;  3B0C T;  5CPJ A;  4QLC C;  3WAA A;  1H3O B;  3AV2 A;  3VH6 A;  3LZ1 D;  3AZJ A;  5B40 A;  5AV8 D;  4AWL C;  1KX4 B;  3VH6 T;  3AYW B;  3AZI D;  3X1U B;  1KX5 B;  5F99 C;  3UTB A;  5AY8 B;  5AVB C;  4G92 B;  4DRB A;  5AV5 C;  3UT9 A;  4WNN B;  4J8U B;  1AOI B;  1TZY C;  3WKJ D;  5B31 D;  5B0Y C;  3AZN D;  4WU8 C;  3LZ1 A;  4LD9 C;  5AV8 A;  3REJ D;  4NE6 A;  4H9P A;  3REI D;  1KX3 B;  3AZI A;  3AN2 D;  5CPJ B;  5AV6 D;  3KXB C;  3WAA B;  3AV2 B;  3AZL B;  3AZJ B;  3WKJ A;  5B31 A;  3TU4 B;  1P3B C;  2PYO C;  4H9Q A;  3AZH A;  3REJ A;  4KHA A;  3MNN D;  3REI A;  3UTB B;  3AN2 A;  3UT9 B;  4ZUX D;  5AV6 A;  1P3M B;  1M19 A;  3KUY C;  1HQ3 C;  4Z2M G;  5AV8 B;  3NQU A;  4ZBJ B;  5DNM D;  5BNV A;  4H9P B;  4DRA A;  5DNN C;  5B24 C;  3AZI B;  3WA9 C;  2JSS A;  1U35 A;  1EQZ D;  5AV9 C;  3B0D C;  4ZUX A;  4J8W C;  3WKJ B;  5B31 B;  3LZ0 B;  4KGC C;  4X23 D;  4H9Q B;  4WV4 B;  3AZH B;  5E5A D;  3O62 A;  4KHA B;  3REJ B;  5CPI D;  3REI B;  5C3I B;  3MVD C;  5GT0 D;  1EQZ A;  5AV6 B;  1ZLA D;  1M19 B;  5B32 A;  2NZD D;  1S32 D;  3X1S B;  3W99 A;  4Z66 C;  1P3I D;  3NQU B;  5BNV B;  1ID3 C;  1P3G C;  4X23 A;  4H9N A;  4H9R A;  3W97 A;  1U35 B;  5CPI A;  5FUG A;  5BT1 D;  5GT0 A;  5CPK D;  5B32 G;  1ZLA A;  4XZQ C;  4EO5 C;  2NZD A;  1P3A C;  5CP6 C;  1P3I A;  4WZS B;  3MGR C;  3O62 B;  4WU9 C;  3B6G C;  3REL A;  1EQZ B;  3X1V D;  5B32 B;  3AZF D;  5CPK A;  1KX4 D;  3W99 B;  4KUD C;  5AV5 D;  2ARO C;  3B6F B;  4X23 B;  2YFV A;  4H9N B;  4H9R B;  3AFA D;  3W97 B;  3NQJ A;  5CPI B;  5AY8 D;  1M18 D;  5FUG B;  3W98 C;  4J8U D;  5GT0 B;  3B0B A;  1ZLA B;  3X1V A;  5JRG C;  2NZD B;  3AZF A;  4R8P D;  1KX4 A;  5AVB A;  5AV5 A;  1TZY A;  5B1M C; 
#chains in the Genus database with same CATH topology
 4J8V D;  3AFA A;  2PYO D;  3REL B;  5B2I C;  5AY8 A;  1M18 A;  5B33 C;  4WNN A;  3WTP C;  4J8U A;  3AZL D;  1F66 C;  4YM6 B;  3AZK D;  3A6N C;  3W96 C;  3TU4 D;  4R8P A;  2YFV B;  3NQJ B;  2HIO D;  2NQB C;  4J8V A;  2BYK A;  3R45 A;  1P3M D;  1P3B A;  5GXQ C;  2PYO A;  3X1V B;  3AZL A;  5F99 B;  3AZF B;  2XD1 A;  5AVB B;  5AV5 B;  3AZK A;  2JE5 A;  1A7W A;  3TU4 A;  1TZY B;  4YS3 C;  3AFA B;  4KGC D;  3REK D;  2HIO A;  3EPL A;  1M18 B;  2F8N G;  1P3M A;  1P34 D;  4CSR A;  3LZ0 D;  2FJ7 C;  5BS7 C;  4NE5 A;  5G49 B;  5B2J C;  4JJN D;  4R8P B;  3AZH D;  3AZE C;  4Z66 D;  4J8W A;  4J8V B;  1F1E A;  2BYK B;  2BYM A;  3R45 B;  5B0Z C;  1P3B B;  1M19 D;  3REK A;  4XUJ D;  3KWQ C;  2PYO B;  4KGC A;  1BFM A;  3X1S D;  1W2E A;  3MVD A;  1P34 A;  3LZ0 A;  3AZK B;  2DF4 C;  4JJN A;  1P3L C;  2L5A A;  4XZQ D;  1U35 D;  3AYW C;  4Z66 A;  2HIO B;  3X1T C;  4Z5T D;  3X1U C;  1KX5 C;  2RVQ D;  5B1L C;  5DNN B;  4XUJ A;  4CSR B;  3LEL D;  3C1C D;  4G92 C;  3AV1 C;  1AOI C;  4NFT A;  3X1S A;  3B6G D;  3REH D;  2ZY4 A;  3MGS C;  4HGA B;  3O62 D;  4H9S A;  1HTA A;  2CV5 D;  3B0D B;  4J8W B;  4XZQ A;  2BYM B;  4KGC B;  1M1A D;  3REK B;  5B32 D;  4G91 B;  4Z5T A;  5CPJ C;  4Z2M H;  3W99 D;  1N1J A;  2F8N K;  3MVD B;  2W8S A;  3WAA C;  1P34 B;  3LEL A;  3C1C A;  3B6F D;  1P3O D;  2G5I C;  5AVC C;  4JJN B;  3AV2 C;  3REH A;  3B6G A;  3AZJ C;  5B40 C;  3W97 D;  3C1B C;  2CV5 A;  1WWI A;  3LJA D;  4Z66 B;  1P3F C;  2Y2I A;  1M1A A;  4CAY B;  3UTB C;  4XUJ B;  3UT9 C;  3AZG D;  3AZM D;  3UTA D;  1R4V A;  3B6F A;  1P3O A;  3LZ1 C;  4WJ3 C;  3A6N D;  3W96 D;  4XZQ B;  2ZY2 A;  3REL D;  5CP6 B;  3LJA A;  3AZI C;  4UUZ A;  4Z5T B;  5GSU D;  4YM6 D;  1N1J B;  4J8X D;  3LEL B;  3C1C B;  4QLC D;  3AZG A;  3B6G B;  3REH B;  3AZM A;  1B67 A;  3UTA A;  5B31 C;  3V9R A;  3WKJ C;  2CV5 B;  3AZN C;  3A6N A;  3W96 A;  3EPH A;  1M1A B;  3AN2 C;  3MGQ C;  5F99 D;  5GSU A;  4YM6 A;  3MGP C;  5AVB D;  4J8X A;  3VH5 A;  1Q9C A;  1TZY D;  2Y2P A;  4QLC A;  1P3O B;  4E44 A;  5B0Y D;  1JFI B;  3A1K A;  4WU8 D;  4LD9 D;  1WWS A;  3LJA B;  4UUZ B;  3MNN C;  2ZY3 A;  3KXB D;  1P3K C;  5F99 A;  3AZG B;  4ZUX C;  3AZM B;  3UTA B;  3V9R B;  2IO5 C;  4NE3 A;  5B0Y A;  3A6N B;  3W96 B;  3IP4 C;  5DNM C;  4WU8 A;  1P3B D;  4LD9 A;  2F8N D;  5GSU B;  1EQZ C;  4J8X B;  3EG5 B;  3X1T D;  5G49 A;  5B0Z A;  3KXB A;  4QLC B;  3AV1 D;  3VH5 W;  3KUY D;  1HQ3 D;  2HUE C;  3MGS D;  4AWL B;  4X23 C;  5E5A C;  1P3L A;  5DNN D;  5B24 D;  5CPI C;  4YS3 B;  3WA9 D;  2F8N A;  5GT0 C;  5AV9 D;  2ZM5 A;  2Y2Q A;  1ZLA C;  3X1T A;  2Y2N A;  1S32 C;  4J8W D;  1P3I C;  3AV1 A;  5B0Y B;  2FJ7 B;  3KUY A;  2FFF B;  1HQ3 A;  4WU8 B;  3MGS A;  4LD9 B;  3C1B D;  3MVD D;  1P3P C;  5DNN A;  5B24 A;  2BG1 A;  3WA9 A;  5BT1 C;  3H0R C;  5B0Z B;  5AV9 A;  3KXB B;  5CPK C;  3KSY A;  1BH9 A;  1ID3 D;  2F8N H;  5AVC A;  5GT3 C;  5BO0 A;  1P3G D;  1P3L B;  1KU5 A;  2F8N B;  3C1B A;  1PZR A;  3X1T B;  1P3F A;  3X1V C;  5B1L B;  2CWE A;  3KFU G;  3AZF C;  1KX4 C;  3AV1 B;  1P3A D;  3KUY B;  1HQ3 B;  5CP6 D;  3MGS B;  3MGR D;  1ID3 A;  4WU9 D;  3AFA C;  1P3G A;  4CAY A;  5B24 B;  2DQN C;  5AY8 C;  1M18 C;  3WA9 B;  4J8U C;  4E45 A;  5AV9 B;  1ULY A;  3MGQ D;  3B0C W;  3MGP D;  4KUD D;  4R8P C;  1BH9 B;  2ARO D;  5AVC B;  1P3A A;  1KX3 C;  5BO0 B;  5B40 B;  5CP6 A;  3MGR A;  3VH6 W;  3C1B B;  4J8V C;  4WU9 A;  3AZN A;  3W98 D;  1P3F B;  3AZL C;  1BH8 A;  2Y2M A;  5JRG D;  3MGQ A;  3AZK C;  1P3K D;  3MGP A;  2Y2O A;  3TU4 C;  4KUD A;  3F6T A;  2ARO A;  1ID3 B;  5B31 G;  5B1M D;  2Y2J A;  3LZ1 B;  1P3G B;  2HIO C;  3H0M C;  5B2I D;  1P3M C;  5B33 D;  2Y2K A;  3W98 A;  1F66 D;  3WTP D;  3P5J B;  5BNX A;  3MNN A;  4HGA C;  5AV8 C;  1JFI A;  4ZBJ C;  5JRG A;  4EO5 B;  1P3K A;  1P3A B;  1TAF A;  5CHL B;  3MGR B;  3AL0 C;  1B6W A;  4WU9 B;  5B1M A;  3AZN B;  3REK C;  2NQB D;  4G91 C;  5DNM A;  5GXQ D;  5KDM A;  2VQR A;  5B2I A;  5B33 A;  1P34 C;  1BH8 B;  3WTP A;  3MGQ B;  3LZ0 C;  3AN2 B;  1F66 A;  4JJN C;  3MGP B;  4H9O A;  4KUD B;  3AZH C;  2ARO B;  3REJ C;  4YS3 D;  3REI C;  5C3I C;  5AV6 C;  1M19 C;  2YFW A;  4XUJ C;  2NQB A;  3W98 B;  5E5A A;  2Y2H A;  5GXQ A;  3X1S C;  5BNX B;  1P3P D;  3MNN B;  2FJ7 D;  5B2J D;  3VH5 T;  4H9S C;  5JRG B;  1P3K B;  4ZUX B;  1TAF B;  2UWX A;  3AZE D;  1U35 C;  2IO5 B;  1S32 A;  5B1M B;  4YS3 A;  5GT3 D;  5B0Z D;  5DNM B;  4Z5T C;  5KDM B;  2RVQ C;  3KWQ D;  5B2I B;  5B33 B;  1F66 B;  3WTP B;  3LEL C;  3C1C C;  5JA4 A;  1P3P A;  4H9O B;  3REH C;  4M6B A;  2Y2G A;  3EPK A;  2FJ7 A;  5BS7 A;  5B2J A;  3O62 C;  1P3L D;  2CV5 C;  3AYW D;  2HUE B;  3AZE A;  1M1A C;  2YFW B;  3X1U D;  1KX5 D;  5B1L D;  5B32 C;  5E5A B;  5GT3 A;  2NQB B;  5GXQ B;  3KWQ A;  3W99 C;  2LY8 A;  1AOI D;  3B6F C;  1P3O C;  3EPJ A;  2J8P A;  1H3O A;  3H0L C;  3W97 C;  1S32 B;  3LJA C;  1P3I B;  3AYW A;  1KX3 D;  3WTP E;  5CPJ D;  3X1U A;  1KX5 A;  5B1L A;  2NZD C;  5JA4 B;  3AZG C;  1P3P B;  3WAA D;  3AZM C;  1AOI A;  3AV2 D;  5AVC D;  3UTA C;  5B2J B;  3AZJ D;  5B40 D;  5CPK B;  4DQY B;  3FDD A;  3AZE B;  3REL C;  1P3F D;  5GT3 B;  1KX3 A;  3UTB D;  5GSU C;  4YM6 C;  3KWQ B;  4J8X C;  3UT9 D;  3B0C T;  5CPJ A;  4QLC C;  3WAA A;  1H3O B;  3AV2 A;  3VH6 A;  3LZ1 D;  3AZJ A;  5B40 A;  5AV8 D;  4AWL C;  1KX4 B;  3VH6 T;  3AYW B;  1Z2C B;  3AZI D;  3X1U B;  1KX5 B;  5F99 C;  2JCH A;  3UTB A;  5AY8 B;  5AVB C;  4G92 B;  4DRB A;  5AV5 C;  3UT9 A;  4WNN B;  4J8U B;  1AOI B;  1TZY C;  3WKJ D;  5B31 D;  5B0Y C;  2F2A C;  3AZN D;  4WU8 C;  3LZ1 A;  4LD9 C;  5AV8 A;  3REJ D;  4NE6 A;  2G5H C;  3A1I A;  4H9P A;  3REI D;  1KX3 B;  3AZI A;  3AN2 D;  5CPJ B;  5AV6 D;  3KXB C;  3WAA B;  3AV2 B;  3AZL B;  3AZJ B;  3WKJ A;  5B31 A;  3TU4 B;  1P3B C;  2PYO C;  4H9Q A;  3AZH A;  3REJ A;  4KHA A;  3MNN D;  3REI A;  3UTB B;  3AN2 A;  3UT9 B;  4ZUX D;  5AV6 A;  1P3M B;  1M19 A;  3KUY C;  1HQ3 C;  4Z2M G;  5AV8 B;  3NQU A;  4ZBJ B;  5DNM D;  5BNV A;  2ZY5 A;  4H9P B;  4DRA A;  5DNN C;  5B24 C;  3AZI B;  3WA9 C;  2JSS A;  1U35 A;  1EQZ D;  5AV9 C;  3B0D C;  4ZUX A;  4J8W C;  3WKJ B;  5B31 B;  3LZ0 B;  4KGC C;  4X23 D;  4H9Q B;  4WV4 B;  3AZH B;  5E5A D;  3O62 A;  4KHA B;  3REJ B;  5CPI D;  3REI B;  5C3I B;  3MVD C;  5GT0 D;  1EQZ A;  5AV6 B;  2RIQ A;  1T3U A;  1M19 B;  1ZLA D;  5B32 A;  2NZD D;  1S32 D;  3X1S B;  3W99 A;  4Z66 C;  1P3I D;  3NQU B;  5BNV B;  1ID3 C;  1P3G C;  4X23 A;  4H9N A;  4H9R A;  3W97 A;  1U35 B;  5CPI A;  5FUG A;  5BT1 D;  5GT0 A;  5CPK D;  5B32 G;  2Y2L A;  1ZLA A;  4XZQ C;  4EO5 C;  2NZD A;  1P3A C;  5CP6 C;  1P3I A;  4WZS B;  3MGR C;  3O62 B;  4WU9 C;  3B6G C;  3REL A;  1EQZ B;  3X1V D;  5B32 B;  3AZF D;  5CPK A;  1KX4 D;  3W99 B;  4KUD C;  5AV5 D;  2ARO C;  3B6F B;  4X23 B;  2YFV A;  4H9N B;  4H9R B;  3AFA D;  3W97 B;  3NQJ A;  5CPI B;  5AY8 D;  4UPK A;  5FUG B;  1M18 D;  3W98 C;  4J8U D;  2XD5 A;  5GT0 B;  3B0B A;  1ZLA B;  3X1V A;  5JRG C;  2NZD B;  3AZF A;  4R8P D;  1KX4 A;  5AVB A;  5AV5 A;  1TZY A;  5B1M C; 
#chains in the Genus database with same CATH homology
 4J8V D;  3AFA A;  2PYO D;  3REL B;  5B2I C;  5AY8 A;  1M18 A;  5B33 C;  4WNN A;  3WTP C;  4J8U A;  3AZL D;  1F66 C;  4YM6 B;  3AZK D;  3A6N C;  3W96 C;  3TU4 D;  4R8P A;  2YFV B;  3NQJ B;  2HIO D;  2NQB C;  4J8V A;  2BYK A;  3R45 A;  1P3M D;  1P3B A;  5GXQ C;  2PYO A;  3X1V B;  3AZL A;  5F99 B;  3AZF B;  2XD1 A;  5AVB B;  5AV5 B;  3AZK A;  2JE5 A;  1A7W A;  3TU4 A;  1TZY B;  4YS3 C;  3AFA B;  4KGC D;  3REK D;  2HIO A;  3EPL A;  1M18 B;  2F8N G;  1P3M A;  1P34 D;  4CSR A;  3LZ0 D;  2FJ7 C;  5BS7 C;  4NE5 A;  5G49 B;  5B2J C;  4JJN D;  4R8P B;  3AZH D;  3AZE C;  4Z66 D;  4J8W A;  4J8V B;  1F1E A;  2BYK B;  2BYM A;  3R45 B;  5B0Z C;  1P3B B;  1M19 D;  3REK A;  4XUJ D;  3KWQ C;  2PYO B;  4KGC A;  1BFM A;  3X1S D;  1W2E A;  3MVD A;  1P34 A;  3LZ0 A;  3AZK B;  2DF4 C;  4JJN A;  1P3L C;  2L5A A;  4XZQ D;  1U35 D;  3AYW C;  4Z66 A;  2HIO B;  3X1T C;  4Z5T D;  3X1U C;  1KX5 C;  2RVQ D;  5B1L C;  5DNN B;  4XUJ A;  4CSR B;  3LEL D;  3C1C D;  4G92 C;  3AV1 C;  1AOI C;  4NFT A;  3X1S A;  3B6G D;  3REH D;  2ZY4 A;  3MGS C;  4HGA B;  3O62 D;  4H9S A;  1HTA A;  2CV5 D;  3B0D B;  4J8W B;  4XZQ A;  2BYM B;  4KGC B;  1M1A D;  3REK B;  5B32 D;  4G91 B;  4Z5T A;  5CPJ C;  4Z2M H;  3W99 D;  1N1J A;  2F8N K;  3MVD B;  2W8S A;  3WAA C;  1P34 B;  3LEL A;  3C1C A;  3B6F D;  1P3O D;  2G5I C;  5AVC C;  4JJN B;  3AV2 C;  3REH A;  3B6G A;  3AZJ C;  5B40 C;  3W97 D;  3C1B C;  2CV5 A;  1WWI A;  3LJA D;  4Z66 B;  1P3F C;  2Y2I A;  1M1A A;  4CAY B;  3UTB C;  4XUJ B;  3UT9 C;  3AZG D;  3AZM D;  3UTA D;  1R4V A;  3B6F A;  1P3O A;  3LZ1 C;  4WJ3 C;  3A6N D;  3W96 D;  4XZQ B;  2ZY2 A;  3REL D;  5CP6 B;  3LJA A;  3AZI C;  4UUZ A;  4Z5T B;  5GSU D;  4YM6 D;  1N1J B;  4J8X D;  3LEL B;  3C1C B;  4QLC D;  3AZG A;  3B6G B;  3REH B;  3AZM A;  1B67 A;  3UTA A;  5B31 C;  3V9R A;  3WKJ C;  2CV5 B;  3AZN C;  3A6N A;  3W96 A;  3EPH A;  1M1A B;  3AN2 C;  3MGQ C;  5F99 D;  5GSU A;  4YM6 A;  3MGP C;  5AVB D;  4J8X A;  3VH5 A;  1Q9C A;  1TZY D;  2Y2P A;  4QLC A;  1P3O B;  4E44 A;  5B0Y D;  1JFI B;  3A1K A;  4WU8 D;  4LD9 D;  1WWS A;  3LJA B;  4UUZ B;  3MNN C;  2ZY3 A;  3KXB D;  1P3K C;  5F99 A;  3AZG B;  4ZUX C;  3AZM B;  3UTA B;  3V9R B;  2IO5 C;  4NE3 A;  5B0Y A;  3A6N B;  3W96 B;  3IP4 C;  5DNM C;  4WU8 A;  1P3B D;  4LD9 A;  2F8N D;  5GSU B;  1EQZ C;  4J8X B;  3EG5 B;  3X1T D;  5G49 A;  5B0Z A;  3KXB A;  4QLC B;  3AV1 D;  3VH5 W;  3KUY D;  1HQ3 D;  2HUE C;  3MGS D;  4AWL B;  4X23 C;  5E5A C;  1P3L A;  5DNN D;  5B24 D;  5CPI C;  4YS3 B;  3WA9 D;  2F8N A;  5GT0 C;  5AV9 D;  2ZM5 A;  2Y2Q A;  1ZLA C;  3X1T A;  2Y2N A;  1S32 C;  4J8W D;  1P3I C;  3AV1 A;  5B0Y B;  2FJ7 B;  3KUY A;  2FFF B;  1HQ3 A;  4WU8 B;  3MGS A;  4LD9 B;  3C1B D;  3MVD D;  1P3P C;  5DNN A;  5B24 A;  2BG1 A;  3WA9 A;  5BT1 C;  3H0R C;  5B0Z B;  5AV9 A;  3KXB B;  5CPK C;  3KSY A;  1BH9 A;  1ID3 D;  2F8N H;  5AVC A;  5GT3 C;  5BO0 A;  1P3G D;  1P3L B;  1KU5 A;  2F8N B;  3C1B A;  1PZR A;  3X1T B;  1P3F A;  3X1V C;  5B1L B;  2CWE A;  3KFU G;  3AZF C;  1KX4 C;  3AV1 B;  1P3A D;  3KUY B;  1HQ3 B;  5CP6 D;  3MGS B;  3MGR D;  1ID3 A;  4WU9 D;  3AFA C;  1P3G A;  4CAY A;  5B24 B;  2DQN C;  5AY8 C;  1M18 C;  3WA9 B;  4J8U C;  4E45 A;  5AV9 B;  1ULY A;  3MGQ D;  3B0C W;  3MGP D;  4KUD D;  4R8P C;  1BH9 B;  2ARO D;  5AVC B;  1P3A A;  1KX3 C;  5BO0 B;  5B40 B;  5CP6 A;  3MGR A;  3VH6 W;  3C1B B;  4J8V C;  4WU9 A;  3AZN A;  3W98 D;  1P3F B;  3AZL C;  1BH8 A;  2Y2M A;  5JRG D;  3MGQ A;  3AZK C;  1P3K D;  3MGP A;  2Y2O A;  3TU4 C;  4KUD A;  3F6T A;  2ARO A;  1ID3 B;  5B31 G;  5B1M D;  2Y2J A;  3LZ1 B;  1P3G B;  2HIO C;  3H0M C;  5B2I D;  1P3M C;  5B33 D;  2Y2K A;  3W98 A;  1F66 D;  3WTP D;  3P5J B;  5BNX A;  3MNN A;  4HGA C;  5AV8 C;  1JFI A;  4ZBJ C;  5JRG A;  4EO5 B;  1P3K A;  1P3A B;  1TAF A;  5CHL B;  3MGR B;  3AL0 C;  1B6W A;  4WU9 B;  5B1M A;  3AZN B;  3REK C;  2NQB D;  4G91 C;  5DNM A;  5GXQ D;  5KDM A;  2VQR A;  5B2I A;  5B33 A;  1P34 C;  1BH8 B;  3WTP A;  3MGQ B;  3LZ0 C;  3AN2 B;  1F66 A;  4JJN C;  3MGP B;  4H9O A;  4KUD B;  3AZH C;  2ARO B;  3REJ C;  4YS3 D;  3REI C;  5C3I C;  5AV6 C;  1M19 C;  2YFW A;  4XUJ C;  2NQB A;  3W98 B;  5E5A A;  2Y2H A;  5GXQ A;  3X1S C;  5BNX B;  1P3P D;  3MNN B;  2FJ7 D;  5B2J D;  3VH5 T;  4H9S C;  5JRG B;  1P3K B;  4ZUX B;  1TAF B;  2UWX A;  3AZE D;  1U35 C;  2IO5 B;  1S32 A;  5B1M B;  4YS3 A;  5GT3 D;  5B0Z D;  5DNM B;  4Z5T C;  5KDM B;  2RVQ C;  3KWQ D;  5B2I B;  5B33 B;  1F66 B;  3WTP B;  3LEL C;  3C1C C;  5JA4 A;  1P3P A;  4H9O B;  3REH C;  4M6B A;  2Y2G A;  3EPK A;  2FJ7 A;  5BS7 A;  5B2J A;  3O62 C;  1P3L D;  2CV5 C;  3AYW D;  2HUE B;  3AZE A;  1M1A C;  2YFW B;  3X1U D;  1KX5 D;  5B1L D;  5B32 C;  5E5A B;  5GT3 A;  2NQB B;  5GXQ B;  3KWQ A;  3W99 C;  2LY8 A;  1AOI D;  3B6F C;  1P3O C;  3EPJ A;  2J8P A;  1H3O A;  3H0L C;  3W97 C;  1S32 B;  3LJA C;  1P3I B;  3AYW A;  1KX3 D;  3WTP E;  5CPJ D;  3X1U A;  1KX5 A;  5B1L A;  2NZD C;  5JA4 B;  3AZG C;  1P3P B;  3WAA D;  3AZM C;  1AOI A;  3AV2 D;  5AVC D;  3UTA C;  5B2J B;  3AZJ D;  5B40 D;  5CPK B;  4DQY B;  3FDD A;  3AZE B;  3REL C;  1P3F D;  5GT3 B;  1KX3 A;  3UTB D;  5GSU C;  4YM6 C;  3KWQ B;  4J8X C;  3UT9 D;  3B0C T;  5CPJ A;  4QLC C;  3WAA A;  1H3O B;  3AV2 A;  3VH6 A;  3LZ1 D;  3AZJ A;  5B40 A;  5AV8 D;  4AWL C;  1KX4 B;  3VH6 T;  3AYW B;  1Z2C B;  3AZI D;  3X1U B;  1KX5 B;  5F99 C;  2JCH A;  3UTB A;  5AY8 B;  5AVB C;  4G92 B;  4DRB A;  5AV5 C;  3UT9 A;  4WNN B;  4J8U B;  1AOI B;  1TZY C;  3WKJ D;  5B31 D;  5B0Y C;  2F2A C;  3AZN D;  4WU8 C;  3LZ1 A;  4LD9 C;  5AV8 A;  3REJ D;  4NE6 A;  2G5H C;  3A1I A;  4H9P A;  3REI D;  1KX3 B;  3AZI A;  3AN2 D;  5CPJ B;  5AV6 D;  3KXB C;  3WAA B;  3AV2 B;  3AZL B;  3AZJ B;  3WKJ A;  5B31 A;  3TU4 B;  1P3B C;  2PYO C;  4H9Q A;  3AZH A;  3REJ A;  4KHA A;  3MNN D;  3REI A;  3UTB B;  3AN2 A;  3UT9 B;  4ZUX D;  5AV6 A;  1P3M B;  1M19 A;  3KUY C;  1HQ3 C;  4Z2M G;  5AV8 B;  3NQU A;  4ZBJ B;  5DNM D;  5BNV A;  2ZY5 A;  4H9P B;  4DRA A;  5DNN C;  5B24 C;  3AZI B;  3WA9 C;  2JSS A;  1U35 A;  1EQZ D;  5AV9 C;  3B0D C;  4ZUX A;  4J8W C;  3WKJ B;  5B31 B;  3LZ0 B;  4KGC C;  4X23 D;  4H9Q B;  4WV4 B;  3AZH B;  5E5A D;  3O62 A;  4KHA B;  3REJ B;  5CPI D;  3REI B;  5C3I B;  3MVD C;  5GT0 D;  1EQZ A;  5AV6 B;  2RIQ A;  1T3U A;  1M19 B;  1ZLA D;  5B32 A;  2NZD D;  1S32 D;  3X1S B;  3W99 A;  4Z66 C;  1P3I D;  3NQU B;  5BNV B;  1ID3 C;  1P3G C;  4X23 A;  4H9N A;  4H9R A;  3W97 A;  1U35 B;  5CPI A;  5FUG A;  5BT1 D;  5GT0 A;  5CPK D;  5B32 G;  2Y2L A;  1ZLA A;  4XZQ C;  4EO5 C;  2NZD A;  1P3A C;  5CP6 C;  1P3I A;  4WZS B;  3MGR C;  3O62 B;  4WU9 C;  3B6G C;  3REL A;  1EQZ B;  3X1V D;  5B32 B;  3AZF D;  5CPK A;  1KX4 D;  3W99 B;  4KUD C;  5AV5 D;  2ARO C;  3B6F B;  4X23 B;  2YFV A;  4H9N B;  4H9R B;  3AFA D;  3W97 B;  3NQJ A;  5CPI B;  5AY8 D;  4UPK A;  5FUG B;  1M18 D;  3W98 C;  4J8U D;  2XD5 A;  5GT0 B;  3B0B A;  1ZLA B;  3X1V A;  5JRG C;  2NZD B;  3AZF A;  4R8P D;  1KX4 A;  5AVB A;  5AV5 A;  1TZY A;  5B1M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...