1R4ZA

Bacillus subtilis lipase a with covalently bound rc-ipg-phosphonate-inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
b'HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Directed Evolution of Bacillus subtilis Lipase A by Use of Enantiomeric Phosphonate Inhibitors: Crystal Structures and Phage Display Selection
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 63
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r4zA00
1ZIXA 3QMWA 2CEKA 4Q34A 4UBMA 5ALWA 5EHNA 1GGVA 1AURA 2OAEA 3G9XA 2LIPA 3EIOA 4Y2QA 5JD4A 4H7JA 3WKDA 5CMLA 2CMFA 4H18A 3I2HA 4BE9A 1R50A 4Y9SA 1LPSA 3DYIA 2G4LA 5HFAA 4FOLA 1FFCA 4RGYA 4J7AA 2PSDA 3QPAA 4J0GA 3WL6A 2DHEA 3Q0TA 4X3CA 4B83A 3HYSA 4DGQA 4ETWA 2JGIA 3WL8A 4PF1A 1QTRA 4FBMA 4C88A 5A7GA 4ARAA 4AMYA 3LCRA 4IQ4A 1QFMA 4BTLA 3MUOA 5D3ZA 1E5TA 4X6XA 3UMJA 1CUHA 2V96A 5AKGA 2WIGA 4UBOA 4U2EA 4IO0A 5DJ5A 1DU4A 4UPDA 5FLKA 1XRQA 1YAHA 2QR5A 4N8EA 1FFAA 3W04A 4Y2SA 1FFEA 4B80A 4DNQA 2OLEA 2JGMA 4DYHA 3C6YA 2H7CA 3VXKA 3CCBA 4HRXA 3LP5A 1N5MA 1CUIA 4FTWA 1EHYA 5AKLA 4J3JA 3WKEA 1KU6A 3EF3A 4EUSA 2DQYA 4QDUA 5JYCA 2FX5A 1P0QA 2DHCA 1SFRA 1EB9A 3I6MA 3VVMA 4OU4A 4MYDA 3WA6A 2JEZA 5CW2A 3CCCA 1NX9A 3HRHA 4GI1A 5F4ZA 2BUCA 1MU0A 3LIPA 1UKAA 3R41A 1CUZA 2XUFA 3IUMA 2ZJ7A 3W9BA 3O4HA 4WJLA 5ALGA 5D6OA 4A23A 3NOXA 1WOMA 1F6WA 4FDMA 4LXHA 3D7RA 2ACKA 1DQYA 1L7RA 3WKBA 5AM2A 4BP8A 3K6KA 4UFPA 2XLCA 5YASA 3G7NA 5ALYA 2DR0A 2XQGA 1CUFA 1JU4A 4CFSA 3ESBA 2I78A 1WHSA 1CLEA 2GBCA 5HQ3B 2O2IA 1ZD2P 5HFNA 3EBLA 4BTVA 5JZBA 2ROQA 4BC1A 2XUAA 1A8QA 5AP9A 1ODCA 3WKCA 2VT7A 1XRRA 4CCYB 3DJYA 4UFOA 1S8OA 5ALKA 1XRLA 5LZ9A 2G5TA 3H1BA 1GZ7A 1LPBB 4BVKA 2J4CA 4L0CA 2BGNA 4IHAA 3R40A 4DMFA 4GLBA 1AMNA 2JEYA 2XT0A 1QIIA 1E3QA 3F96A 4B0OA 1U4NA 4BVLA 2VAVA 4U2CA 5BOVA 1BU8A 2QMQA 4X97A 4QWMA 5JAHA 4QZVA 2Z8XA 4J0DA 5HF9A 1J2EA 1ACJA 1THTA 5IVIA 3D2AA 4KE9A 3G0GA 4DLNA 4OYYA 1XZKA 2OGSA 4KAJA 3ZV7A 4J0KA 3DKKA 4C6HA 1ZI9A 1XRPA 5AO9A 1HPLA 4MXDA 2CBGA 1K4YA 2CKMA 4J0CA 4PSCA 4ZV9A 3H2JA 4JYMA 2VQ6A 1Y37A 4C4ZA 1GT6A 5DYYA 2I3DA 5EGNA 1VA4A 4OB6A 3YASA 5IH7A 3R3UA 4FWBA 2QXTA 2AJDA 1JI3A 3I1IA 3WIBA 4JYPA 4LHEA 4WY8A 1BEZA 1PFQA 1ZGBA 4H7FA 2RGUA 1LPPA 4M0EA 3DOIA 3GUUA 5AKXA 1QIKA 2WTNA 1YB7A 4K6GA 5IVHA 1LBTA 3F8SA 4G4GA 2PSJA 3H2GA 2JGJA 2JBWA 2HHAA 5AI6A 3F67A 5JD5A 3IUNA 1LLFA 1HKHA 3DYVA 2QM0A 3BWXA 4GWLA 2VJAA 3EQ7A 4KAAA 2WUDA 2C0PA 1UOPA 2WSLA 3AZQA 4Y2UA 2J3DA 2VAXA 5IVDA 2WIDA 3WK8A 2W22A 4PO3X 5HKAA 2XMZA 5AI9A 4CG1A 2WILA 4HXFB 4GXNA 3D2BA 4DNPA 3QM1A 2OCKA 3RARA 5C8VA 1F0PA 4CIBA 5CT9A 5IKXA 2FJ0A 1W76A 1A7UA 1YA8A 2PM8A 3D3NA 3BIXA 3FAKA 3O4JA 1YAJA 1FFDA 5ALJA 3IDAA 4M0FA 3KOOA 4QLOA 5AOCA 4K6HA 3WYDA 4B85A 3G02A 1M33A 2HRQA 1A88A 2WIFA 3E1GA 4UHFA 1TQHA 1XKTA 1ZD3A 5DWDA 1CUCA 3QMVA 3ZPXA 2R8BA 3FYUA 3IURA 1XFDA 1YASA 2ECFA 5HKBA 1J1IA 2WJ4A 3V48A 5JASA 3I1YA 1EK2A 1MX1A 2YH2A 5AICA 4HS9A 4DMCA 2WUGA 1XRNA 3UUFA 4UBIA 3ESCA 1X2BA 4V2IA 1VZ2A 4XJVA 2WHRA 4QEKA 2FJPA 2Y6VA 3K2IA 2OCGA 4YK7A 1MTZA 4AX4A 3PFBA 4FLMA 5EHXA 5AI0A 3DS8A 4CI9A 3M3DA 5ALPA 4AN0A 4MWTA 3WK5A 3N2ZB 3OC0A 3HLKA 2XUGA 2WUEA 4BC0A 4OCZA 3PDCA 1H2WA 4O08A 1J07A 4LYDA 1CIJA 5CT5A 1W1IA 3RM3A 5ALMA 3PUHA 4KR0A 3SC2A 3H18A 2B4KA 3C8HA 5LZ4A 2DFPA 4KAFA 3RK4A 1GQRA 3N0TA 1SCIA 4BRSA 2E3JA 4FLFA 5E4TA 1EB8A 1DX4A 2VJDA 3A2LA 1UOOA 3FNBA 1WHTA 2BKLA 5AKHA 2R11A 2QZPA 2HL6A 4NMWA 2VJBA 3DKRA 2CJPA 1G42A 2WUFA 4YASA 1N1MA 4K6KA 1BEEA 4X7BA 4F60A 3IULA 1NU6A 3AZOA 4WCVA 4F0JA 1EI9A 3WA7A 4WFKA 3QVMA 2HFKA 3WYNA 1B6GA 5FV4A 5KWJA 1GKKA 3F9CA 3NWOA 3SWWA 1WCYA 4MEBA 2HDWA 2W6CX 3W06A 4B9AA 3FBWA 4X85A 1BN6A 5IVKA 4DMHA 4LKOA 4I4CA 1AZWA 2IITA 1WB6A 4UBJA 2XUJA 4HXEB 4KE7A 1YB6A 3K9BA 3KXPA 4KYVA 2HM7A 5FXMA 4QWWA 4MWSA 3QMMA 4CCYA 5AKZA 4X95A 2GYWA 5JAOA 4MQMA 3VISA 3OTQA 1LPMA 2Z5GA 4G1FA 3HC7A 4W1QA 3W05A 4B0PA 5JARA 1DTEA 5HZGA 4C01A 2P8SA 1EINA 1CUEA 4Y2PA 1VXRA 4UHEA 1TAHA 3FOBA 4QNNA 5T4EA 2QOEA 4ZV7A 4FBLA 1NU8A 4G9EA 3FYUB 2VT6A 1G5FA 1R9MA 2PBLA 1VKHA 1XQYA 2WLSA 5BV7A 3VJKA 3A2MA 4B82A 3R3VA 2GBGA 1DWOA 2WG0A 2OQVA 3C5VA 3WL7A 3A6ZA 4ZGBA 3KWFA 1QJ4A 5AM1A 3DNMA 3WQHA 2XQFA 4WFIA 1ISPA 3LLCA 1GXSA 3WL5A 1Q83A 1VLQA 4I3FA 2XUQA 3CN9A 4EB0A 4OU5A 3G9ZA 5AI8A 5ISMA 1H22A 1VXOA 4DNOA 4EZIA 1SCQA 1C4XA 3FWHA 3M81A 1CUBA 4ZI5A 1JT2A 4RPCA 4DSZA 1MX9A 1Q0ZA 4E46A 4H77A 3NGMA 1TCAA 4GEGA 3HJUA 1FFBA 2BUAA 3T4UA 5C7YA 2WFLB 2ES4A 2I03A 4KJXA 1WPRA 4KACA 1UKBA 2ZJ6A 3I2KA 1ACLA 4PSDA 1JJBA 4BCDA 1EVQA 4BVJA 4Y2XA 1I6WA 5ALSA 4LYEA 3WWEA 3AILA 5AKKA 4DSAA 2QUAA 5DNUA 4HTAA 4ARBA 1CUDA 4BCBA 1DINA 3FCYA 3ANSA 2PU7A 3E3AA 4Y2YA 3DCNA 4WDQA 1CUVA 2XMGA 4Y7DA 2ORYA 1AC5A 5CT4A 3QYJA 3I2JA 1WM1A 1VA5A 3BDIA 1VJ5A 2H7YA 3I6YA 2JGKA 2WHPB 1ZI8A 1XZIA 2ZJFA 2HA6A 2RAUA 2XUIA 2QKYA 4UBNA 1O6GA 4TVKA 4BRZA 4QDXA 1QTIA 4J0JA 2XUDA 3WZMA 1JJIA 3ED1A 1IUPA 5K5EA 1H2YA 1BN7A 5ALDA 2Y1KA 3GBSA 4C4YA 5KWIA 5AKYA 1QIDA 1Y7HA 3W2TA 1CUYA 1CUWA 5T4HA 4BAUA 4GDMA 4Q3LA 2AJLI 4PV7A 3O0DA 4PW0A 5ALNA 4IH9A 4J0IA 5SYMA 3VJMA 4H7EA 4LXGA 3BL8A 3D5EA 4BYMA 2XMRA 3GZJA 1UK6A 1LBSA 3WWDA 4JEIA 2VA9A 3O4GA 4U2DA 2D5LA 1XZMA 1XZJA 3HI4A 2AJBA 4G8DA 5ALTA 4BZWA 2WTMA 1QIGA 4PQEA 4QDZA 4Q82A 3BXPA 1ZOIA 3PUIA 3WZLA 1CUJA 4QLAA 1R1DA 3WK6A 3OG9A 4W9RA 2D0DA 4RNCA 3IIIA 1XZHA 1ORWA 2O7VA 1XLWA 1C7IA 2HA0A 3X3HA 3AJAA 1UWCA 1XROA 1EXWA 3QITA 2K2QB 4UUQA 3AIOA 4U2FA 3WJ1A 1SC9A 3JW8A 5AI4A 1J06A 2DSNA 2HA4A 3BJRA 1Z68A 1X70A 4P92A 1BRTA 2I3ZA 1MNQA 4AMZA 4KE8A 4IH4A 1G4HA 1SCKA 3C6BA 3STWA 3V1MA 4Y2TA 5FOQA 2Y2VA 1XQVA 2XQIA 1DT5A 2XLBA 1N8SA 2ACEA 3V9AA 3V1KA 2XMDA 1F0NA 2HA2A 4D9JA 3A2NA 2Z8ZA 4NZZA 4PSUA 5ALVA 5LKAA 1AUOA 1QIFA 1MX5A 3DQZA 5CT6A 1VOTA 3LIIA 1XLUA 4HXGA 5E4JA 1AGYA 5JD6A 4EY7A 4B6GA 2ONCA 4BAGA 5C81A 3GROA 6YASA 4N8SA 1UZAA 2CZQA 4OPMA 2H9YA 4B9EA 1UXOA 3C5WP 5BWCA 1H23A 1ODTC 2ZYSA 3L1HA 5JATA 2WJ6A 5DNWA 2V97A 3FLBA 3I6ZA 2ZYRA 5LZ5A 1LZLA 5FP0A 3BDVA 2XMCA 3BF8A 3KDAA 4NVRA 2AXEA 2AJ8A 3P2MA 1W6RA 1TCCA 1USWA 3UUEA 5LKRA 4OUKX 3WWPA 3DLTA 1GPNA 1XZEA 3QPCA 3DEAA 1MNAA 1EH5A 2GZRA 4U2BA 3STVA 4G4JA 5JIBA 2FUKA 1W52X 3EQ8A 2JGLA 3ESAA 5AH0A 2JGEA 5EHZA 3PF8A 4BBZA 3H2HA 4TPKA 2CB9A 3G0BA 1XZFA 1GKLA 2X8BA 1DWPA 1MN6A 2PSFA 2QJWA 3M83A 4G8CA 1CPYA 1IZ8A 2PVSA 2C0QA 1MT3A 1JJFA 2HADA 3BJMA 2VATA 4B81A 2Q0XA 1CEXA 1W75A 4UBLA 3ESDA 4X6YA 3HACA 1U8EA 5D3KA 4BB0A 1MAAA 1AX9A 2NW6A 2DCMA 4H7DA 3WJ2A 1VE6A 1LPOA 3SK0A 3OM8A 5HF8A 3WWOA 1QIHA 4G5XA 5CH3A 4FKBA 3B5EA 4K5QA 4W1PA 1TCBA 4CIAA 4XWGA 1XRMA 1MO2A 3RLIA 4Q3OA 5CT8A 1LNSA 5FKJA 2QTBA 5ALXA 1HDEA 2XUKA 5H3HA 1TIBA 1CQZA 2GBFA 3G0CA 4FFVA 4ZWNA 5DTIA 1XZDA 5K3BA 4F21A 3G0DA 4INZA 1P0PA 1ZICA 5K3CA 1XZAA 5LLSA 4X94A 1UFOA 3IA2A 3JYHA 3BE8A 4EY4A 1DWQA 1N5RA 3ZLVA 2WFLA 3D4LA 4H7IA 3FVTA 3DL7A 1Q0RA 5HF5A 4JUIA 3HZOA 4C87A 3S8YA 5FPPA 5AK4A 5EFZA 5HF6A 5A6VA 5LZ8A 5A62A 5AK6A 1ZD4A 4EHBA 1CUSA 4J03A 2O7RA 5A7HA 4S0XA 1ZIYA 4IH1A 1ODSA 4QE3A 5T4FA 5CURA 3C8DA 1R9NA 5AKIA 3R3YA 5EIHA 1UK8A 4ITVA 4LIPD 3VJLA 3IUJA 3V1LA 4OSEA 2WFMA 5JZ9A 2OAGA 2OPHA 3G8YA 4BATA 2WQZA 5ALRA 3MGAA 2WHPA 2XUHA 2XMSA 1ZD5A 3WLAA 1AKNA 4E15A 4H35A 5EIEA 3OURA 3C70A 4I19A 4U2GA 2PSHA 1SOMA 3WWCA 1EDDA 1OCEA 1L7QA 5JANA 1EA5A 4WDRA 3ILSA 1YSCA 1B41A 5HK9A 4DM7A 4X71A 5AIBA 1IUOA 3I2GA 1TK3A 3JWEA 3S2ZA 1UOQA 3DOHA 3IVMA 1ETHA 2ZYIA 1CFJA 3R3ZA 1CV2A 2V9ZA 2XMQA 1E8DA 4X92A 1ZJ5A 4LXIA 3C43A 1GPKA 5JADA 5FUMA 4DTCA 3B12A 5KREA 4H7HA 5ALOA 2WU3A 3BIWA 2H7XA 3E4DA 3R0VA 5BWBA 1O6FA 3WK9A 4XIIA 5HCUA 2PPLA 5HK8A 3O9VA 2WG2A 4EY8A 2HA5A 1EDBA 4QA9A 3H19A 3WKAA 2OGTA 3ZLTA 3FYTA 4UHHA 2HIHA 1QZ3A 2B20A 4KE6A 3STTA 1QO7A 3PE6A 4FNGA 2PX6A 3AFIA 1BCRA 4HRYA 4ZRDA 4BDTA 1H2ZA 2XQKA 4YPVA 4E11A 3ICVA 5JALA 4PNZA 3F97A 3A70A 4X90A 2VF2A 4RE5A 5AKEA 5C8XA 1CUGA 2RHTA 2OG1A 4ZXFA 1YCDA 1LGYA 3WMRA 7YASA 3WK7A 3T52A 1YR2A 1K8QA 3QBJA 1BE0A 4AXBA 1P0IA 1XZBA 3ANTA 2BAGA 2Y2UA 5EIAA 1E66A 5I8PA 4AO6A 3AUKA 5ALZA 1BROA 3I2FA 3L1JA 5I7UA 1XZLA 3H2KA 1CRLA 3AIMA 5JAPA 5AJHA 2BCEA 4G9GA 4AZ0A 1D07A 3O95A 2UZ0A 4UHDA 1PJAA 4XX1A 2X5XA 4MJ3A 1R3DA 1UK7A 2V98A 1R88A 2HRRA 2WU4A 1DQZA 2EEPA 3H1AA 4X91A 3KWJA 5T4BA 4KRYA 2BFNA 5CXXA 1UK9A 4OB7A 1OILA 1LZKA 1QE3A 2HU5A 2WJ3A 4L3WA 3GA7A 4EY6A 1LPAB 2GZSA 3FSGD 1T4MA 1JMYA 1RWQA 3VKFA 2QJRA 1JU3A 4HVTA 2WHQA 4TGLA 1YS2X 1XLVA 4YX9A 4KEAA 2DHDA 4B7ZA 2ZYHA 4HZGA 4J0HA 1C7JA 3QZUA 1PV1A 2C4HA 2HU7A 4BZZA 2QVBA 2VSQA 4EA6A 4JH0A 3NUZA 2OCLA 4OD0A 2RHWA 5AI5A 5ALEA 1YA4A 5A7FA 4A5SA 3FLEA 3BF7A 1L7AA 1Y7IA 4UHCA 2G5PA 2EDCA 1XZGA 5K3FB 4X6UA 5A71A 1QONA 3PICA 4FFWA 3VDXA 3ZWQA 1IUNA 2VEOA 5CH8A 2OGZA 5EHQA 1CUUA 5AM3A 5AOBA 3DD5A 3CXUA 1IMJA 3SX4A 3G0IA 1CQWA 5AOAA 3KD2A 3Q8WA 2Z3ZA 4MEAA 1VZ3A 1CR6A 2O2HA 1QIMA 3O4IA 1EX9A 4UFNA 5SYNA 3W9UA 2C7BA 4CG2A 4BDSA 3G9UA 2RI6A 4F5ZA 4Y2VA 5ALIA 4WFJA 5JAUA 5K3DA 3IBTA 4EBBA 1K6EA 1H2XA 2X76A 1JMKC 5CBKA 5CTAA 1FJ2A 5ALQA 2ZSHA 3H04A 5I9IA 4UHBA 5K3EA 4H7KA 4OYLA 2GBIA 2J4FA 5CRIA 5LP1A 2ZVDA 4OB8A 1QOZA 5AK3A 4BAZA 4DIUA 4CCWA 4N5HX 1E89A 3IUQA 2IIVA 5DYWA 5EI5A 1A8UA 4GHWA 4G4IA 2BJHA 3QPDA 1CUAA 2G63A 2HFJA 3FSGA 5D7BA 4FNMA 3PI6A 1QIEA 3R3WA 4Y2RA 2C5GA 1XZCA 1FSSA 3TJMA 1CUXA 4H0CA 2XE4A 3RKSA 2WG1A 4AO7A 2BGRA 4MYSA 1EK1A 5ALHA 1ORVA 1EDEA 2Z3WA 5E4YA 2C5FA 4MQLA 3WI7A 3WIOA 3STXA 2RONA 3I28A 2QUBA 2GYUA 5ALFA 3D0KA 3V1NA 5AK5A 5ESRA 1G66A 3F98A 1P0MA 1Q84A 1X2EA 4C89A 5DTJA 3C87A 1YS1X 3OOSA 3TGLA 2XMBA 3H0CA 3O9MA 3DDUA 5LYYA 3H17A 2B9VA 5AIAA 1MPXA 2GYVA 4AN1A 1DT3A 3H2IA 2WIJA 3HSSA 4Q3KA 3VVLA 4WY5A 2HA3A 2B61A 4A16A 5J3JA 4W1SA 3I2IA 4FMPA 2QS9A 3E0XA 3WK4A 3B3QA 5A2GA 3IB3A 3U1TA 3GFFA 2O2GA 4QDOA 1QO9A 4QDTA 2C58A 4P08A 1RYYA 2WFZA 1THGA 3GELA 3QH4A 5AM5A 5LIPA 2QXUA 1TKRA 4FHZA 3FCXA 2WM2A 3ICWA 1ZGCA 5ALLA 1JFRA 3ZI7A 3MVEA 4XVCA 3OPMA 4Q05A 1R4ZA 3TRDA 3STUA 4UBKA 5DLPA 2PUJA 1QGED 5AM4A 1QLWA 4BP9A 3STYA 4P93A 5DNVA 3C6ZA 1JKMA 1XQXA 3ZLUA 2WKWA 2ZSIA 4X93A 1HBJA 2JGFA 5LZ7A 4N5IX 1HL7A 3EQ9A 3C45A 4W1RA 2OXEA 5JZSA 4BCCA 2XI4A 4L72A 3CN7A 2OQIA 2IX9A 4N8DA 4M0MA 1W4LA 2YXPX 5FRDA 3KSRA 1BCSA 4W63A 2DQZA 4CG3A 1MJ5A 2PSEA 5CH5A 1GPLA 3HABA 4AQDA 2YYSA 1U2EA 4GBGA 5DYTA 1AQLA 1TRHA 2QT9A 4Y2JA 2WIKA 3D59A 5E2IA 1UT6A 1QIJA 2XUOA 3L1IA 4AB1A 1XQWA 4HAIA 5FPQA 1F8UA 3AIKA 4X00A 4DMKA 4Z49A 2JIDA 2XUPA 4RE6A 2XDWA 2OCIA 1WB4A 3FYUC 2HA7A 5ALUA 3U0VA 4L9AA 4E14A 1GQSA 3PFCA 1RP1A 4KRXA 2J3QA 4C4XA 1UKCA 2XQJA 4K2AA 1WB5A 4ROTA 3DL4A 1KU0A 2Y6UA 5LZ2A 1LPNA 1QFSA 1WPXA 5K3AA 2PL5A 2VTVA 3G9TA 3LS2A 3PF9A 2BUBA 1E8MA 4AO8A 5AKJA 2VJCA 4JNCA 1CVLA 1XKLA 1EVEA 2H1IA 2PU5A 3FLAA 4Q1VA 3M82A 5AM0A 1T2NA 1ZI6A 1KEZA 1E8NA 3HXKA 4GECA 2XB6A 5FDFA 1VE7A 1HLGA 2EDAA 2PUHA 4DNFA 4B84A 1IVYA 4NS4A 5AHXA 4P9NA 1MAHA 3R3XA 2QRUA 4EY5A 2CUTA 4BE4A 1IZ7A 1U65A 2PKYX 4AZ3A 5CXUA 3MUNA 4FLEA 3C6XA 1A8SA 3AINA 1K63A 2HU8A 1ZJ4A 4GW3A 2JF0A 2AJCA 3AZPA 4G8BA 5HQ3A 5K3FA 1K5PA 3FVRA 3D2CA 1OXMA 3TEJA 5KBYA 1DX6A 2YASA 4ZREA 1BS9A 5C8ZA 3HEAA 1HQDA 2RIPA
chains in the Genus database with same CATH superfamily
3QMWA 3IEKA 1YBMA 3DOCA 1DDGA 3P71T 5DT9A 3G9XA 3EOBI 2K5UA 2I1LA 4ZZ0A 4DLYA 1NBME 4RM3A 5P8WA 1II9A 3HJRA 4WADA 1L8XA 4HSEA 4RHTA 1PQPA 1VRVA 1NY5A 3PSHA 4NYMQ 1R50A 2FN7A 3DT8A 4XM0A 2BFOA 4EHDA 3ZCTA 3SVLA 1RHQA 1TM1E 3OIUA 2FEKA 4HDAA 4NU5A 5CVCA 1WXFA 2V55B 3MTDA 2G4LA 3ILXA 3DFUA 2R8EA 1FFCA 5ITWA 4IDHA 3V34A 5BN4A 4IG4A 2GHTA 2R25B 2PZLA 3LWNA 5LYJF 1DO0A 1U3VA 3QPAA 1AK2A 1KJJA 3GGDA 2IXTA 2LCFA 1FQJA 2Z57A 3E6AA 3TBKA 2FR8A 4L50A 1RPTA 1DCFA 1SHKA 1SCUA 2YWBA 1S8FA 4DGQA 4ETWA 4UNSA 1YQUA 4LK2A 4NX2A 1MIHA 4PF1A 2QJOA 3V9PA 2GFIA 2KLHA 4NMLA 3SNHA 3K70C 2ZKIA 3VNUA 2ZRAA 2QLMA 1Z62A 2A58A 4LWQA 1WXXA 3V32A 3ZXIA 3DUWA 4LDQA 4ARAA 1MUUA 4AMYA 3S81A 3RAEC 2OSBA 1G3QA 1XJ0A 5JEDA 4RGBA 5AW1A 3I9KA 2I62A 4YRCA 1E5TA 4X6XA 5I01A 3AVUA 1K5GA 1XEWX 1JXAA 4IV5A 2GO1A 2EWVA 3EVNA 1RKQA 1S2IA 2H1FA 2R7LA 3N7AA 2JIZD 4J3FA 4GX2A 1QYVA 4D80A 1EG2A 5BP7A 5EJ8A 1WIWA 2AH5A 3PQDA 3LSTA 1XMVA 2C3OA 3E3MA 4NMHA 4UBOA 5FH9A 4IO0A 3ZY5A 2GWHA 5KTSA 5FB3A 3ETEA 1ZK1A 1RXIA 1FVFA 3I9OA 5EHGA 4OEHA 5GADl 1XRQA 3AKZA 2G28A 1YAHA 4OFBA 1AS2A 4R01A 2FLVA 4IEFB 3O82A 3Q7SA 4ZVOA 4N8EA 5BWMA 1HTTA 3DF7A 4MGIR 4I1VA 3QGMA 5CYFA 2V54A 5IS2A 4G0OA 3J81k 1T9BA 4X1OA 1DHRA 4EYEA 5EP1A 3A1TA 3PKJA 1WMEA 1PD1A 4DLRA 1JQEA 2BBWA 1P74A 2DTEA 2CMGA 1A7KA 1T0BA 3R9WA 4PHCA 3GUHA 4OP1A 5IMBA 2FUCA 3R7BA 3EHDA 4XGQA 1PW7A 3KJZA 3WRXC 3OIGA 1BD3A 1PGOA 2PZBA 1KDZA 2M2IA 3A32A 4DWVA 2FZGA 3P26A 3LP5A 2MYPA 1ZRSA 5CGZA 4QBIA 1CUIA 1T9KA 1UBUS 3A1SA 4FFPA 4BV3A 1KI4A 4O29A 1AGNA 5JAMA 1E1RD 4TV8B 2VXCA 4NHEA 2YV3A 1L5RA 4LV6A 5AKLA 4DDWA 2WDZA 3EF3A 3AF5A 4EUSA 2DQYA 3HYCA 2ZS9A 5FLEX 2FX5A 4YREA 5A6SB 3ZXYA 5K8IA 1CY2A 1FU7A 3RUDA 3ITEA 2GBLC 5DI9A 4B3MB 3V4RA 5DM4A 2DHCA 5JI2E 1C9NA 2CVPA 3UOGA 3OLYA 1QRUA 1Y6JA 3WRVA 5IJ9A 4RD0A 3L8CA 3CSUA 1O94D 1OLSB 5E0OA 2ID9A 3HVIA 4EI8A 5KTOA 4R8VA 1WHTB 1NX9A 3UH0A 1JXOA 1YGPA 2O0MA 2KI5A 5F4ZA 3BWBA 3N8NA 2X4GA 3B89A 4AJJA 4BJ3A 2OE2A 1IE3A 3N05A 3OTHA 4EECA 2PRKA 1JSLA 2B8NA 1W47A 2BFBA 1TMKA 2V4ZA 1E3WB 2F9MA 4H6VA 3TZBA 4DLXA 2PAAA 2XRFA 1MAWA 3DLAA 3O8OB 2FW1A 4GSKA 4P58A 2CLEB 2XUFA 3IUMA 2WE7A 2ZJ7A 3JQAB 2I54A 3TLBA 1B0PA 3VZQA 3W9BA 1F5NA 1CQIB 1KK1A 3U4AA 4A23A 5FPYA 4LJ7A 3KPUA 3MW8A 5HS4A 3Q9LA 1IQPA 2FYTA 2MSKA 1XD2B 2DSTA 1G60A 3ZDXB 1ELOA 3SPXA 4D3DA 2CXTA 1Z0SA 3D7RA 1MR3F 3CM0A 1EMDA 2QI9F 3A6EA 3K1AA 1DQYA 3A7EA 1LBQA 2F1JA 4CKBB 3VKHA 2GM3A 2JKZA 1VJ1A 1YD7A 3R7WA 3FBTA 1L7EA 4GGMX 3V8BA 4LBVA 4YMWA 4EFNA 4BVFA 3SYKA 4UFPA 2XVAA 1DTWB 2C78A 2EHDA 1EBFA 3MRVA 3NV9A 1X8XA 3TN7A 2DMRA 3K32A 3QX8A 1W8IA 3H1EA 1PR6A 2P69A 4M46A 4NC9A 4JASB 2GARA 5EIFA 3OOJA 1N5DA 3PX3A 1RBQA 3GB9A 4Z9AA 3ESBA 2I78A 1P9OA 5KTRA 4KZKA 1CLEA 2JI4A 1IN5A 4RD3A 4B4WA 4Z4HA 5HQ3B 1FJGB 1SBYA 1ZUNB 1SHUX 3E7WA 3OECA 4OL0A 2N9UA 3CMMA 4KGVA 3WFIA 4ER5A 3RYIA 1T0UA 4F2GA 4BTVA 4RULA 5DYIA 2H59A 1CY7A 3UV3A 5BORA 1D04A 1S4MA 5G0TA 4EKGA 1CQJB 1NQTA 5B58C 1PZHA 3EG5A 5JZBA 3D8NA 4BC1A 1GGEA 1AKQA 2DE0X 3NHMA 1KWGA 4FI3C 1D2CA 2MMGA 2XE7A 2XDQA 4LNUA 3WKCA 2GEVA 2VT7A 2J30A 3M3HA 2CNWA 2R7NA 1DC3A 1PTJC 2OCBA 3DWEX 4UFOA 4AZWA 1FTYA 2E1RA 3C1UA 4JENA 2W93A 1S8OA 2PMCA 4K40A 4RDIA 3EXEB 5AVKA 5J4VA 3JALA 3T3MB 5C51B 4UTRA 4E2YA 2G5TA 1CHNA 1F8YA 2NU7A 5HJEA 4POOA 1GQFA 2IIBA 1RXUA 4BVKA 4ZIRB 4B09A 3ZDAA 5JZMA 3ZV5A 4D96A 2BHLA 3O7WA 2BGNA 1Q17A 1R8JA 1W34A 2CL6X 2DULA 4IHAA 4E2XA 3HY4A 5J5VA 4GLBA 3FNIA 2W58A 2ZSKA 2LVBA 4GUDA 2ZROA 4F38A 3LBNA 3AIIA 4ZVNA 3IE2A 2QMOA 2OGWA 2EZ9A 3EF1A 1Y5RA 4L6AA 4LY0A 4ND5A 5B30A 5IT5A 1YU6A 5IEBA 3VYWA 5NLLA 3AM5A 4U2CA 5ITZA 1YFJA 4G0XA 1JHYA 4RA9A 3V7WA 4BXOB 5KO2A 3ABOB 1FFXB 3BG5A 1PFYA 4X97A 3WXMA 4QWMA 3DE4X 3HZZA 2C8VA 5EP2A 4D99A 4LW8A 3Q8XB 1WXDA 1SXPA 1U7TA 2AYYA 4WERA 4TTTS 2FUEA 4TL8A 5LA6F 1GCAA 3HKEA 5U4QA 4PWYA 3PGA1 5FT9A 1ACJA 5F33A 1TA0A 4WMLA 3HR4A 5E9WA 1H66A 2BL4A 4JFRA 3CE6A 2PBZA 3VSEA 3G0GA 1GXSB 2B34A 4YAEA 2WOOA 1I4WA 4K26A 5L8VA 3ASVA 1RQXA 5FL7A 2DUUA 1WMAA 3VJLA 3WNVA 1IXKA 1Y1LA 3G8CA 4KAJA 5F7JA 3WE7A 5GINE 4U3JA 3SEQA 3NZEA 2IQ5A 2IBTA 2AMYA 2UVPB 4EF4A 5HKKA 2OZVA 2VJMB 4IYJA 2UV8A 4C08A 1Y9EA 2XH8A 421PA 4GMKA 3O2QB 2QN3A 2QR3A 3QLVA 1K4YA 2CKMA 2A86A 4FS3A 4J0CA 3SCZA 3OHMA 3RU3A 4HS4A 2E0IA 1SUPA 3DDSA 3LY8A 1BHO1 1I2MA 4RHUA 4YP1A 4MNTA 4MQ5A 4C4ZA 3BTVA 2OMKA 1S3SA 3EC1A 2O8CA 4WKCA 2I3DA 1IN8A 1S2MA 2YNMC 2B21A 2OKGA 2PRSA 3DMNA 3FETA 4ND7A 4QQFA 1LC0A 3RIYA 3YASA 1WMDA 1H1LB 2CHVA 1F3OA 1XPUA 3PDIB 2QXTA 1JI3A 5HUHA 3I8SA 4Y0AA 1JWLA 3DL2A 5FA6A 4AJNA 1FMJA 3GEGA 4QFBA 1TCUA 3RYHB 1RKBA 4MAFA 3V8VA 1L7MA 3WLKX 4FT2A 4LHEA 2VQ3A 3PFHA 4WK0B 4WY8A 4HQOA 1YZUA 2VRWA 3KL4A 4PG8A 4ZICA 2FP3A 4V3CA 4Z1MA 1PQYA 1PFQA 3DC2A 4GI5A 4OIMA 4YAWA 1KAOA 1NSYA 2ZU6A 1OR8A 2F67A 4PEVA 2I6XA 5CU7A 4AVYA 3M1IA 3VH2A 2RGUA 3IPXA 1LPPA 1QHGA 2IHYA 4M0EA 4JI3B 5J58A 4G0ZA 2O1XA 3NBAA 3GMIA 1T4CB 2FPRA 2BE9A 4LTNA 1R0BA 1BNCA 3VI3B 3ZU6A 3FYCA 4MV3A 3DMYA 3EUAA 2ZXFA 1JKIA 2YDXA 2WE8A 3E5HA 3GX1A 5AT1A 4ZN6A 4ZYLA 3L77A 3G2HA 3L4EA 4K9MA 4P7JA 2OZEA 2V8OA 4EJ2A 2GKGA 1A76A 2LKCA 2ZRGA 4TTJA 5AI6A 1YI0A 4ZHQA 2I7XA 3IUNA 3PPWA 1RJDA 4CKXA 1OGJA 2X86A 3KR9A 2FMTA 3PRKE 1JBKA 3HWWA 1HKHA 5CVJA 4N7JA 3AR2A 3PIDA 1GGFA 2NO1A 1V5IA 4ZT7A 4UTPA 1O77A 1I2AA 3BWXA 3AONB 3OU6A 1DBRA 1PWYE 3FHTA 2DG2A 1S2DA 4CM4A 1DZIA 1Z6TA 4DQXA 2XR1A 3FE2A 3PHCA 1CTQA 2WUDA 3MFYA 2C0PA 2OZLB 4C6TB 1A98A 1UOPA 3OUTA 3JAMA 2WSLA 1E6UA 4PIPA 2OENG 2J3DA 2VAXA 3QXXA 2XSZA 4LRYA 4NYIQ 4PGMA 5DCLA 4EG6A 2AQHA 5AW7A 2WIDA 3WK8A 3L5KA 4G5SA 1J00A 4DIOA 1I51A 3FKSA 3HVHA 1NYQA 4J9VA 5KTPA 2VPYA 4TUYF 1CT9A 1OWNA 4JU8A 5E3JA 4IDQA 1R74A 2IEZA 4LZLA 1X7XB 3B9PA 3I23A 4MUBA 3QM1A 1M75A 1NW5A 4BIMA 2C7GA 2R8RA 3RARA 2X8WA 1G5RA 3ZN2A 3NVKI 2Z5FA 1PQ4A 1N6OA 4WLFA 4DM3A 3PEYA 2MSCB 5CT9A 3ZS9A 4D8UA 3MWGA 2R8ZA 4QYIA 3RH0A 3TW8B 1A96A 1N5JA 1Y42X 2G9NA 2WJAA 3CIFA 4LK3A 1U0LA 4M1OA 3HFGA 3LUDA 1QDUA 2EL7A 3PUYA 5IKXA 5LQNA 2JFVA 3MCUA 4B35A 1B14A 3AR5A 1BE8A 3TNLA 1YZKA 4P86A 1E2KA 4W5NA 2B7BA 1M2VA 2G1KA 4KR9A 2O8VA 4KP7A 3QVTA 4IZ6A 1KEKA 1A7UA 3CLTD 3CONA 1PU2A 2ZPUA 3AFMA 2FGJA 3DLCA 1Z08A 4CLXA 5LIRA 5IF9A 4ZZIA 3O74A 4LZNA 3UT5B 1FUKA 2JHFA 5CVEA 5DSTA 1H2RS 1LRKA 2Q4BA 2ZIUB 1ILEA 1GO2A 1KBZA 3B5IA 2NYUA 3DHVA 3OT4A 2C00A 1A8PA 5AOCA 4I4TA 1W29A 4E1VA 1P60A 1WXEA 4K6HA 4INOA 4BMVA 5G41A 2WIAA 3DBOB 4X1IA 1RHMA 2N42A 4GX5A 4L6CA 4GRAA 1MW8X 1N7JA 4ZHQF 3E3LA 3VU9B 1W6UA 3KCNA 2YIDA 4B85A 4HPWA 1CSEE 3G02A 1M33A 4M0PA 1YVUA 4BO8A 4C7BA 1KOFA 1U2DA 5AVUA 1H3EA 1YZVA 3OKCA 3D7SA 3S2UA 1DUSA 3RHFA 3USZA 3ZTTA 3E1GA 1XHEA 4UHFA 2XTAA 3RE1A 1WF6A 5LL6P 4NWIA 5HIIA 5LQAA 3OA2A 2YJ5A 4E5KA 3N07A 1N6NA 1YWGO 3F7OA 1I4TD 1O4VA 1PFKA 4J7XA 5EUBA 5B2FA 3W5AA 2WM9B 4M86A 1XTPA 2WV7A 1XFDA 1H0SA 1SB8A 1J1IA 1BH6A 2V7WA 1UIMA 8ATCA 2WJ4A 1MOSA 3ZZ1A 5KCZA 2XT6A 1PUJA 3JD4A 5DGXA 2DUMA 2PV7A 4G84A 4S12A 2BV3A 2BKAA 1CEQA 1T8TA 1XCGB 3GJSA 4D6PA 3FB1A 4HS9A 4KSCA 5EMHA 4DMCA 4HG2A 4AUKA 5ETJA 3I01M 1JR2A 3K94A 2J0UA 1X2BA 4UBIA 5TQVA 4F46A 1MABB 3ADPA 4Z0NA 4OKSA 5GONA 1K66A 3IQGX 4DLBA 4KR7A 2P9HA 3ZD8A 3A8TA 3IOBA 4HWTA 1Z36A 1P1BA 2VIIA 3HCPA 3HK2A 2VBGA 1W1WA 2AI2A 4I50F 2JLBA 4KC0A 2BEKA 1TFRA 4H59A 2DCUA 1X0XA 1BE6A 3OLCX 1MTZA 4RA6A 1V5GA 4F5DA 5EE3A 1RRMA 2A2ZA 4HDSB 3KSUA 1XVLA 1Y4UA 3PHLA 3HJFA 3IYLW 4FC7A 2ISCA 4BNJA 3ELDA 5LP6F 2H06A 4LJLA 4KSYA 2IXBA 2C59A 4EA8A 2XMPA 4I4TF 4MWTA 2K6GA 2PIAA 1AKMA 4JGGA 1HEUA 1B8PA 1T25A 1UINA 1HYGA 1E2DA 3A4VA 3OC0A 3ZKWB 4NYMR 3N9IA 2RCNA 3CRVA 4JJKA 2XUGA 4ZMRA 2VDWB 2WUEA 1LV8A 4OCZA 4BC0A 3RUAA 3CNNA 4OMUA 2NADA 4UHKA 1PP4A 2NMVA 1J07A 3M7IA 5HQTA 4MQ4A 2H4YA 3DDZX 3BWDD 4WBSA 1XU9A 3PUHA 4D79A 3IERA 1ZVKA 3C1AA 3SC2A 2EU8A 5J63A 5KX5A 3C8HA 1NI4B 4ZU1X 4B7XA 3GVXA 4RJ2A 2C7OA 5D5QA 2DFPA 2QNIA 4CN9A 3GBVA 5BV0A 4KAFA 5KQMA 1HUQA 3N0TA 2C3MA 1M6WA 1Q14A 5E1BA 2DWOA 4IDFA 2NZYA 4PZ0A 2WK1A 4GR9A 3UMYA 4CKEB 4FLFA 3H5RA 4RLFA 5I5EA 3T9DA 4RWZA 1DX4A 5JQWA 1FDVA 2ETVA 2W4MA 1LSJA 2FVXA 3H9GA 3LFUA 3N7UA 1PCXA 3HJNA 2B3DA 1Z13A 1UL1X 2VJDA 2LP4Y 3HBAA 5DTMA 2W2LD 4EHKA 2JL1A 1Q74A 1YS4A 2BKLA 1L5NA 3SYTA 2R11A 4FZVA 1C0PA 2VOJA 2AHOA 3R0ZA 2Q7XA 3QU5A 4XSGA 2A9FA 1QSGA 2XVXA 4A0RA 2BEWA 4YASA 3MOIA 2Y76A 3QPBA 4JHLA 1N6RA 5ICMA 3RVNA 1PGQA 2IH2A 2M1ZA 5TPZD 5A0VA 4UAGA 1NNUA 3S4YA 2IODA 1E2MA 4RPGA 1TYZA 2XKBA 5F7ZA 2GZ3A 1ID1A 4K6MA 5E6UB 2O6LA 1ZR2A 2VHEA 3BQNB 2AUNA 5C2JB 2FEAA 3HQ4O 3IV6A 3ZHSA 2VYVD 1P2BA 3A31A 1E4OA 2WWTA 4S0ZA 3ZGYA 4EABA 3WA7A 1VHLA 3K4QA 3RCBA 5E7IA 5BRJA 4HDMB 3I9FA 1A9PA 2D06A 1QRSA 5CA0F 1I6LA 1AU9A 1XF1A 5EKDA 4FMCF 1HT0A 2PLFA 2ZDGA 4TKMA 4DBLC 3RO7A 3DTTA 3AV3A 4MI1A 1VL2A 1UADA 4FDUA 3NWOA 5D6NA 4TXJA 2I33A 2XGOA 4I5DA 4A8PA 3SWWA 1UZNA 1NONA 5DULA 1XWIA 4MEBA 2JCGA 1EE2A 4TZ0A 4DADA 1V9SA 3FVQA 4NL4H 5C8YB 4O59O 2B1QA 3EVFA 1BN6A 1EGHA 1NHWA 2AQKA 1QGZA 4NCJA 3OUZA 1SQ5A 3E3NA 1KJZA 3FNRA 3QKWA 4WK2B 1IHDA 2Q3CA 1QQBA 2IITA 3OQBA 5IN4A 3MK31 1KJIA 1Q0LA 1WB6A 4LSZA 5K45A 3O3MB 4TROA 4DRYA 4XQCA 1HETA 4BEBA 1YKSA 2PX2A 3BWYA 1IB6A 2NSYA 3MCZA 4F5YA 3GD5A 3F4BA 4KE7A 1CDOA 3LM8A 2FEOA 1XC7A 5E1MA 2HM7A 3GHYA 1DP4A 4LX0A 3FDIA 1SQFA 3QOXA 4O2AF 3QQPA 4YRJA 2BMAA 3CWQA 3QNUA 5LM3A 1F60A 1R6XA 2RGYA 3K3PA 4GGPA 1GA1A 4CCYA 1GPWB 3W8DA 1IATA 3JQRA 3UJAA 2BCGY 2B9EA 4IL5A 2APJA 3ETDA 2R5NA 3EWSA 4TYWA 1T9GR 1CZNA 2QAGB 2WF9A 4M99A 3V2UA 3EXHC 1X1DA 4MQMA 2IV7A 3P19A 3VISA 3OTQA 2Z5GA 2PUAA 2JLRA 4G1FA 5CFQA 4B0PA 621PA 4E5PA 5HZGA 3DNFA 2I6UA 4JBWA 3V4FA 3IO5A 1QKIA 1BHJA 4TMTA 1CUEA 3PBKA 1YK1A 1R10A 4KN5A 2QOEA 2R6DA 1ZCAA 4LZWA 5HDQA 2Z8YM 3UMCA 5CIYA 3SXPA 2FSPA 1SVUA 2PWAA 3H3FA 3WJ7A 1JQ3A 4OG2A 3BRQA 1NOIA 1BDIA 1KIAA 2ZYWX 2OEPA 3OEWA 1G5FA 1KQNA 1SUBA 5A3VA 5IWCA 5JC8A 2IBSA 1TAGA 2PS9A 3VJKA 1OE0A 3ZYCA 1VRCA 2Q9UA 4BYGA 1Z9BA 3H5TA 1IOZA 2R62A 5BYBA 4RTJA 2H31A 4CV2A 5KIAA 3PNQA 3DJFA 1N0VC 2FK8A 2FF5A 5M7EA 4C0WA 1IN7A 2C61A 1KL7A 1PZGA 4LGYA 2ONKA 3ENKA 4GQAA 1V37A 2AJTA 4FCWA 4Y1RB 3JQGB 3MJDA 1NTRA 2NUAB 2KBFA 4Q24A 4DUYB 2BTOA 2R79A 3P9RA 5AVZA 1EUCA 1VB3A 2C4UA 2ZBGA 3FMIA 4GRDA 4IILA 4KLZA 3MPUA 3DE2X 2JIRA 4PTZA 3I4FA 1VQ1A 2Y0BA 3DA8A 1C1DB 1YRWA 3WMWA 2Q5FA 2HT1A 3RYCA 4UCFA 1JDNA 2GN6A 1OJ7A 2B94A 1E2JA 2OO7A 2ORIA 4I3FA 5IM5A 3NWEA 5B6JA 2WM8A 4QICA 3CN9A 3RR2A 4KX3A 4OU5A 4YJ3A 5AI8A 3P0IA 1V8ZA 1PEKE 3ZDQA 5ISMA 1VCOA 5DNCA 1VRWA 1DCMA 1VXOA 3TL6A 4YY3B 3WSVA 1YV9A 1LX7A 1DJLA 4OXNA 4EKEA 2BKEA 8GPBA 5IF3A 1L5HB 3CT6A 4FOOA 4W99A 3FWHA 3PITA 3BHMA 4EMSA 2BIFA 4PZZA 3CPSA 4BNVA 5FQNA 2OCAA 1KVSA 4TMVA 3CO5A 4C3UA 1N6PA 3JYPA 4DSZA 1MXHA 1S2GA 4G5QA 4E46A 3U39A 1IDN1 4H77A 4D44A 2J0EA 4D9BA 3NAQA 4I3GA 3EVEA 3LUJA 2NZUG 4IYRA 4KFSA 4QGGA 3AERA 4L8FA 2D8AA 3HJUA 4LQCA 4L0QA 4Q7EA 5FIUA 3T4UA 4E2FA 1F0KA 1E64A 1KA9H 1T13A 1XEAA 2WFLB 1SBQA 1J8MF 3A1NA 3AY0A 3M34A 1WPRA 1D3AA 4WI1A 3ZW9A 4CF5A 1UKBA 1E2LA 1HDIA 2ZJ6A 4MIYA 2IPMA 4YJHB 3SS7X 3KQSA 4Q3CA 4L73A 5C1OA 4LY3A 4EB6B 1ACLA 2C96A 4YXWD 2XCSB 1N2CB 4HCJA 4LRXA 2ZETA 2QRPA 4XKJA 2F4NA 4H6WA 4BVJA 2BLNA 3GLGA 4DG5A 1X15A 1BXRB 4O4JF 1L7DA 1JG2A 2B2NA 2VNAA 3IP6A 1ISHA 1O2DA 1E4EA 4DSAA 5AKKA 5KSYA 1KZGB 1X8LA 3P27A 4LDJA 3WAJA 7MHTA 1BGVA 3X1MA 4HEHA 5JMTA 1SKAA 1HYEA 4BCBA 1DINA 2AF4C 2DY0A 3QKSB 3LHFA 2PU7A 4G1BA 2A9QA 3CRNA 1TF7A 4Y2YA 5EAIA 5EWMB 2CFSA 1U81A 2C5HA 3WGJA 3W5DA 1J1ZA 4XJSA 1XTRA 3WX0A 1N5OX 3LH5A 1HWYA 1CUVA 2XMGA 3ANXA 5E6RA 5CT4A 4D9GA 1UZUA 2VPXA 4LG1A 4LI3X 1Z7YA 2DJ5A 5F5NA 3C6MA 4IHKA 1I01A 3NKFA 1J42A 3QYJA 1ATZA 5HEKA 3JD0A 3DCIA 1VA5A 1JHVA 2AK2A 3CBQA 3E2PA 1QFJA 4PFJA 4QAQA 4YJ3F 5KNLA 4URHA 2PRIA 4E5SA 1C1XB 5FTWA 1M8JA 3T54A 2UZ1A 3TTVA 1BJKA 1T8PA 4Q1EA 1JMVA 4JIGA 4BFWA 5A5EA 5CG2A 3EGDB 4YT5A 4NG4A 2WHPB 5DCYA 4A0SA 1D9XA 4FS8A 2XUIA 2VUSA 3IT1A 3I4LA 1H6DA 5L6MB 3BXXA 1MAUA 1TVCA 2X7JA 2Q4TA 2Z2KA 3JATA 5UKDA 2OAQ1 4Q1BA 1XZQA 1EVZA 2FSVA 4P83A 4RIFA 2BEUA 2ZAOA 1NBOA 2WAYA 5AESA 4RDCA 1QTIA 1P4SA 1FSFA 4BKUA 2NU6A 3PLNA 3WICA 2A1UA 3ED1A 4IX9A 3K15A 4ENQA 1DQSA 4JU9A 3IKLA 5B1IA 1IQRA 4EJSA 3I73A 3VR2D 1BN7A 1ZP6A 3U6KA 4MV5A 1QPZA 5ALDA 3CKYA 4O3FA 1Y4DE 4X1YB 3OFND 3EGXB 3QK7A 2PGDA 5KYGA 3NTVA 3FGOA 4RMIA 3U61B 3HU1A 3ZHRA 2XXAA 3SZ3A 3L6UA 2BTEA 4WX2B 1FNNA 2PKCA 2PRYA 3S6JA 2VRCD 2YVUA 2X2OA 2EYQA 4MCIA 1CUWA 3R23A 3KB6A 2RH9B 7GPBA 2MYUA 1J0EA 1W73A 1F12A 5D51S 2Y0PA 3N0WA 3BKXA 4GDMA 4NH0A 1Q92A 3PHGA 4RY0A 4O5AA 2V8BA 1F51E 1UKEA 1O54A 1FE8A 2CDBA 3HFRA 1GEGA 3EFOB 3HN2A 4KZPA 4RPIA 2AJLI 1LWNA 3RPEA 5KEIA 3GCWA 1VKZA 2YOHA 2O2XA 2XDAA 3PFNA 3UJPA 4BGDA 3THSA 2VK2A 1SC6A 1YNOA 1R5JA 2IOYA 3OD1A 4CKCA 4J0IA 4TN1A 4NH4A 2O5CA 4RZSA 5SYMA 4A0HA 3VJMA 1M8KA 4NZNA 4J16C 1GRNA 1O97C 3EDRA 4NFLA 4LXGA 3ZWAA 3SYNA 3G3EA 1KF0A 2AQIA 3NIWA 2W6PA 3HXQA 3PNOA 4P7GA 4GYKA 3GEBA 2E5WA 4K8RB 2G1UA 3WQQA 1KJWA 2XMRA 5JYDA 3UIEA 2Q1SA 3ND9A 3TE7A 3WWDA 3H9JA 3A0RB 4D57A 4CTOA 4QRDA 7ADHA 3UK2A 4U2DA 2XEDA 2D5LA 1XZMA 5EZ6B 1XZJA 3HI4A 4I81A 5IBPA 5KYVA 3B6ZA 5JSUA 5ALTA 4BZWA 4K88A 4EZBA 5KNDH 4D9NA 4DB4A 3N58A 1E2HA 3QLJA 1IYZA 4HQ6A 5BN1A 3QUAA 1GQQA 3FTDA 3QI7A 3T4XA 5LN1A 2UU9B 1MG0A 4XYGA 2ZQZA 3DAFA 2AX4A 2WVAA 2GEDA 1EJ2A 3UJ9A 2F55A 3KZCA 1BW9B 1YKFA 3SDSA 3HA3A 1ECGA 1NC1A 4NBRA 4CXMA 4M9XA 1QHXA 4GBJA 5DGHA 5F4BA 3WK6A 4LXYA 2HBYA 1VMDA 5B37A 4W9RA 2BHSA 3O9ZA 4D4KA 3RJ9A 4RNCA 4RLQA 1OT3A 4ZT6A 3S2GA 1APBA 4J29A 1XEFA 5EWLB 3O31A 1MCZA 4HLQB 2J9FA 3FCUB 1PJRA 4BLUA 4DLLA 4KIFA 4AYWA 3CLRC 1C7IA 2HA0A 2PUCA 3KXKA 3GMTA 3PFKA 1RI4A 4GC9A 2M32A 3EMVA 3S7ZA 3U9SA 4EO9A 3NEPX 1YVEI 3ZZNA 2XITA 4DBZA 2P2CA 1NXSA 4P3XA 4BFVA 2K2QB 4C7KA 4ZGGA 4BFLA 4CW7A 3E1KA 3NHSA 4A8JC 1LTKA 4GP9A 1G98A 3F9IA 3WMGA 3STHA 4R6WA 5AI4A 1QU3A 4TSFD 5DGDA 2ZRLA 1V2GA 1C7RA 2X5KO 1U9YA 3ZE7A 3THXA 1EESA 2A67A 2DFNA 4V2UA 2JVIA 1JKJB 2GEFA 4HH1A 4A6PA 9ABPA 5JLJA 1JEYB 2X41A 3WHLA 1OLXA 1FQKA 5JBIA 3TF5A 2GDJA 4UKDA 2QPTA 4Z4EA 1Y1QA 4DRXB 3GVCA 2O6HA 3ETNA 4FSHA 5KTMA 1VIYA 2I3ZA 3OMWA 1TPZA 2OO5A 4RTKA 4IH4A 2VP6A 1SCKA 3RRJA 4ES6A 1HQKA 1PJQA 3W8RA 4IIDA 3A3PA 2DFKB 3LTEA 3KR1A 4I08A 4RSMA 4Y2TA 3V1MA 3EZYA 2Y2VA 2A5GA 3UHJA 5FOQA 4QFMA 2ZZNA 4JL6A 3O73A 1DT5A 1T1SA 3OF2A 5CPFA 4QG3A 3GJZA 1LJUA 5KNCH 3C7CB 5DLQC 1QDEA 5H9VA 5M29A 1Z45A 4LJ8A 1FK8A 1OC2A 5BR7A 1Q12A 4ZT4A 3ABSB 2HA2A 3EG9A 5NULA 3GXBA 5IM4A 2P5UA 1CEEA 2IFTA 2QTVA 4KDRA 5BNIA 4D9JA 3A2NA 3BB4A 3Q3HA 3KUKA 2J9GA 2QZJA 4NZZA 3KVRA 4TTAA 2F3RA 4PSUA 5DYGA 5ALVA 1AKEA 1V3TA 4BMPB 3VM6A 3FJ1A 5KOYA 3DLBA 1Z6YA 5KYTA 1N8NA 1QIFA 4KQIA 3AUTA 3DQZA 1G2PA 3SGLA 1U7OA 3RGWS 3AI2A 2DTDA 3HU3A 2IHZA 4R8LA 4N0MA 4FYKA 4LY9A 3D4OA 1F06A 3TPZA 1WU7A 1X7GA 1YQQA 2ZIGA 3ZQUA 3AKCA 1Y3CE 3W3AH 4GXRA 4J49A 4B6GA 1KAMA 4TVBA 2REBA 3U4CA 1N77A 4R2XA 1LA2A 3SBEA 1OTXA 2WC1A 6YASA 3IH5A 4LDPA 1H3NA 1T2AA 4N8SA 4RMNA 2IYLD 2CZQA 1FQOA 2G76A 4B9EA 1C8KA 3QBVA 3SBXA 4FEEA 5G3ZA 3C5WP 3RLFA 4D9FA 4DLAA 3WAGA 1E3DA 2H9AA 4IGFA 2YV4A 3L1HA 1HRKA 3IMCA 4I66A 1T6XA 2WJ6A 3VR5H 4BLOA 5C1BA 3IRVA 1C30B 5FAKA 3IAS1 2PKRA 2EKLA 5HJ5A 4EFDA 4K8OA 3NMUF 3L40A 3FUWA 3M1YA 4ER3A 3QKUA 4AP5A 1QYXA 5BW5A 3ENNA 1NMXA 3A4IA 1WG8A 4MULA 3NDBB 3LPDA 1IEWA 3MSCA 3ABZA 4UJ3A 5B7QA 1V5WA 1W0JD 2B1GA 2FN8A 1B0AA 1EAMA 5K0SA 1NSFA 2GM9A 1DRKA 1QORA 2A0UA 1ISSA 1SCNE 1DBIA 2ZBEA 1IBSA 1PKXA 1U2RA 2DH5A 4H2DA 3CZMA 4XYBA 3RUCA 3KDSE 1YZ3A 3HBLA 4OQ4A 4I5GA 4QBHA 4AMUA 1IY2A 4QRIA 5K03A 1ZL0A 1JLLB 5HSGA 3KDAA 2WEKA 2KW5A 4BX3A 2YXNA 4ECAA 1KORA 3AHEA 3UUWA 4NVRA 3HN7A 5JPCA 3LC2O 3CYFA 4UDNA 3P2MA 4PLCA 5IUNC 1D0IA 4YBZA 1USUA 2C1EA 3FOFC 1H65A 4A4DA 2A9RA 3C6KA 3JZMA 3BFVA 3WWPA 2G77B 1V8DA 1XB2A 4LFBB 2YIJA 2IE0A 2WTBA 3HKBB 4YCDA 3WL3A 1MNAA 2CHEA 2ANCA 2X19A 1Z0DA 3EEQA 4G4JA 4YUAA 2RHOA 5JIBA 1WRBA 2MINB 2F8LA 3AHGA 3F71A 5IM4F 1W52X 2XB2A 2HGZA 2P3SA 2AZDA 3K0CC 4W5TA 4V24A 2JGLA 1ZG3A 3ESAA 2B2CA 3G8BA 3PXBA 4LISA 4MV0A 4WN9A 3EA5A 4BNNA 3WGZA 3VUFA 1JLRA 3C0KA 4RF4A 1LW6E 4Z4IA 1PL0A 2CN1A 2DPYA 3RWOA 3ZJ4A 4RVNA 2EJUA 1XA4A 4BY9E 4I99A 1K4KA 2O3QA 3N2KA 5CDYA 2AD1A 3N75A 2IDJA 4Q7QA 1H2FA 1OBCA 5M04A 2CFCA 3L8DA 4EHLA 2M9MA 1SXJC 1U9JA 4BLTA 1VGRA 2RC5A 5K0CA 1ZW6A 3M83A 3PNMA 5TSDA 1I36A 4MUHA 1RYZA 1UPXA 3GNTA 1RJGA 3FLMA 3KU1A 3A4YA 3F3SA 1MT3A 3T0GA 3BJMA 3OZSA 3HS3A 3LL7A 4GICA 5KJ6A 3V2HA 1RFLA 3SJUA 3VNRA 3D3WB 3EWAA 3F6YA 3M4NA 4HFNA 4P3YA 4QGSA 2EXXA 2BR5A 2Q1YA 3L46A 3FZQA 5DCWA 4PLTA 3VC1A 2D0PB 1O6BA 1E1KA 1JDBC 1U8EA 1IMOA 3HACA 4GSLA 4KB5A 4TLMB 4D0GA 4QTYA 5CFRA 4V1CI 5KVCA 2QBYA 4RW0A 4IO1A 4DC1A 3NHRA 5EGSA 4TZ6A 2EKZA 2O20A 3OU7A 1GKIA 2VKTA 1NXPA 2H6EA 1VE6A 4MV6A 5BNTA 3SICE 2H4JA 3GRYA 3IVRA 4Q93A 5KKNB 3N28A 4Q3BA 4XXHA 3W9YA 3WWOA 4F4DA 1NBMD 1IG3A 1MO4A 3GRCA 3HV2A 4MYHA 1E2QA 2W98A 3VU8A 3W0LB 2HOQA 2Q6TA 2Z4TA 4UMEA 2BGJA 3GRUA 3MMPA 4I2NA 5CH3A 1JF8A 2JI6A 5EKSA 1G38A 3A2KA 5EIBD 3L2OB 4FKBA 3QWIA 5TQ2B 4FYVA 4CEJB 4AF7A 4CIAA 2LCIA 1MO2A 4DWJA 2GA9A 4RADA 2IHTA 3TZKA 3OQ1A 4N3BA 2PH5A 4JA0A 2X5OA 3D6FA 1LNSA 5CT8A 5FKJA 4DJDC 4GOLD 1VFNA 2QTBA 1KY4A 1N9GA 3NHZA 5DFAA 4BZPA 2AK3A 5HTKA 4BTEA 2P40A 2GK7A 3E84A 3NHBA 3P5BA 2YL2A 4ZAWA 1FSGA 1Z6QA 1RQLA 2QEQA 1TIBA 2W8BA 3LQ1A 3ZLBA 5JH7F 1G8SA 1YBHA 1WE2A 3LG2A 1IN4A 2P3LA 3PIIA 3G68A 4JQOA 5DTIA 1UBSB 3W7VA 1AV6A 1V8FA 3KD3A 5LU9A 3Q0IA 1C80A 2C1ZA 1ZJYA 2UUCB 4QLBA 2XECA 1SIWA 4L9RA 3CRW1 2VNHA 4ETNA 3AM1A 4F21A 5K3BA 3ZG6A 1COZA 2YZKA 2XCTB 3NHKA 3T7KA 4INZA 3FSEA 2GN8A 1P0PA 2QP3A 3HYLA 4O4IB 4RY8A 5K3CA 1E1CA 1NQXA 4GLLA 2Y4OA 4QUJA 5DM0A 1IDOA 3TOVA 2EFHB 3DTNA 1XZAA 2GPJA 1E3IA 3P9SA 1T5SA 3DTVA 3DTYA 4X94A 1W0CA 3GRRA 1PS8A 4QYXA 1ZUD1 5FBRB 2EF1A 3GLSA 2FOLA 1RWMA 4FDVA 4YJGA 1IOVA 2UAGA 5H68A 1NWCA 1TUIA 4EY4A 2GHQA 1PVOA 2MT9A 3SHVA 3WYAA 2Q5QA 2C5EA 1P1IA 3EXFB 3LRPA 4RXMA 5AK0A 1EFPB 4DPMA 5A5DA 3N8KA 4YXFA 3VAAA 4YUZA 1NV9A 4N9WA 4UASA 1SUIA 2F1RA 4B3GA 1RXWA 4FUTA 3AETB 3O1IC 1MV8A 2HPHA 4KIGA 5HF5A 4JUIA 4HYEA 2NXEA 3HZOA 1FC0A 2Q6OA 4HQKA 4XA8A 4XFKA 2YN2A 5SYAA 3ROQA 1XDDA 4UAVA 2Y99A 2FMUA 3NLLA 5MN6A 4MVJF 1YH3A 3MAJA 3DOOA 1RLMA 3JRNA 5AK4A 3GUCA 1J90A 5G2OA 4ER7A 4RETA 5C3MA 4RHXA 1TOAA 2ZIEA 1CZHA 1E96A 3U7IA 1ZD4A 1MT0A 4YA6A 4CFZA 3DDCA 1HQYE 1LVUA 4NY1A 1SQ0A 5FPHA 4F91B 1P19A 1JHXA 3AX6A 4BQOA 5BT9A 3V4SA 4KQWA 1KS9A 2FCRA 1ZIYA 1PZXA 2YFQA 3N8IA 4TX1A 3DH0A 3UKDA 3OP4A 3P0HA 1WWKA 4QREA 5C0OE 5CURA 4UUBA 2XKJE 3C8DA 4NDZA 4RD4A 3UC5A 2O8BA 3MRTA 3JVIA 5L3SA 2QDKA 1J33A 5AKIA 1QHYA 1W88B 2NQTA 3OQIB 1T3GA 4H3SA 2YCBA 1F38A 2JCVA 1VG8A 5EIHA 3TR0A 1EPUA 1G8MA 2I4NA 3A06A 4G37A 1QS0B 1SOWA 2PKWA 4IQGA 3IUJA 4MLCA 4OUDA 4REMA 2WVGA 3V1UA 3F2IA 3V1LA 4H4DA 5A0TA 4RJKA 4DIBA 2WWYA 3HCEA 5T7BA 3W8FA 2QD5A 3G8YA 1M10A 4GI3A 2F8SA 5IUKC 1RQNA 2A33A 3DP9A 3MGAA 4FN5A 1PEDA 1ISMA 1JDZA 1IIBA 1KEPA 3DUFB 3OZUA 10MHA 3P0EA 2VYFA 1A9SA 2XUHA 2XMSA 2OV3A 1V5EA 3OBBA 3AJEA 1Q11A 2WKQA 4BLWA 3DG9A 1AKNA 2IXFA 1EX6A 3KYDA 1NN0A 2Y9PB 1F3LA 2ABWA 2H2IA 4IJ6A 4IR7A 4I19A 1LQ2A 5ELLA 5KNDD 2F1HA 1EDDA 4R1NA 4NZ9A 2HRBA 1TYCA 1QF7A 2I65A 3L7NA 1O0SA 1ZPDA 1OCEA 1T2EA 3D6AA 3HUEA 3W34A 2OXTA 4CN8A 1EA5A 4UNQA 1JJ7A 2GNOA 3A6GA 1Z8FA 4FYIA 2VCHA 3DZDA 4X24A 5BUZA 5J40A 4X71A 4J9UE 5BSTA 1YDFA 1IUOA 2QX8A 2VNKA 3AOEC 1X1SA 3FPBA 2XCLA 3U81A 3GPDG 1GVHA 1JFTA 2OO3A 3T8YA 2NVWA 4GVLA 4YRFA 4P7BA 3GNSA 1PIWA 3L0CA 1HFWA 1N0IA 1KEVA 1UJCA 2QR2A 4L1KA 4OLJA 4GQIA 4MW9A 2PUEA 1UOQA 5A9TA 3UFXB 5IARA 2GPWA 1ZM2A 3NW9A 3IVMA 4NK5A 3MSXA 3TBFA 1GOTA 5FTNA 4AG6A 3AB7A 1TLTA 1N75A 1W4CA 2FE4A 3A3NA 1CV2A 1CBUA 3NATA 4YAUA 1IB0A 5ITVA 4ZZ2A 1U0JA 3GUYA 4HBGA 3QWFA 2A9KA 2HJGA 3AP2A 4MCHA 3KYBA 4TWAA 4UZFA 1FYDA 1G5QA 2EJWA 5J2UF 4W9MC 2RB5A 1Q77A 3JAKB 1VCNA 3DE1X 5G0WA 1X7ZB 3H99A 5BQFA 4ESVA 2VTEA 2NU9B 4ND2A 4CCAA 2QPAA 3Q3EA 2H7XA 3Q7TA 3BTUA 3MN1A 1CYDA 5DX0A 4MMZB 3KKMA 3ORFA 3REQA 2M6KA 4FJ0A 3O3OB 1O6FA 2EQAA 1D4ZA 5BW4A 1F2VA 1BMFD 1E1YA 1T5OA 3NBMA 3K0AB 4R8KA 2IK8A 2E5LB 1XL0A 3F4KA 3ZYZA 5KNCD 1DMSA 1D6NA 3KSDO 4CMBA 3EF0A 2P9YA 4X41A 3T7DA 3VPHA 3WRXA 4QIHA 2QN2A 4AYTA 2RI1A 1V26A 3CH7A 3QKRB 3FTNA 4EG5A 1EDBA 5DWVA 2GCEA 2QTAA 2GN1A 4QGHA 3DP7A 2RBKA 5DSZA 3S2YA 1RI1A 1V1MB 4Q4DA 1VIAA 1OB5A 4HDNB 2HIHA 2W4QA 4JT4A 4CF3A 3DM9B 1VJCA 2B20A 4US1R 4YRPA 1RTKA 1SJ9A 3STTA 4OHXA 3N59A 3R9KA 1X86B 2VTDA 3CRQA 2P41A 4FOSA 2GBLA 3FPSA 2B7LA 2RG1A 1AKYA 3IT2A 4FNGA 1T6YA 3TRKA 1XOIA 1XPRA 4DXAA 5JQGB 4RFSA 3GVPA 3AG6A 4HRYA 2XQVA 4ZRDA 4N03A 5GMOA 5CBPA 3W3AD 1Z22A 1XEXB 4MS4A 1B00A 2GAAA 2FCAA 1JHRA 4E11A 5C31A 4BRUA 2YW9A 4CLDA 5I3CA 1JIIA 2PFSA 2VHTA 1JGTA 2ZJOA 2JI7A 3F97A 1U0SY 3A70A 4PNZA 2IZZA 4X90A 5JO9A 1CZKA 1ORDA 3CKMA 3IVGA 1NVBA 4JUBA 4OK5A 3T9EA 1GU0A 3UPUA 3VR5D 1Z18A 3KVNA 4KXLA 4MRSA 4ZRNA 7YASA 2LIVA 3QOYA 3O1HB 1ZNZA 3RSLA 2MR6A 1JHUA 1QRAA 3LPLA 2PKQO 3I3SR 4NE9A 1K8QA 3ZVNA 1NUHA 1ZVJA 3VDNB 4DB2A 1PGNA 4AXBA 4BV9A 2Q21A 1ZJWA 2H16A 5KSOA 2CJXA 1XZBA 3BE4A 4IZOA 3ZWPA 3G0OA 3X1XA 2Q5IA 2Y2UA 5DEOA 1M7BA 4AIRA 5JCJD 1P8JA 5DSXA 1GAJA 1FS5A 1IY1A 5JYBA 2YV1A 1GIAA 2C8LA 3AUKA 2ID8A 2SBTA 4I9FA 1DKQA 3CC8A 3CUKA 1BROA 4TLAA 3L1JA 5DOZA 1DJNA 4B47A 1W35A 221PA 3DHNA 3G2JA 4RH3A 3GYGA 1CRLA 1Z2DA 2Z30A 4P3NA 4TKUA 2Z3VA 4B4UA 3GLFA 1GY8A 2VJNA 2AG0A 3BGSA 5AJHA 4QX6A 5LXTB 3NYQA 5LNK1 2IZ5A 2Y1LA 3AMVA 4G9GA 4NZPA 2OHIA 3EXIB 1Q0PA 3U4GA 1D07A 4A2CA 1JTEA 1N3LA 4JIMA 1IULA 1D7OA 2ZJZA 4QSHA 2YZ7A 3B70A 2BGKA 1HZZC 4CF6A 1IK4A 1IQUA 1PJAA 3EPHA 2D00A 1PR2A 2OLKA 3G59A 2FY8A 4MITA 4XX1A 1ODIA 2M6SA 2JIPA 2GILA 2V6MA 4D9KA 4UPVA 3AJRA 2GAOA 3BS4A 2AT1A 3MS2A 1ST2A 4MR7B 3QLUC 1R88A 1Z5GA 4TZTA 1K3FA 1Z2OX 1I3CA 1RJEA 5EINA 4KWTA 3K4HA 2VHZA 1V0JA 1DS6A 3H1AA 5HOEA 1PK9A 3SJCA 1PTJA 4KRYA 4F3KA 1XXHE 5DRTA 1DC4A 4OB7A 2A57A 2WJJA 1LZKA 2WSIA 2WJ3A 2YMQA 3C3PA 3CEMA 3I9NA 3MFQA 4L3WA 3GH1A 1OV6A 3GA7A 1T5HX 2WF8A 3L84A 4JC0A 4EY6A 4ARCA 2PY6A 3K05A 1NW8A 1UIRA 1Y3FE 4QOJA 1JA9A 2FEPA 4KN8A 2C2OA 4X20B 1L1EA 2C2KA 1RWQA 1R0SA 3RIHA 4ADSG 2OBLA 3VKFA 3OM1A 3RGGA 3L6CA 4MTLA 2QJRA 1Z82A 1JU3A 4NBNA 4O25A 4Q4AA 1HSZA 2Q4EA 3I76A 1BDBA 1EFUA 1NBHA 1Z5OA 3IEXA 3IILA 5CM2Z 5EXSA 1HE4A 5AW9A 5T67A 4AP6A 1GCGA 1YS2X 2BM1A 4KHZA 4UEOA 1ZN7A 2H85A 1KYYA 1AGRA 5CLGA 2C4NA 3TJRA 2XPCA 1OFTA 2NO0A 2RHBA 1KTVA 4MVWA 4WCFB 4WKBA 2BI4A 1YACA 3NRBA 1EWVA 1AZTA 2YUTA 3OZDA 2PNJA 3QZUA 5EE5B 4ABTA 5AJXA 3KAKA 3F5SA 3A9RA 2NZWA 4MIOA 3QSGA 3V8NA 2PO7A 4DJAA 4HAWA 4FYJA 1J2RA 5ER6A 5CIWA 4C14A 4MMXB 5KOHB 3O92A 4AZ3B 3T3IA 4R31A 3IQDB 4B6FA 1TYEB 2P77A 4OD0A 2WAMA 1EJ6A 4RAOA 2NZ2A 1YI8A 1G9XA 1KH2A 1CY0A 2C98A 2B0CA 1RRVA 1TM5E 2P6RA 1E7RA 1ZMXA 1L7AA 3M3PA 4HADA 4Z7JA 4XIGS 3BXOA 4UHCA 5EXDA 4QATA 1S96A 3QW4B 3SQLA 1S8AA 1IXSB 1OI4A 3KXIA 5ARCA 1XZGA 3N87A 5KB3A 3K92A 5KQRA 3F5MA 1T15A 1U1FA 3ZWVA 3FCSB 3IPRA 1QONA 1N1DA 3HU2A 3OLWA 3Q4GA 2QJTA 5JXHA 2QAIA 3R0IA 4V0OA 3SHOA 2FN9A 3WFZA 2HCBA 5CK5A 5J4YA 1HE5A 1R16A 2N0SA 4FFWA 4YIKA 4MW4A 3G1WA 1HTWA 3CNLA 3OM0A 5BWNA 3L4KA 3ZWQA 1IUNA 2Z58A 1IBKB 2VEOA 4IKEA 5CH8A 3PKIA 3TKAA 1MJNA 3WIEA 5JNVA 1C2YA 2OGZA 1VHWA 3KTAA 5EHQA 1YUBA 5TEVA 2XE6A 4JDPA 4AX8A 1EFRA 5EYPB 5AM3A 4YQYA 3RC2A 2CCKA 2NLOA 4ZOAA 3S3TA 4CM8A 4E94A 3F7MA 5BUCA 2C54A 1NRWA 2J87A 1DUIA 4YCLA 3BA6A 4CTMA 1FJHA 1SOUA 1UMCA 2A5FA 2VZLA 2Z3ZA 3BHJA 5YASA 1WTAA 2A7XA 4GXQA 4BBPA 4DA7A 1W36B 2YNMA 2REOA 1I3KA 2XZOA 1ZCZA 4S1NA 4UFNA 3AI7A 1OYOA 3W9UA 4E7PA 3UG6A 4KMRA 3CXRA 2VA8A 4OA8A 4FN4A 3G9UA 4BDSA 1XAIA 1OZ0A 4R7TA 2HGSA 3FZEA 3S55A 1UXIA 3KEFA 4JV5B 3H8WA 1EK0A 1R5OA 2NM0A 4HN9A 5DN6A 2P0EA 1NV8A 3L6OO 4JLVA 1Q0UA 3TFOA 5BN4B 4WFJA 1KO7A 1PNTA 4Q4HA 4UNPA 1FVHA 3NWJA 3GP8A 3KSAC 1F20A 1SHJA 4B33A 4EBBA 1EVJA 1H2XA 2ONJA 1SCUB 1KARA 4KQ2A 2FRVA 4CGYA 4M3NA 2J6CA 1UBTS 5I9IA 2BTQA 4UUPA 4HATA 5FR2A 3SC2B 3VHQA 3EQ2A 3C5CA 4JL5A 4MS1A 3W2EA 5K3EA 2PCJA 1HYQA 1I0IA 5CRIA 3TW0A 2Q0QA 3ADOA 2Y92A 4FSDA 3UGKA 1QP4A 2X9QA 2AKEA 3IPAA 3CUEF 4EY3A 3PTAA 1H42A 4OB8A 4XWAA 3EHEA 3H2YA 4YCCA 4E6PA 1NJ6A 4CCWA 4XPIA 3W2HA 4W9NA 3C3XA 4CM3A 1E89A 3U80A 3F1LA 4C7VA 4PIMA 1S6YA 1VIDA 4NCXA 1NJ2A 2GQ0A 4KXVA 4UD2A 4AQYB 2YS6A 3KB2A 3NYRA 1XHLA 1PGJA 1GU1A 2AYXA 5DYWA 5EZYA 1QRDA 1A8UA 3QXJA 3QE2A 4GR5A 4QXRA 3WGVA 5IDVA 2MDTA 1EZ4A 1PJBA 4P98A 3TKLA 1BWSA 1RRFA 3VPAA 4JROA 1L4FA 4C7XA 2ILVA 3PGXA 1CUAA 4GKAA 2WJGA 4JT2A 1E9EA 3FI0A 4U6NA 2B1IA 4EW3A 2VJPA 5D7BA 2NO9A 3V3KA 1E2GA 4K9DA 3RD5A 2DR3A 3PD0A 1BXGA 3R3WA 4TRRA 3VX3A 1KI1A 1MKYA 1LJLA 4ZT3A 2HU2A 1T8WA 2D62A 2QZ9A 2NTYC 2E4ZA 5DP1A 1PKEA 1TMOA 1UBOS 4YMTA 5I7EA 1ZMRA 3UMVA 2YWJA 3K2QA 4JEHA 4LECA 1JAIA 3A26A 3K0HA 1P0FA 4N5DA 3GGOA 1EK1A 1I1NA 1Y6RA 1QE5A 2AGVA 3D8UA 4S1TA 1CY1A 4NMXB 5ALHA 1ORVA 3QOFA 5SZHB 1N0UA 1Z25A 3WI7A 4FZJA 4E4YA 2G0NA 2FQXA 3ZWDA 4X3PA 5A02A 4KAXA 4CBVA 3E7DA 4MKXA 1Z0FA 1FBTA 4G24A 1M73E 5CB6A 5IAOA 3LTNC 1QCDA 2I2DA 3D0KA 2FZWA 4Q16A 5FNVA 4BJ5A 5ESRA 5LQMA 1RAAA 2R65A 1VE5A 1G66A 3I9V1 4LGVA 3I0NA 4RQTA 1YE3A 4YMGA 4NXNB 4CM5A 2GGSA 2VDRB 3PUJA 4MKGA 3SSNA 3VR4A 4AQ7A 5IJ9B 3O8LA 2PL9A 1L8AA 4C89A 4ITRC 3N7TA 5DTJA 1TYBE 2Y1OA 5LBIA 2V6GA 3EGCA 2G09A 3LUBA 1GNTA 4A91A 4MGKR 4PYRA 3ZWCA 1UFRA 2OTCA 2DAPA 4NCBA 2EBUA 3L0SA 1FVXA 2EX4A 4FDTA 3KM0A 1NYRA 2WFAA 1T8RA 3TK1A 4CM9D 2PXHA 4D9IA 4YRGA 2Y1XA 1U8YA 4GZ5A 3BMCA 2QLFA 5LMZA 1X94A 4YRAA 3DMRA 1NVVR 4NOJA 1MPXA 2IKQA 4AN1A 1RWNA 1EUDA 1SB9A 4JR1A 5H82A 1L3BA 2BT4A 1X80A 1H6AA 1LF0A 4QYMA 1FUUA 4K9OA 2O23A 2ZCVA 1M0TA 3M6IA 2VF7A 3M89A 4MSUA 1ZHOA 3GAZA 5K0JA 3GD7A 3OFVA 2QRLA 4A16A 3JQ7A 2J9XB 1JU9A 5EJ7A 1T5TA 1HX7A 2WUWE 4UM7A 4C0HA 1WNFA 2J0VA 1JEDA 3WK4A 4BP3A 1YB2A 3CUSA 5A1JA 2Y05A 5FWXA 1EUZA 1OZHA 1JHMA 2GPSA 3F6RA 3K1AB 3WSTA 2VHVA 3B8HA 3K96A 4I7EA 3VI4B 1M1NA 2V65A 3O8DA 2WWGA 3BTOA 2ZEJA 3QFRA 1VMIA 5CJ2A 3R7WB 6CHYA 1K5HA 2D5IA 2WAAA 3KJQA 3F6BX 4NZYA 2WRZA 3COYA 2G0TA 3HWX1 4JP5A 4R2KA 2O2GA 1U28C 1ONPA 4CT4B 1WXWA 1FS6A 5H4GA 3CUTA 4QELA 4EGQA 1BDHA 2Z5LA 1UBHS 4G97A 5ECGC 2HRDA 4TMWA 1S5PA 1WAMA 3BCUA 1C0LA 3ONFA 5JAZA 3K9FC 3ZU4A 2J7PD 5AM5A 3AKEA 2H48A 3TLCA 1RQRA 2QXUA 4AJKA 1N9KA 4D3SA 1NR7A 5EERA 2JDIA 2ZBDA 4Q00A 3FCXA 4FKZA 4J94A 1ZGCA 5KMGA 1J39A 1H0RA 2IZ1A 3RYIB 3FDZA 2YY6A 3PQFA 1Z0ZA 4RD2A 4WKNA 3P0FA 1XWFA 4W82A 1YL7A 3WBKA 3ZWWA 2QVXX 3TRDA 2RHDA 1TM7E 3M4XA 4BZQA 5IX8A 4LVOA 3MGKA 4YMSA 3C8ZA 1UEIA 5FNVF 1KEWA 1JE0A 2H57A 2WLTA 3Q7PA 4LNUB 5L3ZA 1F17A 2KX7A 3EFBA 3GAFA 3MUFA 4K3UA 2GD2A 5AM4A 1XTBA 3QWAA 2GFQA 4GMGA 4BGIA 1PF7E 4BP9A 4P93A 2QB5A 3I83A 3JALB 3VHLB 1QGDA 2P6OA 3Q3JB 1XQXA 5FPSA 1WD5A 5LDDC 1V9CA 1YZQA 2Z6VA 1TC2A 1TJPB 2NU7B 3TWOA 3VHXA 2OILA 4ALIA 4YRMA 1AQIA 2D3WA 4E4TA 4D25A 2WKWA 3GJ8A 4F9GA 1FUIA 1ULAA 4X45A 2ZSIA 4LQLA 2AN3A 5K0TA 4AROA 1HBJA 2Q29A 4PNHA 4QXQA 2WB4A 4MLPA 3KZXA 5FOUA 5DF1A 1HL7A 1W25A 4Q0MA 5K6TA 5IWAB 3ACDA 4KQMA 3MEQA 4CMAA 2EFJA 5FF9A 3MWDA 2WW8A 4UATA 3AVXA 3CX7A 4MEJA 3ND5A 3RWBA 1KPHA 4JLWA 2V5AA 1P7CA 1O95D 1BO6A 1HXHA 1BKYA 3I1JA 1ITZA 3IDFA 2IQIA 3NWPA 4FYXA 4URUR 4BCCA 5ITZB 1K06A 2C2WA 2OQIA 3WJAA 4EM6A 1P4RA 2D7CA 4H7PA 4UQOA 3OSUA 4N8DA 5CLIA 3RHSA 3SIXA 2PGLA 4EB3A 1GQYA 3KSRA 2C5AA 2AE2A 1BCSA 1UBMS 2I2CA 4NFHA 4ZOEA 2OHOA 3HCWA 2AV6A 2PSEA 5CH5A 4CG3A 3R5HA 3U40A 5ILQA 3HABA 4OHMA 3FYSA 4LHVA 1CJBA 1N7GA 2YYSA 3HKEB 5LD2C 1SUCA 2IEAA 5GP1A 4FMDF 2R0QC 3GNQA 1JPNA 4IBOA 4KSBA 4IIVA 3T5BA 3EEFA 3FTEA 3G2IA 5I8ZA 4C4RA 3VTFA 1GZSA 2HSZA 4BRWA 1THMA 1XI2A 5J4LA 1YIDA 3F9RA 2FG5A 3D4PA 5TB5A 3DCYA 1KNQA 1SIOA 2WWWA 2Q6KA 2P6UA 4QYSA 4AP9A 1C9MA 4UTZA 1OXUA 4U3JB 4FOTA 4ISBA 1PEAA 3UXYA 3TX6A 1YVDA 5ENVA 2CGEA 1TQ8A 3H13A 1F8UA 4GPEA 4X00A 4BQNA 4EL0A 4B8YA 2PN1A 3LT4A 4H0FA 4CRWB 4Z49A 3CJRA 4FHDA 5BQXA 4V0QA 4IS3A 1T3LA 5REQA 2FRXA 1LEHA 5LWHA 3TL3A 4Q3AA 4RE6A 2CVHA 3FX2A 5TQ0A 3ABIA 5KHAA 2X0FA 3DAOA 3FWKA 1W36D 4F9EA 1AHIA 4NV0A 1L6RA 1WB4A 4QNMA 2O2EA 4WQMA 3P97A 2I2XB 4GOXA 4ARVA 2PS0A 2ZYDA 2B36A 4FU0A 2O8CB 1VKRA 2H5LA 4X62B 2WOJA 3AGPA 5A4DA 3WLEA 1QWOA 1JEQA 2OL4A 4E14A 4LFAB 2O59A 4FZ5A 2FHSA 1W87A 4HNAB 5EXEA 4IV0A 1DPGA 1RP1A 3KTOA 2V1XA 4ARZA 5FLYA 1ESEA 3LYHA 3DPIA 4UOQA 1ISRA 1D0VA 3NCTA 2J3QA 2PH7A 3EYWA 5KU7A 1Y8QB 2QLNA 1CCWA 1DRVA 5LMUB 1Y89A 2Q5LA 2XQJA 3AFOA 4IGAA 2C9MA 1PR1A 1N34B 4DAOA 3OTIA 3UB3A 3D8TA 4KV7A 2NVUA 5DGTA 1XZPA 3D7MA 1GCUA 1RW4A 4EUKA 1NMSA 3DL4A 2CJYA 2DHRA 1KU0A 5LUAA 2D59A 1X7HA 1E1NA 5P21A 2SKEA 1WPXA 3IJPA 1GA6A 3TZQA 1VKNA 4RCZA 4RIIA 3P0JA 4CYMA 4LWZA 2VSOA 4W7HA 3TNFA 3H6HA 1E3TA 1RI5A 1AZLA 3AHHA 3G9TA 2B3TA 3L05A 1K1EA 4HK4A 3FUVA 1E8MA 3T5AA 2NSLA 2JIOA 5I9BA 4DL9A 2RJ3A 1ZNQO 4JOSA 4A0GA 3WVNA 5IANA 3IO3A 1CVLA 1GWNA 2IUEA 2VPIA 2MYNA 1XKLA 2I4LA 1SCBA 3DLHA 2GD0A 1KO1A 3ISTA 4YI5A 3G0HA 2H1IA 1GUBA 4L0DA 4FC6A 4ZHQB 4JLJA 4A2WA 2I6QA 3UJ8A 1UJNA 3M82A 2EEZA 3EXHA 4I5IA 3WBBA 3AVVA 2UZ3A 3HDGA 2IYAA 1E8NA 2C5LA 1JHDA 3T0IA 4D4IA 1DKPA 1RKVA 3GP5A 2EFEB 2Q5OA 2AXNA 2Q6VA 4HWPA 4UVEA 3ZQJA 4C0BA 3GRZA 3JQAA 3R5XA 3Q1LA 4RXTA 3KK0A 3L7JA 3WB9A 3SKXA 4CM4B 2GYYA 1E0JA 1IZYA 1U7HA 2B4TO 2HJWA 3LAWA 5FO0A 4DKXA 2ZYVX 5THQA 4D4LA 5L51A 3FMFA 5AHXA 4N3GA 1NRIA 4DC9A 5IMSA 3D31A 3VNQA 4DR1B 4YRSA 2Z6QA 3SD7A 2NNLD 1MAHA 2W6MA 6REQA 1UEXC 3I6IA 3R3XA 1S1MA 2ZE8A 3O4RA 5KINB 2IEBA 5I9SA 3WGTA 5E8JA 4HYTA 1Q1NA 4EGAA 1GCIA 2BFPA 2D7JA 4FYMA 3N6RA 4CMEC 4BE4A 3S1LA 3U7FB 2DFTA 2YIVX 2H2GA 1IZ7A 2PKYX 2V3WA 1DC8A 3A6HA 4RTMA 3QWBA 1QQ6A 4J90A 3JARA 2M6LA 4X8OA 2HNBA 3CH6A 2I4RA 2O3SA 2PXXA 4JOBA 2N47A 4C6RA 2BKUA 1A8SA 2VBFA 2H0RA 2ZR8A 3AINA 4QYIB 3RRFA 1OYYA 1XJWA 1KFKB 3JR7A 5LQJA 2JGAA 3QIVA 5TT1A 1O9GA 2QTTA 4LYYA 3B7GA 5HQ3A 4IUCS 1TZBA 3OCXA 1T2CA 3FVRA 3INNA 3K72B 3URKA 1C7ZA 1M2VB 1U5AA 2HSGA 3D2CA 1M3SA 2WJHA 2P3OA 4LJ9A