1R4ZA

Bacillus subtilis lipase a with covalently bound rc-ipg-phosphonate-inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed Evolution of Bacillus subtilis Lipase A by Use of Enantiomeric Phosphonate Inhibitors: Crystal Structures and Phage Display Selection
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase
total genus 63
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r4zA00
1XZCA 3ICVA 3W2TA 1R3DA 2X8BA 1DWOA 1GQSA 2QRUA 1KEZA 5AKEA 3HJUA 3N2ZB 1BROA 1IVYA 3LIIA 1A7UA 5E4JA 2CEKA 5AO9A 3QPAA 2XQJA 2OAEA 4CG1A 4N8SA 1CUBA 2G63A 4FLEA 3PUIA 1TQHA 1E8NA 1YSCA 1HL7A 3FYUC 1CFJA 4J0GA 2J4FA 1TIBA 1RP1A 1GKKA 3WLAA 4X94A 1LPMA 5AM4A 4AO6A 4GI1A 2GYWA 3I2HA 3WKDA 4ZREA 2PUJA 3ANSA 1EDBA 3KXPA 2CUTA 3WL7A 3MUNA 1CUFA 3L1HA 2IIVA 4N8DA 3GZJA 5T4FA 5ALVA 4UFNA 1EINA 4DNPA 3G9XA 4RE6A 4UHFA 1F0NA 1AQLA 3WK4A 3IUJA 2ZYSA 4J7AA 2C0PA 4BZZA 2Z8XA 1WPRA 5JAUA 4BAGA 1LPSA 3QYJA 4G4GA 4N8EA 3D2BA 4BDTA 4Q3LA 5IVDA 1OCEA 3FWHA 5ALEA 3O95A 1XLUA 1LPOA 4DIUA 1BCSA 1KU0A 3HC7A 3JWEA 4LYDA 4OU4A 2QUBA 1NU8A 3WWEA 5HFNA 1G42A 4BAUA 2VJCA 2DHDA 4BVJA 2HFJA 2W22A 2PBLA 3VJLA 2ZSHA 4C4XA 2XMRA 4EY8A 5AKIA 5EI5A 5K3FB 5AI4A 1LBSA 1H2XA 5CT6A 4TPKA 1EH5A 1XZHA 1QZ3A 2WHPA 2AXEA 1MAAA 4TVKA 4QDOA 3HACA 3VVMA 2OPHA 3FYUB 4QA9A 2Y1KA 2Z5GA 4EY6A 1M33A 1DQZA 2JGEA 1W6RA 3AIMA 4I4CA 1CPYA 2Z3ZA 3AINA 2O7RA 3WI7A 5ISMA 2WU3A 5AP9A 4AXBA 5CH3A 2BJHA 3DL4A 2XMQA 5A71A 3WWPA 3M83A 3CN9A 4U2EA 4IH9A 5DTIA 4KYVA 4Y2SA 2RHWA 5DJ5A 5CH8A 1XQYA 3A6ZA 1CUIA 1H2WA 1XLWA 4O08A 2PPLA 1YA4A 5HQ3A 3ICWA 1E3QA 3KDAA 4MXDA 2WUGA 4BVKA 1CR6A 2PU7A 5AK3A 5DYTA 3WK5A 2EDAA 5SYNA 2GYUA 1WB4A 4UBMA 4B83A 3U0VA 3IA2A 4KR0A 1UK6A 3R3VA 2BGRA 3STXA 4AO7A 4BE4A 4DGQA 3V48A 4ARAA 1J07A 3BL8A 4JEIA 4QWMA 5AI9A 5EHQA 4Q05A 5FP0A 5FLKA 4FOLA 1L7QA 2WLSA 1MPXA 1ODCA 3LCRA 1UK9A 3HABA 1NU6A 2WHRA 1EA5A 1ZI9A 3CCBA 2YYSA 1WM1A 5IVIA 3STWA 3TGLA 3OOSA 1AX9A 2XMDA 4DMFA 4Q34A 5ALMA 3VJKA 2HADA 3GA7A 3DYVA 4LXIA 1XQXA 5C8XA 4H18A 4CCYB 1ZGCA 5LKAA 2OG1A 3BDIA 4GBGA 3C6BA 5EHXA 4QE3A 4G1FA 4HS9A 1GPKA 4ETWA 1BRTA 4PF1A 4G4JA 3A2LA 5JD6A 1QTRA 4P08A 3H18A 4XVCA 2VEOA 1LGYA 5AM1A 5ALQA 4DNOA 2FUKA 3E4DA 5EHZA 2BAGA 3E1GA 4LXGA 2QOEA 4BC1A 4PSDA 5AK5A 4G8DA 4U2CA 5HFAA 3Q8WA 3Q0TA 2PM8A 2VAVA 4DYHA 3DD5A 1SOMA 4H7FA 3BIWA 1THGA 1G5FA 3H2GA 4C6HA 2B20A 5CT5A 4GXNA 3FSGA 3UUEA 4OD0A 3EQ7A 5AM5A 3VISA 2WG2A 2HA0A 1TKRA 1UOQA 3DJYA 1FFEA 4WFJA 4GECA 3RM3A 1VZ2A 2AJLI 1CIJA 4PNZA 3OG9A 3STTA 3L1IA 5J3JA 1JKMA 4AZ0A 1DX6A 5ALLA 1CUYA 2RIPA 1UWCA 4UBNA 5JAHA 1ORWA 2JBWA 3WKCA 1ZD5A 4RNCA 1TRHA 2WFMA 4NMWA 3V9AA 1JMKC 4LYEA 4EY4A 1VZ3A 2PSEA 1Y7HA 4ROTA 5AI8A 2GBCA 1VLQA 4BZWA 1ODTC 2ECFA 4QLAA 1DQYA 1BS9A 3B12A 1BE0A 2XQFA 3TEJA 2B61A 5JD4A 2PSJA 4LIPD 4BE9A 4UHHA 4KRYA 3O0DA 4LXHA 1ZOIA 1H23A 4TGLA 4WFKA 1DWPA 2XMSA 2XMGA 1ZI6A 4Y2YA 4X6UA 5HKBA 4XIIA 5C8ZA 2XUKA 1QFSA 2JEYA 3D2AA 4FLFA 1QE3A 4X93A 2O2HA 4HZGA 1PJAA 4BRSA 5KREA 4YK7A 4MEAA 1TK3A 3K2IA 3PF8A 1C7IA 1CUUA 5LZ7A 4YASA 2QZPA 3G0IA 5EHNA 2YH2A 3STVA 1ZD3A 1XZBA 4L9AA 2DFPA 3QMWA 3GELA 4IH1A 4J0KA 5ALHA 3AIOA 1T2NA 1VKHA 2VAXA 2XLCA 2JF0A 4UBLA 5H3HA 3BF7A 2V98A 2J3QA 2PSDA 1QO9A 4G9EA 2ACKA 1AURA 3QITA 2G5PA 4UBIA 3O9MA 5D6OA 3IUQA 4KE8A 1VE7A 4MQLA 2CKMA 2HA4A 4H7IA 1GGVA 4W1SA 1CUDA 1HQDA 5ALTA 3FBWA 1TCBA 4UUQA 3QZUA 1WOMA 3M81A 1E5TA 4Q3KA 2WUEA 1YA8A 3QPDA 3R3UA 1QO7A 4BTLA 1RYYA 1YB6A 4KE7A 5K3CA 1H2YA 1TAHA 2C5GA 2H9YA 6YASA 2QJWA 1P0QA 3WKBA 2BUBA 3O4GA 5C7YA 3TRDA 4HXFB 3PI6A 4MEBA 3VVLA 1TCAA 2V96A 4OYYA 4BBZA 3D5EA 4FTWA 4U2GA 1UXOA 1QFMA 3R40A 3ZLVA 4CFSA 3STYA 3BIXA 2R11A 1BN6A 4FDMA 1AZWA 1CLEA 2CBGA 1P0PA 3LLCA 2BFNA 2OCKA 2H1IA 2DR0A 3FLEA 1UKCA 5A6VA 3DLTA 4FHZA 4XWGA 2JGIA 4ITVA 5I7UA 1USWA 5AI5A 1JFRA 3RARA 1C7JA 1EX9A 3AUKA 1LBTA 5AKKA 3WIBA 1F0PA 2EEPA 4PV7A 3PICA 3VJMA 1CUVA 4YX9A 4OYLA 3MUOA 5JANA 1ZGBA 1UK7A 4Y2TA 2H7CA 1GPNA 3WK7A 2HU5A 2WFZA 5AK4A 2VTVA 4FBMA 5FPPA 1R50A 5FDFA 1LPPA 3R3XA 1Y7IA 1UK8A 3OTQA 4J0HA 4CIAA 4B6GA 2OLEA 1XZMA 1CVLA 1QIHA 3ZLTA 3JYHA 3IDAA 2R8BA 2DCMA 4JNCA 4BP8A 4WDRA 2WIKA 1LNSA 3CN7A 5HZGA 2ZYHA 5T4EA 3V1NA 2DQYA 2I3DA 1LZLA 4K5QA 4X7BA 2RGUA 3BXPA 3W9BA 5D3KA 5CBKA 3WWOA 5FRDA 3E0XA 2HA2A 3ESBA 1YCDA 4Q1VA 2PSFA 4JYMA 5DWDA 1C4XA 1FFBA 5E4YA 1Q0RA 4BB0A 5AKLA 4CCYA 3A70A 1XZEA 2QT9A 3I2JA 3V1KA 3DOHA 1CUEA 5LP1A 2RONA 1YASA 4A5SA 5HKAA 4QDZA 2QJRA 5EIHA 1XZKA 2Y2UA 4EZIA 3W06A 4KE9A 2RHTA 4W9RA 1WB6A 4C89A 4QWWA 1YR2A 5ALFA 4EA6A 5LKRA 1X70A 1DWQA 4W1QA 3EQ8A 5AOAA 1J1IA 2WM2A 2XUJA 1YAHA 5CW2A 4P9NA 3PFCA 3WJ1A 1K5PA 3DCNA 2X5XA 1WHTA 4MWSA 4GLBA 5JAOA 4UHCA 4GHWA 2QKYA 4B0OA 3IUNA 4INZA 5AK6A 2BGNA 3DYIA 3F98A 1MO2A 2B4KA 1W75A 1GXSA 3VKFA 4P92A 1K4YA 1HLGA 1QJ4A 4MYSA 1J2EA 4UPDA 3G9TA 3LP5A 4G8BA 2ZSIA 3D59A 2ES4A 5JARA 4G4IA 4H7HA 4X6XA 1R4ZA 2Z8ZA 3I6MA 3FCYA 1IZ8A 2ROQA 3S8YA 2VT7A 3G02A 2BUCA 2QR5A 3JW8A 2D5LA 3AIKA 2RAUA 4G9GA 4B0PA 3I6YA 5JD5A 1R88A 5AKYA 4I19A 3WL6A 5AI0A 5EIEA 1QIEA 5DTJA 1W52X 3H0CA 4QDTA 1NX9A 2QMQA 4X71A 2GBFA 4F60A 4Y2QA 5JAPA 1AUOA 3F67A 3ZI7A 1XRMA 3WWDA 3H2HA 1WB5A 1BCRA 1FSSA 1AKNA 4X90A 4KAAA 2DHCA 4FNGA 1XZFA 5HK9A 4FKBA 5CT4A 3TJMA 3BJMA 5BWCA 3HZOA 2GBGA 1SCKA 2K2QB 4B84A 4EB0A 3G9UA 5DNVA 1SCQA 3QMVA 3C8DA 1VXOA 1ZJ5A 3N0TA 2WJ6A 2ZJFA 2XI4A 4Q3OA 2WSLA 2XUHA 1E66A 4MQMA 2CB9A 4B9EA 4WY8A 2WG1A 4PO3X 2JGJA 4BC0A 1XZJA 5HF6A 5ALGA 4N5IX 2OGSA 3BJRA 2WUFA 2OCGA 4X00A 1YB7A 4BTVA 2VJDA 3GROA 4PSUA 2XDWA 4L72A 1QGED 4JH0A 3SC2A 1F6WA 3A2NA 4F21A 4OPMA 3ZLUA 4DMCA 2HM7A 2PL5A 3FLBA 1YS1X 3HI4A 1LPNA 4Y9SA 4PQEA 1VA4A 4S0XA 1MT3A 1XZIA 4LHEA 3H17A 1XRNA 1XZGA 1GZ7A 3MGAA 2WUDA 2QXTA 4M0FA 4IH4A 4J0CA 5AI6A 2HHAA 1DX4A 5ALWA 1MX9A 3F8SA 5AIBA 2VT6A 1GQRA 4H7JA 4PW0A 1FFCA 4FFVA 3R0VA 1ODSA 3AZOA 1ZI8A 2ACEA 5JYCA 1EK1A 3FAKA 5AM0A 3R3ZA 4E11A 3AILA 4Y7DA 1MTZA 2HU7A 3DKRA 1EHYA 1XZLA 3I2GA 3GUUA 2X76A 5ALNA 4B80A 4B81A 4JUIA 4Q82A 3C6YA 1H22A 5AKZA 1CUWA 1EXWA 3PUHA 3KWJA 2XB6A 1BU8A 2IITA 1WCYA 2PUHA 4BCBA 5ALXA 5IVHA 4KE6A 3ANTA 3RKSA 1JJFA 1ACJA 2XLBA 2WIFA 1CUSA 5DYWA 3O4JA 3IIIA 4GWLA 1UZAA 2NW6A 4AQDA 4AN1A 3VXKA 1QIFA 3DEAA 5C8VA 5AICA 2PVSA 1Q83A 1E8MA 3O4IA 4XJVA 4BAZA 5AM3A 2DHEA 1A8UA 5CXXA 4MJ3A 1QLWA 5JADA 2WTMA 5D3ZA 5JASA 1EK2A 3ZPXA 3WMRA 3H1AA 2VJAA 3HXKA 3EIOA 1QONA 1AMNA 3FCXA 2CMFA 3A2MA 5ALSA 1ACLA 1QIIA 2CJPA 2JEZA 2JGKA 4Y2JA 2P8SA 3F96A 5HCUA 5CT9A 5HK8A 4GW3A 5ALOA 2QM0A 4ZXFA 7YASA 3SX4A 1HDEA 5CRIA 2XQKA 4ZWNA 2PKYX 5AOCA 1N5MA 2W6CX 3QPCA 3DL7A 4AMYA 2J4CA 1JMYA 2I3ZA 1AGYA 2WJ4A 1UFOA 4W63A 5T4BA 3WK6A 1XRLA 3UMJA 4H0CA 1N8SA 2E3JA 5K3DA 4BRZA 2HA7A 2WHPB 3D7RA 3FSGD 1DTEA 1XKTA 5JATA 1MN6A 5FV4A 3M3DA 4KACA 1N5RA 2GZRA 1Z68A 2OCLA 4IHAA 2IX9A 4BVLA 3FOBA 4CCWA 2I03A 1XRRA 3PDCA 1IUNA 4KAFA 1I6WA 2H7XA 4G8CA 4FFWA 2XMZA 1JJIA 3NWOA 4J3JA 3W05A 4Y2XA 2DSNA 4B7ZA 4EBBA 1S8OA 4DLNA 3PE6A 2PSHA 5ALRA 4BP9A 5AHXA 2JGFA 1MNAA 2OGTA 1IZ7A 3W04A 2QUAA 3IB3A 3AFIA 4X95A 2VQ6A 3HYSA 3AZPA 5LZ2A 3U1TA 4X85A 1VE6A 5LZ8A 2AJCA 3I1IA 4ZRDA 1MJ5A 2WIGA 4BDSA 5FUMA 3YASA 4CIBA 3G0CA 1TCCA 1CUJA 1LLFA 1DU4A 3WA7A 1GT6A 4AO8A 5DLPA 3C70A 4K6HA 4HRYA 2C7BA 2XUQA 3G0DA 1X2BA 4B9AA 2C0QA 3H2JA 2XUIA 5A7HA 4IQ4A 4N5HX 3O9VA 1U65A 1H2ZA 2XMCA 4WJLA 4B82A 3EQ9A 4DTCA 3C43A 2XQIA 4UHBA 4AZ3A 2XUPA 3H2KA 2HDWA 1JU4A 2WQZA 3DOIA 1EDDA 2HIHA 3G0GA 4FNMA 4C4YA 2OXEA 3M82A 1ISPA 4BATA 1W4LA 1Y37A 3UUFA 2B9VA 2Q0XA 2WIJA 5BV7A 1GPLA 5JIBA 3C6ZA 5F4ZA 5KWJA 2WJ3A 4Y2VA 2BUAA 5E4TA 5HF8A 5LZ9A 2ZYRA 3HLKA 1CV2A 2QS9A 2WILA 1UOOA 3NGMA 4CI9A 1FJ2A 3IULA 1U2EA 1IUPA 3FVTA 4UHDA 3D4LA 3GFFA 3ESAA 2XQGA 4W1RA 4UBKA 5HF9A 3IURA 1T4MA 1QIGA 5K3BA 5AKJA 1YS2X 3WK8A 4FLMA 4WCVA 5K3AA 4RPCA 1WPXA 4GEGA 4GDMA 3PFBA 1KU6A 3W9UA 4QNNA 5AM2A 3H1BA 1EB8A 2VF2A 4KAJA 4H77A 3C5WP 5LIPA 1CRLA 4UHEA 3WYDA 3QVMA 3T52A 4FBLA 1OILA 3ZWQA 5EGNA 2O2IA 3C87A 5SYMA 2ORYA 2ZJ6A 4OUKX 5D7BA 4UBOA 5BWBA 4F0JA 1E8DA 4OSEA 3DQZA 5HQ3B 1QTIA 1X2EA 5A7FA 2XUOA 4E15A 2OAGA 2HL6A 3GBSA 2QXUA 4QDXA 1DINA 1JI3A 1P0IA 3STUA 5JZSA 4LKOA 4E46A 4H35A 2HRQA 4NVRA 1EB9A 2DQZA 4UFPA 1SC9A 4AB1A 2WU4A 4OB7A 4K6KA 1EDEA 4CG2A 5ALKA 3HRHA 1LZKA 3F9CA 1W1IA 3KWFA 2OGZA 4C87A 5ALUA 1RWQA 3WKAA 2XUGA 1O6FA 1LPBB 3H19A 1G4HA 2FJ0A 3WYNA 1GKLA 3K9BA 2GZSA 2BCEA 4QDUA 4E14A 1BN7A 3WA6A 5ALZA 5LLSA 3I28A 1BEZA 3SWWA 1F8UA 2XUFA 4OB8A 1QIDA 4UBJA 3S2ZA 1OXMA 2O2GA 4MYDA 5AOBA 3P2MA 1XKLA 2ONCA 3G7NA 4X3CA 2VATA 2D0DA 3I2IA 3K6KA 2WG0A 1EVEA 5ALPA 5ESRA 1XQWA 3QM1A 4NZZA 2BKLA 4ARBA 3EF3A 3KD2A 4JYPA 2EDCA 1U4NA 4DNFA 2Y6UA 1CUZA 1IUOA 2WFLA 3FVRA 3CXUA 2XUAA 2VSQA 3RLIA 1UKBA 2JGMA 5ALIA 2FJPA 2Y6VA 3D2CA 4C4ZA 4X6YA 3ED1A 1HBJA 3OC0A 2WIDA 1MNQA 1CUHA 1K6EA 4WDQA 5FPQA 1XFDA 3F97A 5ALDA 4V2IA 2AJBA 4BCCA 5AJHA 4C01A 1SFRA 3OM8A 2XMBA 2HA3A 4B85A 1CQWA 5FXMA 2WKWA 3DDUA 1QIKA 4I3FA 3OURA 3R3WA 3LIPA 3FYTA 3D3NA 2HRRA 3SK0A 3IBTA 2OQIA 2PX6A 1CUXA 3X3HA 5A62A 2JGLA 5YASA 4DNQA 5EIAA 4DSZA 3ESDA 1A8SA 4K2AA 2HU8A 3NUZA 4D9JA 3FYUA 5IH7A 2XE4A 3DS8A 5DNUA 2Y2VA 4HAIA 4OU5A 4PSCA 1VOTA 5HF5A 1Q84A 1E89A 4IO0A 5CXUA 3IVMA 1K8QA 4RE5A 1VJ5A 3I6ZA 1CUGA 4ZV9A 1R1DA 1VA5A 4EY5A 1MAHA 5K5EA 4U2BA 3HSSA 1FFDA 1HKHA 2WTNA 2I78A 3ZV7A 1AC5A 1B6GA 3R41A 1Q0ZA 1CUCA 4UFOA 2G4LA 4M0MA 4KEAA 1UOPA 4ZI5A 1XQVA 5IVKA 4P93A 2QVBA 3WZMA 5C81A 1UKAA 3BE8A 3I2FA 1JT2A 3T4UA 4H7DA 3I1YA 3FLAA 3WQHA 1P0MA 2PU5A 4Y2RA 2CZQA 4L0CA 3CCCA 2RI6A 4A16A 3KOOA 2GYVA 1B41A 2O7VA 3BF8A 2HA6A 1D07A 1FFAA 3C45A 3RK4A 1JU3A 3WJ2A 1DT5A 5A2GA 2YXPX 4FWBA 2AJDA 3WL5A 1SCIA 5LZ5A 1K63A 3LS2A 5K3EA 4OCZA 4M0EA 5FKJA 2V9ZA 2VA9A 3WKEA 3BWXA 2OCIA 4G5XA 3V1MA 4C88A 2C5FA 5ALJA 5CMLA 3BDVA 1A88A 1VXRA 3AZQA 1QOZA 5K3FA 2G5TA 4EHBA 4W1PA 2WFLB 1L7AA 4F5ZA 5KWIA 2H7YA 4CG3A 5ALYA 3WWCA 1XRPA 3V1LA 4YPVA 5AH0A 2ZYIA 3DKKA 1N1MA 5KBYA 4MWTA 4Z49A 1A8QA 3EBLA 1ZD4A 4Y2PA 2GBIA 3FNBA 5FOQA 4BYMA 2XUDA 4J03A 3O4HA 1J06A 1U8EA 4WY5A 3PF9A 4U2FA 4DMKA 4QLOA 5CURA 3ILSA 3C5VA 3NOXA 3I2KA 1ZD2P 1JJBA 4HVTA 4DMHA 2WHQA 3HEAA 5I8PA 4EUSA 2JIDA 4KJXA 4KRXA 4X97A 4QZVA 2VJBA 1MX1A 2LIPA 2ZVDA 1LPAB 2Z3WA 1XROA 1QIMA 3WL8A 4DM7A 4Y2UA 1MX5A 5CH5A 1QIJA 5A7GA 3G8YA 1MU0A 5CT8A 3WIOA 2V97A 1XZAA 1ZICA 1O6GA 3QMMA 2ZJ7A 1BEEA 3MVEA 3R3YA 2HA5A 4NS4A 3WZLA 1XZDA 2HFKA 4AX4A 1WHSA 5BOVA 1UT6A 4J0JA 4HXGA 1EVQA 1G66A 2C58A 2J3DA 1CUAA 4HRXA 4L3WA 4DSAA 5JZBA 3C8HA 1ZIYA 4K6GA 1PFQA 5LYYA 4H7EA 1ORVA 5AKGA 2OQVA 4AN0A 4AMZA 1THTA 5JALA 3QBJA 4H7KA 3B3QA 1XLVA 2XT0A 4EY7A 1R9NA 3B5EA 1IMJA 1PV1A 2YASA 4X92A 3OPMA 5IKXA 4OB6A 1YAJA 2C4HA 1HPLA 5AKHA 4ZGBA 1L7RA 5EFZA 3QH4A 3G9ZA 3AJAA 1ZJ4A 2UZ0A 3ESCA 3VDXA 3E3AA 1ETHA 1CEXA 4QEKA 5AIAA 5T4HA 5AKXA 4ZV7A 4HXEB 3WK9A 1R9MA 4WFIA 1CQZA 5JZ9A 1DT3A 1W76A 4J0IA 4X91A 5I9IA 4J0DA 4HTAA 5DNWA 3G0BA 4XX1A 3DNMA 5LZ4A 1ZIXA 5CTAA 5E2IA 1EI9A 4BCDA 4FMPA 2FX5A 2QTBA 3H04A 3IUMA 1XRQA 3D0KA 2AJ8A 3L1JA 3KSRA 5DYYA 3C6XA 4A23A 4RGYA 3H2IA 4U2DA
chains in the Genus database with same CATH superfamily
1U94A 3IB6A 3W2TA 4V1CB 4UM9B 2N42A 1MEEA 2X8BA 1Y9DA 4BLUA 2B0CA 2JDIA 5ESDA 4DQ0A 5AKEA 3A1EA 3LIIA 2X5NA 1OASA 1YFJA 5JCZA 4MJXA 3UMFA 5E4JA 2WINI 3BEDA 4CPDA 2HCJB 1RI5A 5AO9A 2QMYA 4MDHA 2IOHA 3S2FA 2AN1A 2OAEA 3Q6NA 1Z5OA 4YRMA 4CLRB 4UEWA 4N8SA 1DJNA 4TWIA 3DDSA 1JE1A 2JW5A 1Y3AA 2OBXA 3VVBA 1T10A 3PUIA 1GEGA 2I2BA 1TQHA 4IDOA 2QSUA 3IKVA 5H4GA 1VLLA 3IPLA 1GUBA 3NJRA 2PFGA 5JPCA 1ULAA 4M38A 5CVVA 4LW8A 1XWFA 1Y3CE 3V34A 4ZKDA 4AZ0B 1GKKA 5DGCA 5T5QA 4GXRA 2QIPA 2ETXA 4C20A 2I8CA 4HJRA 2VOJA 4Q1DA 4AO6A 4G25A 2NVWA 4HATA 3A28A 4ZREA 3V33A 1R2QA 2DG2A 3ANSA 1EDBA 4Z7OB 3M9LA 2VHYA 1FXWF 1LWOA 2FZGA 3WL7A 4E31A 3C3MA 1JTEA 3AEKA 3DCIA 1A9PA 2FG5A 3NBMA 5AUOB 2A1TS 3QY9A 5KVQA 3CH4B 4G81A 1QNLA 2RH5A 2CXOA 2QPOA 1TJ3A 2ZRJA 4FILA 4N8DA 5ALVA 4UFNA 1T9HA 1GA1A 1X7XB 5BRAA 1I5RA 1KIAA 1S8NA 3KHSA 2RKWA 4KFUA 4KU4A 1C30A 4F11A 4QRHA 1P0CA 1C9EA 2V6MA 2FR8C 2VP5A 3H1EA 4D26A 1TFRA 2WT9A 3L01A 4Q1BA 2RSLA 4M89A 4FN4A 1ZFNA 3D6JA 4J7AA 1W85A 4BZZA 1YQ9A 2Z8XA 3PXBA 1PW7A 2DHQA 3JX9A 1U1EA 1LPSA 4L4RA 4BAGA 3CRVA 3QYJA 1W48A 2O1WA 1Y5LA 4TLMB 4Q3LA 2ZIWB 3TXAA 3ZVLA 4BGUA 5I4KA 3AF3A 3OJLA 1EVKA 4DCSA 4L07A 5ALEA 1H2FA 3O95A 1R74A 1N0IA 2DTEA 2QRVA 2V6BA 3IHKA 4HOYA 4Q4DA 1MXFA 4TROA 2AZ4A 4Y1GA 4Z53A 1Z6GA 4KJZA 4TM7A 4DIUA 2HCFA 4M0KA 2IYEA 4A8HA 3UQYS 1OXKB 1R3UA 3TLYA 3U48A 1JBEA 5ED0A 3ISTA 4LWQA 1NF8A 2X6TA 1OAOC 3HCAA 4K9SA 1NN0A 2IHZA 2PWYA 4FEYA 1NU8A 1ZRMA 1GJRA 3AQ4A 3AEUB 2I2WA 4EG0A 3KT3A 2IYUA 5CDGA 4FYWA 1ZXXA 2CHVA 1ISSA 4UTVA 5FBLB 4XB2A 2JLWA 2JBAB 2VJCA 1QQ5A 1MGOA 3H5LA 2ZPUA 4DQLA 5JPDA 4NYMQ 3Q3VA 1KYYA 3R7FA 5FLYA 3BK2A 3OO0A 2R79A 5AW8A 1EFLA 1S9HA 2ZSHA 5KNCA 4PLTA 4MRPA 5HRUA 4DOMA 4C4XA 4FYHA 2P6UA 4ND2A 5FUWA 2XMRA 1J0BA 1U3WA 3L1VA 2P1ZA 2PZMA 5EI5A 1Y1RA 2R8OA 4B6QA 4X62B 2C1EA 1QKIA 4PZDA 3OEED 2C7OA 1GUAA 5FO1A 5I7SA 1ZYUA 1UJ4A 4ONEA 4TPKA 4B6PA 1EH5A 1QE0A 1RYHA 2GQ0A 1KAEA 3NHKA 4L3OA 4B71A 3AHGA 3PNQA 2WPDA 3VZQA 2PX5A 2NMVA 3NIDB 3SXPA 3MHTA 1O2DA 1KMHB 3GLTA 4BJ6A 1I0LA 1NKSA 3KYDB 3KEQA 2AC4A 4P7JA 2Y1KA 2X0KA 3PHJA 2EBHX 5EEGA 4CU5A 2R65A 1YZNA 1JLKA 5LOVA 4W9NA 1W581 3MJDA 3VR3A 1C2YA 2CJYA 2ZJZA 1MKYA 2BBOA 3DO5A 3V1YA 2FPLA 2Z3ZA 1CLUA 5A4DA 2H65A 3PDWA 1GPDG 1E1RD 3DT9A 4LC0A 2E6UX 1FFHA 3ORQA 3ZLJA 1HO3A 4I3GA 3WSTA 2C2BA 2VUHB 3HXTA 3VH2A 3WNDA 4JVOA 2IEBA 1MB4A 1G6OA 5CH3A 3F6EX 2PG3A 4XM1A 1P1IA 5HRCA 2XRMA 3F74A 3C3YA 1KBZA 2DZDA 4DSTA 2XMQA 2WOOA 3EVZA 3INNA 3NOQA 5CDHA 1YZGA 1HURA 5A71A 2HH9A 1WY7A 1YFKA 2BEVA 2GJ4A 4M8IA 4BNYA 3CN9A 3NHUA 3WISA 1IHYA 1T36B 3FKSA 3LSTA 3A1VA 4IH9A 4QGGA 4AZTA 4CMEC 4KYVA 1Q77A 5F2OA 5K03A 1DMRA 5JCJD 3ZNNA 1SUFA 1XDGA 2P0YA 5DJ5A 3KKEA 1B8PA 1XQYA 1LKZA 1N92A 3OIUA 3QVGB 1SZDA 4QJ4A 2OBMA 4B4DA 4O08A 3D81A 2PT5A 3K1YA 3CUWA 4B6OA 2C3OA 4HQNA 3EIUA 4H4EA 2XRZA 3D54D 2KJQA 4UHJA 3ZW8A 1AK9A 5JVDF 3L7CA 3QU9A 2FHSA 1E3QA 2PDAA 4L8WB 2ADMA 1VPEA 1YRLA 1E1KA 4BVKA 2QW8A 2M6KA 1GPBA 1DKUA 1GD1O 3PL5A 5AK3A 3BCHA 3M1LA 4MQEB 5DYTA 4CJXA 2I4IA 4F5DA 4EKEA 1D6SA 2GYUA 1P5HA 3NLLA 4RX1A 2H54A 1J22A 2ZIXA 1C30B 3H1FA 3U0VA 5DEIA 1KYVA 3E15A 3O3OB 4DJ5X 4KR0A 4OHFA 1MO3A 1X7XA 4G4SO 3KPVA 2POQX 1EESA 3L82B 5TPZA 1T9ZA 3IAUA 1AJEA 4N9WA 1EXDA 4YWJA 4F5YA 2NTVA 4FZJA 5J43A 1Z2AA 4NE7A 4ZO9A 3W8EA 1U7ZA 4GVLA 1K1EA 4AKEA 4MI1A 5L7YA 4WVFA 4JEIA 4QWMA 4BNMA 5AI9A 3O31A 3X0DA 4J76A 4RYLA 3Q7SA 5FP0A 4CLEA 4V38A 1NJ1A 3W5IA 1SKBA 2NV0A 2OGWA 5CNIA 3SJZA 4D8TA 4DIKA 1GGMA 5H5JA 1UK9A 1E3DA 1EIWA 1I1QB 4BPRA 5DM60 3CRZA 1LY1A 2WHRA 1QANA 2HMUA 3QLUC 3S28A 4NFYA 2AT1A 1SQ0A 2P5UA 2GBPA 2IQIA 1BYIA 1P7WA 5G41A 3CCBA 3JAMA 1WM1A 2C88A 1KY5A 2QV0A 1H42A 3F7TA 3RV3A 1KEEA 3OOSA 4YJ3A 5FUXA 2XB2A 4FGSA 3RRFA 3U80A 3QIVA 3VJKA 5FUQA 2DWUA 4NCBA 4CZ2A 2Q9UA 3B7PA 4TKVA 5T8KA 5ICMA 5LMUB 4BL5A 3N7AA 2X42A 2P65A 2F8LA 2BSAA 3OUZA 2RHMA 2B98A 1XU4A 3GA7A 3P5BA 2YOGA 4IGEA 2X9VA 4LGVA 4NCHA 3DYVA 4EGAA 4G3XA 3WLJA 2J9YB 4XLTA 4D74A 2D5CA 1QVWA 5HJ2A 4URXR 5C8XA 3GLSA 5KX5F 1L6IA 1SBYA 4CCYB 3Q4GA 1FFYA 1U31A 3HKEA 4DCVA 2B4TO 3O3CA 4G23A 1XVLA 1Z4QA 2F48A 2QTFA 3L0YA 4P84A 2UUPA 4XTRA 1VE1A 3IQDB 3FPEA 4GBGA 5KKAA 5F73A 3HJCA 5EHXA 4IZIA 4LZWA 1LVUA 1Q0SA 4HEJA 4MV0A 4QE3A 4LA4A 4KQ1A 4HS9A 5EXXA 1ZUD1 5MDHA 1JJAA 2DUJA 3KTAA 3PTLA 4A8PA 1CU1A 1L7OA 2Y4OA 4PF1A 4TTSA 1W4ZA 2XE7A 4MRMA 1ZOSA 2QN3A 3F7NA 3U1VA 4G4JA 4Z1MD 2DBZA 2IV7A 3HCEA 4K9LA 1MV8A 2TRSB 2VP6A 4LBYA 4JB2A 3SX2A 4ACAA 2GZMA 2J31A 1Z6XA 1CQXA 4XVCA 5MN4A 1LGYA 2Z8YA 3AU8A 1HDCA 2XDAA 2X8AA 1W88B 3F4KA 4TWJA 4Y3UA 1WUKS 3ELDA 3TOZA 4EPVA 3QKIA 1UXKA 2RH9B 2Z9BA 1KDTA 3DF7A 4X64B 3UXHA 4RBNA 3AESB 3VTAA 4GO1A 4YVFA 3IJ5A 3SU8A 4I1SA 1Y9EA 5ALQA 3VOTA 2GNAA 2FUKA 2VYND 3BSSA 1ORRA 2IRWA 2WTAA 3O38A 4IHJA 1M1NB 1DGQA 3MGGA 1RXUA 5FOSA 2G25A 4B7UA 2JI9A 2XNCA 3VNAA 4PZPA 2Q2VA 2QOEA 1CKEA 4N40A 5M34A 2UXCB 4J8PA 2GN8A 4PSDA 3TVTA 2XMPA 1GGEA 1I2BA 4G8DA 4P53A 4D98A 2O05A 5HJEA 5BN1A 3M9WA 1K89A 1SG0A 3HVHA 4LDZA 2R62A 3EAGA 1Z18A 5FI5A 1R6VA 4ESVA 3RODA 1S3GA 2UYGA 1VLHA 4DYHA 3VKGA 4BMPB 3LY9A 3KZOA 5IEBA 4D99A 4DR2B 2GTPA 2XGOA 3MT7A 3SF8B 2EFYA 2D2EA 2BFFB 1XGKA 2FWRA 2GPAA 4HKTA 3VZSA 2FU5C 3IC5A 4A2CA 4AJLA 2VR1A 4WN3A 4XGNA 1DX9A 3UOGA 5DBGA 3IV7A 2HF8A 1D2GA 1FQOA 1HG0A 3E9NA 4I50B 1YE3A 3FPLA 5F64A 4YV0A 5LWHA 2OBFA 3PQCA 3AI7A 4O4HA 4PHTA 3TB4A 3FOEC 3GJYA 4JGIA 1TUEA 4I4LA 1DFGA 1N3BA 4KQ2A 4YQFA 3MHPA 1V3QE 2OOSA 2ZAMA 1D3AA 4UUPA 2B20A 4RMJA 3UANA 4C6HA 2BGGA 2EOAA 4Y0NA 5B1EA 3KB8A 4GXNA 4TMYA 3Q3IA 1G4UR 4EHDA 2XCRB 3FSGA 3LM8A 4OD0A 3UUEA 1PZMA 2Q50A 5AM5A 1MH1A 2H52A 5EMHA 2FOIA 5JY6A 4G26A 1HK7A 2FW6A 4BRUA 2VF7A 4RYDA 2V3CC 1QK4A 1B1AA 4JK3A 3VR1A 3GCXA 1X1EA 3A1UA 1FFEA 1OFGA 1SKAA 1FDRA 1Z8DA 3RVDA 3SE0A 5KTTA 1HE1C 4KQJA 3SZGA 5M29A 1CIJA 4PNZA 4UTOA 2FWMX 2MOKA 3UFXB 2IYZA 2QQ5A 3DVAA 2QRMA 1QCZA 5L4NA 2QX6A 3V8EA 1HTWA 4A0RA 3A6HA 2G08A 3LUBA 4OHUA 2AVNA 2WYUA 3ENNA 5ALLA 4DB2A 1UMDB 3U7EB 2OCXA 3IDSA 4PZYA 5JAZA 1YUMA 1OW3B 3DEFA 1FP4B 1C7FA 2RIPA 2QJTA 3WRYA 4GZ5A 2ZETA 3UJHA 3KXIA 4BFWA 1PWYE 4QIHA 4YRGA 2QQ0A 3WKCA 2F59A 4U00A 1ZD5A 1T8WA 1H6DA 3S8MA 1NVAA 4LYHA 5B12A 4NOLA 1TRHA 4HQOA 4BNWA 3MAGA 4ZPXA 2O7NA 3V9AA 1DXOA 3DTVD 3LA6A 4P3OA 4DDMA 1Y5RA 1T3TA 5J2TA 1B26A 1NE7A 1UBSB 1VZ3A 4O4IA 2C9BA 4WH0A 1GDHA 4ML3A 4PCLA 1QQAA 2VDWB 4LJ6A 5A9RA 5C8DA 2MSWA 1X1SA 2PSEA 1DEHA 1GV1A 3BXFA 5LFAA 3FPGA 4ROTA 2W93A 4YP1A 1V2GA 1GZDA 1ODTC 4JVMA 2ECFA 3LUFA 1CWUA 1FUIA 1CG6A 3B12A 3VC7A 1UBTS 1CYEA 4B3GA 4HQ6A 4AY4A 2XQFA 3K0KA 1AN9A 1YQDA 3SOZA 3ESZA 4LIPD 3WHIA 5C1BA 2RGNA 3GV0A 1RC0A 2IYYA 4CGYA 1P4RA 1IBKB 3J7AC 1SUEA 1B00A 3Q40A 4MS4B 3DVRX 3ZY4A 3ZK7A 1KXZA 4Z2YA 2VCEA 4NZMA 1CJTC 4R2KA 5BVHB 5D5PA 1VKNA 1A5TA 2P9JA 2QQFA 3IAM6 5BSGA 1WRBA 2HWWA 4MITA 3TW6A 4R8KA 5AVWA 2YJGA 5KU7A 3KYCA 3VZCA 4JUDX 4HDSA 2D3WA 3T9DA 3PUZA 1WXXA 4X6UA 3OKCA 1K06A 2ADOA 3LQRA 4XIIA 3B52X 2JA2A 3M6XA 3NHRA 4F1JA 5CDFE 5K4GA 2JK0A 5C52B 4FOOA 5C8ZA 2UDPA 1GCGA 1QFSA 3UYKA 1VMEA 3FDFA 2BISA 2ZBRA 2HJHA 3N2IA 2DOKA 2O0MA 1QBGA 2YWBA 1RSZA 3MOGA 4YQYA 1OLXB 5B57C 3TDNA 4U39A 1QE3A 4KL8S 4IZHA 3WGOA 3HR8A 2O2HA 3IDQA 4QPJC 3WG9A 4HZGA 3ZWBA 2CEAA 2LTAA 2WW8A 5KREA 4YK7A 4U7DA 3UK1A 5D6NA 3SMQA 4YRQA 1JSZA 3M7IA 1PRYA 4FGWA 9LDBA 1HKUA 4OXRA 3EXEA 4TQUS 2HO4A 2V45A 1PD0A 1GNQA 5DI3A 4URYR 1CUUA 3REQA 5JNLA 3KYCB 5IKOA 2BFEB 5LZ7A 3TDKA 1O97C 2OC9A 1V9LA 3G89A 1OFHA 3QENA 1IFXA 4CTKA 3N6XA 1KK0A 2PMWB 1FTGA 3A4MA 4XASA 3M5DA 3G0IA 5FBZA 3HXQA 4RJJA 3EG9B 1XP5A 2G0NA 5E38A 2PXAA 4U9UA 4WKCA 5JBNA 1CRZA 4JWKA 4PWYA 1BSVA 2IPAB 4FP9A 2A57A 1U7PA 2X40A 2VI5A 3C3WA 4AF7A 3ZS8A 2DFPA 4DV6B 2JFVA 7ABPA 1QDEA 3RRZA 3SIRA 3VDNB 2CMKA 3CIFA 4L57A 3JZAA 1YI0A 4IH1A 4J0KA 4YRFA 1B8NA 3KKOA 2IYNA 4AJJA 2JIRA 4CDNA 2L19A 4K6CA 1VKHA 1QVRA 4O4HB 3DQQA 2JF0A 1SUCA 5FFFA 2VHEA 1N1GA 3HG7A 3QXGA 5K6AA 2E4VA 2ACKA 1M6VB 3VGJA 1KFCB 3PYLA 2YKGA 4H27A 4IV5A 4INAA 3TI9A 4Z4IA 4E21A 5D6OA 1DVRA 1PR5A 3IUQA 2ZJ3A 4QYXA 3GA0A 5B7QA 3SEZA 1O77A 3KQOA 3HWWA 3K15A 1SOUA 2H1SA 5AVUA 5K01A 4ZOQI 2J07A 1W88A 2OCPA 2BKXA 1SH7A 1UBNA 4H3VA 3UGTA 4H7IA 3ZS9A 1I32A 2ZBPA 1GGVA 2KMLA 4PHHA 3W5SA 2D8AA 4JBGA 4B3CA 2JHGA 1CUDA 1EZ4A 1HQDA 1KEUA 1RFLA 1SVMA 1BOOA 2QK4A 4WZAE 1XU9A 3ONFA 4MA0A 4IHJB 3JAWA 1EIZA 1HA3A 1TCBA 4FJ0A 1W73A 4MTCA 2JKVA 1ZISA 3TXYA 4RH1A 4KPEC 6Q21A 3V4OA 1WSBA 4HFMA 1NOKA 3C98A 3WBBA 4DA7A 4O5OA 4TV9F 1G8SA 1M2OB 4HC4A 4LY0A 3ZVRA 3AB7A 4BNIA 1C0LA 4ZOLF 1ZSNA 3FGZA 3U4IA 1K7CA 1PGOA 1Y4AE 1HM5A 3R3UA 4XVQA 2OHVA 3UHPA 4EO7A 1QO7A 4KPUB 3ZOKA 1KMCA 1KDPA 3TNYA 2YQZA 4LX8A 1Q7GA 1SC6A 2QY6A 3G7SA 4UCWA 1Z15A 1S4QA 3GRKA 1XAHA 2BEUA 5KI6A 4RTLA 2BW0A 3AC0A 3ESYA 3S81A 3GH1A 4XWAA 3NEAA 1FYFA 4B2PA 5THKA 4I4TF 4CMIB 1BQEA 5F12A 2REOA 4I36A 3KUUA 1IBLB 3FTEA 1DJMA 2GKGA 1P5RA 2QJWA 1C80A 4Q4AB 5IU6A 1APBA 1EBBA 3WKBA 1OT3A 3A4VA 1L8XA 1TE2A 1OFTA 2BUBA 3AUAA 4YMHA 1F38A 3LGSA 2I7CA 4LI3X 3BZUA 5C5IA 1DXHA 3ONDA 5JAMA 3O4GA 1XDWA 4RQUA 1ND6A 3GLHA 3QVJA 1G21A 1T26A 2AOXA 5EIWA 3ZHYA 3JQFA 4ZOLB 2Z58A 2ZULA 3I62A 4H0FA 1UMCB 1NTOA 3F6BX 3CEJA 5H83A 3PP8A 5J4KA 2PAFA 2ZDQA 3UV3A 1BOFA 3PI6A 1IN8A 4BMCA 1GRCA 5KDDA 4BBZA 2P3QA 3AFOA 2WD7A 4NRDA 1ZU4A 3ZWYA 1FMTA 3VKHA 4FTWA 3SYLA 5EXEA 1M83A 3RYCB 1ADYA 3X1XA 3VU3A 1QFJA 2YRWA 1RAIA 4TYMA 2A7XA 3HDQA 3ZLVA 2ZANA 2XYQA 4I9UA 5B7PA 2B30A 3STYA 3BIXA 4MLZA 1NUQA 1CP2A 2R11A 3OFNA 1RPAA 4DT1B 2YZNA 5HQTA 1X80A 5EUQB 3U31A 2BEWB 2POCA 2BV3A 5H68A 4GKBA 4IOKA 1UR5A 4BXOA 3W6PA 3HEMA 1C9DB 3OTIA 3VX3A 3SQWA 1PP4A 2HC9A 1T6BY 2HTFA 1S2OA 2PN1A 2AL7A 2QGNA 3KJEA 1U8TA 3CEMA 3DLTA 4FHZA 1ZUWA 4OLJA 4WEOA 4XWGA 1JWAB 3C1TA 5C3UA 3TAXA 3M4JA 5CJ2A 1E96A 4E30A 5I7UA 1JFRA 1BYUA 1GSHA 3I6QA 5FWAA 5H3LA 5K2OA 2NU9A 3RARA 2HYIC 3UMVA 3AUKA 4EZEA 3VR6H 4Q47A 3GUHA 1G5PA 3N05A 3V32A 3VJMA 3RT7A 2GZAA 4AY6A 2G7ZA 1CUVA 1S3FA 1IHPA 4MWCA 4OYLA 3PQFA 5D1HA 3CC8A 5JANA 1MC4A 4AMGA 2FZCA 4MV4A 5IAKA 5CAEA 1NUTA 1RLOA 2TMKA 2CXHA 4Y2TA 3TNDA 1H8EA 4HGZA 3VO2A 2IP2A 3F5FA 5FA6A 4FC7A 1OJ7A 2HU5A 5DFAA 1F8GA 3HXPA 5AK4A 1NBHA 3KZXA 3LO8A 4QC2A 3UT0A 4U7GA 1KZGB 3CJQA 1PUIA 1V1RA 4IFEA 4DRXA 4EUFA 1U1DA 1ZKDA 4YUAA 4MI9A 3IVAA 2J3IA 2NQ2C 3MSXA 2ZUTA 4BTEA 4ZP1A 4X54A 3NBUA 5LD2B 1ONSA 3NC0C 5BOSB 3C0KA 1UFKA 2CJXA 2GUWA 1OKKA 5AW9A 5IKMA 3CU5A 2VG8A 1PR9A 1QHHB 2GWHA 4F92B 2AIRA 4X8LA 3TSYA 1UK8A 2A7QA 2XVYA 4IIJA 1O7JA 4MPPA 1ETUA 1C8BA 4BKOA 4XRRA 3N9IA 2Y0BA 4B6GA 2DT5A 4RSRA 4FGZA 1Z6PA 2O2DA 1XZMA 2QMOA 3P27A 4R54A 4X3OA 1CVLA 1QIHA 5B3AA 1XNQB 5DTQA 1GLNA 2O7QA 5SY6A 3ACBA 2B4YA 3PWSA 3IDAA 3VRHA 3B82A 2ZW9A 4DIFA 1E0JA 2Q5FA 2R8BA 5D1NA 2DCMA 3SDBA 3M5WA 2XTZA 2ZRNA 5ARDA 4BP8A 1TJNA 2BJVA 1PQUA 7REQB 1NI4B 5JWRA 3B8HA 1H4TA 4WDRA 4QUEA 3K0BA 3USES 1JXAA 3QEAZ 3L4BC 5TSDA 2ZYAA 1TZMA 2ZYHA 3I9FA 4LG1A 3WMGA 3V3TA 1LZLA 1KMHA 1E77A 1G3UA 4E2WA 1G7RA 2Q46A 3GDHA 4K5QA 1MFPA 2UZAA 3UTCA 4A27A 1WF6A 1KSJA 1LB1B 3BXPA 1DO0A 4GLOA 5EEHA 3PHIA 1SU7A 2IZ6A 1G0OA 1V95A 1JQEA 1PNOA 3I5AA 3O1HB 3LP8A 3I1FA 4NTZA 5B1DA 3UK0A 5JH7F 2IZ5A 1DG9A 2ZG6A 3CH7A 2O1SA 1KGSA 3NM5A 1PI3A 5CJJA 4B2YA 1QPBA 4GBED 2G9UA 4CT4B 4ZT2A 5B36A 1FFBA 1NLZA 3FI0A 4RQAA 5HKKD 5E6RA 5CYOA 1NP7A 3OA0A 3A70A 5IBQA 1DEOA 3QE3A 4YRPA 3I73A 4ZHSA 1Y7LA 1XJ5A 3CLRC 3ZKWA 2OFOA 4ZVPA 3H9UA 1DQSA 2QT9A 5JUWA 1TM4E 4JBHA 3GRPA 1NXTA 1KETA 1RAEA 1ADCA 2OD2A 4XYEA 5DRTA 3C41J 4NE2A 4AUEA 5JZOA 1U2GC 1YASA 2RONA 1WDWB 1U8FO 3R7AA 2FMTA 4RA6B 2JFXA 4TWRA 3SSOA 3CVVA 1GAQA 1E9SA 2XIQA 3EE6A 2P5YA 3GG9A 4HWSA 5EIHA 3X1ZA 4D4JA 5BWLA 3FOFC 1X42A 3PFNA 2AZXA 1PT9A 3MSCA 4BX9A 4RMHA 3K09C 3W06A 4W9RA 3PEEA 4LC9A 4BASA 4PQRA 3G59A 4MUNA 4P22A 5AHRA 4G2TA 5A05A 3IEVA 4PSKA 5T57A 2O8EA 4B40A 1ESEA 5KKCA 1KYTA 5E6SB 4R2IA 4IVNA 3ICCA 1YDHA 3IHLA 2HV9A 1WXFA 3AP3A 4P3KA 2V4UA 1YR2A 1BHJA 2PGIA 3PTZA 2C1ZA 3NCTA 5LKRA 5KVVA 2WM8A 3DBOB 2F2TA 2YHAA 2R00C 5F5LA 3VTFA 2K7FA 1KJYA 5AOAA 1J1IA 2WM2A 3RS5A 1EM8A 4M0CA 2Q27A 3F3MA 1YAHA 4N48A 3EY9A 5GWXA 5BQ5A 1L7DA 4IBOA 4MYRA 4MI6A 5BVHA 1PD1A 3N53A 4DMMA 3RIXA 1CRWG 1C14A 4RIGA 4DTIA 1K8XB 2NIPA 3A58B 1RMYA 4MS4A 4GLBA 5JAOA 1N6NA 1V6SA 4UHCA 4XFKA 5IN4A 1TADA 2ILVA 1V1MB 4LV6A 4RADA 4G86A 4B0OA 3PHCA 3PV0A 4D42A 4FCCA 4X6LA 1VRWA 4UNSA 5HR5A 1YIAA 2FGKA 4OA5A 1C8LA 2W6OA 1YQTA 2GM3A 2G1KA 3PYXA 3O91A 2C5SA 1JDZA 4P54A 5JDIA 1AGRA 3DYIA 3EZNA 3AKDA 3F98A 3HJHA 3V4SA 1NR5A 2HSEA 3F8WA 5AVOA 3WY9A 3IQFA 3ZCVA 2G17A 1L7BA 1NVMB 3W6OA 4Q3EA 3VKFA 1GUDA 2K87A 1UXHA 3PFHA 1HLGA 4BNKA 3KZCA 2HT6A 2PYDA 4Y9DA 4EKYA 4YT4A 3U17A 1MP0A 8ATCA 3H5RA 1E9CA 2WPNA 3RG8A 3LHFA 1YI1A 3NW9A 4RKWA 2JFNA 3G9TA 3ZU3A 3AF1A 5I7WA 1RJDA 2WWWA 5IT5A 4ZZ0A 1Z8NA 5GZ1A 1N3YA 5MFPA 3DE2X 5DI9A 3TZCA 3I6IA 1KC3A 4MPRA 4BLQA 2ZSIA 2PH3A 5EFOA 1SR8A 2ES4A 4WXMA 5I8ZA 2B1QA 3KKMA 5CFOA 2XE6A 2Z2IA 4GQIA 1ZL2A 2OSVA 1FTYA 4H7HA 1DRWA 4X6XA 5DGXA 4ERNA 4L76A 5F7OA 1R4ZA 2BF7A 5ICSA 1PTJA 1OYWA 1RWWA 1QC5A 3I6MA 3R8FA 3SIWA 3ND5A 5DCLA 2Q07A 4YXWA 1BHQ1 1VPDA 2PUDA 4ZEOA 2AE2A 5A0TA 2BEJA 4TLBA 1U9IC 3IP5A 1P4AA 2EJUA 2FUCA 3FPHA 5BOSA 4DEYA 2O8FA 1T0BA 3DMGA 5IWAB 4LDPA 1N2OA 1Q7EA 1UDBA 1V1RB 2F1JA 4DRXB 3S8YA 2BZSA 1ECJA 2VT7A 3RE1A 2BUCA 2XA2A 4I81A 1WSAA 2PGLA 2PGJA 3E9MA 3T7EA 3AIKA 3X2FA 5KNCH 1T3SA 2I1WA 4RDHA 3EVAA 1GCOA 3GD7A 1N4AA 2ZJ8A 1OX6A 4JY7A 4B3RB 1BC5A 3DONA 4M7OA 4OQZA 3Q3JB 4S35A 4LNHA 5JQWA 2NU7A 4AM8A 2I99A 4DZTA 1SCBA 3W5BA 2MINB 1UJMA 2WFAA 3BMNA 4PG5A 5LL6P 1R88A 1U9ZA 2IY7A 5AKYA 1UBFA 2PX2A 1F7UA 3V8BA 1NQ5A 1QIEA 2OV4A 2QM7A 2WB4A 4BNFA 1DRKA 4JBLA 3COZA 5HIMA 2IU4A 4OOFA 3NHYA 1JVBA 5IYZB 1KSHA 1TVEA 2C78A 3CG4A 1CSEE 3H0CA 3GEIA 4QDTA 1WXGA 3EDRA 1EUQA 3OIDA 4GPTA 4K3UA 4DR3B 1NULA 1KO7A 3R75A 4Q6WA 1E60A 2ACVA 2GBFA 3IPCA 1B1CA 4B45A 2O19A 1GSOA 1AUOA 3C3EA 1XEAA 2P79A 1L4MA 2EV9A 2VPIA 3DMYA 4HNSA 4W6ZA 3ZI7A 1QTQA 2DFTA 2O06A 4R2HA 1L5RA 2JIMA 2WUVA 3VNSA 4RZIA 4LF9B 5EWMB 1P6QA 2VCYA 3N8KA 3VHLB 1IOWA 2QLLA 5L3VA 5JMWA 2WA1A 2YOHA 4ID9A 4NFHA 4DIEA 5FI1B 1MZPA 1DWUA 5LP6C 3BXXA 4OAPA 1PYGA 2FDRA 5BSUA 1QH1A 1OXXK 1OB2A 4BEVA 4F8YA 1WABA 1YXMA 2DHCA 2GBLC 1N78A 3PVZA 5EZYB 4EPTA 1WVGA 1YDGA 2ZSAA 3IT2A 2ODBA 2V6IA 1HYGA 1NW7A 2HHJA 3CNEA 4NNJA 1YD7A 2O5CA 4B3TB 3L0ZA 3QEMB 2HK8A 3UJPA 3NONA 4PLVA 3SXUA 3RUEA 3CF2A 2CNWA 1BMDA 3RBVA 1SCAA 5B6JA 3FVQA 4PICA 5K8JB 4CMIA 3VSBA 4P6VF 4E6PA 2AOWA 1R8XA 5GV8A 5DO9A 4YV1A 2NXJA 3N0XA 3QVXA 1LF5A 4BVHA 9MHTA 2VJPA 2QE7D 1L7EA 2OV1A 4J1QA 1PGQA 1TCUA 2NZVG 2OHFA 1D4OA 1ZJ5A 5I9TA 3N0TA 4I1PA 1BMTA 4GU5A 1XHEA 2COKA 2Y9PB 3D6UA 2VRWA 1G4AE 1Z26A 3UBTA 1P72A 4M0UA 1P1CA 1UZMA 1LX6A 2CL5A 3SQNA 2REBA 4QXOA 2CB9A 3MELA 4GUDA 5AT1A 5TJ9A 3SN6A 1TU3A 3MT8A 2YR0A 3TLEA 1U1FA 2ZQ5A 4NQZA 2FR0A 3PA8A 4MVJD 3A1NA 4BC0A 1XZJA 4JB0A 2P27A 3GEGA 2HIGA 3F0TA 2OGSA 1NBMD 3KJZA 3NHJA 2OCGA 4WLOA 5BWMA 3MRSA 4R2WA 1N77A 4X00A 1PFKA 1YB7A 3PXUA 4RTSA 1YR6A 2PL1A 3GDOA 3WIUA 4CM6A 1ZVMA 3DMNA 1WZUA 3G2QA 3HPRA 1P7ZA 4QOIA 1Q16A 1EGMB 1PR6A 3RIMA 3FUXA 5F77A 1XNJA 2D1TA 2VP0A 5C4GB 3M4ZA 10MHA 4C03A 4J2HA 1F6WA 2OEPA 4Q18A 2RHBA 1EK0A 1Z7GA 5GONB 4OPMA 1TK9A 2VL7A 1L1QA 4ND1A 1PHRA 2C4NA 2VUUA 3NRBA 3CR3C 3EK2A 5KJEA 2YNMD 4AYXA 5DMHA 3ZLUA 3C2QA 2OMEA 4G09A 3VR2D 3H2SA 4G24A 5EUBA 3LDAA 3RYHA 4BKQA 4UM5A 3MBKA 4O1MA 3OOJA 4FPXA 5CX1B 4YS6A 2G72A 4WNYA 1LPNA 3N59A 4UEJA 3RQSA 1S0UA 2VWPA 1Q1ZA 2FPMA 3RS7A 2BTQA 4TN5A 1IN4A 2NV6A 1UPTA 2HBRA 3CGWA 4BQPA 4XM2A 3NT2A 1L4HA 3BQ9A 3F5SA 2NT3A 4PYOA 1RP7A 3IAXA 3H17A 3G5AA 2HTEA 1KFJB 2RBEA 4HNQA 1VRCA 2ATIA 4AFNA 1LRLA 1XRNA 2VJMB 2PHZA 3JVUA 1E6CA 1UH5A 2AG0A 3DUFA 1GZSA 2FZLA 3NBFA 4C0BA 3D1LA 4E5MA 1UBHS 1Y42X 2WUDA 3LBFA 2QXTA 4HEQA 2YFQA 1JEJA 1GT91 4LDQA 4UAGA 1IOZA 2PD3A 2XVZA 2YIJA 4EB3A 3W3AD 5BW6B 1S8AA 5F5NA 4YLGA 4WZBE 1OFIA 2BM8A 1XCBA 1T2VA 4YI5A 1WVIA 4GLJA 3GQBA 5ALWA 3E8XA 4MKHA 3RTBA 4LDAA 4NMHA 4JI4B 2V5VA 1KDOA 2WKRA 3CLSD 3F8SA 3HO8A 4NBRA 1Y6JA 3JWIA 4P5EA 5EZ5A 1GQRA 3LWNA 1H5NA 3GFOA 2VQDA 1FFCA 5JSFA 2JZNA 2XT6A 3A3PA 2HMAA 1GPH1 5K0LA 3RAGA 1T34A 4IRXA 1YE8A 1NW5A 4RZ2A 4ATNA 4DG8A 3DPIA 3T5BA 3T7SA 1IN6A 1EK1A 1TECE 4DCPA 5KDOA 5LDHA 3EISA 3FUUA 4E11A 5KTPA 2H11A 2HF7A 3PCXA 4Q1CA 3S1SA 4W7SA 1IWBB 3DKRA 3KKPA 5F4BA 2WJIA 2Q6OA 1SPBS 2QJFA 3HY3A 3F8TA 3FCUB 4CL2A 5J2UF 3TL6A 1SKYE 1SD1A 1XZLA 3TR5A 5JXHA 2ZSEA 4RSHA 5A9SB 2ECQA 3ZE1B 2YINC 3TPCA 3SPXA 3EAFA 5ALNA 2NVUB 4YO8A 4B81A 1I4WA 3KELA 3I01A 1J0EA 2EVWX 1F9EA 2QSYA 3QG1A 3ZE7A 3ZWKA 1H22A 1U7TA 2H4XA 4Q4JA 4BMDA 1CUWA 1VKJA 4OAOA 4A2PA 4P32A 2IWRA 5HP4A 1I36A 1BU8A 4GVPA 4K28A 2D59A 4KVFA 4MR8B 4KLCA 4BCBA 4QUAA 4R8SA 4RO0A 1PVVA 3BL5A 4KE6A 3UCFA 2HDHA 3PSHA 1NM5A 3AY6A 1JJFA 2GHRA 4X1IA 4K26A 4RIEA 3PTAA 2W90A 4CTMA 3D9QX 3V7WA 5CB8A 3P9XA 2Q0HA 3QIAA 1QG2A 2C2XA 3R0IA 4LTDA 4UMEA 5D87A 3IIIA 4IUBS 4TSFA 4AQ7A 1ISMA 1SIOA 2NW6A 4BMSA 1BQ3A 3V4ZA 3KR9A 1NUHA 2RIRA 1O4WA 1RLTA 4OKSA 3GL9A 1T6ZA 4HFJA 4BV3A 3OM1A 3IV9A 3L3BA 4RNDB 3V2IA 1XD2B 2BMDA 3AR9A 3PC6A 4TTAA 3R44A 1Z4KA 3ZIDA 2GFHA 3NUQA 1F14A 1UMDA 1ZAKA 1RPNA 3D6MA 3HVUA 1LW6E 3RHFA 2IHTA 1O6CA 3B6KA 1NQAO 2NTNA 2APJA 2IOFK 2PVSA 5BV0A 2Y1DA 3JQQA 1PJ8A 1T9BA 1E8MA 2TS1A 2RBKA 2D2FA 3AR4A 4PFSA 3U4HA 4BAZA 1G20E 3F9RA 3O90A 1A8UA 2IUSA 3THXA 3LDUA 5CXXA 2IEZA 2IS2A 1PEAA 4K0RA 3T7JA 2V7EA 3JD4A 4URVR 5ED4A 3S5JA 4LN1A 3ZI4A 2C7VA 2W2KB 3NB0A 4PTLA 2QR2A 3OZVA 4A0SA 1H93A 3P9NA 2YFYA 3TQHA 3WMRA 3ZPXA 1C3LA 1JHAA 1FS5A 2EHJA 1JR4A 3NKFA 3H1AA 2WWFA 2YWHA 4EFLA 1M66A 3CV3A 1Y3FE 1W2WB 1V3UA 2Q29A 1ZVKA 3N76A 4LMAA 5F35A 3DDZX 2GKOA 4YHBA 3BBLA 1Z63A 2X4LA 1MRSA 1S2NA 3VZRA 3LYUA 2A1UB 3OLZA 1JEAA 4JXKA 4QFBA 4TXMA 3RANA 1G1AA 1QONA 2IZZA 3E05A 2NU9B 4FCVA 1X1QA 3PNBA 5HEKA 3PEVA 3OCYA 1PAUA 3ZGVA 3R74A 1H0HA 5SY4A 3W4JA 4DIDA 1D2HA 2XD9A 3X2EA 5F7JA 2C8JA 3BS4A 2AXQA 4EMSA 4PAOA 2VK8A 4NLLA 1QGDA 4Y2JA 1ILEA 3X1WA 2F3UA 4NZ9A 4PRKA 1PJ4A 3F96A 5CT9A 2WF6A 1G6HA 1II0A 1NNLA 4RW0A 4I4NA 5FWXA 1HT2E 1V43A 3P19A 2ZSBA 1XTZA 1G59A 2YJTD 3QELB 3NDIA 1G9XA 4RY9A 2PZJA 5E8JA 3WGHA 4D46A 4EI9A 4G1MB 1M34A 4RD2A 4D57A 2NVOA 4IJUA 4IHQA 7YASA 4F2DA 1LDYA 3FD8A 4YQZA 2Q4BA 3KOWA 4AJIA 1QF6A 3EQ2A 3ASVA 1RIFA 5CRIA 1YJCA 2C7QA 4W8GA 1QF9A 1EFRD 3IBCA 1VI6A 1N5MA 2J5XA 3RAPR 4J9VA 3W7AA 2G0AA 4GP6A 4IJQA 4YAGA 1RKQA 3WGIA 3H87A 2Z83A 3AETA 3DGFC 3BUSA 3DL7A 4GP9A 2WEKA 4HDKA 2I3ZA 1BO6A 4OK3A 3D7KA 4CDMA 1AGYA 1F48A 4ZI7B 2FQWA 1B0UA 1T8UA 5JI3E 2X1VA 3TJRA 4BBPA 3VYRB 1RRCA 2QX8A 4DC1A 3VOSA 2YBEA 1KI7A 3E3NA 3IQGX 3K1JA 2B4QA 3PNKA 2G6TA 2HPVA 5FV4A 1S6YA 1XF9A 2FEOA 1GTMA 1DOHA 2HMYB 2NVBA 5AOVA 4QTZA 2F3QA 3VPGA 5A1JA 3H75A 1Z12A 1MRZA 3C16C 5DP2A 3W5VA 3ZZ1A 5C18A 3R3SA 1M10A 1N5RA 2GZRA 4J29A 1SXHA 4P7FA 1KZ9A 2XNHA 3ZIAA 4M6WB 4YAJA 1QSGA 4NI5A 5LQCA 3GPLA 3LX6A 3RC1A 5FOWA 1QV6A 4B6RA 4IICA 1N2IA 3OLVA 2NUAA 4PQFA 3SJBA 1XRRA 1A4UA 3E9ZA 4D0RA 2CHQA 3JALB 8GPBA 3IODA 2UUAB 2C2KA 3A3YA 1FPQA 1NBMA 2FV8A 1I3NA 3O2QB 4G8CA 2HDNB 4FFWA 4C78A 1F9AA 2XMZA 3OX2A 3HJTA 3KPUA 1SK8A 1OZFA 3D3EA 3P9SA 4QTUB 2G04A 1M2OA 3CS3A 2Q7XA 2H48A 4R31A 4DF3A 3FMGA 4BMVA 4EBBA 2XZOA 1Y1SA 4UUAA 4XQEA 5AJTA 5EQJB 4DLNA 1OHHD 3AP1A 5G3ZA 5LU9A 4JAVC 1CQIA 2YDYA 1ZW1A 4HLCA 2GCEA 5KCZA 2PUAA 1PJSA 2GHQA 1M34B 2VH1A 1IHUA 1JHPA 3CH5A 3BGVA 4YC7A 1U4OA 1U3CA 3JAWB 4LQ4A 4DLVA 2IP4A 2AKEA 3CWZA 4ZQEA 4ZQIA 4WK4B 3K6JA 3U7HB 4B6EA 4TV8B 1GPMA 2OHXA 3D3WA 3F47A 1Y4UA 2JGFA 4MVJE 4ENWA 3O4VA 3PNYA 1IZ7A 4LY6A 2ZIEA 3A3NA 3U9TA 4EHJA 2J85A 3GFQA 2UZIR 4HAUA 2VDVE 4DEVA 5CVDA 3RU7A 5JZMA 3O8BA 4QYWA 3SIXA 4MMYB 3OOHA 4XSGA 4MUFA 4II7A 4ZT6A 2M1XA 2QTVA 4LY9A 4J1SA 3NZEA 3MCWA 1EU1A 3HP4A 2VTKA 4H16A 4RZSA 1ZUHA 2YHBA 3H5IA 3OI7A 4L5JA 1I3KA 3PXEA 1G55A 4EG4A 1Q95A 4JP1A 2P9YA 1K7EB 1CZLA 2C77A 4BMXA 2OCBA 3IVGA 3P0RA 1Z22A 1SWWA 2WM9B 3I04A 4LNAA 2FK8A 2O3TA 5LDGA 2IDZA 1C3VA 1XTIA 2IUFA 4HWTA 4IDNA 4GOMD 3YASA 1TCCA 2QMUA 3TLJA 1D04A 1CUJA 4KQWA 1DU4A 2FN9A 1U2DC 4K6HA 2O2JA 5DSXA 2YN4A 5KYYA 3O1LA 4A2QA 4POAA 3ME5A 2Y9MB 4KBYA 3ACDA 2XUQA 3A6FA 2O14A 1P4JA 3ZWXA 3T5AA 2XNKA 4B9AA 4BB5A 4BGVA 4ZJYA 4U5QA 2R6FA 3PPWA 4D6XA 1HZZC 2CF5A 1JAIA 3L1UA 2XUIA 3V8QA 2PE5A 4LWPA 4FQ8A 3R8CA 2NTYC 4YALA 2IYTA 4ER6A 1O97D 1A5ZA 2CFTA 3GO4A 3O9VA 3QKSB 4GYYA 1H2ZA 2RC5A 2NOAA 4RHUA 1LQTA 2P6RA 1G5HA 1VFPA 1NQXA 4N0DA 3BA1A 4CNQA 4B82A 4U6SA 1B8VA 3DE5X 1GGHA 2WZQA 4ZVSA 1C7EA 2JD0A 4KTVE 1XCPA 2G77B 5BVGB 1XQ9A 1YRHA 4CF3A 5TQ0A 3TQOA 4UHBA 2AN3A 2IDJA 3CPSA 5F21A 3H2KA 3HJRA 1JU4A 4EUKA 2WQZA 4FNMA 1Q6ZA 3ZHRA 3NOOA 1KZHA 2VUSA 3GXOA 2XWQA 5C8YA 2OVBA 5ECWA 5BORA 4CKEB 1IE3A 1K7YA 2E89A 3I09A 3ODPA 4BATA 1DRVA 5JSZB 1R5JA 1VBNA 3MS4A 4LE1A 2J3KA 4LTNA 4BO2A 1TM7E 3BFXA 4UDYX 2V7WA 4TS3A 3AVTA 2P4QA 1CS4C 4N47A 1R8JA 1JEOA 3GJQA 4QSHA 2B9VA 4JB8A 1SUIA 2Q0XA 2WIJA 3EIXA 2QBYA 3R6LA 3OTHA 3FNGA 3CKMA 1ZIPA 4D41A 3HBFA 1SBHA 4X44A 1PYDA 1QQ6A 2AMJA 2VHCA 3L7MA 2IOFA 4IMRA 4KNWA 4PX3A 4UZFA 4X8HA 4XEUA 1Y5MA 2WJ3A 3RYHB 4CM3A 1F2UA 2PEYA 5IXJA 3UJ8A 1EP3B 3IKLA 4PCUA 5LPNA 1AKUA 1Q20A 4HDOB 1F8YA 4L0QA 2RC6A 1OTHA 3JWHA 2DTDA 3T4PA 3I5YA 2WYWA 3IHWA 1U5CA 2X9GA 3KJGA 3EZ9A 3VU0A 3FOWA 4ZT7A 3RJMA 1NOIA 1WOYA 2OWEA 3A6KA 1CV2A 2QS9A 4F3TA 3FLMA 1IEQA 2R6GA 1FJ2A 4FINA 3DDCA 5DH9A 1DJPA 3AOEA 221PA 4B79A 1CJCA 3QUCA 1RR6A 2EKDA 1G98A 1GFSA 4K1LA 3HCFA 4XSHA 3C4JA 4C1NA 4V3CA 3CX4A 1WPGA 3TRJA 5B1SA 4I55A 3LBYA 2QTGA 2W6QA 1N6HA 2XQGA 2XTAA 5EPEA 3B51X 3AJEA 4PBTA 5IAOA 4LE2A 1NNSA 4MIKA 4EJFA 2HLPA 2FG6C 2FRDA 3CJTA 2NM0A 4M0LA 3SVLA 1I2CA 5G1PA 4C4AA 4C7JA 4UULA 2FN3A 2GK6A 4FLMA 2W6IA 3RIGA 1LSJA 4BVBA 4S2EA 4WPGA 3K1AB 2AZTA 1FF9A 3PHBE 1II8A 2OM2A 3B8EA 3AP2A 3SJCA 2MSEB 1Q0UA 1GUFA 1BH6A 1TKCA 4DLZA 1KU6A 1R0XA 2B2CA 1RWKA 1Z5UA 4QNNA 3TO5A 4ENQA 3PX7A 2O5EA 2VF2A 1Q57A 1HSZA 3SEAA 3S8EA 2QRKA 5LA6A 1QCDA 4H77A 2VK4A 5WRFA 1N1DA 5LIPA 3SJAA 3BFJA 1GILA 2B4RO 3AW8A 1BTOA 3I45A 1KK1A 3RS2A 5DP1A 5I9NA 1IG0A 5C51B 3VR5A 4Q02A 4I9NA 1N4DA 4YRZA 3HB7A 4ITUA 5J58A 2O0HA 1CF4A 1J24A 3KTDA 4XD2A 1TYAE 4AY3A 1GOTA 2P68A 4B3XA 4ENRA 3ZIUA 1EQAA 3SM3A 5KYNA 1T13A 1EFKA 3AHCA 1KDVA 2I5PO 1PN3A 3WB0A 3B9PA 1D09A 2X0RA 3M0EA 4N6NA 2MYNA 2J67A 3QLTA 4P2BA 1Y81A 3C39A 3GDFA 4D9HA 3OU2A 3EPRA 3JR3A 1WY5A 5BWBA 5J2TF 2ZRBA 3W9SA 1J39A 2C20A 3MJFA 3ZC3A 2QUIA 4C04A 2DP4E 2GZ3A 4JOSA 4Q0MA 1WHTB 3FI9A 4OSEA 3L18A 2FP4A 3JQBA 1F06A 5M3BA 4FNOA 2QM8A 2XXJA 5HQ3B 1PJZA 3U62A 1J6UA 2ID7A 3HVIA 5JOQA 3ROEA 3RLFA 2IFTA 3E03A 4OXNA 5F3WB 1QTIA 2Q45A 4DJEC 5FWYA 1JDSA 3WJ7A 4EFDA 3WLHA 2A0WA 1S5PA 4KV9A 3SOPA 1N5KA 3UEOA 1OD6A 3GFBA 4CNBA 1BGXT 1M2VA 3IBFA 2IEYA 4EGCB 1DINA 1V4VA 3Q6MA 3DOFA 4KH1A 1EMDA 5DN6D 3EVCA 3H1GA 1ZITA 5HRAA 4H35A 2QWXA 4J4TA 5EXPA 3IXMA 2E37A 1EB9A 4U1RA 3RRJA 3DEKA 4A8JB 4W5WA 1SC9A 3AV3A 3D4PA 4EF6A 4WCFC 3SFZA 2C4WA 1TTHA 2IPOA 1YB2A 2Z9CA 1KYZA 1Z4OA 1I5EA 4M9QA 3KQQA 3C48A 2PT6A 1DIHA 5GJBA 1TM3E 1GZ5A 1YULA 2OE2A 1E2IA 3H11A 4O6VA 4CMEA 1U6IA 2RHGB 4GWGA 3B1FA 4CETA 2P90A 3O5AA 4ZMRA 1P4HA 1D0SA 2B6HA 3AEQA 3KX2A 4AS2A 4DREA 1ZMBA 5ALUA 5BR1A 3T7RA 3TNFA 1KFEB 1YVUA 4Q9HA 1RWQA 5FAKA 4LGYA 1OBFO 4NBLA 3BHJA 1EFHA 2C3UA 4MLPA 2PKWA 1OI7A 1XJCA 2C2ZA 3L92A 4G0XA 4ZO7A 4DQUA 3TJZA 2WD8A 3FROA 4ZXPA 4DLXA 3EH1A 1I7PA 4Y9TA 1TQ2A 2BCEA 1CULC 1RWPA 3F3YA 1Y98A 2DWCA 2BLNA 2F67A 3DMRA 1ZC3A 3KKQA 4UMFA 4YJ3B 4Z0HO 2NU8A 1A98A 3WA6A 3ZXUB 4LHYA 4BRWA 3P9RA 4E08A 1GTRA 5LLSA 3A3KA 1Q1QA 8ADHA 3KD3A 4EEZA 2FPUA 3K30A 3AB8A 4I5IA 3OMXA 2B0JA 1SXJC 3DC2A 3P0HA 1Q50A 1S96A 1YGPA 2V0GA 4AJ2A 5JQGB 1QIDA 3JD0A 4UBJA 3GCWA 4L28A 4JDPA 5BXYA 3C7DB 2WY2D 1OXMA 2VVTA 2O2GA 1JIUA 4QTTB 3P2MA 1XL0A 3COYA 2ONCA 5EAIA 4F9TA 4X3CA 2PQ0A 2Q1YA 2SHKA 3U9SA 4YRDA 3K6KA 2B8EA 3ANNA 4FHEA 3FFTA 1TD9A 3KCNA 1FLVA 1E9VA 3WLIA 3NBZC 1QH0A 3EXHC 4RACA 4W99A 1D6MA 2ZBFA 3DOCA 3HDHA 1FSPA 1Y4DE 3EEBA 4ZOAA 1VPTA 3WGUA 5JRZA 1DJOA 1SVSA 1X19A 4QVGA 1U0JA 3VSDA 4TTQA 2A5YB 3ZVMA 1KK2A 1YKGA 3FVVA 1LVGA 4BNHA 2J46A 2B6NA 4JJ4A 3OHSX 1C7QA 1UQTA 3U39A 1ISRA 4X63A 5EIXA 3K5HA 1CD5A 1ZH6A 2P40A 4UNIA 5C31A 4GMFA 4A9AA 3JCZA 4IAOA 1K5GA 2Y6UA 4FZVA 1X86B 1NN5A 3OF5A 5HE8A 2CUKA 3S5UA 2WFLA 4KYIB 4R1NA 3HV0A 3LXXA 4RF2A 5LQUA 2HR1A 3I0MA 3EGXB 1I3OA 5JHGB 3MTBA 2CXQA 2VH5R 1FRVA 1SG9A 2HK9A 1ZRSA 2YYZA 4TV9A 3T1OA 2JGMA 5ALIA 2R1TB 4D5GA 2V7TA 2Y6VA 2ZT8A 3IP7A 3D2CA 3MPOA 2G8NA 3QOXA 3KJIA 3ED1A 4Y18A 4KYUA 1LTKA 5JCXA 3W3ZB 4F46A 3CF4G 1RWXA 3ND6A 1T2FA 2J32A 3IALA 4TTRA 3L7NA 3KLMX 2E87A 1MNQA 4P1ZA 4EATA 4EMBA 2K4MA 1CUHA 1WP4A 2CLKB 2OXRA 2V7VA 4I4TA 4WDQA 4YP6A 4F1KA 4BPBA 1IIRA 2O59A 4R3WA 4N76A 2AJBA 4EJ0A 2GFQA 4X24A 1WUYA 5LJIA 2ZTHA 5REQA 4IKOA 3NP9A 3M6UA 3AHHA 2CVZA 3OPYB 2FZEA 4MDYA 4F6RB 4GEKA 4JUBA 5EVCA 3GJ0A 4FEAA 2QZ9A 2EFDB 3DDUA 1KA9H 4G1EB 2Z98A 4I3FA 2YN2A 4D43A 1T4CA 1DOAA 1WX1A 4IDFA 3R4CA 1MGPA 4R3NA 5EZSA 4CIXA 4MR8A 2O4UX 1FDWA 3CZQA 4TTTS 3I61A 4QGHA 1DRUA 2UYCA 5G1OA 1GCAA 4EF4A 3QXCA 3MF4A 5HZMA 1BW9A 3ZUGA 3BC1A 4DUGD 4D1YA 1XZPA 2ZUCA 4FIDA 4MW4A 3U4QA 5ENZA 1FQWA 3LWBA 5BW5A 2OQIA 1MABB 2PX6A 3BKWA 1EVJA 3UJ7A 4BQOA 2HJRA 3X3HA 2D2XA 2JGLA 3G8AA 4YAEA 3X1KA 4QREA 4O4LB 1W9MA 3ESDA 1WZIA 3OU6A 3DLHA 2A5DA 4OBBA 2B3DA 4ZD6A 4ZHQB 4KXFB 4WKGA 1NDHA 3OMWA 5HFJA 4DV3B 4LEIA 1YJ5A 5BNZA 1N7GA 2YC2C 5LMZA 4R6XA 3JTEA 4QU5A 3PNLA 4F9EA 2LGJA 3V8RA 2Y2VA 4HAIA 4KXVA 4N7RA 2DMRA 2J9RA 1VOTA 4XR4A 2OXTA 5A2QA 1V5WA 4ALMA 2DH5A 3JQRA 1XX6A 3QU5A 4C2TA 3RFFA 2I6TA 3LK7A 3T4XA 2PZBA 3FAZA 2XWSA 3C6KA 4IO0A 4RE5A 3PGLA 5IG2A 1YACA 1OE0A 1VJ5A 4GYKA 3FMVA 4CW7A 6GPBA 1TGYA 3C3KA 3G5TA 5KC9A 1V5EA 2AC7A 2ATVA 2CFIA 1GLGA 5JSUA 1E2KA 3MPUA 4J0EA 3DW3X 1BKYA 4U7FA 3U7RA 1VA5A 3ZHVA 2I7DA 4WNAA 1SBTA 1WV0A 3KQNA 3DOJA 1D03A 1RBQA 1WKCA 3O8LA 3ITNA 5LXTB 1N32B 2FSUA 1Y63A 4QODA 1OTXA 1CZNA 1HKHA 4WESB 3AHDA 3V2HA 3DUFB 4E32A 5DTRA 5JO9A 5BSVA 5BW4A 1DFIA 2ONYA 3J81A 3OZTA 4B44A 1YMVA 5EP2A 5DYGA 4YRSA 1KRWA 1W85B 3R41A 1HYQA 4J94A 1V6CA 1T0UA 3R5JA 1CY8A 4CT5A 4M0MA 2ZSKA 3TAUA 2CSXA 2XXAB 1SA0A 3A1DA 2QIOA 5BMOA 2ZT6A 2KWIA 4CIVA 2RAVA 3OCJA 1Z74A 2PVCA 3R77A 4R8RA 3WZMA 3BRSA 3ZY3A 3U49A 4Q7EA 3TSCA 4AXXA 4LNUB 1PT6A 1IONA 4FN5A 4D6YA 4WXRA 3I1YA 4EHFA 1WDTA 4UAUA 1L3IA 5FPTA 2C1XA 5CPBA 4Y2RA 4UTPA 3KWLA 2PGNA 4YXWD 5A3RA 2F3RA 1P4SA 2RI6A 3E2MA 1COZA 1NTRA 1V41E 3E6AA 3KOOA 3N5CA 4M9UA 2C83A 1PYOA 2O7VA 3JQ8A 1E79D 4HNAB 3GRUA 4YCAA 2PKCA 2HA6A 2XSZD 4Y0AA 1DBVO 2V7PA 1P45A 4XJXA 4ZCQA 1M2JA 3EFHA 1HTTA 1JKJB 1JU3A 4HXYA 3RVSA 3ZTTA 1QVZA 3HE3A 3KR0A 3IT0A 4QU0A 4DR4B 3UNXA 4DUYB 4RCZA 5IDWA 4JXJA 2NZUG 2AJDA 1JKIA 4IWNA 2I4NA 4LK2A 4JJEA 4TTPA 5GQSA 4AMBA 1NV9A 3WL5A 4KIUA 1H2EA 1SCIA 5KYWA 5IAGA 3L07A 4A8JC 4J4BA 1QG0A 3E70C 3LS2A 4MUAA 3HYCA 1W0JD 1XJWA 2J8ZA 3O84A 3AIIA 4KMRA 4OGGA 2F55A 3CNHA 2XGMA 5SV2A 3KWMA 5FOUA 2RFLA 4R8VA 1N9GB 2J6BA 3FETA 2QNBA 4IFIA 1JDTA 1FL9A 4RKEA 4YJHB 1ISJA 3W1EA 5GJCA 3ROZA 5A02A 5KYTA 1AHPA 1T1JA 3BWXA 4EEKA 3NR2A 1ZM2A 4Y0VA 1N6KA 3RAFC 1H1LB 2A9QA 2PS0A 2XF2A 2C5FA 4RHYA 1J0CA 4UVHA 4IY1A 4ENVA 3ROKA 3BDVA 3QVWA 1H3FA 4HQ0A 5K3FA 1IBSA 2ZQYA 1W5TA 3CB4A 4UAVA 3EGXA 1OGYA 3A06A 3B1JA 2WFLB 3LDHA 2QN8A 3GH3A 4QXPA 4ND6A 1Z4JA 2VOEA 4CG3A 5ECGC 3RI3A 2ZQZA 1UPUA 2FW8A 2H06A 1J23A 3CZ9A 1A04A 1J8FA 5FR2A 2J4DA 4YPVA 3PPIA 5BXQC 4G6ZA 3Q6IA 1G2QA 2ZYIA 1ZGJA 1YI8A 1A9QA 2X1MA 4JQZA 4YDHB 3DKKA 4I66A 3ZWCA 4BZQA 1GKUB 4TYNA 2WWXA 1FYDA 5EYPB 1EZ1A 2IHUA 4HNUA 3RG2A 4XCVA 5KBYA 2CXSA 3HWRA 5G53C 2B8JA 1P4GA 3OEHA 1J97A 4NNPA 1ZA1A 4XUDA 1VIYA 4Y2PA 4FS8A 3HVRA 4EL0A 1QO0D 3BXGA 3HDVA 3O9ZA 4HVCA 1ARZA 5GP1A 4QJBA 3Q15C 1NVVR 4YP9A 5KU1A 4OGLA 4EF5A 2AMVA 1KDYA 3W6ZA 4DXDA 2Z1NA 2CDBA 4H1HA 3PF9A 3TG8A 3V8MA 2VHWA 1EUDB 3N70A 4MOWA 2XITA 2EFJA 4EA9A 4U2FA 1RJGA 5B37A 5E6UB 3IEPA 2XNJA 3A1CA 2C4TA 2X77A 4REQA 3WGZA 1VQ1A 1SN7A 3NJ8A 3WRXA 3BIOA 4YN3A 4ZKEA 2QD3A 1NJ6A 1K88A 4F72A 4Z4HA 2D6FA 1NJ5A 3NOXA 1I7NA 2HXSA 3FZNA 3M6IA 3N1UA 3FNHA 3KV1A 4HPWA 1JXQA 4LF8B 1PUXA 1YZFA 5JYBA 4IJKA 1O89A 1XFAA 1ZD2P 2QPAA 1X7YB 4GRIA 4R3UC 2W48A 5DWVA 3TUZC 2IYXA 1NXXA 4OHVA 2ZBUA 2OP0A 3KDSE 1L4EA 2IE0A 2QYSA 3QMPA 4EJSB 4KJXA 4DCMA 5IW8A 2VXYA 2GZHA 1NF3A 3KFVA 5FLXA 2C03A 4MYHA 1YHZA 5EMNA 1M6YA 3GRCA 4G9BA 4LHVA 1XJ0A 3SC2B 1D2RA 2E0IA 4IF4A 4QYIB 3OQBA 1OYOA 4X1KA 5DHQA 3UK7A 4DM7A 3C85A 2JFWA 5TDHA 4D8UA 1YV9A 3K9LA 4MDEA 3E23A 5K45A 1XIVA 1MB3A 3E2PA 3L49A 3PFIA 4XIJA 5A7GA 3GLGA 5TF4A 4DXHA 4ZYYA 4BX3A 1TM5E 4DCCA 5JROA 5TIIA 4NCNA 4EEXA 1OB5A 1PX2A 1XTQA 2EIHA 5DM0A 3JD1A 1RAHA 5JTTA 1OF1A 5HIAA 3WIOA 2HJGA 4LJAA 2R751 3O7WA 3K1ZA 3EXEB 4AJ1A 3BRQA 3PEWA 1VP9A 3IMEA 2QZJA 2RH8A 2ZUDA 1JVSA 2O4CA 2WJAA 2E7ZA 4PLZA 5EMMA 1O6GA 2H5EA 3TAHA 4RD4A 1TB4A 4QQFA 3UAXA 3ZDXB 4N3AA 2VF8A 5K8UA 3WL3A 1C0PA 2ZJ7A 4UPVA 2VYQA 1HWYA 4KI0A 4I55B 1DQRA 1MXHA 2ZB2A 4NJEA 5KAPA 1J5XA 4DHWA 2HA5A 1HDZA 1DO8A 3WZLA 2WHYA 3ELBA 3EVTA 2HFKA 4PZ0A 5FYQA 4C3VA 2KLHA 4D3SA 4DJAA 3VI3B 3F1LA 4LSGA 4UZSA 5KX5A 2X41A 2Y8EA 3E9RA 2YJ5A 3Q5GA 3B2QA 1UT6A 4RULA 2ZRDA 1EVQA 1H2RS 3PLNA 4KQGA 1RJFA 2BONA 3MRVA 2X2PA 1PL8A 3TLGA 1ECBA 2X4DA 2OV2A 2J3DA 1JFFA 5AXAA 1QZZA 5JRJA 4L3WA 2CUZA 4DSAA 5K8VA 4B31A 1PVOA 2J48A 4NBNA 1QV7A 2BHTA 3C8HA 1F2UB 1ZIYA 1KY3A 1M1YB 1COWA 2HRDA 1ORVA 5EMJA 5LYYA 4AMZA 4NNOA 2I33A 2R48A 2XDQA 5BURA 5HVNA 5ICCA 5IJXA 3NGXA 1KEKA 2ASVA 4OI0A 3HCNA 1F5SA 1YNSA 5CP8A 3U4DA 1ZA2A 2ZCVA 3QJYA 1F8FA 4I5GA 2WQ7A 3M33A 3GJ3A 1YDFA 1QHSA 2PLNA 1L9KA 4QD3A 1K4KA 2BFDB 5B6IA 4U6NA 1WCXA 2C4HA 1NPYA 3CT6A 3EZ7A 4ZALA 4ZGBA 4OLBA 3IIJA 1YZYA 5EFZA 5KPJA 1N0VC 4G5GA 5CIYA 3HB1A 1ANKA 5CA0B 2PRJA 2BTEA 5E0KB 4UOQA 1IPFA 3JAKA 4HN9A 3HCBA 2J7PD 4HL6A 1R00A 1UAAA 3ESCA 2C4MA 2B82A 2VK2A