1R4ZA

Bacillus subtilis lipase a with covalently bound rc-ipg-phosphonate-inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed Evolution of Bacillus subtilis Lipase A by Use of Enantiomeric Phosphonate Inhibitors: Crystal Structures and Phage Display Selection
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase
total genus 63
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r4zA00
2XMRA 1GGVA 4ZXFA 1DQZA 1X2EA 1KU0A 2UZ0A 4M0EA 4W1RA 2HA4A 5JAPA 5IVKA 3HC7A 4QLOA 2GBFA 5FXMA 3FBWA 2VJDA 1TRHA 3EQ7A 4UHFA 4DNPA 1NX9A 3AZPA 2PU5A 1CUSA 3STXA 1MNAA 1AMNA 3E4DA 1OCEA 2HU7A 1P0MA 1ZIXA 1XZJA 5AM4A 3G9XA 5FLKA 1LBSA 3OTQA 4BVJA 5EHNA 4J0KA 1GT6A 5JZSA 4AXBA 4UBMA 4CG1A 3F98A 4LHEA 1BEZA 4JYPA 2XMQA 3EF3A 3H2JA 2PKYX 1BEEA 3ZV7A 2XQKA 3KOOA 4X00A 3C45A 4FOLA 5AK3A 3QH4A 2OLEA 4K6GA 4YX9A 3IUMA 2HA2A 4LXHA 4LYEA 4AMZA 1B6GA 1YS2X 5FKJA 4BAUA 5ALJA 3WK6A 4B80A 1CUVA 5AKEA 5KBYA 4XIIA 3F9CA 5LZ2A 1MAHA 4ARAA 3WLAA 4BB0A 2XUQA 4AO7A 4A16A 1TCAA 4Y2UA 2O2HA 3GUUA 2RHTA 5ALOA 3NGMA 3M83A 4B83A 5DTJA 3RKSA 3R3ZA 3DKRA 1SCIA 4EY4A 1MAAA 4X97A 5AI6A 2BUBA 1XZLA 4EA6A 5CXUA 5ALZA 4ZWNA 4NMWA 3BL8A 1VXRA 3R3YA 1DWOA 1RYYA 4DSZA 4JUIA 4Y2PA 2C4HA 2VSQA 3GFFA 3I1YA 2PVSA 4DMCA 3O4JA 3QPAA 3IVMA 4QDXA 2WKWA 2FUKA 2I03A 3MVEA 4BAZA 3BDIA 1EB8A 2XUIA 1A7UA 4H7IA 5ALGA 5ALWA 1MU0A 1MTZA 2WHPA 2H7CA 1VZ3A 2RGUA 2OG1A 3GA7A 1MT3A 2WIFA 3MUOA 1K63A 1TCCA 4H35A 2HA0A 4W1PA 1VE7A 5ALTA 1IZ8A 4WDRA 2PUHA 5K3AA 3DYIA 3I6ZA 3WKCA 2WUDA 1A8SA 2E3JA 4DSAA 1HBJA 3CN7A 3I2GA 1X70A 2C0PA 3G0GA 5CBKA 5ISMA 2J4CA 2V97A 5ALYA 4G8CA 4QLAA 5CT9A 3WL5A 3AIOA 5IVDA 5HKAA 3G0IA 4FLMA 2WHPB 3VVMA 4UBOA 1YAJA 5DTIA 3B5EA 2YYSA 2GBCA 5ALRA 4QDZA 1EVQA 3O9MA 2Y6VA 3O95A 3PICA 5KWIA 1LBTA 3R0VA 4B7ZA 3QPDA 2IITA 3Q8WA 2OCIA 2PM8A 2W6CX 5HK9A 5I8PA 4CG3A 5ALDA 1WB4A 2AXEA 4UBLA 5BV7A 3V1LA 1XQXA 3HLKA 3H0CA 3VJLA 3FSGD 2LIPA 1THTA 1U2EA 5AH0A 2XE4A 3QMVA 3KSRA 4GEGA 2HA6A 5A2GA 2AJBA 2WFLA 2C0QA 4WFJA 3C87A 5AKYA 4C4ZA 1QLWA 1THGA 1D07A 2YH2A 4H77A 4ZI5A 4QZVA 5JD4A 4DYHA 2G63A 5ALIA 4B84A 3WIOA 2Z5GA 1O6GA 1UOPA 4Y7DA 3OOSA 5LZ8A 5CW2A 3STVA 3AIMA 5K3EA 2XMCA 2WTMA 3G9TA 1IUNA 5JZ9A 3W2TA 4XVCA 2PBLA 4C01A 4UHCA 2GYVA 5JALA 4HAIA 5I7UA 2G5PA 2O7VA 2DSNA 2Z3ZA 3HSSA 3DQZA 4IH1A 4ZV9A 4RE5A 4WFIA 4OB7A 2OAEA 1CRLA 4W1QA 1CQZA 2XUGA 1QONA 2C7BA 2PL5A 3AFIA 5HF8A 4B9EA 5LKAA 5T4EA 4JEIA 1CUWA 1HKHA 4FLFA 4Y2SA 1XFDA 2JGMA 3FWHA 5JYCA 4TVKA 3WJ1A 4BTLA 1UKAA 3LLCA 2CBGA 5D7BA 5JAOA 3D2BA 3K2IA 3WA7A 4OB8A 2RIPA 2DHEA 4NS4A 2XT0A 4RNCA 4AB1A 1A88A 5EIEA 5AK5A 4WJLA 4EBBA 4FKBA 4U2GA 2XUKA 5EI5A 2JGEA 4KJXA 1WB6A 4UHBA 4H0CA 2IX9A 5CH8A 3KXPA 4KE8A 1Y7HA 3CCCA 1E3QA 2V98A 2GZRA 4J0CA 4KE7A 1SOMA 1GPLA 4G1FA 1XQYA 4DGQA 5AOCA 1AGYA 4BDSA 1FFAA 4U2EA 4CCYA 4Z49A 3PDCA 1IUPA 1H2WA 2EDCA 3WWOA 4B6GA 1JMKC 1VA5A 1VJ5A 2WIGA 3M3DA 2JIDA 3NOXA 2XMGA 4N5HX 1N8SA 1EA5A 3PUIA 3LIPA 3FYTA 1HL7A 1LPSA 1X2BA 1IUOA 1QOZA 3Q0TA 5ALXA 5HK8A 1RP1A 2AJDA 2OCGA 3EQ8A 1XRLA 5EFZA 1VKHA 4P93A 3WK4A 5IVIA 1XKTA 5AKKA 5ALFA 1EDEA 1XRMA 1XRRA 4G8DA 4CIBA 5A7GA 3STYA 2FJ0A 3D4LA 3AINA 4A23A 1T4MA 1XLWA 2I78A 4L0CA 1FFDA 4HTAA 2HA7A 4GI1A 4CFSA 3F96A 3HJUA 4BATA 5ALHA 4X92A 5A71A 4WDQA 3L1HA 4UFPA 3F67A 4PW0A 3G0CA 1QIIA 2RHWA 4HS9A 1ZOIA 3LS2A 1UOOA 4HRXA 2BAGA 1AZWA 5ALUA 1FFBA 3C8HA 4Y2RA 2XDWA 1EXWA 4BP8A 3NUZA 4Q05A 3LCRA 4MQMA 1N1MA 5C8XA 1EDDA 2I3DA 2BUAA 3ANTA 5C8ZA 3AIKA 1G4HA 4KRXA 5A6VA 4GLBA 3WJ2A 1QIJA 5C7YA 1JMYA 4C4YA 5K3BA 3C6ZA 1CIJA 2HFKA 2XQFA 3HABA 3D7RA 4H7EA 3FVTA 2AJCA 3B12A 2O2IA 3AJAA 2BKLA 1E5TA 3QZUA 4QDTA 5AM5A 5IH7A 1JFRA 3AUKA 1E8DA 3T4UA 4Y2TA 1IZ7A 5JAHA 1TQHA 4AX4A 3DOIA 5JAUA 1TKRA 5E2IA 1QJ4A 1ODSA 3C8DA 1PJAA 4HXFB 3DD5A 3OC0A 4KE9A 4M0MA 1LGYA 4E15A 1AURA 2WUGA 2XUOA 3H19A 2R8BA 2JF0A 5CH5A 1CVLA 2OPHA 5BWBA 5AKXA 4PSUA 2PSEA 3D0KA 3BF8A 3TJMA 2H1IA 4FBLA 3M82A 2V96A 5AP9A 3WWEA 2CUTA 2CZQA 1WB5A 3HYSA 5JIBA 2GBGA 5FPQA 5IKXA 5SYMA 2XUHA 1ZD2P 3G0DA 1LPPA 5AIAA 3SC2A 4RE6A 1QTIA 3I2HA 2HIHA 4Q3LA 2WFLB 1DX6A 3K6KA 1JJFA 3ICVA 4BRSA 2WILA 1QO7A 1R3DA 1UKCA 2Z8XA 1E8MA 1B41A 4JYMA 3N2ZB 1ZIYA 1E8NA 3WYNA 5A62A 2QUBA 1LNSA 3FYUB 3ESDA 3HZOA 2WIJA 3H2HA 5AKGA 1QIMA 2VATA 3O4GA 1UWCA 5JANA 3BE8A 1C4XA 2QKYA 3E3AA 5D3ZA 2ZVDA 3OG9A 4UUQA 1VXOA 5AI9A 3SX4A 3WK5A 4CIAA 4UBIA 5KWJA 3O0DA 1HLGA 1UK6A 5HF5A 2HDWA 2ZJFA 1ISPA 3T52A 4UFNA 2CJPA 2WLSA 1J1IA 3DYVA 4IH9A 1JI3A 3V1MA 4W9RA 4DMFA 4G4JA 1XRPA 4WY5A 4KR0A 4OYLA 4BCBA 1XZDA 2WUEA 1CPYA 1ZGBA 2VF2A 5JADA 1ZJ4A 2WIKA 2G5TA 4MWSA 4DNQA 1TK3A 1J07A 2XMSA 4RPCA 4F60A 5CMLA 4HRYA 2PU7A 5J3JA 4IHAA 4AZ0A 2QTBA 1R1DA 4QNNA 2XLCA 4KAAA 1JU4A 2HM7A 3WWDA 2RONA 5BWCA 4G9GA 1H23A 4EHBA 4MXDA 3QYJA 2OQVA 1VA4A 3GZJA 2R11A 4I19A 1HDEA 1N5RA 2BCEA 4U2DA 3H18A 3W06A 5CRIA 3HI4A 1GQSA 5ALPA 4W63A 5AICA 2G4LA 4AQDA 3FOBA 1CUFA 3ZPXA 3I2IA 3QVMA 4MJ3A 2WFMA 3C6XA 1P0IA 3IUJA 3OURA 5JZBA 2H7YA 1HPLA 5AI0A 5ESRA 4TPKA 1LLFA 2ZYSA 3DNMA 2QS9A 5CT6A 4LXIA 1S8OA 3BJRA 3I1IA 1F0NA 4DIUA 2FJPA 4EY8A 1G5FA 2QXTA 3DJYA 1K6EA 4OB6A 3DS8A 5JD5A 4QA9A 4J0JA 1LZLA 2C58A 3B3QA 4UBJA 4QWWA 4S0XA 5AJHA 5DWDA 5BOVA 5JARA 3F8SA 3WL7A 2BGNA 1DWQA 1TCBA 4KEAA 3VDXA 2XMDA 1QO9A 1CLEA 5EGNA 1QZ3A 3I2FA 1XZIA 3M81A 5T4BA 4CI9A 4QE3A 2CMFA 4B0PA 2PX6A 1A8QA 4EY7A 1TIBA 4G5XA 1XZHA 3FAKA 2ORYA 4MYSA 4W1SA 3GBSA 2XUFA 2QM0A 3R3XA 3SWWA 1LPOA 4H7HA 1P0PA 1CR6A 4LKOA 1F8UA 1J06A 5EHXA 1ETHA 2VEOA 5HZGA 4N5IX 2ZJ6A 2WG2A 4GWLA 1MNQA 3C6YA 3BDVA 1M33A 1ODTC 3G9ZA 1XQVA 1CFJA 2DQZA 2AJLI 1MO2A 3RK4A 5DYWA 5FV4A 1CUZA 5K3FA 3KWJA 3BXPA 1CUAA 4BC1A 3PF9A 4C88A 2ZYHA 3QITA 3IBTA 4LIPD 1W52X 4Y2XA 5HQ3A 2WQZA 1XZMA 1ZICA 1C7IA 2HADA 3AZOA 2H9YA 1QIKA 5LZ7A 2VT7A 4INZA 4MQLA 3A70A 3QMMA 4NVRA 2HRQA 2XB6A 4D9JA 2BGRA 2QJRA 4ITVA 1PV1A 5DYYA 4Y2QA 3QM1A 4Q1VA 3OPMA 4G9EA 3VKFA 4PSCA 2Z8ZA 4J0GA 3G9UA 2JEYA 2QT9A 2WIDA 2WM2A 1WOMA 3CN9A 3IUQA 4PSDA 4AZ3A 1KU6A 1QIGA 4UHHA 1DU4A 1DINA 4UBNA 3L1IA 1E66A 5FUMA 2JGJA 4Y2YA 3WKBA 5LZ9A 1NU6A 1CUGA 2WU4A 3PE6A 1F0PA 1VZ2A 4UFOA 4QDOA 4H7JA 4FTWA 4L9AA 5AI5A 1BRTA 1ORVA 5E4YA 4B0OA 4ZRDA 2ZSHA 3ESCA 1Z68A 2OXEA 2HU5A 4JH0A 4FBMA 2HA5A 1W4LA 3WMRA 4X93A 4BC0A 3FLAA 2ZJ7A 3FCXA 4PQEA 3WK7A 3A2NA 3E0XA 4AO6A 2WHQA 3WWPA 4FDMA 3WI7A 2DCMA 1J2EA 3EQ9A 2P8SA 3C5VA 4JNCA 5EIHA 4PNZA 4GXNA 1MX9A 3C70A 5HFNA 2BJHA 4M0FA 1SCKA 2DFPA 1I6WA 4F21A 4ARBA 3KDAA 4X71A 3WK9A 3V1KA 4U2CA 4DNFA 3LP5A 5HQ3B 4DM7A 5FP0A 1XZEA 3DOHA 4FFWA 4BE4A 4FWBA 5I9IA 2WTNA 2ONCA 3H2GA 4IH4A 1W1IA 3MGAA 5K5EA 3NWOA 1MN6A 3O4HA 2JGKA 2D5LA 1G66A 4I3FA 1L7QA 2GZSA 4X6XA 1YS1X 1CUIA 5DLPA 1DT3A 4IQ4A 3BJMA 2ACKA 3D5EA 2QUAA 3LIIA 4OSEA 5HF6A 3UMJA 1FSSA 2NW6A 1SC9A 4OU5A 1C7JA 1H2ZA 1XKLA 3VJMA 2JGIA 3L1JA 4B82A 3IA2A 3FLEA 4BBZA 1EDBA 4BZWA 1YAHA 5FDFA 5AI8A 4BYMA 4A5SA 3ZLUA 2GYUA 3IB3A 1R50A 5EIAA 1VOTA 5DNUA 4P92A 1R9MA 4BCCA 3WL8A 1A8UA 4AN1A 4C4XA 1IVYA 4BVLA 4G4GA 4K6KA 1UOQA 1QTRA 1QFMA 4N8DA 2RI6A 4BAGA 2OGZA 2QXUA 1E89A 1Q84A 3QMWA 2J3QA 2QRUA 1BN6A 1ZI9A 3H2IA 5D3KA 3PFCA 5IVHA 3R41A 3ILSA 3I6MA 2VA9A 4OUKX 4Q34A 3WIBA 1CUJA 1XRNA 1NU8A 5JASA 1GQRA 2X8BA 3D59A 1F6WA 1VLQA 5K3FB 4EB0A 3WQHA 3BWXA 4G8BA 1BS9A 1U8EA 4WFKA 1USWA 5CT5A 1FJ2A 4QDUA 2XUPA 2Y2UA 4BTVA 1BU8A 4XJVA 4X3CA 4DMKA 3ZLTA 3G02A 2XMBA 1LPBB 2WJ4A 1EH5A 4L72A 4GW3A 2Y2VA 1Q0ZA 2JBWA 3STTA 4C6HA 3GROA 3C5WP 3R3VA 4BZZA 2PSHA 1OILA 3S8YA 2VJBA 2H7XA 1L7RA 3WZMA 4HZGA 1QFSA 1DWPA 1XZAA 4E14A 1JT2A 4F0JA 1QIDA 3G8YA 3HACA 3WWCA 4IO0A 4H7FA 4X85A 1LPNA 1T2NA 5AHXA 3WKDA 5HCUA 5AM0A 2J4FA 2ECFA 3IURA 2HRRA 1H2XA 4OYYA 1YR2A 4N8SA 4PO3X 4CCYB 5CURA 1O6FA 3RARA 1XZCA 2XQJA 3C6BA 1FFCA 2PSDA 4CG2A 5CT4A 1Y37A 3C43A 4K5QA 5ALEA 4AMYA 3V48A 2DQYA 2GYWA 1K8QA 1BCRA 1W75A 4X6YA 3UUFA 3WK8A 4F5ZA 2VT6A 3PUHA 3WKAA 3O9VA 3W05A 4U2BA 1XZKA 5JATA 4B81A 3H1AA 1KEZA 1ZD3A 1YCDA 2QZPA 4MWTA 1YASA 4E11A 4LXGA 5T4FA 1UK8A 5ALNA 2OGSA 1EK2A 1CUXA 1EI9A 4UHEA 1P0QA 3VVLA 2I3ZA 4XX1A 4XWGA 4J0DA 1BN7A 3DKKA 4B85A 4V2IA 2XLBA 4I4CA 4ZV7A 4FHZA 1YA8A 3DLTA 3PI6A 1QIEA 4MYDA 2EEPA 4FNMA 1CUDA 5CXXA 3D2AA 2JGFA 2BUCA 4DNOA 4HXEB 1HQDA 4X7BA 2JEZA 3QPCA 5A7HA 3FNBA 1UKBA 1EB9A 4Y9SA 1ZD4A 2QR5A 5EHZA 1UFOA 2XMZA 3PFBA 3OM8A 5A7FA 1AQLA 2RAUA 2AJ8A 1CV2A 2FX5A 2B61A 2Q0XA 5ALSA 4GBGA 2O7RA 4P9NA 2DHDA 1AUOA 1SCQA 5T4HA 1JJIA 1QIHA 3GELA 4GDMA 5C8VA 3U1TA 1R4ZA 4H7KA 3O4IA 2WHRA 2WSLA 4EY5A 3DL7A 1Q0RA 1GZ7A 1N5MA 3KWFA 1YA4A 2D0DA 3U0VA 5CH3A 4Y2VA 5K3DA 1MX5A 1RWQA 4GHWA 2EDAA 5AKIA 5H3HA 2BFNA 3ICWA 4O08A 2ROQA 4J03A 3RM3A 2Y1KA 3K9BA 1WPXA 5LP1A 1CEXA 2QVBA 3ANSA 1G42A 4ROTA 3A6ZA 1Q83A 2XUAA 3UUEA 2HA3A 3DCNA 3R3UA 2W22A 4EY6A 1EX9A 1UK7A 3JYHA 1U65A 3R40A 3VISA 3D2CA 3WKEA 1XRQA 4PV7A 1XZFA 1QE3A 3FLBA 7YASA 1GPNA 3A2MA 1QGED 3STWA 4PF1A 1R88A 5AKHA 4UPDA 4OPMA 1FFEA 3EBLA 1BCSA 5AM1A 2J3DA 1H22A 3FCYA 2VJCA 2XQIA 4H18A 1JKMA 2OAGA 4X6UA 1DTEA 5HKBA 6YASA 3YASA 1AX9A 3CXUA 3H1BA 4KRYA 2JGLA 3H17A 3I6YA 2DR0A 3FSGA 1YB6A 4HXGA 1WHTA 1K5PA 3X3HA 1XROA 1TAHA 2WU3A 4LYDA 1ORWA 3IIIA 3ED1A 5HFAA 3FYUA 1CQWA 1GXSA 2WJ3A 4BE9A 2VTVA 3RLIA 2Y6UA 4BVKA 4E46A 3G7NA 1LZKA 1WM1A 4J3JA 4DMHA 4KYVA 4L3WA 2K2QB 1UK9A 4FFVA 5JD6A 2QOEA 5C81A 4K2AA 3KD2A 1CUBA 3HXKA 2XQGA 2C5GA 5AK6A 1H2YA 2ZYIA 5DNWA 3V9AA 3WYDA 3PF8A 2CB9A 4H7DA 2X76A 1DT5A 2DHCA 2PUJA 4TGLA 2ACEA 4FLEA 4OD0A 4BDTA 4DLNA 4J7AA 4KE6A 3E1GA 5FPPA 4CCWA 2WG0A 5LYYA 5AI4A 1SFRA 3QBJA 4ZGBA 4WY8A 3N0TA 5AIBA 4BP9A 5AKZA 1DX4A 5ALMA 3DEAA 2XUDA 2X5XA 1GKLA 4AO8A 4BCDA 5AOAA 1MJ5A 5LIPA 5HF9A 1MX1A 4RGYA 2V9ZA 4NZZA 4ETWA 3BIWA 1WCYA 4EUSA 1OXMA 3F97A 1LPMA 5K3CA 1XLUA 1LPAB 3HRHA 1CUEA 5LZ4A 4P08A 1UZAA 1AC5A 3I2JA 3FVRA 1UXOA 4DTCA 1ZGCA 4YK7A 5F4ZA 1IMJA 2CEKA 4OU4A 3A2LA 5LLSA 4WCVA 2WUFA 5ALVA 3I28A 4J0HA 2ES4A 2YASA 3STUA 1W6RA 4OCZA 2OCKA 1ACJA 3EIOA 2B20A 4K6HA 3I2KA 4KAJA 1ZI8A 1CUCA 2C5FA 1XQWA 3SK0A 1YB7A 4U2FA 3W9UA 4UBKA 3TGLA 1U4NA 5CT8A 1XZGA 5FRDA 1JJBA 1BE0A 1YSCA 3DL4A 4Q3KA 3IULA 1Y7IA 1MPXA 2QJWA 5DJ5A 5YASA 3MUNA 1CUUA 1WHSA 5EHQA 5ALKA 4C87A 1R9NA 5E4JA 2OQIA 3H04A 3VXKA 3R3WA 1DQYA 4FMPA 4Q82A 2VJAA 2WFZA 4X94A 4KACA 2IIVA 2Z3WA 5DYTA 3TEJA 2PPLA 4X90A 4X91A 1CUYA 2XUJA 5E4TA 2GBIA 3CCBA 2OGTA 3WZLA 3AILA 3AZQA 4EZIA 1CUHA 4C89A 2WJ6A 3ESAA 2XI4A 4FNGA 2O2GA 1AKNA 3DDUA 2VQ6A 5AKJA 4Y2JA 5ALQA 3S2ZA 1EK1A 3H2KA 1ACLA 5AM2A 5AK4A 3ZLVA 1XZBA 1PFQA 1UT6A 4Q3OA 5DNVA 1EHYA 2OCLA 3VJKA 5AM3A 5LZ5A 3IUNA 4MEBA 5FOQA 3G0BA 1K4YA 1ZJ5A 3IDAA 1VE6A 3D3NA 1GKKA 4YASA 1QIFA 1ZD5A 4UHDA 3ZWQA 3WA6A 1GPKA 3W04A 4KAFA 4YPVA 3TRDA 3BF7A 5D6OA 3JWEA 3ESBA 5ALLA 1XLVA 1ODCA 2WG1A 4ZREA 3HEAA 5AOBA 3P2MA 1W76A 5SYNA 5AKLA 2VAXA 4HVTA 1EVEA 3ZI7A 3JW8A 1BROA 5AO9A 1WPRA 2HFJA 4MEAA 2ZYRA 4G4IA 4J0IA 4N8EA 3W9BA 2YXPX 4GECA 5CTAA 4QEKA 3V1NA 4AN0A 2ZSIA 4B9AA 2CKMA 2HU8A 5KREA 3WL6A 1JU3A 2PSFA 3FYUC 1L7AA 4QWMA 2HL6A 2B4KA 1ZI6A 3BIXA 2B9VA 4BRZA 4X95A 5LKRA 1EINA 2VAVA 2QMQA 2HHAA 2PSJA
chains in the Genus database with same CATH superfamily
1Z17A 3ER8A 2QMYA 1IH8A 1N5OX 1O9HA 3IEPA 5GM1A 3IXQA 3G2OA 3UC5A 1SHTX 2JAOA 1NOIA 3UYLA 4BJ6A 3JWPA 4IDPA 4MI6A 1V2HE 3ST7A 5FJJA 2AFHE 1YS4A 2FPWA 2GHIA 3UAVA 4TV9B 4D9NA 4M46A 3AETA 1SRQA 1ZUWA 3GY0A 4OVKA 1FS5A 2AQHA 3KPUA 4R2MA 4ZO7A 1ZR2A 3PTLA 5A2QA 4BLPA 5JAIA 3SZMA 5EQFA 2G1KA 2Q4OA 3PEFA 3TQQA 1B2RA 1Q7TA 1TRHA 2P3QA 3NT5A 1UJ5A 4MV5A 3BRCA 4FNOA 4N9QA 4OXRA 4UHFA 3LW8A 1ONPA 4R05A 4XDGA 4F46A 2W4IA 1NX9A 3FF4A 4L4SA 1CUSA 3STXA 4KQXA 3EH2A 1F0YA 4L8LA 1KMIY 1WXGA 2XPCA 5IWCA 1BXZA 1OT3A 1AMNA 4J75A 2DOKA 1JH9A 2FWIA 2PZBA 1GG2A 3R9IA 3L6DA 2XJ9A 1ZIXA 1ZH6A 1XLTC 3A36A 5CA1B 3PHIA 2PAAA 5FLKA 2NP7A 2I4IA 1IYZA 1VL0A 1YOBA 4BPRA 1B74A 3IQZA 4P7FA 3RCBA 1EGAA 3E9EA 5JZSA 4UBMA 2O8EB 4HEQA 4LHEA 2XMQA 2Y1XA 3H2JA 3DAHA 2Q0QA 1TZCA 3UY4A 3X1WA 3TG2A 3KOOA 4IHJF 5A03A 4FOLA 4HQRA 1AA9A 2H31A 3EFBA 4F06A 1Z7YA 4DQKA 2C7OA 4ZQIA 1CR2A 3IAS1 5AK3A 4EJ2A 5AVZA 3LUCA 4WK0B 4WKOA 1G20B 1T5IA 3G1TA 3E05A 3NETA 4IDCA 4Q1BA 4QFDA 4YX9A 4Q4HB 2P1RA 3BTVA 4LY3A 2HA2A 1G63A 4LXHA 1HYQA 4MUYA 4WNIA 1UZUA 1YS2X 2JFYA 3DDHA 4FR2A 1TUBB 4O5OA 4BAUA 4CR7A 3OKCA 3UJ7A 3TTVA 1GUYA 3Q0EA 3I8OA 5KYUB 2XB8A 2Y99A 4C2AA 5AKEA 3WB0A 4CV3A 1UFVA 1L7PA 1YS6A 2BH9A 3GG2A 1OOEA 1KQOA 1MAWA 3H4IA 4FB4A 4MA4A 1OJLA 5LZ2A 3K16A 1JLLB 1QH8A 2H2AA 4X7RA 4AMVA 3CX6A 4ARAA 5F7OA 4BVFA 4AO7A 3S81A 3ZDAA 4A16A 4OBBA 3V4PB 3R6DA 4HHEA 1I7DA 2I1LA 1BXGB 2RHTA 1S3IA 2BT4A 1Q95A 1JFVA 4GMKA 1XLTA 4PWYA 5ALOA 3SF0A 3KKEA 4UOZA 2E89A 5DOZA 5A04A 3RKSA 1SELA 4WOBA 1V8OA 2A9VA 4N18A 5HVNA 4BBPA 2UAGA 2VQ3A 1SCIA 4HGNA 3MWKA 4QNMA 4ZT6A 3CBQA 1BIFA 5AI6A 2BUBA 2JCVA 4D46A 2AYZA 2RHLA 4L6IA 1XNQB 3LM8A 1DXQA 3NWEA 4EA6A 5CXUA 2N9UA 3BKWA 3VTFA 1HT0A 1PZFA 3CX3A 2ARKA 2YHIB 3BL8A 4GM4A 1IEQA 4MDYA 1XTBA 4NATA 4OLHA 2ETXA 4PCVA 2HHJA 4FGKA 3R3YA 1DC3A 4G07A 1W9HA 1HXHA 3T99A 5FUXA 1JAZA 1CG6A 2UVQA 1SUSA 1WUTA 1KPIA 2QUKA 4BVEA 4TTIA 4CYMA 3F6SA 1NVWQ 2QDXA 5AJYA 4EG5A 1YL6A 1KHTA 4P84A 4Y2PA 2C4HA 5CA0B 2HBQA 3L8GA 3S0JA 4CKBB 4BY9E 4M8SA 3V7NA 5B7PA 3LK7A 2BRUA 2WYVA 3TTUA 1A8IA 2XB2A 3O3MB 4UATA 3GFFA 2AEMA 3RFCA 2BFBB 4DUYB 4OX9B 3I1YA 4PRZA 3SU8A 1DV2A 1DAKA 1AF4A 4JJFA 3GGGA 4EG1A 2P3LA 5H81A 4BNYA 5DX8A 3AB3A 1I36A 2PVSA 4PGFA 4DV3B 4DZZA 4UHJA 2K87A 4EQZA 4DMCA 5WRFA 4XQ0A 2BEVB 3AUFA 2RFLA 3IVMA 3QPAA 4IX1A 4YJGB 3LPNA 4MVWA 4QDXA 3W0LB 3K9LA 5CNJA 4JBLA 1NW5A 1ML3A 3FOAA 1NYLA 3JATA 1QMPA 1W4BA 1MB4A 2RK6A 4JWTA 2I6UA 4I36A 3NYRA 1BE1A 2GB4A 3UATA 1ZMXA 2A9QA 5K8IA 4RTSA 1SB8A 3N0XA 3GJYA 3PQ5A 4RCZA 4Y0NA 1EB8A 3RJTA 3V2GA 3QXJA 4TTAA 4CIYA 1G9XA 4ERXA 4H7IA 4YEDA 5FPKA 1ZKDA 5ALWA 3HSYA 1E99A 4MQ4A 3M89A 5GONF 1MU0A 4JU8A 1MTZA 1BWPA 4IIBA 1VZ3A 4LC9A 1MT3A 2V6FA 3KLOA 1HWYA 3CO5A 4NBKA 3ZG6A 3QEOA 4EEZA 1TCCA 1E3WB 2AS0A 3BCUA 2XRMA 4GLJA 4U7HA 2G82A 2JW5A 4UEKA 5ECGC 2B7CA 2OM6A 2WVHA 2HJVA 3P52A 4LHSA 1FYVA 1HSOA 1VE7A 4AJEA 3DHEA 3R8CA 2P6OA 4WDRA 4DA6A 4YPFA 1YCHA 2A9RA 2PUHA 3I39X 3II6X 5K3AA 1KH1A 3GEPA 4MVXA 2WWVD 4O59O 3WKCA 1JQJC 4TKVB 4LN1A 4V0ME 5I7RA 2WUDA 3P8ZA 3SX0A 1OLSA 3CVJA 3FCSB 6REQA 2ZUVA 1G6Q1 2B1GA 2V74B 2X0RA 3JALA 3LLSA 4HF7A 4KXYA 2VP6A 5FQNA 4B45A 3EW7A 4NJEB 4D80A 2GSDA 2H07A 1EXNA 3CONA 1JW9B 1X70A 1YUBA 5CBKA 3GLRA 2OORC 4G24A 3UXMA 5ISMA 3MWEA 4LY6A 3UV7A 5ALYA 4RIFA 3ZVNA 2OBXA 3CF6R 2VWGA 2O8VA 4MULA 1DJLA 1K5DA 4CVNA 4XM2A 3TNLA 4K86A 1SHUX 2OYSA 5HKAA 1SVWA 4DCPA 4X65B 1RPTA 4R4JA 1G7TA 5KAMA 1VE1A 4UBOA 1OI4A 2AUNA 3FY4A 1GAQA 5ED0A 2C8KA 3WGMA 4KXNA 2Q0HA 1NBEA 3KYDB 4AKTA 1YQXA 4I5IA 5ALRA 4B6EA 3M1YA 2H5EA 4PZCA 3CVWA 1KARA 2W2QA 2W83A 4EHFA 4EA7A 3RWMB 3O95A 3HXMA 4X61A 1UC9A 1LBTA 2YIJA 1X0VA 2OZLA 3T38A 3OBIA 2XHEA 1S2GA 3QXHA 3ZNOA 3EN0A 2PM8A 1YVEI 2W6CX 1N0UA 5E8RA 3ZVMA 3G7UA 1NYRA 5J2UF 2KS6A 4KLAA 4EPYA 2Q5IA 2V7TA 1H42A 3QRWA 3JZIA 4KIUA 4KSBA 2NV0A 1I80A 1B2LA 1KVUA 4CMJA 4F45A 2IEZA 2F6RA 2C8VA 3QTLA 3V1LA 4F4HA 5TRTA 1Y1RA 1YVDA 4R5MA 5HNKA 2B2XA 4LMPA 3VJLA 1OYVA 4UMFA 3IQEA 4JGGA 3VSAA 2LIPA 1PFVA 2FFJA 1THTA 2CUNA 5CG1A 3MWGA 3RT7A 3GUZA 1O0SA 4ON9A 2E2WA 3ECCA 4FYIA 2HLPA 4GEGA 1WX1A 1OV6A 4IEFB 4J16C 4ZHQA 3FHTA 1VKJA 2P6PA 4WBXC 1ZM2A 1M10A 4Z6KA 1NHGA 3I64A 3JRNA 4G4SO 4ZEVA 2ZGVA 1JDZA 3KQOA 5DNYB 5ELXA 3QIVA 4FINA 3GGJA 4UUAA 2JAXA 3EXIA 4UTXA 4C4ZA 5BV2P 5DN9A 2BDTA 4KV9A 1QPBA 1D03A 2M6KA 1E3TA 1NE7A 3AB7A 2DPXA 4ZCRA 1RP7A 2CHGA 2IHZA 4WSOA 1NPYA 2JK0A 4H77A 2IXTA 4JCCA 3VNSA 2GLTA 2TYSB 2W6JA 3TSCA 3ENZA 5FL7D 2Z98A 1IHDA 3PCTA 5F51A 5F5XA 1ZKMA 4CEHB 1Z0IA 3VSDA 1E9EA 3Q3JB 4HPXB 3RTCA 1E0AA 2RG1A 3PKZA 3RGGA 2AA3A 3WIEA 4DC0A 4G0WA 4B84A 4JLBA 4EQ6B 2DY0A 3L02A 5T7BA 4NI5A 2OHFA 2Q8PA 1QZUA 5CLIA 3OKPA 4GFDA 1E7MA 4FFBA 1UOPA 2GI4A 5F3DA 1BQ3A 3AEUA 4G0OA 2PGIA 3RC7A 221PA 3T9DA 3K7EA 1P29A 5H9VA 5CW2A 5K0BA 3RC1A 1P7VA 3KT3A 3VR2A 2FHSA 5K0TA 4TWIA 2HRDA 4YWHA 2DETA 1M2VB 1PQUA 2XMCA 3A26A 3DDZX 3S6JA 4QHSA 3KUCA 5JOQA 1Z56C 2WTMA 1KQFA 2IXGA 4RPKA 3ADDA 2SICE 3DOCA 2YVAA 3RSOA 3W2TA 4XVCA 2AWNA 5LMCA 1G2IA 3O93A 4ZT7A 5J47A 1YZVA 2J5XA 4C01A 2A57A 1FK8A 3BHMA 3CH4B 1GARA 2NG1A 4HAIA 3LBFA 1U4OA 4J8PA 4B8WA 5I7UA 5DXJA 1PJBA 4PBSA 3CRW1 1XMXA 1J0EA 3JVIA 3HFRA 1CY1A 1MABA 1O5TA 4EG7A 2G5PA 5DI3B 2O7VA 3I9LA 3HSSA 2VHJA 2F48A 1N6HA 1Q57A 1ZCAA 1HQKA 1ORIA 1ISMA 1YFKA 5A4IS 5D86A 2CD9A 3JQ9C 1Y3IA 4F38A 3FYDA 3O91A 1L4LA 4WCDA 3GLGA 1T3LA 3A58B 2OGUA 3VPSA 1E2IA 3A05A 1L7DA 1ISFA 3KALA 2QGFA 5DBGA 4CLEA 1BCRB 4XCVA 5H4GA 4R2KA 5IN4A 5EP3A 3DVQX 2H0AA 3F3SA 2H4WA 4Q3AA 3WLPA 2ZBEA 3D8SA 2RBGA 4NONA 3ZR4B 5JNRA 2FN3A 1HFJA 1CUWA 2XRZA 3ONWA 4MWZA 6CHYA 1P8JA 4JBHA 1WY7A 2XGOA 5CJJA 4FLFA 5DW3A 1OZ0A 4Z3KA 3FOWA 4WXYB 4A1FA 3DV9A 4MA5A 2IA5A 3AY0A 3H5OA 1GFSA 4R40A 4DSTA 5KKNB 5E1OA 2FPSA 5BSUA 4YV1A 3E5HA 3NPMA 4HQOA 1ZZGA 1J00A 2OZPA 4ILKA 3I37X 1XRJA 2E87A 2LKCA 1K66A 4O1IA 1U0LA 3GGDA 2RHDA 2OKCA 4A26A 5BQXA 5FWYA 2C29D 3C4QA 2GEBA 3CLUC 1NRJB 4KTVE 1QCZA 3KEMA 1B8PA 2C5BA 4RA9A 3HXOA 4Z99A 2OD2A 3D2BA 3K2IA 1H6AA 2RIPA 5A0FA 4C9BA 1TYEB 3EIFA 5ESDA 1FTSA 3DMTC 3ROQA 4DLTA 4FHCA 4ARZB 4RNCA 3IBYA 1NUUA 4IRMA 5LOVF 5LQUA 1T35A 4I8IA 5LA6A 3ZCXA 1J0AA 1TNDA 1QH0A 4NKRA 4DIBA 2QPOA 4JJ7A 2EHDA 4IXDA 4WJLA 2C77A 4OP3A 1M2HA 3TNJA 2WSMA 3EDQA 2H2FA 1L7OA 3IP6A 1K7XB 1SBYA 3WZ2A 1AUPA 4FHDA 4FEAA 4M8LA 4U2GA 4RH0A 4Q9JA 3BWDD 3AHFA 4IKPA 2JGEA 5B3JA 3TTXA 4GMXA 4D5EA 3AO0B 1BD3A 3FXAA 3IHWA 5JFGA 5DGDA 4BNUA 1E2KA 5JAZA 5F7JA 2H2IA 2PIAA 3I58A 3O3OB 4TYMA 4RWEA 1B76A 3FPKA 4UHBA 2WEKA 5EJ9A 3PX2A 5CH8A 5AHWA 3ZWVA 5AR1A 6ADHA 1DQRA 4TMWA 4RVUA 1SC6A 2V6MA 1E3QA 2V98A 3SXUA 2EFGA 3ROZA 1D0VA 3V7FA 3AU9A 1SU8A 4EGCB 4KE7A 3ORRA 1E9DA 2WICA 5T41A 4YRMA 2IEBA 2X5NA 1YDMA 5IARA 5B2ZA 3KB2A 1GPLA 4Q4AB 3BTOA 2DFVA 1B1AA 4MR8B 2XTAA 2P2CA 4LHVA 4BDSA 4BQOA 2ADOA 3SYRA 1WMEA 1BW9A 3DWGA 3JQDA 1GY8A 5IM5A 3OJLA 3KKOA 3PDCA 1H2WA 4XX0B 4PONA 1SRRA 3O1LA 1HDCA 3PDWA 2VPWA 3O6VA 2C8LA 2I1WA 3W9SA 2JIDA 2R1UA 2CCGA 3EDCA 4JYBA 2XMGA 3QA3E 4N5HX 4JLWA 1PSWA 5AW7A 3AL0C 3IPLA 1N8SA 4HK4A 1EA5A 2EOAA 1ZN2A 2JKVA 5DEOA 1QYWA 4IV0A 3HJHA 2QK4A 2A0XA 2V1XA 4FD2A 3OMXA 5H1YA 1O6ZA 3N7UA 3OU6A 4Q1EA 4FMCB 2AG6A 2OKGA 3KC2A 5IHPA 4PCUA 5ADHA 1KZ9A 4P8RA 2IV7A 3AWDA 4FKZA 421PA 3PDJA 3CIOA 1GKYA 4LZAA 3DAOA 1C9MA 3OH8A 3UBTA 5ALXA 1YGYA 2A92A 5D00A 3HDHA 1RP1A 2BFCA 1Z7WA 2FX3A 3NCTA 4EJSC 5ICCA 5K0EA 3T34A 2PZEA 4H1TA 4MKHA 1OWNA 1QHXA 2PX5A 1ZMBA 2OCGA 3JU3A 3GGPA 4JQOA 5D01A 3KM0A 3TPCA 5EJ5A 5CFPA 1AKVA 1E62A 1OR8A 4I8XA 4UNNA 2W7TA 1VDZA 3GFGA 3B7PA 1H5QA 1FRNA 1K4KA 3F5SA 4UW9A 4WOPA 5AW8A 1OXSC 1WW3A 3C3PA 3B85A 3SDBA 4GPBA 4Y1RA 4EA9A 3NKVA 4F4JA 4II2A 2ZRJA 1G4UR 3E8SA 1Q74A 2H2DA 3EDRA 3JRWA 1QBGA 4IWNA 3PJFA 4AC9A 2QF7A 3M6XA 3C39A 3PTZA 2CD7A 4TV8A 2R8XA 3LZ6A 1T4MA 4ZARA 3ZKWB 4DBVO 3B3GA 2ZBFA 4L0CA 1T9GS 1W25A 4IXWA 1LK5A 1QHNA 2FZ5A 2O9JA 2VH2A 4EVIA 5ANRB 2QTRA 4JYCA 4BRWA 3IDZA 1J21A 2VPQA 1ZDMA 3R76A 2ZYAA 2PKQO 5DIFA 1IBMB 3INTA 1GRVA 2CMGA 1DO0A 4CKWB 4M49A 1OGJA 1UXJA 3HL0A 5LNK6 3OEWA 1FTWA 2DLNA 3QW2A 3AF5A 3G2KA 5ALHA 5JYBA 1KYXA 3ZDDA 4LF9B 4KQKA 3O8OB 3NHZA 4BO4A 4WDQA 1P77A 3RBVA 2ZBDA 1P9WA 4V3CA 5BV8A 5CCXA 4UFPA 1BVRA 2E49A 3LZCA 1NUPA 5C3UA 3UWKA 2MMGA 2EU8A 1NTRA 2ZJYA 3MJTA 4UMDA 3WQBA 1QIIA 2PNJA 3ZOZA 2BAGA 3V2UA 2Q5OA 4RD0A 3M4NA 4NOLA 3RE1A 5DM60 2IIQA 3K8OE 3ZV4A 2WYUA 1Q20A 4RCYA 4XCQA 1QQ7A 4Y6RA 3ABRB 3SEFA 3RAGA 4YXWD 3C8HA 2RH4A 3A7DA 5LB4A 3CW2A 4D81A 3KSMA 5B4TA 5EJ6A 2ZB3A 2UU9B 1RQRA 3WTCA 2R1VB 4JNKA 3LGSA 1PZGA 2ISCA 4MROA 4U39A 3ZZ0A 3FDXA 4AS1A 1EDDA 4XR9A 4MHOA 4TQ9A 2OY0A 4U7DA 1L4GA 1Z5NA 2I3DA 2B21A 4IDQA 2PZJA 4C1NA 5JCZA 2WMNB 4P3OA 4DR5B 5JU6A 3KZNA 2JH3A 3A4MA 5JHGB 3KS9A 4QOGA 2BMJA 1N36B 1HE4A 1KZHA 3CLTD 1IMOA 3C4JA 3AIKA 1PT5A 1S2NA 2ZG6A 1N1GA 1ULBA 4XB2A 3UCXA 1BD4A 2WWRA 4UD6A 4ZC1A 5I7OA 2YRWA 1ZCJA 3H84A 5A6VA 1X0XA 1G20A 3J81k 1NM5A 1U9YA 1ZBQA 1VL5A 5CDFE 1C3VA 1GSHA 4FGZA 5IJ0A 3K20A 3B20A 3HADA 1AV7A 3ONFA 4S3MA 2HYDA 4PGGA 1H3FA 1LFAA 3BSWA 3DLIA 4MV6A 2C2YA 4WLNA 4BLTA 2PUDA 1NW4A 3WJ2A 2X14A 3O38A 5J59A 4D3ZA 2PZLA 4R8LA 2NVBA 4HYYA 3RVLA 1AD2A 2GX6A 3WGIA 4DV2B 3LX8A 4AT1A 2KI5A 3D7RA 5CNMA 1QNLA 2ZSUA 3HL4A 4KR7A 1SZCA 2GCPA 2O2IA 3AJAA 1G16A 3JVVA 4QRHA 1BX0A 1FLAA 1E5TA 1RABA 1XE3A 3PL5A 2P1ZA 3QZUA 5EPEA 1QYXA 1GCIA 3AUKA 1LH0A 1W34A 5K0JA 4ZIRA 2WV7A 3OLYA 1NQWA 2ZQZA 4UEQA 5EA2A 5HKLA 1JH8A 1CF2O 2AG1A 2GPBA 3TKLA 2I7XA 4Q7JB 3LQ4A 4G2NA 3THOA 3TLZA 2ORIA 4NP6A 5EUMA 1K89A 3HKBB 1ODSA 4XCXA 1K68A 2PCJA 1U7DA 3VKVA 4HXFB 4Q7EA 2BDUA 4KVGA 2VPPA 1FP6A 4I99A 3AL3A 1QX4A 3JWIA 1LSUA 1LGYA 1Q0LA 2R6AA 3D3JA 4M0MA 1AURA 5GQSA 3HSKA 2M6SA 4PO8A 2ZWMA 4Y2HA 3H19A 3VFDA 4ZP1A 2DVMA 2JF0A 4EBFA 4F9GA 1C3XA 4V0RA 5CH5A 4OMUA 4OLBA 3WSTA 1CVLA 1OC4A 4ZEOA 5SZKB 1FDOA 1HMPA 3ZWNA 5BWBA 1SQFA 4DR3B 5AKXA 1O5OA 4RXUA 1Y5LA 2HK7A 4EHLA 4L8GA 4OIMA 3WLOA 1LLUA 3S28A 2OV4A 2I2XB 3LHFA 3D0KA 5K7SA 1A9XA 2GTHA 2ZB2A 3DLHA 5K0GA 3W4IA 3NC0C 1DE0A 3ZJ5A 1RC0A 1EDZA 1TL7C 1AKRA 3OTOB 1PR0A 2OHGA 1VQ1A 4JR2A 5F2EA 1DUIA 1E6CA 1XTQA 3FCCA 3H11A 5IANA 3SD7A 3FMPB 3G88A 1Y3CE 5EZ5A 5A06A 1WB5A 6AT1A 2OWEA 3F7MA 1E1KA 3UQZA 1Z8NA 2ZBUA 3TBFA 3WISA 4CI0B 3PQ4A 4NSNA 13PKA 3AM3A 4LNUB 5IKXA 2BEVA 4YJGA 2C59A 3BA1A 1VRWA 1VE9A 4I9UA 4RLQA 5ECWA 5CA0F 1SKBA 1NLUA 3AXTA 4IJ6A 4B1FA 1ULZA 3FWYA 4OI2A 3W5BA 3G0DA 1OI7A 3SC2A 2VQDA 5ITSA 1UIMA 3ZNNA 2JD1A 4F56A 1IBRA 1C4WA 3DOFA 5IG2A 1SXGA 1Q7RA 1BJTA 1T3TA 3RO7A 2EQBA 3Q6NA 3B82A 1JEJA 4W5WA 1EJ2A 2AOUA 2WFLB 1RT9A 3EVTA 4RS3A 3KKKA 5D6NA 5GVRA 1L3CA 3K6KA 1T3GA 2PX0A 4HVLA 3P9KA 2EJBA 3EGIA 1C30B 1PR2A 3B6MA 4X54A 2ZTHA 1Q3HA 3PFIA 4P0TA 1X7ZB 1I7PA 2WILA 3PLNA 3QU9A 4PZPA 5CXQA 3ODPA 4RX1A 4PS1A 1U7XA 4D3DA 4ZOAA 3BYZA 1IY8A 2X2PA 3IT1A 5TEWA 4UUPA 1ABEA 3O2QB 3HKCA 3BGWA 4TTTS 3VDNB 4B75A 4A0QA 2XBLA 4BKUA 2F1KA 1E8MA 1NUQA 3N2GB 4BMZA 1WLSA 4OLAA 1E9AA 4ZAZA 3CEMA 2GZ3A 4FIZA 4W7SA 3QKSB 4RFSA 1TO2E 1UKYA 1ZIYA 1GJRA 1ZXLA 2BZGA 1WJGA 2QUBA 4XOUA 8ATCA 1LNSA 3PIRA 4D4JA 1YB1A 3HZOA 1K97A 2WIJA 2X1VA 3LAWA 2FG7C 4HAUA 4M55A 1GYQA 4P3NA 3DLBA 1EFRA 4YBZA 4HWKA 3H2HA 4DDTA 4LMRA 2C4MA 2O2JA 1XR3A 1X86B 4YAEA 1UWCA 3ZDXB 1W0CA 3X1YA 3AEKA 2EW1A 2FRDA 2L19A 1DCKA 3C1OA 3BE8A 1QANA 4RENA 4YP0A 3KWMA 4PQRA 3ZX5A 3TH5A 1HNZB 2QKYA 1MB9A 5F2OA 4IUDS 5ESXA 3FHOA 2YMQA 3LY9A 3N2KB 1DTWA 1LQUA 4IFIA 3BXGA 3L84A 1CS0B 2ZVDA 1O95D 3VR2D 4LHXA 3ZHQA 2ZREA 4YBRA 4ENVA 3E61A 3SX4A 5KZMB 8MHTA 4WASA 2V0GA 1Q15A 5JXGA 3NTOA 1PJ4A 4BFYA 2IUYA 2NU9B 1P60A 1OAOC 5EINA 3R7NA 3V7YA 4B3IA 1ZXBA 2X19A 1H2HA 4HN4B 4B4KA 2ZJFA 5IKPA 1N2CE 2VYFA 4D9EA 4CXMA 2AYXA 3T52A 1HDIA 3JY6A 2V3WA 1PJ2A 1OX4A 4BN5A 1UPAA 5HPYB 9LDBA 3DYVA 4CV0A 3GL9A 4IH9A 4U7WA 1PFWA 3PRHA 1O3YA 2J67A 4GLFA 4BNGA 4DLYA 3IEIA 5HM6A 1TZ2A 3C3DA 1VJ1A 3QE2A 3U3XA 3ZD8A 4JHLA 1MP0A 2CLFB 2NO6A 1JDTA 1Y8AA 1W8IA 2ZXFA 4KR0A 4RM2A 4URXR 1P62B 1TM4E 4BX9A 4L9RA 4ZZIA 3E27A 1N6IA 3L3BA 4ESHA 2WUEA 1F12A 4JOQA 1ZGBA 4FI3C 4MVYA 2YBEA 4PZ0A 2VF2A 3USCS 2NTVA 2VTKA 1JR3E 2H8KA 1D7OA 4YAUA 2GFIA 3ETGA 5GOTA 5ECDA 4FJ1A 2XXAB 1FMLA 3P0EA 3GAFA 3IO3A 4KO3S 1LS1A 2G5TA 5EVCA 5DOVA 5DTQA 4AWAA 1YR7A 3UWMA 1PDVA 1QV9A 3T9CA 5BMVA 3GVIA 1U7PA 4G65A 5KEIA 2WINI 2XMSA 1NMXA 5PNTA 4IFBA 4F60A 3QNUA 4R84A 3NOOA 4ZJYA 5J3JA 3KTAB 2FOXA 4R1LA 4QUDA 4RPIA 1A7KA 1XXHB 5FOSA 3I61A 5CVUA 2VDPB 4NK5A 1DWUA 1Z25A 2WWTA 3DTVD 1G6HA 1OD6A 3FZNA 4QNNA 3SBDA 4AJJA 3TOZA 10MHA 3OHPA 1UJNA 5L7TA 1DBVO 5IZCC 5EMNA 1L5FA 5FD8A 1BMDA 4UEJA 4QBIA 3O3NB 5AVOA 4G9GA 4UDYX 3OD1A 2ZE7A 4BX3A 2OWDA 4EHBA 4Z3OA 2D59A 2CXSA 1EA7A 3C3MA 2DUJA 4UXHA 2OQVA 1IAQA 1VA4A 5IT0A 1R2QA 3KQMA 5G3YA 2R11A 2VYVD 1I3OA 1ODKA 4OXNA 5F1PA 2ZKIA 2ZWIA 4GOXA 1R6BX 3G8DA 5EJFA 3B3JA 1JFFB 1N5RA 4EGSA 2BCEA 1DDGA 3KAPA 4IYJA 3H18A 3T1HB 2HIAA 2OB2A 2Q3MA 1QV6A 3I76A 1U9IA 5F7XA 4LDRA 1L5ZA 5ALPA 1WR8A 2CL6X 3E9MA 3C85A 5AICA 4CT5A 1M0TA 2VJPA 2IF0A 5KYNA 3QXGA 3EBOA 1Q3TA 2GWRA 3K6RA 3L82B 3LX5A 4EYSA 3CKLA 3ZQ4A 1O1YA 1CUFA 3FOBA 4N0QA 2RGEA 2HJ9A 1USIA 3I2IA 3QVMA 1LJ8A 4JUAA 3R3SA 2WFMA 2HWWA 2PZFA 3AT1A 2J59A 2J9RA 3FR7A 2H7YA 3IUJA 1A97A 4MR7A 5JZBA 2JJMA 3V4SA 3UJNA 1C9EA 1W46A 2DECA 2MIIA 4TMFA 3SSOA 2JLVA 1NVBA 2WYOA 2V6BA 4UPEA 1DBSA 5ESRA 2QW8A 4ARZA 1LLFA 5JLJA 4K88A 3DNMA 2NUAA 1E2EA 3A9VA 4Y6LA 3ZWOA 4A9AA 3CS3A 3OTGA 2GGSA 1PR4A 4LV8B 3ZGNA 4JP1A 1VLVA 3U3MA 3GWGA 1U3WA 2Y9PB 1Z4MA 3LY7A 3BJRA 4XLZA 4OI0A 3I1IA 4ZU1X 1LRLA 2YFHA 1F0NA 2IELA 1QDUA 1RKXA 1H0KA 2C2ZA 2XVZA 3IKLA 1K0FA 3CRNA 2FQYA 4DQXA 4U6NA 2X9GA 2PWPA 4B73A 3TQFA 3VAYA 4RY8A 2DJ5A 1ODIA 2XVMA 3T15A 2FZVA 4JY7A 3X1ZA 1J2UA 4AM8A 2FR1A 3L0BA 3A1TA 1M6NA 3PI7A 2UUPA 3DS8A 4EO4A 4X1IB 5I5GA 3ZHCA 1JQBA 2ZWPA 2AG8A 4W9NA 4CTJA 2F3TA 2H4ZA 3D6UA 2XVAA 2PAFA 5KU7A 3UMCA 2DXIA 1Q7GA 3OFKA 1IPEA 1W4CA 1P1KA 5IFLA 4O0MA 2D7JA 4UBJA 3P9QA 5IRCD 3U7HB 5BYKA 4YUAA 2ZZMA 1KMMA 4K6MA 1N9GA 3ZXXA 2QMZA 5K0FA 3AUXA 3ZD7A 5FBHA 4V0QA 4O33A 1WTCA 1D9XA 1HTTA 5DWDA 1NP3A 3RU9A 2P6MA 3A4IA 4L8YA 2QX6A 1CY6A 3HCOA 5BW5A 1CSEE 5GP1A 1P3Y1 1V96A 1EZZA 1XTPA 3D8UA 5JI3E 1RD4A 4U6QA 1TCBA 2FEWB 4KEAA 2DGDA 3DV0B 4NDNE 2BLNA 1CLEA 3NHWA 3E58A 4NQRA 1W36C 2RBKA 2ZYGA 1VL1A 3CRRA 4QFCA 4OHZA 4DIKA 2HMVA 1BVUA 4ER5A 2XD9A 4B7CA 1DELA 3PGXA 5FPSA 4CEJA 4NJOA 4UXJA 1RXCA 3WGJA 4WNCA 1D09A 2F3SA 3IR5A 2IHKA 2CMHA 4HJRA 4M37A 5BR7A 3KUKA 2REBA 3TKAA 3RSFA 1TTPB 4L15A 1JEAA 3UFXB 1PQPA 2PKXA 1CDDA 1OFIA 3TSWA 1DBIA 1GL3A 3HA7A 4W1SA 2HT6A 3MWJA 4FC6A 7MDHA 2XUFA 1U1GA 4Y1FA 3P9YA 3WHKA 1WZEA 3EF1A 2RAPA 1BX3A 3C6MA 3DJFA 3MJCA 1EWYA 3PUWA 4HG2A 4NCKA 2EBHX 1KFCB 4AU1A 2A5YB 5JUWA 1NOJA 2ZCVA 4C0AC 4H7HA 4PC7A 1C0LA 2QLMA 3P9NA 4FFSA 4D82A 4DJTA 4RL4A 1F8UA 1F38A 3M6IA 1GHTA 3TOVA 1LVUA 1RPNA 1EXDA 1RZVA 1NP7A 1A69A 4R8KA 3UB4A 2QIOA 1GVHA 4OHBA 3O3CA 4KVAA 1MGPA 2X8AA 3CYFA 5CFNA 2GXAA 3QUQA 2DWQA 2J85A 3ETEA 4MV0A 3UM9A 4PRLA 3JQ7B 3OFNA 2BHSA 2J5KA 3BXEA 3H1PA 3RGWS 4C0HA 4JROA 3RYHA 3CBGA 5DH9A 5JS2A 2IKQA 4HCJA 2X5KO 1K8YB 1AMUA 4D8YA 3BL6A 5D3QA 1U8UA 2G25A 1DG1G 1TXGA 4LWZA 2W8BA 1QF6A 3RRFA 5I8ZA 1T5DX 2P7IA 1Q1ZA 1FSFA 4WL0A 1MR3F 3IUPA 5EEHA 2DQZA 2AJLI 3R6LA 1ZX1A 3RK4A 4BV3A 2HV8A 4IXTA 3ZGXA 4U7TB 2AE1A 4EUKA 5GTDA 1VLZA 4CJXA 1ML4A 3LZDA 1RWXA 1E4VA 1GPYA 4WEOA 4NY1A 3V97A 4DIEA 4TMYA 2PX3A 5D87A 5FX2A 1NUTA 1TU0A 2JS7A 4GP6A 4XQCA 4J49A 1C8KA 5LQAA 3KEOA 3CUEF 1YMVA 5CJPA 1UJ2A 4EEXA 1QU2A 1WKCA 2R8OA 2CLMB 2ZFUA 3GAZA 3ITNA 2VHWA 3FKSA 1OKKD 1CUAA 4KO4S 3BAFA 1AVTA 2VZLA 3QQ5A 5DMXA 2C5LA 2HF7A 2FSPA 2ZYHA 2XX3A 4RF5A 4C1BA 2IP2A 3HUTA 3RIGA 1H65A 4ZVSA 3JCZA 5CNKA 3THWB 1PI3A 1I4TD 4CUKA 2Q07A 5BSWA 5HQ3A 2CV2A 2WQZA 4OBXA 4GDFA 4I14A 1XZMA 2N3ZA 4RY2A 3JQ7A 5E9WA 2YJ4A 3OJFA 4PC2A 3AZOA 1I4EB 3MA0A 2WV9A 3PITA 1PUXA 5EGSA 1K3FA 3H75A 5IM4F 1V1JA 4U0KA 1WL8A 2G7MC 4GOLD 1FP4A 4LISA 5EZYF 1TYCA 1XEXB 5MDHA 2R0QC 3ZYZA 2VJOA 3HPQA 3V1UA 4DV5B 3IXLA 1YR1A 4J9UE 2IRWA 3CY6A 2CFIA 2MSDB 2QD2A 2X77A 3A70A 3OPYI 1CR1A 2FMHA 4PYMA 3IPCA 3USZA 4NVRA 4QYIB 1FMTA 1ZLXA 2FRDC 5B58T 1IN6A 3RS5A 3RFTA 2ECPA 3RAFC 2WIAA 4XGNA 5DYGA 3COVA 2ZR8A 2QJRA 3FTPA 3L7IA 1U8TA 1SC4A 4FFPA 2BISA 3AK4A 3P5BA 1NSYA 3OPMA 1Q3KA 2C83A 3MINB 3DMGA 4DUGD 1T26A 2GNOA 3L7JA 1YZYA 4PSCA 4NYIR 4RLHA 1LNQA 2Z8ZA 4D9HA 1VI2A 1W2WB 3EZ7A 4M1MA 4XVHA 1C9YA 1YZLA 2X7XA 4MGYR 2Q8NA 3DTNA 3KQYA 2FSSA 4X41A 4XR4A 1KI4A 1AGPA 1ZD9A 2QTTA 1PWXA 1X6VA 2WIDA 3A9WA 1SKAA 1P7YA 2R6CA 2WM2A 3IP5A 4HDKB 3CN9A 4Z0NA 4J2OA 5D1NA 4PSDA 1EFLA 4WKCA 4UHHA 5DM1A 4AZ3A 4COKA 5FO0A 1DINA 2WAOA 3JAWB 1U7WA 2YXLA 3JQPA 3L1IA 4QQ8A 3BC1A 3TTSA 1E66A 1MT0A 2OOKA 2QY9A 2RB5A 4HJXA 4IGFA 5H68A 4Q7QA 1GNPA 4C08A 4EFMA 4HWRA 4KXQA 3AJRA 5FCDA 2V7GA 1AM4D 4L9SA 1Z6AA 4NBLA 4OXIA 5I48A 2O8EA 2C7QA 1RHJA 3IKJA 3C6QA 1FSZA 3VPCA 3L7MA 3N2KA 3UMFA 4KHPB 1TAUA 2JIOA 2JJ1D 5DLYA 4E5MA 4LHYA 3AR7A 4HWSA 4WXHA 5TQ2B 3VR3D 5AVWA 4KQ1A 1VL6A 4IEIA 4QDOA 2SHKA 4ER7A 2AMLA 2AYYA 4M7RA 1Y8ZA 3MJHA 3VUEA 1N2OA 4RA6A 2GN9A 1Z68A 5COAA 3RQIA 1WXHA 1SVUA 3M49A 5CU7A 1Q0SA 1I8TA 3MJVA 3LXUX 4HB2A 4MS3B 3P19A 4I4NA 5HIMA 2ZJ4A 3VPDA 1Q5PA 4WZZA 5HQTA 3WBBA 1KZGB 1TLTA 4FBMA 2DBVO 2C3MA 2ZK7A 1NN5A 3QXSA 4U63A 3K2QA 2QRKA 3NTQA 3WMRA 3GP8A 4DA7A 4W9NC 2FGKA 1ADBA 1U0EA 2F8SA 4LOKA 5IFKA 4ADSG 1ZK0A 2YIMA 2VBFA 1UANA 1A76A 3OT5A 2QYHA 3RVJA 3WK7A 3ITEA 3C3KA 2OFXA 2BP7B 5DBFA 2BC9A 3JYNA 4IL5A 5DWVA 4D45A 4PGAA 4JBIA 2AV6A 1WD5A 1ZCFA 1ISJA 4NCHA 1GFIA 1GQQA 2DCMA 2YYAA 5EERA 3LQRA 3NTRA 4YCBA 3RI3A 2EW8A 4UNSA 2CSUA 5HCIA 3K8YA 1OMOA 3PIDA 3PK0A 4ITUA 4JNCA 3FAZA 4NBUA 1OPRA 2R3SA 3IQGX 2YWBA 2O0KA 3V33A 1GN8A 4PYOA 1ADFA 3UG6A 2BGTA 5BVHB 1W59A 1KQPA 4M0FA 4OKSA 5EE5B 1C1XB 2FPGB 1M1NB 4KBGA 2ZUTA 3UN1A 3K0HA 4XIGS 4CMCA 1X7HA 4OJQA 5FV7A 3I2YX 1M8PA 1RLTA 1ZD1A 3MB5A 4GP9A 1O8BA 4DNFA 4OJYA 3E84A 5JSUA 2VAPA 4IWYA 4DE5A 2PVPA 1E9BA 4RIEA 1MC5A 1T6YA 1TJ3A 1TYDE 3IMEA 4JP3A 3DSRA 4XAQA 5DGXA 5TF4A 1PT7A 2JIBA 1E6LA 3BN3A 3QHAA 3SIWA 1JNYA 4XGRA 3RW9A 1JDUA 3DOHA 1KS9A 1T24A 2R5NA 1SWVA 4I55F 4TUYA 2NU8A 5A4DA 1TYBE 2W6PA 4MWOA 1G2PA 4R9UC 3TKYA 5I9IA 4URWR 2BHNA 4CL3A 5DHPA 2CNDA 2XZDA 1ANKA 1K6XA 3OE4A 3B38A 2YOFA 2ONCA 4GI3A 4H0FA 4M0KA 4Y1EA 3ZI4A 1JLLA 1QH8B 1SD1A 1S3GA 2PGLA 2WC1A 4HPJB 1Z73A 4N0PA 4Q24A 1W1IA 4JLOA 3MGAA 3EGCA 1FDVA 1BHO1 4RZIA 5K5EA 1IN7A 3UXHA 4M54A 3WLNA 4QYXA 4YR9A 3RF6A 2NZ2A 2LNDA 3ZIDA 3RF7A 2D5LA 1KZ1A 2HLDA 2VHXA 1GQFA 2A0YA 2AEFA 3C14C 1AHPA 2GJ4A 2KWIA 4ZO4A 4JLMA 2Q3CA 3AC0A 4BNMA 4C2TA 3DWFA 2GXQA 1V41E 1YS1X 3FETA 4BGDA 3SEAA 3AR3A 2E48A 2QRLA 3O83A 3EVDA 1ZONA 4J0FA 3P9ZA 4JGIA 2QX4A 1AKWA 1YHNA 2YHIA 3RSGA 5FO1A 4AS3A 2RDMA 1FSSA 3CMMA 4NIMA 3GEEA 2LCQA 1Q11A 3CUUA 3LXMA 4OU5A 3IEMA 4OLFA 4HUTA 2IP4A 3MHTA 1XKLA 4ZVKA 4J1TA 3L1JA 1IM5A 3WP1B 3NW9A 3RC3A 1Y8CA 3EEIA 1DAMA 2BCJQ 5DK4A 4P1ZA 4BBZA 1YVUA 3L5OA 5CIYA 5JJCA 5I51A 2VH1A 1TJ5A 4JI1B 2PLAA 1I6LA 1QFXA 5K0LA 2CHQA 3F47A 4BZWA 5C4IA 4TS3A 5HUJA 5K20A 2WD8A 2YY6A 1NDQA 1R0XA 5AI8A 4BYMA 1XXHE 5FB3A 5I7WA 5CB0A 4OJTA 3I01M 1TI7A 1DAHA 1U3TA 3ZY4A 1R50A 1II0A 3HUFA 3PC8A 3NHJA 5EIAA 5DNUA 4CDNA 3ET4A 3HJTA 1R9MA 1T1SA 2F1IA 1K6IA 2VTEA 4LK2A 1JEYA 2R8ZA 5ENDA 1WBBA 1VCHA 3ELUA 3L43A 2PZGA 1C80A 2DPLA 3DNPA 4YRCA 2R62A 1O95C 3CEHA 4ZODA 4AN1A 1V4BA 1XCGB 4PBRA 1QS0A 3HMKA 1MA0A 2JRCA 3TS1A 3ZVLA 2JLZA 5EMKA 1FP7A 2QR2A 4FEYA 2GZHA 1JR3D 5C3MA 4X1OA 1TU4A 1QTRA 3ZOKA 5H7XA 2MR6A 2YZMA 3RSSA 1JRLA 1N7IA 4JI7B 2X3FA 4BAGA 1E89A 1E63A 1GGFA 1XD2A 2J3QA 4BNIA 2XNKA 3IHTA 1YU9A 1JR4A 2AOXA 2QUIA 3KSZO 2FPRA 3AY7A 3PLRA 4OJKA 4P3XA 5FAXA 4DGSA 3AHDA 3CNBA 3M6FA 3ILYA 3UMSA 4C5AA 1ZI9A 2YWXA 3H2IA 4DCMA 3PFCA 5EYPA 3D6AA 2AJTA 1H05A 3G0OA 5ERXA 4X1KB 5CEJA 5CDHA 2IXFA 3U0BA 3MIIA 4CKEB 3ILSA 4R2LA 4XW2A 4OUKX 4YAOA 4YRPA 3CKKA 3DZGA 3OFVA 5F2KA 2JI8A 3PC2A 4S1VA 2AD1A 3K8ZA 5TPZD 1L5RA 1M34E 1VB5A 5JHHB 4LXUA 1TZBA 3TDNA 1D4FA 1XRNA 5TPWB 4CF4A 3R9WA 2P1DA 1GQRA 4GP7A 1TJPB 4H16A 2P78A 4PR3A 4FN5A 4DG5A 3SYNA 4YAKA 5C37A 1JSCA 3QKIA 4AP9A 4EO9A 3K9CA 1VLQA 4MS4A 4YCLA 2ZIAA 1QYDA 8ADHA 4L4YA 5K3FB 4AF8A 4BMPB 3PEUA 4F86A 5BPHA 4A82A 1N0WA 2OUKA 3JAWA 1KEUA 2FTKE 1T9CA 1ZM9A 2UXBB 4PX9A 1ECPA 2D5CA 1U8EA 2FV8A 4L2IB 3X1JA 1ZAYA 2VVTA 4N54A 1USWA 2DPMA 4XZ3A 3T5AA 4MB2A 4YQEA 3WMFA 2WY2D 3DYBA 2HRCA 2O8BA 1ZGJA 1T0HB 2G04A 1KMHB 3PNSA 3DZJA 1M72A 4X3CA 4Y6PA 5IBCA 5THXA 3WHPA 2W42A 3I3SR 4K9RA 1BDMA 2WJ4A 1EH5A 2NZYA 3RR2A 4GW3A 4YJHA 4BKQA 1QE5A 3KVNA 3PB3A 1KAEA 3COSA 1M74A 3LO5A 1UZMA 2L2QA 2Y71A 2QX7A 3K53A 4V24A 4BMXA 4I4TA 4BZZA 4DQVA 2PSHA 1X1SA 2CBXA 1LSJA 4Q15A 4CWAA 1WY5A 4N3NA 2WWGA 4YJ2F 1PL7A 2W8BB 1CEEA 2H7XA 4XVQA 2LE0A 2Q3BA 2B4AA 2GK4A 2VP5A 4WTOA 2ZIVB 3T8YA 4LJ6A 2ZJ5A 1ZR4A 4ZVNA 2UZ3A 4FYPA 2EBUA 3CV3A 5KCZA 1RVDA 2JLQA 4RYDA 3K70C 4OP2A 2BMWA 2ID7A 3UOAB 5JG7A 3MQ2A 4KWTA 2I4RA 4Q1DA 2VDLB 4F0JA 4DIOA 1OXVA 4Z0PA 2EQ5A 2Q6KA 1YXMA 3G8YA 3EPJA 4IDOA 2R00A 4EKEA 4FP9A 3WWCA 2PN1A 2ZT6A 1Y6RA 1AN9A 4IO0A 1DDOA 4X85A 3NWJA 1Y9EA 2P4EA 2AUTA 1YZFA 1N8KA 3ZHYA 4E22A 2XVXA 3IPYA 2EJWA 4L57A 5AM0A 3T95A 5TT1A 1U9ZA 3KUXA 3ZHXA 2ECFA 1CLUA 2P9CA 3G7SA 3ANLA 2R85A 1JHXA 4LOLA 4XFDA 4H1WA 2PUAA 3VZBA 4OG2A 3FWNA 4X3PA 4RC9A 3ELWA 4WI1A 1SVKA 1Z8HA 1OXUA 1F06A 3ZDFA 2HDNB 2CY0A 2VUSA 1DCTA 2Y0EA 1I4DD 2IEGA 1MD9A 3ICPA 4OYYA 4C0WA 1YR2A 2VTDA 2NUBA 4N8SA 5LLDA 3VJRA 4Q02A 4CCYB 4C0BA 5DP1A 5EUBA 3KVRA 4FQ7A 2QRQA 3L01A 3K31A 4R6WA 1WDTA 4JVOA 2XQJA 4AKHA 3EJWA 2ZI5A 3KJQA 1FFCA 2Z4SA 1KHHA 4RIIA 3W1VA 3VX3A 1Z3IX 2Q9AA 2XDQA 3KQLA 3UVEA 3CCFA 2PSDA 1WD7A 4GX2A 5AW2A 4CG2A 4PZ9A 4AKEA 4O4LB 2J07A 1UBKS 1Z12A 1ZN7A 2ZS8A 4KK3A 4PY2A 4QM6A 1NASA 4XDZA 1K88A 3D2LA 2X7HA 1U11A 3C43A 4X1KA 4EARA 3N1UA 1NW6A 4B6SA 2NO5A 4K5QA 5IUKC 5LIRA 1H85A 4MQFA 4C04A 5E6SB 3V48A 2DQYA 2GYWA 3TAUA 1K98A 2Q2NA 4FNAA 3HP1A 2YXDA 4JAVC 2V7VA 1X13A 4HX5A 5TSDA 1JN0A 2R00C 3DGEC 4K9MA 1B15A 1NN3A 1N7HA 2NADA 1RZ3A 2EV9A 2J0EA 3PUJA 4Q4JA 3OQBA 3COYA 3T5DA 2FW9A 2JARA 3PWTA 1FNMA 1EUYA 3OZTA 4RF4A 4KXXA 3DMFA 4ZYYA 3U4HA 3NXKA 3SS9X 4ZC8A 3FUUA 3K9GA 4LZZA 4F4FA 2ZAIA 5TC4A 2QP4A 5DI3A 3TDMA 5JATA 3IV9A 3M2PA 2PY6A 3OPXA 9ATCA 2AN9A 2DMRA 3H5IA 1DRJA 3KJXA 4R1PA 1SU7A 2VZEA 2QZPA 2C4UA 2IU4A 5FWXA 3RUAA 3TLYA 2DEUA 5DPMA 5A9TA 4CUZA 1KZ6A 4LF8B 4A8TA 3MCUA 3FGNA 4NCAA 4C7JA 3EZYA 4F96A 4MQEB 4QGBA 3ID6C 4NQZA 3A6PC 3PRKE 4PIPA 1YQTA 2J0VA 1W1WA 4PFJA 4BOYA 3I8SA 5FT9A 4TKUA 4MVCA 3HK2A 4JS0A 1RJWA 5AJVB 2CJWA 5IW8A 3UHJA 3W2HA 1P0QA 5CT5A 4G25A 1UC8A 3PJGA 5IT4A 1AJEA 2XAUA 2IQIA 3AFMA 4DDHA 5EWMA 2CL7X 3BM5A 3U56A 3R44A 4F93B 1UDCA 3BREA 2C5AA 1W1UA 2YYYA 5SY9A 4LI0A 4DEVA 3DKKA 3LX6A 3CHYA 1IXSB 3LH5A 2GEJA 1SG9A 3W79A 1Q22A 2B7LA 4I4CA 4ZV7A 3P20A 3MTQA 1BZYA 3Q2OA 3DLTA 1IY0A 3FJOA 4MYDA 2YWDA 5SV2A 1SWWA 3D3QA 1Q1NA 1N8TA 4HMPA 2RGNA 4DXAA 4M7WA 1BTOA 4M9SA 3UWSA 5CXXA 4JR1A 3QWFA 1SIUA 2BUCA 3VR4H 5K8JB 3UGQA 1HORA 5BVHA 1HQDA 4ZANA 1AQIA 1GPMA 4K0RA 4Z86A 4YJ2A 5EIXA 3SJBA 3M4JA 3T1VA 2IUTA 5FR1A 4EB8A 5HKKD 5KTMA 4W9MC 5CLJA 5ER9A 3F2IA 3HPRA 3HV0A 1SPBS 4TKMA 1GV0A 2C94A 1UKBA 5FFNA 3EZ6A 2P79A 1R5NA 3V8QA 1N33B 1EB9A 3RPEA 4LX8A 2HV9A 5K3OA 5BSTA 3NX4A 3TOXA 3ZJUA 3JX9A 5EHZA 3JYPA 2YBDA 1IJBA 2IYLD 3NP7A 3IQHX 5A7FA 1EE1A 4JFRA 1H2AS 4MOWA 1RKUA 1AUXA 1LFDB 3L8DA 3SXJA 5ITWA 1CV2A 4MVJM 5E7QA 4C05A 4F1WA 5BMOA 4X84A 3RAEC 2A1UA 3TXYA 1GXSB 4FM9A 5ALSA 3TL6A 2Z43A 2HK8A 3RIEA 4EPXA 5EZSA 4CDRA 4ZJPA 5KQPA 4G4SP 4P9NA 2HHHB 1FRFS 2DHDA 4NMHA 1JBQA 1T1EA 4HFMA 4HH3C 3G49A 4JEHA 4YRTA 5DHUA 4AZTA 2HPZA 3T1OA 1D2RA 1U90A 1O57A 3MS7A 3S2YA 3IIJA 2QQ5A 3MLBA 3R7SA 3AW9A 3PCXA 1SD2A 2BI8A 2WMYA 3DE5X 3OIWA 1N2JA 2YWFA 4GDMA 2WHEA 1Q0TA 3SJ7A 1YS7A 1RQNA 3B7WA 3BCRA 3FIJA 3GRPA 3FGOA 5HE9A 2YFYA 1F1BA 2QZJA 2WSLA 5LQCA 4BV9A 3AYXB 3CNEA 1R4AA 4B33A 3DBLB 1PNOA 1SZJG 3L0YA 3B13B 3FSRA 3OEHA 4BMYA 5A9SB 1PGNA 3A4VA 4YY3B 1D4ZA 1P1FA 5CH3A 3VOBA 1WSWA 2XZTA 4KQJA 1PK8A 5DLQC 1RWQA 5K3DA 1UWLA 3PS9A 4U2KA 4DDVA 4QU5A 1NNSA 3CB2A 1ZISA 2BKAA 4GLLA 4DUZB 4C3VA 3L0SA 1TD1A 3ICWA 3RS2A 3AVXA 1UFRA 2DFKB 3FTNA 3FPFA 3AP1A 3M5CA 1ETUA 3QUCA 4E4TA 1WUKS 1SBHA 4BXOB 3DVAA 1UEJA 4MVJE 4JJKA 5ITZB 4COOA 4QTYA 3HA3A 4C78A 5C7LO 1K27A 1VCNA 3PZBA 1XDSA 1ADJA 2QTLA 3T3PB 2P8JA 3L41A 3OFSA 3BZWA 2D5AA 3FBTA 3GEDA 2XUAA 4IM7A 4QUHA 2HA3A 4TXJA 2H3EA 4NBSA 2W22A 3LHSA 4Q18A 4G1EB 1PDOA 1AZTA 3OZEA 2BTQB 4ZO9A 4RETA 3JR7A 4WLOA 1XRQA 1OB5A 2GM4A 1JDBB 5AUNB 2IEDA 3KSDO 3KYIB 4IZIA 2ID4A 3FWPA 3DDSA 2IHTA 1LBEA 4HQNA 1XWFA 1Z4IA 1CT9A 1GPNA 2VP3A 3A2MA 2JAQA 4TSKA 3ZEIA 5K4HA 2ZRFA 4LJLA 3OPYB 1YJBA 4O4IF 3EEBA 2B4YA 4DA4A 3KKPA 2CDNA 2GCGA 1NMSA 3CINA 3KKLA 4YPOA 2IYRA 3L1VA 1C3OA 1PL8A 3R20A 1BCSA 1XU7A 1MZPA 3O8BA 1IIRA 1WSDA 2NUTB 4WWHA 3TZCA 3V4OA 4I9GA 1H22A 3FCYA 2VJCA 3OF3A 4FZVA 1R9GA 2UDPA 4FGLA 4H18A 4LRQA 4DRYA 4LRSB 5EZQA 4YMVA 3AF2A 1MXHA 2CCKA 2NXWA 2XE7A 1KMQA 3A9CA 4PLWA 1U2DC 3VHLB 5C18A 4NBWA 1DUVG 4ZYXA 2A30A 2GQ0A 1U8CB 2C61A 4LZPA 1NW3A 5CP8A 3SMQA 4EPWA 2V58A 4AWBA 4ZVMA 3THXA 3GO4A 3H17A 3I6YA 4Z9FA 4NNPA 3T7AA 3HUUA 4NF2A 3FSGA 4DCTA 4JOSA 4E5YA 1QBKC 2PH7A 1E2JA 3R7WB 3CUYA 5EESA 4FX5A 1CEQA 1GUBA 3GEBA 2Q9BA 4XJTA 4EMSA 3ELYA 4BQIA 2VNKA 4OQPA 1WHTA 3LU1A 1J0BA 4Y9UA 5A4KA 5E1BA 1N57A 1XROA 4Q3CA 1P4JA 3W1EA 1QYRA 2O14A 2WU3A 2B2CA 2BGUA 3PSHA 3K6JA 3VDMA 1CCWA 3ED1A 1C0EA 1JXMA 1CQWA 1GTMA 4PFQA 1GPH1 2WJ3A 3LP6A 2NM0A 4QOIA 2FKNA 3JAKB 4QGAA 4X20B 5IUNC 3RLIA 3B51X 1V71A 1WU8A 3DT8A 2R86A 3GFOA 4FYJA 5FF9A 4EI2A 3E5NA 1LZKA 1PK7A 5B4UA 1RWVA 2O1SA 2NSDA 1JG6A 1BXGA 4KXLA 3W6NA 5MGNA 5I7AA 4YP7A 1QH9A 1QGOA 4UU1A 3VR1A 4DT1B 2IYNA 2CV0A 2PZ8A 2NQTA 3IESA 5AMXA 1UK9A 3PP8A 4FFVA 1UBOS 3PYMA 3TLXA 1XA3A 1WXEA 2QOEA 2OXTA 4YRZA 5C81A 2WNSA 3KD2A 4JA0A 2ZRPA 4JQZA 3TMAA 3ECAA 4PG7A 3HXKA 1RKVA 2F8MA 2C5GA 1F8GA 3PEVA 1WXQA 2Q3EA 3S27A 3ZV5A 4JOCA 1KR2A 4H15A 3RFUA 2QJFA 4OKNA 1DKPA 1AB6A 2FWMX 2JLAA 1PFKA 1ZOSA 4LBVA 3V9AA 1VIAA 4J90A 4F3CA 3NWPA 2CB9A 1ZMOA 1RPAA 4QRDA 1M2VA 4IIJF 4KH1A 3AGQA 2Q50A 3N76A 3GLIB 4XGKA 4IR7A 1PP4A 2XWBF 5BMVF 1RWKA 3OKFA 3QNMA 5DNDA 4ZIRB 1RRVA 2PUJA 3QVWA 5B64A 2RHOA 4DAOA 5KCMA 2B8EA 1PFUA 1PTKA 2BM1A 2EFYA 4IW3B 3UT5A 2DQSA 4KWIA 2R9VA 4AIIA 1G8HA 2MSEB 3DXFA 2VF7A 2ZAMA 4YI5A 4BDTA 4DADA 2HQSA 4LDNA 2IE8A 1KIFA 4JC4A 4AJKA 1CJCA 1CF9A 2QE6A 4M1SA 3RC2A 2W71A 2X4IA 2ZTLA 2IFTA 1G3MA 1AQYA 2WG0A 5LYYA 1U3UA 5AI4A 3EIXA 1V1MA 4J1SA 3DAPA 3WYGA 3QBJA 4MX8A 1F2DA 3B2NA 3KXKA 4EYOA 5TMPA 3LWBA 2CNWD 2XE6A 5AKZA 1DX4A 2HSWA 3AUSA 3OJ0A 4HAYA 4OAQA 4IZHA 5ALMA 4RSGA 3Q1LA 2H4JA 2XUDA 4X8MA 1MC8A 4TKLA 1G5IA 2HWKA 2IPXA 2XGGA 4R8SA 4MRVA 4TXMA 3HJAA 4BFLA 2J4DA 2J9GA 3KAJA 5AOAA 2X4GA 2OBBA 3KHTA 5FBLB 1A5SB 5HM8A 1GZ3A 4RGYA 4K03A 3BXOA 3RS9A 3CE9A 1ZEMA 3BIWA 1IJKA 4TS1A 3F5MA 1XBTA 5ICMA 4IHQA 2E4WA 3CKYA 3HBAA 4N0DA 4YDHB 1RM0A 3GRVA 2O23A 3W5AA 4KFUA 4BNDB 3NAZA 4H27A 4XVUA 1W85B 3D6TB 3ETDA 2QG9A 4HNRA 1XEFA 2PMFA 5CA0A 5J5AA 2I2AA 3U7RA 2I0FA 3VNBA 5GZ1A 2IS1A 4PNPA 2HJHA 1RLMA 4JXKA 2PIDA 1NBOA 4JMLA 3ZHRA 3I01A 1CUEA 1ODLA 3IL2A 1VGRA 1UPXA 1W581 1I7QB 4H60A 1G9SA 2EZUA 1YFLA 1ZGCA 4PX5A 3EISA 5DCLA 4M1YA 3IMGA 3U7QA 3UNXA 4F2PA 1Y4UA 4YK7A 5F4ZA 1NLFA 1IMJA 3MRTA 3R3HA 3UGKA 2AKYA 1Z62A 3JQAA 4OJNA 4GMGA 4EEKA 3SC2B 1O2DA 4PNHA 1HC7A 3H5RA 4KQWA 1PVVA 2BFOA 2B37A 2J5QA 4H59A 3WSVA 2HUNA 3TAHA 1WABA 4BTEA 3IAM6 2C4WA 2V4MA 4R2JA 1FC0A 4RZQA 1A5AB 1IOZA 3EVGA 2XVYA 4WADA 3R9KA 1NMZA 2ES4A 5TVGA 4LZWA 3KZVA 4PZLA 4O29A 4ZU3A 3OQVA 1OWLA 3Q7SA 3STUA 3WAJA 1GG5A 1RWNA 2OCKA 4R98A 2FUG6 2EG9A 3DVAB 1GYRA 2FY8A 2B20A 3S4YA 3FMGA 3VHQA 3GNSA 4NTZA 5E3IA 4F3TA 4K6HA 1XVIA 3SXPA 3H86A 5E9QA 4D9CA 2IYTA 4KAJA 3VTKA 3UJCA 1O5IA 1XDBA 1CUCA 1TZMA 2IYSA 2WM9B 1T29A 3IAUA 4QYTA 2J5RA 5FR2A 4S05A 4UBKA 5CA1F 4QFBA 3AR6A 2GKOA 2IDJA 1XZGA 3ETCA 5EP2A 4LYYA 4Q4HA 4AUMA 3ZU6A 4HAOA 4IF6A 4K6OA 4NAUA 4YDRA 1YSCA 4Z8XA 3TTYA 1RYHA 1M73E 2WI8A 3ZE6A 4E5NA 3OPVA 2QJWA 4F97A 4GR4A 4MI1A 1GT91 5YASA 4LE2A 3W1WA 4B3SB 1C0IA 3D43A 4IY1A 1FSPA 1GGHA 5EHQA 4LI3X 3P2OA 3IIKA 3KBBA 1XWWA 3PHCA 4S2EA 4AUNA 4JBGA 4XJXA 1AB5A 1BXKA 1K7CA 2ZU0C 4OIFA 2Q3FA 2QM8A 1GPAA 3DBRA 4JFAA 1P74A 1QKIA 2WYIA 5E4JA 1JEQA 1Z38A 3UJBA 2K5UA 2ZYWX 1TEXA 1EGHA 1N6KA 2CYAA 1XEXA 3VXKA 4I1IA 3ABSB 4JJ4A 4NCJA 4M8NE 4V0KA 1UXGA 1DLIA 1MQAA 1VBMA 3AI7A 2QLNA 3I9FA 4PZDA 5JPIA 3UTDA 1TW3A 1ZK1A 2IZ0A 3PGJA 2YJTD 4PFSA 2A0UA 4PG6A 3W5DA 1KPGA 3PG5A 1Y48E 2QN7A 1QQ6A 3QV2A 1FZQA 4A2CA 3JSAA 4HQFA 1HQYE 4NV0A 2PPLA 5I4IA 1E6KA 4LCJA 1H5NA 2BFFA 2RH8A 2ZRDA 3CUTA 1YCFA 1MV8A 1CUYA 2C9DA 2OC4A 4LGVA 4DMLA 3MAGA 3UJ6A 1Z6ZA 1J8DA 3V4FA 2GBIA 4Y30A 3L05A 3CCBA 3O92A 3HWX1 4HGQA 5KYYA 3L6RA 1BWSA 2GN1A 1U8AA 1E79A 1G1AA 2OGTA 3CR7A 4XM1A 3WZLA 3E53A 5E7MA 3ZU3A 1R10A 2IDZA 4EHIA 4EZIA 3TLBA 1ES9A 3PR3A 1CUHA 1XA4A 5G0UA 4YCSA 4A0GA 4RDXA 5I6DA 4YMWA 4C6SA 3OPNA 4MMYB 4NBNA 2OCAA 5FNVF 3MWYW 3TSOA 1OIVA 3GFBA 2OTCA 3JQCA 3QK7A 2FRVA 4KB5A 3VH4A 1A9YA 1NJFA 3DDUA 1M7BA 4EH1A 1NN1A 4MP3A 1U7UA 3VHXA 4JYZA 2Z2ZA 2O3JA 1QO0A 1GIAA 2P9QA 5ALQA 4BUJA 3QENA 2FP4A 4L7VA 2ZQYA 4RORA 1ZD8A 3Q5GA 2ASVA 1QQ5A 2JD0A 1ACLA 3WV4A 1DADA 4J7XA 4UM9B 5U4XA 3VKWA 1GNLA 3FTFA 3HBJA 1J8YF 3WGLA 3N8IA 1XO1A 4Q3OA 5JXJA 2BFPA 3ZDQA 3OP1A 4E09A 1YJCA 1S2IA 1GTL1 1RBMA 2OP0A 4EGJA 4Z7JA 3N28A 4OK3A 2R6JA 1Y6FA 1KY2A 2I3BA 3ND8A 1R6XA 5K09A 4KREA 3O0TA 2Q5HA 3L8CA 5BO5A 4MEBA 3FFAA 5BQ5A 2HF9A 2ZSFA 3Q7TA 3NDRA 4UCFA 2BEJA 4CF7A 4GPIB 4B7XA 2NYVA 3P9IA 1YNOA 2B8TA 3ZTTA 1VE6A 1WIWA 4W5QA 1UMDA 4C4TA 2PKWA 1GKKA 3L0OA 2LDXA 3ND6A 4KDRA 3TL3A 3K0KA 4ID3A 3LUFA 5KOIA 1IWPB 3CRVA 3TNFA 1FJGB 4RXTA 1BNCA 2RH5A 3EZFA 1L5YA 4NYMQ 2XCIA 1OTXA 3A7EA 4IPTA 4M9XA