1R50A

Bacillus subtilis lipase a with covalently bound sc-ipg-phosphonate-inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
b'HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Directed Evolution of Bacillus subtilis Lipase A by Use of Enantiomeric Phosphonate Inhibitors: Crystal Structures and Phage Display Selection
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 63
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r50A00
3I6ZA 5LZ9A 5AM2A 5DNWA 3STVA 5CXUA 2Y2UA 3D4LA 1VE7A 1WB5A 4KRXA 3WA7A 2WIFA 1XZIA 1YA8A 2OCKA 4V2IA 2ZYRA 5ALMA 3R3XA 2OCLA 5HFNA 1JU3A 1GPNA 5ALOA 3AILA 1XRMA 2PKYX 3A2NA 1EXWA 1A88A 4CG3A 1AC5A 2V98A 1DT3A 2XMRA 5ALSA 2G4LA 4N5IX 2AJCA 2XI4A 1GQRA 3WIOA 3FAKA 1ZD4A 1W6RA 3MUNA 1T4MA 1BS9A 2QTBA 1EI9A 2J3QA 5DJ5A 2C5FA 3I6MA 3W9BA 3H2IA 1MNAA 1DQZA 2UZ0A 3P2MA 2W22A 4J0DA 1UK9A 5JADA 3BJMA 1W1IA 5T4FA 3KD2A 4C4YA 2QJRA 4NVRA 2XE4A 5JZSA 2WIGA 1ZIXA 3C5VA 1Y7IA 4ROTA 4FHZA 3OOSA 1EB8A 4KAJA 1XZJA 4L72A 4F5ZA 2C0QA 3VKFA 2DSNA 1TRHA 4C6HA 1PJAA 1OXMA 1LPPA 4G5XA 3FOBA 4OU5A 4ZREA 3LP5A 4DTCA 3DNMA 4MQMA 4C4ZA 3UUEA 5A7HA 5KWJA 1CQZA 2ZSHA 1SCQA 4OYLA 4XWGA 3IB3A 3T52A 1BRTA 1XZBA 3V1LA 3I1IA 3H2KA 2WIDA 1LBSA 4JEIA 5LYYA 2QM0A 4QNNA 2V96A 5AM1A 1QZ3A 4F0JA 4MWTA 3F96A 1CFJA 4MWSA 3PF9A 1RP1A 1QIHA 1PV1A 3C45A 4KJXA 5HKAA 2GYUA 1UOPA 1LPBB 4AZ3A 2RAUA 4IH9A 1JKMA 2JGMA 3B5EA 5CBKA 3E3AA 3ZLUA 3ANSA 3LLCA 3R3WA 3W2TA 1QFMA 1W4LA 5K3FB 4IH4A 4Y2YA 4QA9A 5AOCA 4M0EA 5D7BA 1K5PA 1VKHA 3OC0A 2PUHA 6YASA 3QPCA 1ORWA 4J0HA 5CH5A 2Y6UA 2WJ4A 2QRUA 4GEGA 1XZEA 1W76A 3SWWA 5AK3A 4GWLA 3I28A 1QIDA 1JJBA 4P92A 5FLKA 3G9UA 1ZI9A 1U65A 1U2EA 3TGLA 5F4ZA 3C5WP 2QT9A 2I3DA 2JGFA 5JYCA 3RARA 2ECFA 2GZRA 3M83A 1ODCA 4BP9A 4X95A 5EHNA 3WL7A 3H1BA 5AK5A 4BVLA 1DT5A 1XZDA 4TPKA 1XRLA 1XZKA 3WZMA 2PSHA 4JNCA 2WHPA 2VAVA 2LIPA 3ZI7A 2RHTA 2HIHA 4Y2JA 1QE3A 2ZSIA 5ALHA 1MT3A 1WPXA 1QIIA 1TK3A 3I6YA 4BB0A 4H0CA 4BC1A 4EUSA 1U4NA 2PVSA 2EEPA 1N8SA 4EA6A 2PM8A 4GHWA 1L7RA 5ALLA 3L1IA 1Z68A 2X76A 2DFPA 3KXPA 1YSCA 1DTEA 4INZA 1LNSA 2ZYIA 4N8SA 1KU0A 4G9GA 1WHSA 5D3ZA 5JANA 1E66A 4FMPA 3WK7A 3WKCA 2OXEA 2WUGA 4UBNA 3DD5A 2GYWA 4LXGA 3WKBA 4BAGA 4UBKA 2JGJA 1XLWA 2WM2A 1QIKA 3HABA 2HADA 5AICA 1JJFA 5ALQA 1CEXA 2QUBA 2DQYA 1HKHA 3FWHA 4UBMA 1ZJ4A 3WA6A 3AINA 4J0IA 3BE8A 4HVTA 5C8VA 2HA3A 4AX4A 5CTAA 3GROA 2OCIA 3HXKA 4DNOA 2VEOA 1P0IA 1XLUA 3C6YA 1CUXA 1QIMA 1THTA 1XROA 1XZFA 4HRYA 3WYDA 1C7IA 1FFAA 2VAXA 5AI5A 5AKIA 4D9JA 4L3WA 3O0DA 3C6BA 4OB7A 1HBJA 3L1HA 5K3DA 4G8CA 4FLMA 5AI8A 4N8DA 4ZV7A 4YK7A 2XLBA 1XRQA 2XMSA 1CUDA 3IURA 3WL8A 3UUFA 2WUFA 5D6OA 5C8ZA 2B61A 2XMGA 3IIIA 3H17A 4H7HA 1WM1A 4X85A 3WZLA 4DSAA 2HA5A 2DR0A 3WLAA 4A5SA 1K4YA 3V1KA 1BCSA 4TVKA 2G5TA 3R3ZA 1XQWA 2WQZA 4LHEA 3LIIA 4LIPD 1HDEA 4M0MA 3BDIA 3FSGA 3I2HA 1AMNA 4BAZA 4MQLA 1LZKA 1ISPA 4FBLA 1H2YA 3WWEA 4B7ZA 3CN7A 3UMJA 1WPRA 1UK6A 1LPAB 3FYUA 1SFRA 4U2CA 5DYWA 1LPOA 4OCZA 1CQWA 2XUDA 4EZIA 4BZWA 2OAGA 2HA0A 5AKJA 2PBLA 3B3QA 1R3DA 4TGLA 3G7NA 4HAIA 3DOIA 4ZV9A 3OM8A 2WIJA 4DMFA 1ZI6A 4GXNA 4E15A 2J4FA 5AJHA 4I4CA 2EDCA 1LZLA 1YS1X 5CT6A 2CUTA 3ZLTA 3C6ZA 3WWDA 2XUHA 4QWWA 4CG1A 2QXUA 1GXSA 1LLFA 2PPLA 5AIAA 5HK9A 5ALVA 1TIBA 3ANTA 4RPCA 1JJIA 1ZIYA 3IUJA 1VXOA 1WB4A 1QIGA 3ILSA 4QWMA 4U2DA 5LZ4A 2WFLA 1XLVA 1CUBA 1ZJ5A 4UHFA 4PV7A 5FDFA 1EDDA 3G9XA 2BCEA 2XUOA 4O08A 4M0FA 1R9MA 1WHTA 4FDMA 5IVKA 1TAHA 1LPMA 2WLSA 4G8BA 2JEZA 5JZ9A 3H2GA 5FPPA 3V1NA 4W1RA 5FXMA 3QPDA 3CCCA 1Q0ZA 4BDTA 3R41A 4DMCA 1IUOA 3HEAA 1ZGBA 4X6UA 3MVEA 4MJ3A 3H0CA 1ACLA 1Q0RA 4AO8A 5DNVA 2AJLI 1EHYA 4J0GA 3HLKA 1D07A 4B0OA 1K8QA 5ALIA 4Y2UA 4NMWA 2OPHA 4FFVA 2PX6A 3QMWA 1UWCA 2PL5A 1AQLA 2HRQA 3D2CA 2XUJA 2VSQA 1JT2A 2HA4A 1GT6A 1G66A 1E5TA 4KE8A 5IH7A 1BROA 2OGZA 2WJ6A 5HF8A 4PQEA 3R0VA 1Y37A 2J3DA 1IUNA 5CT9A 3STWA 3C70A 2XMZA 2Y1KA 1YASA 3D2AA 4E14A 5CH8A 3R3UA 3R3VA 2JIDA 1TKRA 3WK9A 3VJLA 4U2EA 2JGLA 2VJDA 3BWXA 5EGNA 4DYHA 4QLOA 1SC9A 3HACA 4CIAA 1MX5A 5BWBA 2PSDA 4G1FA 1P0PA 4HXGA 5JD4A 3FVRA 4OU4A 1JFRA 4RE5A 2HHAA 2I3ZA 1K6EA 1LPSA 1NU8A 3NOXA 4XX1A 4F21A 4IO0A 1Y7HA 3O95A 3A2LA 1EA5A 2CBGA 4L0CA 4W63A 4J03A 2E3JA 3RM3A 5T4EA 2G5PA 4QDOA 4HZGA 4QLAA 2H9YA 2GBGA 5ISMA 4JYPA 2JF0A 1P0QA 3F97A 4BTVA 3GBSA 1MAAA 5AKKA 5CT8A 2H7XA 1VA5A 3STYA 2XUFA 1ZICA 5AKHA 3BF7A 3JW8A 2B4KA 2W6CX 1J1IA 5CT4A 2CMFA 1B6GA 1SCKA 2GBCA 4BRSA 5JAUA 2ZJFA 3BL8A 2VJCA 1CUEA 2OAEA 4H7KA 3GELA 3W06A 1G4HA 2HU7A 4WDRA 1EDEA 3IUQA 2PSFA 5SYNA 1YR2A 1GKKA 4UFNA 4AZ0A 4MEBA 1YA4A 4AO7A 1QIEA 5EIHA 1QONA 1CUFA 4CCWA 3G8YA 2GYVA 2D0DA 1XRNA 5C8XA 4G8DA 2VA9A 4KE9A 5JAHA 3GUUA 4PF1A 3ESBA 4OD0A 4H77A 2I03A 5JIBA 1FJ2A 4B80A 4CI9A 1ORVA 4S0XA 4AQDA 2WILA 5KBYA 1H2WA 3QH4A 1MN6A 5AI4A 1BCRA 1XRRA 4X97A 4PO3X 5K3AA 4J0CA 2EDAA 1J07A 4H18A 1RYYA 3L1JA 3AZOA 3SK0A 2BUAA 2O7RA 4QDTA 1JMKC 5SYMA 3HC7A 3G9ZA 4LYEA 5ALKA 3C43A 4DM7A 1EINA 4FBMA 1MNQA 2RI6A 1QO7A 1VA4A 1ACJA 1XKTA 1VE6A 3H19A 5A7GA 1SCIA 3G0IA 1AX9A 2JEYA 2YYSA 1EVQA 4YX9A 1UFOA 5CH3A 5ALYA 2VT6A 3ESAA 4J0JA 1TCBA 1SOMA 4LXHA 4ZXFA 1DU4A 5IVIA 1UK7A 2DHCA 3G0BA 1DX4A 4GECA 2OGTA 5D3KA 2PU7A 4AN1A 1CUGA 4CIBA 5H3HA 1UXOA 3OPMA 3O4JA 1LBTA 2Z8XA 3WWOA 3Q8WA 1KEZA 1EVEA 5DYYA 1JMYA 4ITVA 2Z3WA 4Y7DA 5AOBA 5HK8A 2FX5A 4PSCA 1MTZA 3F98A 4MYSA 3DOHA 1CR6A 2C5GA 5ALRA 3VXKA 3DL4A 1UKCA 2HDWA 2WHPB 2XQIA 5AI6A 5EI5A 1MO2A 4KRYA 2Y6VA 3ZV7A 2BUBA 3F8SA 3IULA 2ES4A 4UBIA 1F0PA 4OUKX 1C4XA 4AMYA 4Y2QA 2CZQA 5ALUA 2XUQA 3HZOA 1R50A 4CG2A 2HU5A 1YAJA 1CVLA 1EK2A 4P08A 3V1MA 1W75A 3ICWA 2O2IA 2ZJ6A 2IX9A 3H18A 4B81A 3DQZA 4UBOA 1AKNA 1EB9A 3DYIA 4Y2VA 1L7AA 3HI4A 4OYYA 3PF8A 3O4IA 1GPLA 5AHXA 5FV4A 3H2HA 4Z49A 3QMVA 4UBLA 5HF5A 1M33A 3D59A 3G02A 1EDBA 1CV2A 3FSGD 4KYVA 3G9TA 1K63A 3GA7A 3A6ZA 2ZVDA 4DLNA 4B82A 3VISA 4X6XA 1Q84A 2C58A 2XQKA 3RLIA 2X5XA 4HS9A 1OILA 4HRXA 3BIXA 4KAFA 1WB6A 2HFJA 3WK4A 4BAUA 5JATA 3PUIA 1DX6A 4EY8A 1CUYA 3V9AA 1CUVA 3BF8A 3AIKA 1IUPA 4BTLA 3W9UA 1FFCA 4P93A 5AI0A 1OCEA 1A7UA 4XVCA 1X2EA 2IIVA 2XUAA 4FNGA 5YASA 1C7JA 1NX9A 4EY7A 5HQ3A 2C0PA 5JAOA 5EHQA 4WY5A 2VF2A 4X93A 3STUA 5AKLA 5DTIA 4BATA 2WG2A 3NUZA 5LKRA 2JGKA 3O4HA 2WUEA 4JYMA 1AZWA 2QZPA 1LPNA 2Z3ZA 2VATA 1AGYA 1QLWA 5I7UA 4C01A 1USWA 3F9CA 4XIIA 2QS9A 5T4BA 3RKSA 2PSEA 2J4CA 2R11A 1I6WA 4FLFA 2OQVA 3BXPA 3PFBA 4DMHA 4FNMA 1TCCA 4U2BA 3WI7A 3WK6A 3WL6A 5AM3A 3QPAA 1T2NA 3AZPA 5HCUA 1WCYA 5T4HA 2HM7A 2V97A 3WKAA 2OLEA 2CKMA 3F67A 4Q1VA 1JI3A 3FCXA 5A62A 4W9RA 4WY8A 1TCAA 5IVHA 1CRLA 4HXFB 3FYUB 4Y2XA 4EBBA 4G4JA 1BN7A 3PICA 5K3CA 5ALFA 3ESCA 5DWDA 3WK5A 1VJ5A 4LKOA 3PFCA 3I2JA 1MPXA 3WJ2A 5KREA 1XKLA 4FFWA 4B6GA 1FFDA 1G5FA 1U8EA 1DQYA 2CJPA 2GZSA 2XMQA 2YASA 5ESRA 3S8YA 4C87A 5JZBA 3DLTA 5CW2A 2DHEA 3CCBA 3R40A 3HYSA 2AJ8A 1A8QA 3O9VA 1XQVA 2QUAA 4X90A 2FJPA 5CRIA 2QXTA 4ZRDA 3DS8A 2Y2VA 1QO9A 5HF9A 5DLPA 1ZD3A 2WTMA 3EQ9A 4CFSA 1IZ8A 4DGQA 4G4GA 4EHBA 3C8HA 5C7YA 3D0KA 4QDZA 2WFLB 4BE9A 2WKWA 2BGRA 4BZZA 4KR0A 1F0NA 3K6KA 1EX9A 3LIPA 4B84A 1QIJA 1JU4A 4W1SA 4BCBA 4Y2SA 3WK8A 2RIPA 1ZGCA 2Z5GA 2RONA 5KWIA 2ACEA 4L9AA 1H23A 3FVTA 1UKBA 5LIPA 1UZAA 5JARA 1QIFA 2YH2A 3TRDA 5A2GA 2WHRA 1ZOIA 4N5HX 2BUCA 3CN9A 3PE6A 3PDCA 1R9NA 4RGYA 5FRDA 2HRRA 5HKBA 3OG9A 5FUMA 3H04A 4LYDA 5AM5A 1MU0A 2V9ZA 2WG0A 4H35A 3A2MA 3IUMA 5AK6A 4G9EA 4WJLA 3O4GA 2O2GA 3KWJA 5ALJA 3STXA 4ZWNA 3M82A 5K3BA 5ALTA 4CCYB 4P9NA 4DNFA 1ETHA 4PW0A 2XQFA 2DQZA 1DWQA 1BN6A 2H7YA 4K6KA 2BAGA 2G63A 1X2BA 2HA6A 3BIWA 3RK4A 5K3FA 3ZWQA 5AM0A 1E8NA 1QJ4A 2WG1A 3DL7A 4GLBA 4X94A 4DSZA 3IBTA 2XT0A 3MUOA 4W1QA 5LZ8A 5AO9A 3MGAA 2QKYA 5FP0A 4GBGA 1WOMA 2XMBA 4Q3KA 3N0TA 4KAAA 3VVMA 1CUIA 1XZHA 1QFSA 7YASA 1N5RA 1AURA 5ALXA 4FWBA 4X92A 4BCDA 4H7JA 1YB6A 2JGIA 1DINA 4RNCA 4EY4A 3CXUA 1R4ZA 5AKEA 4WCVA 3I2KA 4AXBA 4C88A 1CUWA 5E4TA 4B9AA 4FOLA 3NWOA 4H7IA 4GI1A 3ZLVA 1NU6A 1XFDA 3VJMA 1ODSA 5AKZA 4WFKA 2GBFA 3DCNA 5AP9A 2P8SA 1MX9A 1FFBA 4FTWA 1BU8A 5ALZA 1THGA 4EY6A 1QGED 5AKYA 2D5LA 4UHEA 2X8BA 5ALGA 1H2ZA 2DCMA 3W04A 4Y9SA 1W52X 4Q34A 4U2GA 2I78A 3DYVA 2XQGA 1R1DA 3AZQA 4Q05A 5JD6A 2OQIA 3FYUC 3WWPA 3DKKA 1YS2X 1HQDA 4IQ4A 1E89A 3QYJA 3A70A 2QR5A 4AMZA 5LP1A 3LCRA 3TEJA 4BVKA 3SC2A 3GFFA 2OGSA 4Y2TA 5AKGA 3AFIA 4RE6A 3OTQA 2QJWA 4I3FA 2H7CA 3FLBA 4OB8A 3ESDA 4JH0A 3BJRA 1A8UA 4PSUA 5I9IA 4DNQA 5J3JA 3S2ZA 4A23A 4UBJA 2PUJA 3K9BA 3OURA 3YASA 2XMDA 3WJ1A 1S8OA 2BFNA 1GPKA 3QZUA 5IVDA 3QMMA 5A6VA 4UFPA 2VT7A 4X7BA 2WFZA 2QOEA 1J2EA 2NW6A 2YXPX 3FNBA 5C81A 3KWFA 1L7QA 1BE0A 1QOZA 4I19A 3G0DA 1H22A 4DNPA 4MEAA 5ALPA 3DKRA 2C4HA 3C6XA 4DIUA 4G4IA 2WJ3A 1GKLA 3IVMA 3FCYA 4WFJA 5LZ2A 3KDAA 2OCGA 5CURA 3QVMA 2HFKA 3IA2A 2ORYA 1YB7A 4H7FA 2Q0XA 4HXEB 4UHHA 5AOAA 1J06A 2Z8ZA 3K2IA 5E4JA 1PFQA 1YAHA 2BKLA 5DNUA 4WFIA 2K2QB 4QEKA 3DJYA 1VZ2A 1LGYA 3WYNA 3HSSA 1N5MA 4N8EA 3EQ8A 4X6YA 4ZGBA 1GQSA 4LXIA 1KU6A 1XZLA 4BE4A 3ZPXA 5CT5A 4FKBA 3V48A 3HRHA 3WKDA 3WQHA 3D5EA 2R8BA 4OSEA 4BRZA 5LKAA 4BBZA 1ZI8A 1E3QA 2XUIA 2VJBA 1UKAA 5ALWA 3H2JA 1CUJA 2BJHA 5IKXA 2B20A 1Q83A 5A71A 1VLQA 4OPMA 4W1PA 2HA2A 2IITA 2AJDA 4FLEA 2ZYSA 4X00A 3I1YA 5HFAA 5EHZA 4C4XA 5I8PA 2PU5A 2VJAA 1XRPA 5LZ5A 3AIMA 1IMJA 4UUQA 2PSJA 1DWPA 3G0CA 4F60A 3I2GA 2CB9A 1HLGA 1RWQA 4JUIA 1FSSA 5EIAA 1CUUA 2XUGA 3ICVA 1F6WA 4B83A 1CUSA 2ZJ7A 1QTRA 4EY5A 2JGEA 3WIBA 4B9EA 4UHDA 4NS4A 3DEAA 3U0VA 5A7FA 4E11A 3IDAA 3PI6A 5FOQA 1MX1A 5LZ7A 1ODTC 3D7RA 4Q3LA 1MJ5A 4IH1A 5AKXA 2QVBA 4OB6A 1GGVA 2ACKA 3WMRA 3AJAA 2VTVA 5EIEA 5CXXA 1ZD5A 3WKEA 2RGUA 4DMKA 3M81A 2C7BA 2QMQA 3LS2A 4KEAA 1CPYA 1XZMA 5HQ3B 3W05A 2ZYHA 3X3HA 4BYMA 5BOVA 4Q82A 5K3EA 3B12A 3AIOA 1EH5A 4UFOA 4J0KA 3JYHA 3KOOA 3BDVA 3ED1A 4C89A 4UHCA 4ZI5A 2FJ0A 4K2AA 2H1IA 4B0PA 2WSLA 1CUHA 5K5EA 1XZGA 2VQ6A 1BEEA 3EF3A 2GBIA 3FYTA 5E2IA 3TJMA 4KE6A 1CUZA 1EK1A 5JD5A 1AUOA 3U1TA 1UOOA 4K6GA 1CUCA 2XQJA 3Q0TA 3GZJA 4QE3A 1E8DA 3D2BA 3QM1A 4PNZA 1FFEA 4GW3A 3C87A 5JALA 5EHXA 3E4DA 5BV7A 5HF6A 3T4UA 2BGNA 4BC0A 2WTNA 4U2FA 4YASA 1HPLA 1UT6A 3FBWA 2DHDA 4Q3OA 5E4YA 5AK4A 2AXEA 1GZ7A 2XUPA 1CIJA 4KACA 4K6HA 1YCDA 3QBJA 4HTAA 5HZGA 1G42A 3M3DA 5ALEA 1BEZA 4KE7A 4BDSA 4J7AA 4K5QA 5EFZA 5LLSA 5ALDA 1F8UA 4WDQA 2WFMA 3H1AA 3VJKA 2CEKA 3EQ7A 3I2IA 5DTJA 3JWEA 1VXRA 1DWOA 2HL6A 5BWCA 1N1MA 3EBLA 4BVJA 1CUAA 1IVYA 4X91A 2O7VA 4UHBA 4UPDA 1VZ3A 1UOQA 2WUDA 4QDUA 3FLEA 3VVLA 3HJUA 3N2ZB 2JBWA 4J3JA 4B85A 2FUKA 3O9MA 3R3YA 1ZD2P 5AM4A 3E1GA 4NZZA 2O2HA 4PSDA 1R88A 3E0XA 4EB0A 2ROQA 3PUHA 3AUKA 5AIBA 4XJVA 2RHWA 2XB6A 4BCCA 4X71A 1IZ7A 2HA7A 5AI9A 5JAPA 3VDXA 1XQYA 2WU3A 2ONCA 4Y2PA 4IHAA 2XDWA 4YPVA 1B41A 2WIKA 3C8DA 1HL7A 3NGMA 2B9VA 2WU4A 2WHQA 4AB1A 4ARAA 3WWCA 3QITA 4AN0A 3STTA 1VOTA 1QTIA 4ETWA 3FLAA 4QDXA 2HU8A 3IUNA 1A8SA 4QZVA 1O6FA 2XLCA 5ALNA 4MYDA 3SX4A 4H7DA 1E8MA 2XMCA 1UK8A 1XZAA 4H7EA 5FKJA 1X70A 4GDMA 4Y2RA 4MXDA 1CLEA 1O6GA 3DDUA 5AH0A 3WL5A 1P0MA 1H2XA 5FPQA 4CCYA 3EIOA 4ARBA 4BP8A 2OG1A 3G0GA 1XZCA 4X3CA 4A16A 1TQHA 5CMLA 2XUKA 3I2FA 4AO6A 1XQXA 1MAHA 5DYTA 4E46A 5JASA 3KSRA 2AJBA 3D3NA
chains in the Genus database with same CATH superfamily
2NXWA 4EG8A 5LZ9A 2XJ9A 4JA0A 5DNWA 3V3TA 5BORA 4FYMA 2EW2A 8ADHA 3I04A 1NULA 3IAM6 4U63A 2GCGA 4UAGA 4TZKA 3ZIAD 4YRAA 4AS1A 3MSXA 4Z8XA 3WP0A 2VHUA 4M6WA 4HLDA 3KPUA 4KRXA 3HKEA 5KX5A 3QNMA 4BUJA 4E08A 4WWHA 3F6CA 4WRRA 5KPJA 1ZXLA 3BFXA 4JL6A 5AW6A 3NBFA 5K20A 3WA7A 2NVUA 2IQ5A 2QX6A 3MW8A 1NXQA 5D85A 3SSOA 3HB5X 2IZ7A 4NBNA 4DDWA 1X74A 1IPEA 5EUCA 3SIWA 3AEUA 3TQIA 4M3NA 1Y9ZA 1Z39A 2QPOA 3VNAA 1D4ZA 3HO8A 3R3XA 3GMSA 3NOVA 5ALMA 1ZN8A 3F6EX 4UM5A 2DPYA 1RD4A 3ORRA 4MX8A 2JH9A 4NJMB 5KNDD 1AKWA 2HRZA 1XT6A 1EXWA 3M6FA 2IDMA 2VPQA 5HUQA 2G80A 2IEIA 1NF3A 4B4DA 121PA 3LWNA 1GZ3A 4C0AC 1WMDA 4K2HA 1G7SA 1MZVA 2C4WA 3TL6A 1XU9A 4R2JA 3PNBA 1T8RA 2V98A 4CTMA 3R7WB 3TRFA 2G4LA 3GDWA 3ORQA 4OQFA 4NTZA 5DULA 5EMKA 1XAGA 2WSSD 4DRZA 3N0XA 1ZD4A 1W6RA 2QQFA 1MAVA 2D8MA 3RI3A 1F8YA 5B1IA 3ZYCA 2B0CA 3L6RA 2QTBA 1EI9A 2J3QA 1LI5A 2G40A 2W6IA 4K5QA 2BHRA 4AJKA 3MT9A 2FWBA 1V5IA 3PFIA 4BLUA 5K8LA 1YS4A 1DQZA 5TMDA 1V8DA 1MOSA 5EJFA 3BQNB 5CNIA 1R0LA 4RF4A 5FOUA 2JEOA 1R6BX 3DQQA 1QFXA 1ONSA 1F8FA 1X7DA 2BSXA 1W1IA 5EP2A 1Y3HA 3DDSA 1WNFA 3EUWA 1W9HA 3HJGA 2XWJI 2IOFA 1GT91 1MABA 3SYNA 2O48X 2AKYA 1NUTA 3M3HA 4NVRA 2IXDA 1ZINA 2PCJA 1SA0A 1YGPA 2XE4A 2Q07A 1FBNA 1GDDA 3SYLA 1EWRA 4DWVA 1Y7IA 3U31A 3O1JC 4ROTA 1Y3AA 4J91A 2FWNA 5KOHA 1P6UA 1O4WA 3IMKA 3IXLA 3TG2A 1ZN2A 1OZAA 4PXSA 1SXPA 4YIHA 3SE7A 3RYIA 3P1JA 3UAZA 3LDGA 4F5ZA 1VRWA 3G89A 2QJOA 3VKFA 2AG0A 4DYVA 4EPXA 3R9XA 2Z2XA 1M34E 1BFUA 1RU3A 1FMFA 5CDFE 4LNUB 3UMBA 2FP4A 3O83A 2VZ9A 1KP9A 3PQ6A 4C6HA 5BMVF 2P0EA 1T0UA 1ESEA 1Y9AA 4GR4A 5KMGA 3LI2A 3MBKA 5CX1A 4URWR 1DAKA 1P8AA 4OU5A 4EGFA 3TECE 3LSTA 3TQSA 1UEXC 1JR3E 3LP5A 1AGRA 2I5PO 1A9YA 4DR2B 1O3YA 5KU7A 1DX9A 4NSNA 3C4VA 3ZC3A 4GS5A 4MQMA 5JMTA 3DTNA 3UUEA 5A7HA 2OHGA 4NENA 1KFEB 1PTKA 2OBLA 1O58A 1ZK1A 2WYVA 1I24A 4ID3A 4FD2A 4R69A 4ZP1A 5KB3A 1BX3A 3LDAA 3R3SA 3AF1A 4YP9A 1CQZA 2ZSHA 3FTCA 3SOPA 4L4ZA 2A0YA 4NBKA 5HPYB 1L5LA 4OYLA 3I8OA 3T52A 1Z4IA 3VU8A 5FF9A 4E7OA 5MN6A 3B7GA 3B52X 2B94A 3CYFA 4NYIR 3V1LA 3I1IA 3KJHA 4I9FA 5BQPA 5EG5A 2G71A 4BX9A 4EELA 2CLDX 2PZGA 5AVOA 1YR6A 4D6YA 4YRLA 5LN1A 2EKZA 1LBSA 4ASUA 4FB4A 2Z4RA 4LHYA 4WERA 2X3YA 3D54D 2UVDA 4L8LA 1A95A 2B8JA 2QYTA 1SHUX 3DONA 3P2KA 5KOIA 4D4GA 2L42A 2SHKA 1M2OB 5FYQA 5AM1A 3OPQA 2XTJA 4WKOA 4F0JA 2I55A 4MWTA 4H1WA 5ICEA 3WIVA 4L9SA 2QVLA 3TXXA 1PV1A 2Z2JA 3C45A 3ZCSA 1PT7A 1AMOA 2C2WA 1UJ4A 2BPOA 3CF4A 3I8SA 4GC5A 3AG5A 4N40A 1DBQA 1FTSA 4TM8A 4OA8A 2XD4A 1LPBB 2AXPA 2D2XA 4HN4B 4K6MA 4OI4A 1RQ2A 3P9NA 4LJRA 1KXZA 1ZEJA 2WOJA 2BM1A 3B5EA 3RYTC 1KI1A 2FN4A 3ZW7A 5HM6A 5CBKA 3B1FA 3NDJA 1GSIA 1CP3A 4AMVA 3P2JA 4TMVA 3RSOA 2C3PA 2IY9A 4FFDA 2Z3VA 4WOCA 2BFEB 3FRHA 1ADYA 3FI9A 1GTRA 3AOGA 5EHIA 4B47A 2HWKA 4GOND 5AXDA 1T8YA 1NXSA 3K0FA 3AXSA 5IDYA 3ZHUA 1RZRD 2J9RA 3GZNB 2P67A 5IARA 1A9PA 4D7AA 1KAEA 2X19A 4KNVA 1IQPA 5DBOA 4YMWA 1I6MA 1VKHA 2CVHA 2C4VA 2G8LA 2P27A 3E2IA 3K1ZA 3L77A 5H82A 2ZPUA 5KYTA 3W9SA 4HI0E 4AKSA 5MDHA 3EDOA 3KOUA 4LV8B 5LR6A 6YASA 2DX7A 4J0QA 5KJCA 5ABPA 1FFYA 3WGJA 3QPCA 1ORWA 3B1JA 3IBSA 2DY1A 3GLHB 5CH5A 1K1EA 4CM1A 4RA9A 1FTQA 2Q4DA 3EISA 3SX0A 4II2A 2HOQA 1NXXA 5HKLA 1SCUA 3FMOB 1H0SA 2H2DA 1LV7A 1PT5A 1PUXA 1KO4A 2DPGA 1AY0A 1JBKA 4YECA 1XUOA 3LV8A 4ALJA 2FZCA 4GI2A 3JWPA 3THOA 3H5NA 4JB3A 2FMIA 4MARA 4O1MA 4YJFB 3T38A 5BV8A 1U4OA 2ADFA 2C2MA 2A9FA 3MERA 1T2VA 1QIDA 1JJBA 3BGIA 1D8TA 1ZNYA 7REQA 2NTYC 3L82B 4HUQB 1G7RA 4BLQA 3HFJA 1ZI9A 4J43A 5JBNA 1U65A 2O8EB 1FP2A 3CNEA 3OLWA 3INTA 3U5ZB 1URPA 4HNHA 4O4IB 4QYXA 3PUJA 1U9ZA 2Q8QA 3ES9A 3IT1A 5LL6P 3UJCA 4TSFA 4PIVA 2YV1A 1EUCB 3BC1A 3EIXA 1G17A 4PONA 3RTDA 3F3MA 4IX1A 3PFGA 2H65A 4AF6A 2BLLA 1GUAA 1PJZA 2AFHE 4HBZA 3REGA 3UGKA 4MCAA 2OCPA 3EZNA 3CVYA 2FQQA 3ODPA 1SB8A 3RARA 4FJ0A 5JUWA 3TUZC 3S2FA 4MVYA 1CY1A 3KEGA 2RHHA 4KSCA 3UTDA 4AZWA 2OMKA 5EL0A 5K0FA 4S1PA 3T1QA 5KOHB 2GZ3A 1W0KD 2IEDA 1FPQA 3SC4A 1WETA 1TRKA 4V1CB 1US8B 3H5LA 4BVLA 1ZESA 1ADJA 3FOZA 1WF3A 2BTQB 3IBCA 3IMCA 1XZDA 3KUDA 3RSSA 3ZDRA 1JYSA 1ORDA 4Z4CA 3ML1A 1DQNA 4MPPA 2O8DB 1EIWA 3VNVA 1XTZA 5A1TA 3RS5A 5L3RA 3AP1A 4CIVA 2B4YA 4BLRA 5CJPA 5IN5A 1JSXA 5GINE 2HIHA 1FP1D 2EKQA 1HTBA 2XAUA 1GR0A 3CNBA 1Z56C 4Y2JA 1QE3A 1AHIA 1SM4A 1MT3A 2ZSIA 3RPEA 1VJ0A 3M89A 3TZCA 5CITA 2YIDA 1YULA 3OHPA 3PXEA 5B58T 4WN9A 4OHZA 4E31A 1EFRD 2H4XA 4MVJH 4BB0A 1SBIA 3FDIA 2ZJYA 2YXLA 2CMDA 3D0OA 1H1LA 2PVSA 3Q5DA 2VHCA 4LJ7A 3FPAA 4EA6A 2PM8A 1E6EA 1DC6A 4G1MB 1QG0A 4NEHB 1T5HX 5GONB 4HH4A 1KQPA 5TGDA 1BNCA 3PCRB 4Z86A 1PKEA 3HSYA 5TV2A 1NP7A 4IZIA 4EI8A 2QD3A 2WMOB 4YALA 5F12A 1FYWA 2P4UA 3AHEA 3MWYW 1YSCA 2DF8A 3JASA 2ODWA 4D46A 1CY0A 3S3TA 2OENG 1DKMA 4QG7A 3LHSA 3SLGA 2IHYA 1LNSA 1VDZA 3LNCA 3OI7A 2RJNA 1P29A 3KQUA 2IP4A 4TM7A 3AESB 3ZWYA 1DUSA 1Z0SA 2I7VA 1YQQA 4DEYA 5DI3B 2B1RA 1IJBA 3GLFB 4JLMA 5D3ZA 5JANA 2A1TS 1E66A 1NJ8A 3QOWA 4UMFA 4FMPA 2OECA 4TKLA 4DV7B 2EW8A 1Q92A 3B8EA 2C5LA 2OXEA 3ZVLA 1Z4NA 2JCBA 2HC9A 4M86A 1TCUA 1ISSA 5CB6A 1JTVA 1JIUA 4ECAA 1IBKB 1I0ZA 3WBKA 3WKBA 3HMKA 4WLNA 5F1OA 2V5VA 1C3XA 3B6MA 3K6SB 3VO9A 2H2WA 1XLWA 1G7CA 1SCBA 3V6LA 2WM2A 2GD0A 1GVHA 4EJSA 1GSHA 3HB7A 5LYJB 3V7WA 3U5TA 2MU1A 2WD7B 4NU5A 4RIEA 3EW7A 1QG2A 1UM9A 3UAXA 3OEED 1W87A 3HR8A 2HADA 3PHGA 4IWYA 1RPJA 4HHEA 4DLYA 5IC5A 1O03A 1COZA 1QYIA 1H2RS 3U60B 4JD5A 1K8YB 3D3JA 3IKJA 3LNTA 3U4CA 1X7XA 2A7XA 2BM9A 5B58C 5BN1A 5JFGA 1U6KA 1EFKA 1ZK2A 3JQ7A 1HKHA 3WSWA 3BTVA 4TUYB 1HOXA 1WCIA 1ZBDA 4ZDKA 1J8MF 2WSBA 3F3SA 3C98A 3WA6A 3HFGA 3C3JA 2RGCA 4I55B 2A1IA 1QLJA 2QL5A 4LE0A 1YVUA 2GN1A 3M5WA 4M0KA 4ED9A 4BE7B 1LVHA 2C9DA 1F3LA 1U0TA 4P98A 4QT0A 3V2GA 4EM6A 4O5AA 1ECPA 3GWZA 3EW9A 4AX4A 5CTAA 3PL5A 1AUQA 2IYWA 4PPYA 4BMSA 2ALJA 1CQXA 1ZU5A 3GROA 5H4HA 3A4TA 4XASA 2SCUA 1F6DA 1ZDMA 1RAHA 1PI3A 2WICA 3H6KA 3RBZA 1NNSA 2ANBA 3MRXA 4QXAA 2NVOA 1P0IA 4UU7A 4ZVUA 4C7MA 5GY7A 1RXVA 4MCIA 2JANA 5C1PA 2GD1O 5IF3A 1OGJA 3O7MA 4NJOA 1QUFA 2VNJA 4LYJA 3TJZA 2D62A 3WHKA 1OH8A 3BAFA 3WYDA 1C7IA 1D0VA 3DEHA 1KJIA 1U8YA 5ERXA 4PYLA 3MGGA 1HO3A 3TSOA 5DYIA 4HADA 1IPFA 3RBAA 1ZJYA 1KE1A 5JEEA 3CEPB 5LJIA 4AVYA 3A6JA 5K7SA 3DBRA 1C9YA 1FDIA 3R0ZA 4L3WA 4OKSA 1O6BA 4EIWA 2C5SA 4QTYA 2Q45A 4OB7A 1HBJA 1N3LA 3DBHB 1QYVA 5K3DA 1CDEA 4E2WA 4F5EA 1QU2A 1QOPB 1L5HB 2OCXA 2OV4A 4J6EA 4B3JA 5TF4A 3Q5GA 2XOKA 2X4LA 5JCOA 5CCDA 5L3SB 5IPFA 3EE6A 3KV1A 1ZHOA 5HTOA 2Q29A 3MJCA 1V5EA 1PRYA 2HPZA 1HLFA 1LDBA 3IURA 5CB0A 2PQ0A 3K2BA 4ZC8A 5K2OA 3PQ3A 4KR9A 4ER5A 4OXXA 1DZIA 5C8ZA 3H17A 3W6UA 1WW2A 4U8GA 1RBYA 4R1MA 3WV5A 1JDZA 4MHSA 1TA0A 1VFNA 5T6BA 5CP8A 3ZBTA 1U0NA 3WLAA 5CVCA 3HM9A 3MQFA 2KQUA 3WYAA 2NYAA 2OBXA 2FZLA 1FJXA 3QBTA 2FEPA 3SICE 1Y5MA 3EZFA 3W1WA 3U40A 2WQZA 4FZ5A 4M9CA 3HUUA 4A0GA 4B34A 4CHTA 4YCLA 4RFSB 2JJ8A 1ZPDA 1SBZA 4H7PA 3QELA 2VPZA 2XBUA 4IDOA 4LOJA 4FMDB 2GXUA 4FB5A 4K9PA 2ZUVA 3K1AB 4KMRA 4AK9A 3JQAD 1VPEA 1IVSA 1Z6XA 4RORA 3OX4A 3WRXA 3I2HA 4I5FA 1AMNA 4MQLA 1DJNA 1KZ7B 2QTMA 1UMCA 3RC9A 3WDMA 5BOSB 4KGXA 1C7EA 1CRWG 4FOTA 1OLXA 4MVJD 5TS2A 4DSUA 4PN7A 1H2YA 4TMZA 4ZMBA 3BTSA 3M3PA 1V39A 4CEJA 3RFVA 1TYZA 3WXMA 2OP1A 4D0GA 2JIRA 1Q0SA 1NVMB 3HB0A 4QAQA 4H27A 2Q2WA 2XWQA 5EERA 2H5EA 3I62A 1U0EA 2MINA 4Q3EA 4OQEA 5G3ZA 3VH2A 1MB4A 1KK3A 5H1YA 3HWRA 4RK0A 1H5QA 5JISA 2OHFA 3NWJA 1UK6A 2H9AA 1LJLA 4UAVA 1LI4A 1U90A 2PLFA 3N2IA 3HA3A 4S05A 4EW1A 4U2CA 4V0MA 2QR2A 3PUYA 5FWXA 3BWYA 1ZJWA 5IZCA 1PSZA 4BGEA 3ZDFA 7MHTA 2BM0A 1MVNA 2BI4A 3AVXA 4EG3A 3G17A 2LXNA 1ZAKA 2VK4A 3L7CA 3UWMA 3V32A 5IFKA 1XXHA 1TT5B 4M0DA 4B35A 3H4VA 3EC1A 1V96A 3GA0A 3RS7A 2RGXA 1O57A 5HILA 5KKAA 1L4FA 3B7PA 5BN5B 4HAIA 2AOTB 3COZA 2OZEA 4ILKA 1ZAYA 4F2DA 3GFSA 2E5LB 3OM8A 1GZUA 2VSYA 2WIJA 4DMFA 4QVKA 3LBYA 4YUAA 4D4MA 2C98A 2VDKB 1C1XB 5H7XA 2EHJA 1RWBA 3RTCA 4K9NA 1ZNWA 4GXNA 3WQRA 4E15A 4U39A 1QDEA 2J4FA 1VLVA 2BFFB 4F4HA 5LU8A 2WUWE 3UJ3X 3H9QA 3A4LA 2AMYA 2CDNA 4UJ5A 2QPTA 1WTAA 4XZ3A 3UCFA 4HDOB 3VYRB 3DYBA 4WKCA 3AGQA 1P5HA 3CIOA 4CMCA 2ZYVX 3ROFA 2CUTA 5DP2A 1M8JA 1XVLA 3PDIB 4N3GA 4R5HA 3JZAA 1HK7A 3WWDA 1K8RA 1I2ZA 1YVEI 2VCHA 2HIMA 4OEHA 4K3VA 3MAAC 1T0BA 2VRCD 4G5FA 2NXNA 3MWDA 4Q39A 3GPDG 2JVKA 1GFZA 3NOQA 3OOYA 4MO2A 1GKUB 3UANA 3GDOA 4RPCA 1OXXK 1E3LA 3KX2A 1SUEA 2H2FA 1U0RA 3IUJA 1AE1A 1X14A 2VNSA 1EFTA 1BKYA 3P4UA 1I51A 5B53A 1L5SA 3ILSA 4EZEA 1HLPA 2OORC 4JB2A 3KZNA 4L7VA 5BQFA 5HXAA 1GG2A 3Q7SA 3ZIDA 1N2JA 1OWPA 3HN2A 3TLKA 1NBEA 5KNCH 1XPUA 1U1GA 4X1YB 4RK7A 3WDSA 4YH1A 3WLSA 5HFJA 5SY9A 2JB9A 1M0TA 2BFPA 2QTNA 1KSJA 1IC6A 1ZJ5A 3FPBA 1V7CA 3IS3A 3NHKA 1OW3B 4NCXA 3DMPA 1WWKA 2M6LA 2W6MA 3V46A 3O3CA 3VR6H 5C7OO 4ZHQF 5KYGA 2JA2A 2J3MA 3N70A 2ZR8A 3CPEA 3D7LA 5H4GA 1VL1A 3JQAB 2BCEA 4O08A 5G3YA 4R2KA 3A4MA 3TPZA 4BASA 2QVXX 1F14A 1U4SA 2PS3A 3H83A 3F78A 1SK8A 3UMYA 1R9MA 3UHFA 1M2HA 1BWPA 1YUNA 4Q19A 1ZFNA 4A6DA 2RC6A 5DCUA 3ZY3A 2O2JA 3Q4GA 5IVKA 1RMTA 2KX7A 3KFVA 3MMPA 1S7GA 4FYYA 1LPMA 1JLMA 5DLDA 4KI0A 2WLSA 1B23P 3P4YA 1ZUHA 1RHRA 2WSIA 3K8YA 4W8OA 3O8RA 1GL3A 1JECA 3KXDA 2FSPA 2NSYA 4AG3A 1N6LA 1N9GA 4Z99A 4RVUA 2ZE5A 2CV1A 1Y1TA 3QKSB 5JZ9A 3LT4A 3U49A 3H2GA 2FWAA 1QGDA 1ST2A 3DR5A 4XCVA 4YA6A 5FPPA 5L7WA 4KRFA 3V1NA 4EJ6A 5C52B 2HSDA 4LZZA 5FXMA 3THYB 4W9NC 3WLTA 2FA9A 4FYPA 4QDKA 1QQ5A 3QPDA 4KSBA 4TS9A 1V16A 4EG1A 4NCKA 3P9YA 5K9ZA 2IH2A 4URXR 2IYUA 1IM5A 5DIZA 3R9KA 1GCAA 5FOWA 3RG8A 1VECA 1QGZA 4W6QA 1PS9A 2C94A 1NUUA 3WBBA 3AHCA 4MJ3A 2HQOA 2ZS8A 1Z25A 2P2CA 1EDOA 3Q72A 4HYYA 3RIYA 1N2CB 1AD2A 1KI7A 3CUYA 1IHOA 4OK5A 4YC7A 2YFKA 3O90A 4J1TC 1H2FA 4GM4A 1DEOA 4OH7A 3SLKA 2VBIA 2ODAA 2IIBA 4ZCTA 4UQPA 1K8QA 4B6QA 1OF1A 4PFQA 5ALIA 3ULKA 4G8JA 3CZMA 4NMWA 4Y2HA 5E2BA 5F3RA 4FFVA 2PX6A 3AUJB 4L73A 4RU1A 3TL3A 3GJSA 1KK0A 1XMPA 2ZRBA 3AJ8A 3QVGA 4MW6A 2C2XA 1B0ZA 3OOEA 4QAJA 3CLVA 1IG3A 1M1YA 3DSRA 1L2TA 4DDKA 2BSAA 2WYWA 3D2CA 4XGIA 5CDFA 4DR3B 1V11A 2ODTX 2XE8A 4XDHA 2C61A 2WY2D 4PCAA 4K9MA 5KCZA 4EP1A 5I47A 1S0UA 2H5JA 3RYFA 4N3AA 1NQVA 2PGAA 3B70A 1G66A 1IRXA 1HC7A 3A32A 4IQ0A 4CQMD 3RBXA 1EFHA 3KLNA 4HGZA 1L7VC 5A0FA 3NALA 1B43A 1YE3A 2JFXA 2W8BB 3G82C 3KEQA 2WJ6A 4X7MA 3U44A 4BO2A 1ZYUA 5EWMB 5K6RA 2O2YA 2XZDA 3NHSA 3DBLA 2MSNA 3LQFA 3R0VA 1AKEA 1SQ0A 2V0CA 1Y37A 2HF9A 2X6RA 3DVAB 4PGMA 4QL3A 4QQNA 2PUTA 3K4PA 2VPPA 5TNXA 1WG8A 3MM4A 2PFSA 4WXYB 1TTPB 2DXIA 1T4DA 2PLWA 1IJEA 3CVOA 3R3UA 1KY2A 2X9QA 3NIBA 3I1JA 4K0RA 4EW2A 4W5NA 4ZT3A 1K4MA 2Q4OA 4DYHA 3FB4A 2P9ZA 4L2IB 3FUWA 5GZ6A 2JZOA 2UYGA 3P9CA 4PFJA 4QLOA 5C1OA 4PPGA 4FCCA 3O4FA 4II3A 5JSUA 4KN5A 3FH0A 4A5OA 1Q77A 5K8TA 3ZCTA 2DT8A 1UH5A 1TMKA 4U7DA 3H86A 1H8EA 4RWEA 4I81A 4HXGA 2ZDQA 5JD4A 4UCFA 3IQWA 2AEJA 1B6TA 1DAOA 3I9KA 4KO3S 1T3SA 3JATA 4B7XA 4D9MA 2FLWA 4DCMA 4R1NA 4PICA 1KPHA 3ZTWA 1ULUA 2DUJA 1AB6A 1E2NA 1XCLA 4GPEA 3NOXA 3AU8A 3Q9UA 4GM0A 3M4JA 1CY6A 4XX1A 4OYRA 2PSSA 5EC8A 1JKFA 5BRJA 2ON6A 5JS1A 1U2SA 1LUAA 3GEIA 2X9NA 4HY3A 3M34A 3A7EA 4MH0R 4D4LA 1N6KA 1AKMA 1X80B 3KNZA 5JS8A 2PYZA 1NQAO 1XTQA 5HGJA 3SQMA 2VYNA 5NLLA 2CBGA 1NFQA 3E1KA 1RRMA 3FDZB 3MJSA 4H4DA 4L0CA 5BUCA 1P7CA 4P81A 2CXSA 4IIYA 3HBFA 3ENKA 4QDOA 3S2YA 4Q1DA 4QLAA 3WLJA 2BEUB 3IPAA 4YXWD 2QNRA 2JH8A 1TA9A 3O5AA 3OU7A 4AP9A 3EDRA 5GIOE 3EWIA 2GBGA 2WQ6A 4JYPA 1UJ6A 1NN3A 1ZCJA 2C3OA 2NPIA 4XUCA 4F5WA 2IF0A 2RAVA 1A5TA 3AHGA 3F97A 2LCQA 3UMGA 1Z38A 3QIVA 5AKKA 4YMTA 3LUHA 4KL8S 1KDVA 5HE8A 2H7XA 1YOVA 4L5CA 1VA5A 1EKXA 1M6HA 3BE4A 5KNCD 1T43A 1OXKB 2CXUA 2IHZA 2XUFA 2ZCUA 4K9KA 3L07A 2D2VA 1JEDA 2R6GA 2I29A 3ESRA 4MEJA 4EUKA 5A5EA 5IBCA 2J46A 1RC0A 5K0TA 1E1QD 2GM3A 3RWMB 3SC6A 2GZHA 3BF7A 1L5GB 1Q0LA 2Y0EA 3JZFA 3JW8A 3V7NA 3VR6D 4BNHA 1BQ4A 4CETA 3K9QO 5KYWB 2HK8A 1KAMA 1CX9B 1GNLA 1QH8A 1J1IA 1QPGA 3GGJA 1EG7A 2BZ0A 2B4QA 3ZN2A 5ER9A 3NHUA 1SCKA 1BE8A 4BPBA 1Z18A 2GBCA 3PGLA 4BRSA 1YDMA 2FFQA 2Z5VA 3NETA 2IX3A 3L4BA 4CQMB 3DKIA 3SM9A 2W00A 3GFRA 3OMXA 2FX2A 5CFMA 2C2GA 2E4AA 3A05A 3U4QB 5JDCA 3T1YB 5AW3A 3FUCA 4RJLA 3RC3A 3IBYA 2M6SA 1G20E 3EXFA 3MWKA 1KEWA 3M4YA 3OY7A 4WDRA 5AESA 2O19A 4L07A 4NF2A 1L5KA 1DELA 2RAFA 2I7CA 2JFFA 1JYEA 1TT7A 1YRWA 2WSMA 4UFNA 3T7SA 5ITWA 2Q0QA 3LKZA 4AECA 1R0SA 2PGOA 2IHTA 2YXNA 8ABPA 3ZDAA 4L6AA 3U4GA 2PGXA 2R7MA 3I4FA 1J20A 4CZ2A 4DJTA 2YFYA 1NR7A 1T8TA 1L4UA 1O8BA 2QMHA 5C8XA 1M83A 2VRNA 3HE3A 4MW4A 5JAHA 3RIXA 4MI9A 1WDTA 3L4JA 4PF1A 3PNLA 3AVOA 5G0VA 1G41A 3AOEA 2I03A 4I3GA 5JIBA 2I71A 1QF7A 2GMWA 1J70A 4RZQA 4U0JA 1LRJA 2FW9A 2PH7A 3U3OA 4BV9A 5KBYA 2I6XA 2GK7A 1UKYA 3KYDA 3ERCA 2IZ5A 1O87A 5KTKA 5LBUA 3RF7A 4BNNA 1H5NA 2WF8A 2QP3A 1XRRA 4PO3X 4PZZA 3BJIC 1PVDA 5K3AA 4EKYA 3KJEA 3K35A 4P3OA 5ESWA 1ZJ6A 4GZLA 4TL8A 4AULA 3C1UA 4TTPA 1SC1A 5HYVA 5BN3A 4REOA 4HGRA 3Q8MA 3L1JA 3ZG6A 4DYDA 4BTEA 3AI1A 2V6IA 2BUAA 4WKNA 5EIWA 3FM9A 1Z5ZA 4ZI7F 5JI3E 3ELBA 3IOCA 1NUAA 1I6LA 3LP6A 2LNDA 3D1JA 4IOJA 4RK4A 2ZQYA 1SPBS 1OI2A 5ARCA 3KS9A 4QYIB 2Q6LA 4QRHA 2M2IA 4XA8A 4H15A 4PS1A 5LVAA 4BGDA 1H0RA 2L0XA 2XRMA 3KQQA 1N5JA 2FPSA 1SVKA 1RWVA 1M2FA 3EC2A 4EKIA 3CINA 3WQQA 1RWMA 2HCJB 2IW3A 3KR9A 3CURA 4J6FA 4S12A 5TY0A 1B1CA 1EINA 4LJSA 3V34A 3PXAA 6CHYA 3UK0A 2FZGA 4YROA 1EXNA 1RJEA 1T2EA 2FPIB 1AS0A 3CZCA 4KQEA 1CC1S 1QO7A 2NU6A 2IYEA 4KWHA 4MLDA 1UIMA 3PSHA 4P0TA 1ACJA 1YQTA 3WFJA 3ZWNA 5LMZA 1G3QA 1VE6A 1Z0KA 2ECQA 3LLUA 2W2PA 3DZGA 1WW3A 2X4IA 2A0FA 3LPCA 1W88B 1X8KA 2JLZA 4KVAA 2R47A 1EVQA 1PZMA 1ZGJA 2GSWA 3DUFB 3PIDA 4P80A 1RM3A 4YX9A 4ZZ1A 1UFOA 3IQFA 4DDMA 1JL3A 2OV6A 2IHJA 2VCEA 2B30A 2VT6A 3ESAA 5HS6A 4ZKDA 1IY9A 1PX0A 1PZNA 3HBAA 1YVRA 4M1EA 2V6FA 3PUZA 2M98A 4NCJA 5JVDF 1UJNA 1W5TA 3PRYA 4MWDA 1N9ZA 3FOEC 3PGVA 5IVIA 1UK7A 2DHCA 2W4IA 2ZJAA 3OMWA 4J1SA 4P3NA 4YLYA 4HFMA 5I7FA 1K97A 2QX7A 2FZKA 3LBIA 1N0HA 3KPWA 4L8GA 5BYBA 1JIJA 3SJAA 3AHJA 2PU7A 4FYXA 3DP9A 4MULA 1U2DC 1CUGA 3EG9A 3S5UA 4B2LA 1P9LA 5H3HA 4ZCIA 1T0IA 4PXAA 3AUSA 1PLKA 2WJPA 3O38A 3CH4B 3NLLA 3O2SB 4DCPA 1UBTS 2GK4A 3A27A 2FPRA 4MRPA 3ROEA 1OLUA 4BJ6A 3IAEA 2JASA 3HNRA 1HKUA 4HB0A 5CR9A 5FWDA 2JFWA 4FZJA 3UJBA 1BWSA 1JDSA 1KEZA 1Z6GA 2QRZA 4GNKA 3VMMA 1G8PA 1J5EB 2OEPA 4JJ7A 1VCOA 3N9IA 3QWFA 2EP8A 3PSAA 2A5GA 4RHYA 5DEIA 3DMYA 3PZBA 3WMXA 5BQXA 3PEUA 3SZOA 1MPTA 2YYZA 4HWPA 3ONWA 4PSCA 2Z09A 4C7XA 1XWIA 4C78A 1J1ZA 4MIKA 3U3MA 3OTHA 4KQ9A 4LEIA 5FYDA 3CVVA 3QXCA 1P91A 3LY9A 4XPZA 2OD2A 3MTEA 4D0NA 3P7MA 2C5GA 5CFQA 2FFAA 1SU8A 5F4BA 2YNMA 4E51A 1C81A 1N75A 3QFFA 1G60A 3SEAA 3X1XA 4RQTA 4YR9A 1R8YA 3G5MA 2VTBB 1XPOA 4DMRA 5SYAA 2WHPB 1NIPA 3DHYA 4JBIA 1DC8A 4XARA 4AY4A 1P1JA 1F12A 1MO2A 2DWUA 5HCIA 4GKJB 3EEFA 1V3TA 3S2SA 1XPRA 3S44A 3RC2A 4Z7OB 3IEPA 3DGEC 4BO8A 4HN2A 2Y0BA 3C15C 4GEKA 3CFYA 2CDCA 4HH3C 5A6SB 5LP6F 1OD6A 4L0QA 3D3KA 3U13A 1ULHA 1NJ2A 2GHRA 2YCBA 1C4XA 1PWYE 3U7IA 3UB2A 2CZQA 2H06A 3EA0A 2CNKA 5DCLA 2B4AA 2W7TA 4RSGA 1JXAA 2P3SA 3CRZA 3GJZA 2EFDB 3QRWA 3F5MA 1M6VB 2PS9A 3QVVA 5H5JA 3RU9A 1EGHA 1R50A 4JJ8A 5FUBA 3ET5A 4OP2A 1YAJA 3O2NA 3QYAA 4RW0A 2ORIA 5F52A 3NPMA 1S1MA 4RY0A 1EK2A 4HFRA 4R8KA 4JSYA 2HF2A 1E6KA 1Z12A 2QRQA 4XAQA 3BGSA 3UOGA 4BB6A 1TUBB 2VDWA 2ZJ6A 4K6CA 4UTPA 1A9XA 1H9AA 1KY3A 3RSQA 4C07A 3SZGA 1I2DA 3P2EA 1DAHA 1VIVA 3BA1A 4BJHB 1AKNA 3BCUA 4EMTA 3NBYC 5EWLA 1QHGA 4PGFA 1M6EX 1MEOA 4TRJA 4BMDA 3B2EA 2D2EA 1S8AA 1Y1SA 3D6MA 3N2NA 2PKEA 2OM6A 3UWSA 4Y2VA 4V0OA 1L7AA 2CXHA 2DWCA 2IJGX 2NYUA 3EGWA 4ENQA 3C6KA 1PQPA 4FW8A 3T1VA 3RLFA 3RT1A 3PFWO 1VSTA 4G24A 4BVHA 3JQFA 1Z33A 1L1RA 4Q9LA 1K2VN 1WZ2A 1JG2A 1MX3A 1VJTA 1FOEB 1LQTA 2Q4EA 3M1LA 3O4IA 3PRHA 4HB2A 1Z7YA 1QK3A 5T67A 3RK0A 4O2AF 5CVUA 3L93A 3WB9A 2YVQA 5IJZA 5F9FA 4PNHA 2VPXA 5CAEA 4P3XA 1D0SA 4BUCA 3G02A 1IY0A 4HDMB 3SJCA 3HP7A 1NMEA 2IH4A 5KSOA 4UNSA 4E4RA 5D1HA 3G9TA 5KSWB 3GA7A 5THQA 1E62A 4IW3B 3RGGA 1L7NA 4LOHA 1GAWA 2NPFA 3SHFA 2ZVDA 4LX8A 3WG9A 3DKVA 3CW8X 3ZH2A 3VISA 3C7CB 2YZGA 3PENA 4B75A 1Q84A 4DLNA 1Z5VA 3U4IA 1DVRA 1DQRA 2P9FA 3Q88A 4GBED 1OU4A 1Y4SA 1CULC 2GPWA 5CA1B 1J7KA 3AY0A 2ZOSA 4FR5A 4B3HA 3Q1KA 2JBAA 2O5VA 2H57A 1LX7A 2WNHA 4LYYA 1LFDB 2FH5B 5FHRA 2ODQA 2OVFA 4BKOA 1X9GA 4YMVA 2HFJA 2FV8A 1V8PA 5MN5A 1CDOA 2REBA 3N2GB 4MUFA 2FMUA 3ABIA 2BFCA 1CUYA 4OUDA 5THKA 4MUKA 2CWDA 4QTUB 5JC1A 1JALA 3PFFA 5FQNA 3VU3A 4MJLA 3FETA 1L5MA 1UMBB 1IUPA 1V7ZA 1XR3A 3AIKA 3H97A 3L04A 4I4TA 4R01A 5DGHA 3NHBA 2KM1A 4P93A 1WULS 2OZVA 4L8VA 1OCEA 1SOWA 1GITA 2RB4A 3IO3A 4X60A 4B3DA 1MXFA 1XL1A 2G6TA 1SD5A 2G5CA 5EE3A 2ZBQA 2IIVA 3W8DA 3DE6X 3F9IA 3G2KA 4IPTA 1WRBA 3PJRA 1OH6A 1NX9A 2J9ZB 1KORA 4MS1A 2UYHA 1NW5A 1DIBA 2ZFUA 3FFAA 3GDGA 3QF4A 3V9PA 1T9BA 2FP3A 1E1CA 2ZSUA 1DV1A 3NUZA 3SS8A 4CUJA 4DANA 1BJKA 3PPVA 3UFBA 2XCTB 4OMUA 2K4MA 1I33A 4EHAA 1A5AB 2Q1SA 1CEYA 1LLCA 1YFJA 4P7JA 1EK0A 5KAMA 2IEZA 1NN1A 2ZIAA 4L78A 5F33A 2B6HA 1V25A 2O52A 4WZAE 1TQ8A 1CJCA 3V1TC 4D82A 1DOAA 4TMWA 3ITNA 4BNFA 1MB0A 3UEOA 4C01A 3LC2O 1FLNA 1C8BA 3OLQA 5JW6A 2EAUA 4H1VA 1ODLA 1I6WA 4YRFA 3OLXA 3BXPA 3TOXA 5JCJD 2E9SA 3EGDA 5KOJB 3SGLA 1EP2B 5D2CA 4BXOB 1TKBA 2BW0A 2GHTA 5C8DA 5M34A 2Q3CA 3P9ZA 2RBEA 2QRKA 2AZMA 4QQRA 3DO8A 2DULA 3PC3A 3JAMA 1DARA 1R5NA 4JMLA 2ZU6A 3RHZA 4LV6A 2F1RA 4U2BA 4C04A 2RMKA 5DYNA 4WMLA 3N8DA 2A92A 1SC4A 2Y1CA 3QPAA 2ID4A 1MEJA 2DVMA 1RI2A 1T2NA 1SBQA 1TGVA 2V97A 1Q20A 3WKAA 1UDRA 3H87A 3T5TA 2BT4A 4F06A 3WGGA 2G4CA 4KFTA 3GT3A 1Y8QB 4FNAA 4NYJR 3HDTA 3JVEA 5IMBA 1PR2A 1D1QA 3USES 1OUMA 4W9RA 4EHIA 3N6VA 1S8FA 3QYPA 4QUGA 4URFA 4A9AA 1MXHA 3C3WA 2H7VA 1C8VB 1FZQA 3IQIX 1H65A 5CDSA 4C7VA 3EVAA 4R83A 5IVHA 3GZTB 3M1YA 4M22A 3SQLA 4YPFA 3UW3A 4E09A 2BH2A 3WZ2A 1DPGA 2ONJA 2X0KA 1FQWA 1R0RE 4G4JA 4HZUB 4Q7MB 5TQ0B 3ZU5A 1G4UR 4EBBA 5LPNA 4ZOCA 3T5CA 2NMVA 2V5UA 4U0KA 2FUCA 1VJ5A 2DBYA 3ZE7A 3LFUA 2BP7B 1LK0A 1KF0A 1WLYA 4KFCA 3L4KA 3DVLA 1FNCA 2AX4A 3OAAA 3JQBA 3VO1A 5B3JC 3W6NA 1EJ2A 2J1LA 4FFWA 1AM4D 1FFDA 4DHEA 1JDBC 1CS0B 2WDPA 4MWBA 3W2EA 4MYUA 1JHAA 3C8UA 1YU9A 5BW8A 2CJPA 1L7XA 3S8YA 2H0AA 1Q1BA 3H2SA 4WH0A 4BRWA 2IS6A 1Q1QA 2CHVA 1GN8A 1ZH8A 3F3YA 2DHEA 2TMYA 5KNLA 3KIPA 1KVTA 1M75A 3HJCA 3L8GA 5BMOA 2Z9CA 4EX6A 5BV2P 2RGBA 4YRZA 3W3AA 1NW3A 3AEQA 1SKYE 5CB4A 1F5SA 5JAMA 5HKKD 3SOZA 2WQ7A 4G0ZA 5F7ZA 2QPAA 3IPRA 1XRJA 1A8QA 3OT1B 2CXRA 3S81A 2V4ZA 3E9EA 2CT8A 1NN5A 4J1QA 3CUEF 3A3YA 1P5JA 4ZYXA 3OHMA 1SZPA 3ZW9A 4QFCA 4KPUA 4W5JA 4X90A 3UYKA 2DTXA 1R6DA 2FJPA 4MS3A 4C0SA 1WX1A 3TRIA 2PIAA 1KERA 3K30A 1QO9A 2PA3A 2JGAA 3DHNA 4RAQA 3JTEA 2GXAA 4MRSA 1HYBA 3EQ9A 2FEOA 4XCXA 4AY5A 4XDZA 4DGQA 4G4GA 3RG2A 4LZOA 5E0KB 4HYEA 2WLTA 3D0KA 1L8XA 4QDZA 1V5GA 1S2IA 2WFLB 4BE9A 3QLVA 3ROGA 5JROA 3AR8A 2OVBA 1YC2A 3OD5A 2V6JA 3K6KA 1PWEA 4OGKA 4Y7CA 1XDZA 4G1BA 4MS4A 3OT5A 4HATA 4KVZA 1B16A 5JSZA 1V1MA 3X1YA 3SXJA 2G9UA 3DDOA 2VSXA 2A5JA 2EKLA 5D86A 1JU4A 2IEBA 2SICE 1N0IA 3OZTA 4CUKA 1T8PA 4Y2SA 1RQ7A 2PAFA 2B8TA 5KYUA 3SVZA 1MJGM 3T06B 5C2JB 4IFIA 4B73A 5IXSA 3WMFA 1V71A 1ZGCA 4D9EA 1SUDA 1AK9A 2X2OA 3O8OA 1JQAA 2ACEA 4PC7A 1Y6FA 3MCUA 4KDFA 2BVNA 4OI2A 2ZBFA 4TL9A 1BZYA 4AUMA 2JIMA 1JJVA 1OLOA 3WE7A 4DMUB 4E4YA 2P9YA 3FTNA 4BLWA 2NZ2A 4UVDA 1XDWA 5H59A 3C5EA 1MRSA 4F4FA 4AWAA 5HJ2A 5DM60 2FUEA 3F5QA 4N5HX 4P31A 4RHEA 3CN9A 4MUAA 3D6FA 1JPNA 2QGNA 4FFLA 3CRW1 3PDCA 4RGYA 5DHPA 3ZS9A 2CB0A 3CVWA 3EVZA 4ZKEA 2CFIA 4KIFA 4DCTA 4WD3A 5CEEA 4MA0A 1O95D 4CMEA 4OLJA 1EQUA 3VH4A 2R8YA 4DAOA 1D9ZA 4HC4A 4ENVA 3N8NA 4AJLA 3GPBA 1TE2A 1I4DD 3KL4A 3QBDA 1B0PA 4GP9A 4RS4A 5FUMA 2LZ0A 2AFIA 3H04A 4G56A 3OICA 4B5KA 3OQ1A 1NXOA 4G0PA 1HL3A 2H00A 4I36A 4V24A 2GA9A 4ZU3A 3E61A 4MQEB 3B3GA 5KJFA 1HSZA 4WJZA 4DT1B 4Z7JA 5K0GA 2VUIB 5AW8A 4P6VF 3O4GA 4LF9B 3OUZA 5D3MA 1B3RA 5IC6A 3RIMA 4QU8A 2WWHA 4CF3A 4DLUA 4ZVSA 1B8NA 3A10A 1KJ9A 3F6RA 5ALTA 2ONYA 3ADOA 1PGOA 2VT2A 5LQSA 1SUBA 1ETHA 3AL3A 4NI5A 4MDYA 4RL4A 4J49A 3UAVA 3KSBC 3A4IA 5FR1A 1EHCA 4HAUA 1DWQA 2XVYA 4DLWA 4KRGA 1XKXA 1BN6A 4R3NA 1TYBE 5G0SA 4BMOB 2H7YA 4KBYA 4M7RA 3RAPR 4XVHA 1B2RA 1NXPA 1QRAA 2HLDD 3BIWA 3O75A 2COEA 3NJ4A 5CYGA 3OA2A 1BYIA 1VL8A 5EESA 5IJ9B 3GIWA 4LYGA 3TIGA 1PZFA 3GLQA 3OO1A 1E8NA 3VKGA 4EYEA 4OFXA 4N39A 2G9VA 3N6RA 2FTKE 4G81A 1MQAA 1RMYA 4RJ2A 3MMZA 4GLBA 3K9WA 1S4QA 4S2UA 2FPMA 2VS1A 1SHZA 3ECAA 4M9RA 4C30A 5B1EA 1CRPA 3FVWA 4NICA 1VHWA 1DXQA 2XYHA 1PBNA 2I67A 3MUOA 5DM2A 2DQKA 3CUUA 5EMNA 5LZ8A 3UCEA 4BO0A 5F23A 1C9JA 2FN8A 1U28C 2RCNA 3E7DA 4LWOA 1TTQB 1CZNA 5JFTA 3M2PA 3KZOA 2PUCA 4IXTA 1J8DA 2XCRB 2FHPA 1AF4A 4FGSA 1RPTA 2RGWA 3GO4A 3OWHA 4IIGA 4KBGA 1WOMA 1G8AA 1T2AA 4JC5A 4F3YA 4AS2A 2JIPA 4QYSA 4IXDA 2XMBA 7ABPA 3N0TA 1QHEA 5AVVA 1SXIA 2WJHA 1RIIA 1XZHA 1QFSA 2VNAA 3E03A 3W78A 1U7UA 1NZFA 5CCEA 2BMAA 2V0GA 3BICA 1DSSG 1N5RA 4HNAB 1GNPA 3D1LA 4MVJE 3PQ4A 3TW4A 4AJ1A 3GEEA 3O9ZA 3W5VA 1TMGE 3EVDA 3R7WA 2X2FA 4II7A 2EBWA 3BJZA 4ARUA 1QDLB 2YINC 2W2XA 5D51S 2VPWA 4ZU1X 2WVAA 2GPJA 3L2OB 3TNDA 2VDMB 1OVMA 2VL7A 3QUAA 3MT8A 1QF6A 3Q87B 4BCDA 3FCEA 3CNNA 1YB6A 2JGIA 2QB5A 2XRYA 4NCAA 4ID9A 1NF9A 2JLSA 4PZUA 4RNCA 2DKNA 2X0IA 3GRKA 1ZL2A 2GERA 2NSHA 3K1JA 4PO9A 1JIXA 3R7AA 4B48A 1I7PA 1UJBA 2DY0A 4FR0A 5BO5A 3L7MA 8OHMA 1R18A 5TMPA 2AN4A 3F74A 5GJVC 5A5DA 1SQ5A 1XCBA 2X14A 1EBFA 4E22A 1W96A 4C88A 4B7CA 5B6PA 4X62B 3DL2A 3HCPA 4R81A 4HDNB 2FGJA 4QNRA 4RYLA 1N33B 1UQTA 3MTBA 4PC1A 4GI1A 4EW3A 1SOAA 2LV8A 4KK3A 4HQ6A 4OREX 1LTHR 4DRXB 2ZVQX 1QZZA 3ICOA 4WFKA 4X1IA 3R24A 4EATA 4L76A 5J2UB 2YWEA 4NMHA 3FBTA 2WYHA 4OJMX 5FOXA 4ZMSA 2ZCJA 5D6NA 3NVAA 1HYGA 1Y5NA 1VHTA 4RIIA 2P8SA 2H1FA 2BEWB 3B51X 2DQ4A 2CD7A 5DRTA 4D99A 1LTQA 3RRFA 3UHOA 1AIPA 3X1JA 1QK4A 3MFYA 2OOKA 3F9RA 2RHLA 2NYVA 1D8AA 3BD6A 1V95A 4KOAA 4LNUA 4YRGA 2C9BA 5I7RA 4XJXA 4WVFA 1NXTA 2FPKA 2Q2QA 4WK4B 4JVSB 1MA3A 3H7IA 4IJUA 1GTMA 3SFVA 2QEQA 1V35A 3VO8A 1UPCA 4PLFA 2X8BA 3W3ZB 2UZ4A 1XTKA 2VF7A 3OKPA 3MHPA 4HGYA 1R66A 3W04A 2JFUA 2QTRA 4Y9SA 1W52X 1KZ4A 5EKSA 4BV2A 3DYVA 4NBLA 4OP1A 4RS3A 3SIRA 3SBDA 3ZIAA 2IPLA 3EODA 4EPWA 1F8XA 3GH3A 3NIFB 4DVJA 3RODA 2L82A 2OQIA 1U8AA 2AZTA 5AW5A 5GJBA 3DMGA 1ZUIA 3IKVA 1JFSA 5AYVA 1SHJA 4PSAA 3ONNA 4D3ZA 2BD0A 1E89A 1W6UA 2MSCB 1NNEA 2P9TA 5DSXA 1Z36A 4LZLA 5HHTA 1KTVA 2J33A 3G2HA 1DC7A 2QR5A 3RS0A 3V2HA 1UAYA 3I45A 4MRMA 4LCJA 4P1ZA 2UXCB 4YEDA 5KHAA 5I5EA 4WPGA 3UXMA 3ZTTA 2FSVA 5LP1A 3EEYA 1ORRA 3TEJA 1M76A 1M2OA 2Y1GA 2OGSA 4EA8A 3CH5A 3LP8A 3P19A 5AKGA 4KXWA 3SDZA 1BH6A 3HTXA 1P1BA 1T3TA 4KC0A 4I3FA 1OASA 2B8EA 1S3GA 1AXGA 3HUDA 1JXQA 2RGAA 4RY9A 2WT8A 2I2XB 2DMRA 2PKRA 2B1QA 2H4WA 3ESDA 3KRTA 3LM8A 4YNBA 5FNVF 3ZUPA 1SOVA 1XDGA 5AR1A 5GGYA 3RNLA 3B1VA 4GQAA 4JH0A 2PUVA 4R6XA 2QVZX 5DXFA 3AUYA 4YYEA 4ZOQI 4DSOA 3SVLA 4TYQA 4TYWA 3ZHZA 3A4YA 5AQEA 3HXOA 1O4VA 2YV2A 3K5PA 3S2ZA 4CLRA 2WA2A 1GKIA 3GLKA 3HGQA 4Q03A 2BFEA 4U7JA 4A23A 1MG5A 2VDPB 2JJ2D 3T5GA 3R4VA 3QXXA 3NOOA 1CY4A 3RFXA 3LYHA 3DLIA 1R74A 1PQ4A 5LXTA 4LYAA 3GZNA 3T9AA 4BZXA 4P0PB 2H2AA 4LXYA 5EYPB 4DZTA 4R54A 3DMFA 3NHLA 4PQFA 8MHTA 2VHXA 3NM5A 4O2LA 5D87A 4Y18A 4F5YA 4HSGA 1A4IA 1JDBB 1V7PC 2G77B 3IPXA 1S8OA 2BFNA 4WA7A 1GPKA 3N3BC 4UDXX 2RB5A 4RUKA 4P4SB 5JMOA 4LVCA 1TQ2A 5EE1A 1W581 3QMMA 3RJ9A 3GLHA 3EYWA 2E4VA 4K46A 4MGZR 3FZNA 4GM1A 4KPYA 4KSYA 5JS2A 2X8AA 3P94A 4PBRA 4JK3A 1FSPA 4K81B 3KSDO 4FUTA 1FEZA 1I9CA 1NBIA 3ER9A 5B12A 2SBTA 4HBGA 2JARA 1LBHA 3UCXA 3L7LA 1JIKA 1NWCA 1R0ZA 1UJCA 1BE0A 1WMSA 1I3CA 1QKKA 1QOZA 4YJFA 4K03A 4B4OA 2ZQZA 4NATA 4RANA 4FKZA 1K9VF 4LRXA 1NXWA 5B3AA 2DG2A 3EMKA 4OQPA 4DNPA 1L5QA 4HUQA 5CIYA 3OZAA 4NZNA 5ALPA 3JS5A 5CDUA 4ESVA 4IIJB 2O8EA 1T10A 1HURA 4NH4A 1XVAA 3QU5A 1VE1A 4O4IA 3RVLA 1ZOOA 3DOFA 5JJCA 3T3NA 1UQRA 4D2IA 2H2HA 3KKMA 4ACAA 3B2NA 3TR6A 1GKLA 3IVMA 1I1NA 2OL4A 3FCYA 1I36A 3K73O 4WFJA 4DJJA 5JEDA 1KPGA 1Y3FE 1HEIA 1V9SA 1CZLA 5I4IA 2F3PA 2F6RA 4ZO4A 4O2BB 4PG4A 5CURA 4F1WA 3QUQA 1D4OA 1JIVA 3IA2A 3KSZO 5G0WA 3D7KA 1D3AA 4H7FA 2O8CB 1VM6A 3OBBA 3NUGA 4IGKA 2AYYA 5AOAA 3H5RA 3HJBA 3D8BA 4AWXA 1QE5A 3RFCA 3L0OA 1G21A 4EO4A 1MJFA 4V1CA 4Y1RB 3PC7A 2ARKA 2BKLA 3KEOA 2BTQA 2K2QB 4QEKA 1VZ2A 2HMVA 4QVIA 1VL2A 3AVYA 2O8DA 4Y8VA 4TXJA 3DLHA 1Y4UA 3IC5A 3HSSA 3RAGA 3PX3A 3K0AB 1I3NA 1ICIA 4DCGA 3EA4A 4CT5A 4EJFA 4ADSG 2ZS7A 3CWZA 4CN8A 5LM3A 1XZLA 3ZD6A 1NVTA 3Q8LA 4J90A 5CT5A 2FSUA 3VV2A 1RBMA 2UKDA 4ZQIA 4C3ZA 2P79A 1JEJA 3DT8A 4V0NA 3D64A 1U7HA 1NUSA 1T36B 5JHGB 4JI0B 1E9CA 1JG6A 2DPXA 3KYIB 4HX5A 3UUGA 5DNEA 4OSEA 1RJFA 2R8BA 5DYGA 4BRZA 2EBHX 2QR3A 1BFKA 2I2BA 1RZRA 5EIBC 1E3QA 1JDJA 3SHVA 1UDAA 5IWCA 3D3WB 3I01A 3TB4A 1UKAA 5IDWA 5IEJA 5LQJA 1VQ1A 4E1VA 3PHLA 2BJHA 5COQA 4BFWA 1HE2A 5DGTA 2KBEA 2XKJE 4N0MA 1U0FA 4W5QA 1RWNA 3KHSA 2BJWA 2LRHA 3RVNA 5D3QA 5EJ9A 3MTGA 4D74A 1VLQA 3A1CA 1VE3A 5A4IS 3AESA 4R2LA 1H4SA 1X7ZB 1COWA 3C39A 3W5SA 4FIZA 3W4KA 5DI3A 2ZYSA 4O4HF 5GVSA 1BOFA 1N57A 3GLFA 4US2R 1PUJA 1KO7A 1E0DA 2OP0A 3QVLA 4KYUA 2IP2A 3EDMA 2ID9A 4QFBA 1TM2A 2ZRCA 3I1YA 4UZFA 1ILWA 2GCEA 4HLUC 4MMXB 5HFAA 3TSZA 4NX2A 2XGGA 2A30A 1TAQA 2EW1A 2FN3A 2FZEA 2J0EA 3NTOA 4Z4HA 1Z4KA 5DNAA 2VJAA 1FQJA 1XRPA 2QTVB 4KGDA 5LZ5A 2F3UA 4JJFA 4RLHA 3RS4A 1L4NA 4HNGA 2PSJA 2A9QA 3EPLA 1T9ZA 3IMGA 1MOPA 2CB9A 4JUIA 3K6SA 2W42A 3T5PA 1W85B 2O1WA 1RRFA 3TOVA 3ICVA 1U9IC 5LYJA 2B9EA 2WD7A 1FTNA 3KE8A 1JBQA 2H5IA 1YDWA 3GAAA 3QTTA 5JNRA 3EEOA 1RQNA 6REQB 3FHOA 1TJ4A 3OZXA 4EY5A 2JGEA 4G89A 4F9GA 2O6LA 3K9HA 4LGCA 2AGVA 3GFPA 4YR7A 5IJWA 1Q0UA 3KJXA 4RNDB 4ODIA 1ZM9A 1J6UA 1E2JA 4LE2A 3U0VA 1XE3A 2Q5HA 1JR4A 2A88A 2FW6A 1U1EA 3U56A 1O6CA 2R6HA 4KMOA 2N3ZA 3RU2A 3V33A 1ODTC 3EFBA 4I55A 2DR2A 1HX7A 4I0WB 1H0KA 2I4OA 1YZKA 5DASA 5AJZA 1Z6TA 1GNTA 2YY7A 4CV2A 5AKXA 3PNPA 2VWHA 4G63A 3Q2OA 4LW8A 2P8JA 2E21A 1IBCA 2GM4A 4XLLA 1D2CA 2AMJA 5F35A 1T8SA 3ZHSA 1UFQA 4Q6BA 3OLYA 3GV0A 3Q3CA 2X58A 2R6JA 1U5AA 5DBFA 4CV1A 1WXDA 5H81A 3TFQA 3ZWVA 2EX1A 3VBCA 2C5BA 4JUAA 1WXFA 3RVKA 1PJLA 1QQTA 4CRWB 1IOVA 1DKLA 3PZRA 4EFLA 1N2BA 3D8SA 3GJXC 4IIHA 1R10A 4PPNA 1EFRA 1G3MA 1KYXA 2P6PA 1VYHA 1NC1A 1YHZA 2VG8A 3BGWA 3DFUA 3KT8A 2Q8PA 1ULTA 4LDRA 5M04A 2VQFB 1YB2A 5ERYA 4D81A 2C7BA 1C0PA 4WXMA 5IZ4A 3EWNA 5HQJA 1AV6A 1E1MA 3EIFA 1CPYA 2YYYA 2YRXA 2ZYHA 1M1ZA 2O57A 2I3AA 4FGJA 2P5TB 1J8QA 2C04A 1S3FA 4XOIA 3ZV3A 3B12A 3AIOA 1EH5A 3MRVA 3UIEA 1EAMA 2ZB4A 1E2UA 3ACCA 3BERA 2Q4TA 3HDYA 3DBHA 3S7TA 2DC1A 1KYYA 2FRDC 3MBIA 1L5HA 4XSGA 3AK4A 5L3SA 2VTKA 3KKOA 3L7JA 4BNYA 3A4NA 1JFTA 1AO0A 2Y71A 4S1TA 2J5KA 4LZWA 1O0BA 2WV9A 2AR7A 3SY8A 4I5EA 4ZI5A 2HY7A 1DC5A 1G9TA 1M5UA 1LNQA 1NE7A 1X1BA 4KTVE 3GLIB 1JXOA 3LXXA 3G2OA 1ENOA 5LC1A 1AN9A 4QXPA 5J4LA 1QG6A 3LCMA 2NU8A 3S2EA 1JTEA 2WSLA 1CQIB 721PA 3N8HA 1FLVA 5NULA 1N3BA 1L8QA 2O1XA 3EF3A 4K9DA 2QM3A 2GBIA 5E2IA 4BBAA 1QV9A 4KE6A 1WXXA 4DM3A 4U5QA 3CA8A 4RFSA 3ZDCA 5LXTF 4JI1B 1UOOA 1UBEA 2IF2A 1CUCA 4K6GA 3TL2A 4EECA 3R09A 3T9CA 4UE3S 2XQJA 3ZHYA 3K1AA 4Q4DA 3Q0TA 4QE3A 3DTVB 3AHFA 4NU6A 2FEAA 2QRVB 3KVVA 3O73A 2IC5A 5A9TA 3KB8A 3I9OA 4OMFG 4GW3A 5BOSA 3C87A 1XNRB 5EHXA 4OAQA 3VPSA 1XEFA 3OEEA 2IDJA 4AJHA 3PLRA 3P2OA 4BMNA 4XWWA 2CYAA 2TRSB 4Y1GA 5I9TA 1QNFA 2HIAA 3ZY5A 3T4UA 4E12A 4LUCA 1S3SA 2BE7A 2VWGA 2WT4A 4NJEB 1X1CA 2PH1A 3MB8A 3SSNA 4BC0A 1I5OA 2YOGA 3N0WA 1L4BA 1E99A 4U2FA 3JSXA 1RE1A 3QUSA 4YASA 4CTJA 5F1KA 1ZBQA 1CF2O 3AR3A 1AOXA 3B82A 3CH7A 3H75A 1UT6A 3FBWA 3ZNQA 3LJKA 4RXTA 3KPVA 4MMZB 3DXXA 4MKIA 4U5XA 3GAZA 5F3WB 2AXEA 3D81A 2PXAA 4MV4A 3H9EO 4IO1A 1PQYA 4M88A 1D5CA 3LMKA 3ASYA 4FUQA 4GU5A 2YQ5A 5HIIA 5JE8A 4FU0A 3KUXA 1BMFD 4RTKA 1EGVB 1GGNA 4Y67A 5IDVA 5LQDA 1BKDR 5LWQA 1G2QA 3F7NA 2WI8A 2V4UA 2W6JA 4KKXB 4FYIA 4GICA 2QGZA 4F9FA 1TT5A 5BWOA 1Y42X 3BXOA 1EFCA 5IW8A 4CF5A 5B57C 3K9NA 5HZGA 3HJFA 3HU1A 4FFOA 2WZCA 3THRA 3UKOA 5EE5B 5BN5A 2AOTA 5JJBA 1X3LA 5ALEA 4F72A 1BEZA 3TO5A 3OQIB 4KE7A 1JAIA 1KQ3A 3CZ9A 4LA4A 3AR5A 1NIJA 4WV3A 3OZFA 1WOYA 1PL7A 2E55A 3LZCA 3NCTA 3NBUA 1E20A 2HO4A 4JBXA 4QBTA 1C1XA 4RVCA 5ESXA 2RGRA 2C5HA 4IV5A 5ALDA 1F8UA 1N2OA 2BFFA 4YRJA 4G09A 4WDQA 4FFRA 2FDRA 3ET4A 4DADA 4F85A 1TECE 2OB2A 1GHTA 1LLUA 3BRSA 3EUEA 3FPGA 4IMJB 4N7MA 2XMPA 3IT3A 4QREA 3VJKA 4CIXA 1NLZA 1P2UA 1WVIA 3PDIA 1E9DA 1S2GA 2W4MA 1FY2A 4JENA 4TXNA 1R0CA 2ZWAA 2RDMA 5EIBD 3ZHCA 4KUEA 1QKIA 5LD2C 1RKVA 2NTNA 2WVJA 4U4AA 1N6OA 2QPLA 4Z8YA 3GX1A 5F1YA 3FE2A 1SKBA 1DMRA 1Z6AA 2LDBA 2XGSA 3L06A 2UYOA 2R8RA 4LVNA 1YIOA 3TQCA 1PGQA 4KODA 4A0QA 1CUAA 5MFZA 4MQUA 2BMFA 3PXXA 1IVYA 4P34A 4G9BA 3FWZA 4IKEA 4V3CA 2PRJA 2YWGA 4MLPA 1GNQA 4BZPA 2JAWA 1UOQA 4KW7A 3INNA 1QQ6A 4HQNA 2XZPA 2BI8A 1P7VA 4X1YA 5SY6A 3ADBA 2LTAA 3W6OA 4EFMA 1P60A 3HJUA 2P7IA 1Z0DA 3N2ZB 3VVLA 1WZEA 4ZI3A 4DPKA 1G8JA 1Q14A 4O0MA 1S2DA 2FWJA 2ZG6A 3RRXA 3R3YA 5JC8A 4MJXA 5KWEA 3GH1A 3JQAA 4U7FA 2VO1A 2Q3EA 1FVHA 1R0KA 3N59A 3CZ5A 4PSDA 1JQ5A 3I73A 5FTWA 1NRXA 2YXDA 2C20A 3UWPA 3L1UA 4DMKA 3A1TA 2ROQA 2Y99A 3GFTA 1KH3A 3SSAA 2OO5C 4TSKA 2VOJA 4RMJA 1Y9EA 3R5TA 4JT8A 4L74A 4B32A 2ATXA 3FF4A 3OLVA 3G1WA 4X71A 3GY0A 1DEHA 4BCCA 1C29B 4DL9A 1YR7A 2MYNA 3QJGA 1WD5A 2NSJA 3M1AA 3ANYB 4YONB 3QKSA 1FCJA 3DF9A 4ZCQA 1BOOA 2A67A 2Q4RA 4E11A 1VI2A 3R8FA 1IAQA 2C95A 5KDLA 1XQYA 3JD3A 4GL4A 4YDQA 1WUIS 2GPAA 3THYA 2O2XA 3E22B 2XNSA 3WRYA 4FDTA 2Q7DA 1C7ZA 4ZZ0A 2FFJA 3Q7EA 4PYNA 2P6RA 3NGMA 3T3HA 3RS3A 2B9VA 4F9TA 5B4TA 1DQPA 5AW7A 1K0FA 3NHJA 2B98A 2IHUA 2B37A 4DBZA 7MDHA 1UC4B 4BFXA 1N2CA 4GVPA 4E6EA 4WE3A 3HYNA 3RUFA 5GM1A 4AURA 2VUTA 4DLVA 3PC2A 4IDQA 4ZZ3A 4PX9A 3STTA 4UEJA 5FIUA 4HG2A 4ETWA 2C3MA 1X9IA 2RD2A 3UMVA 5FTJA 4ZK2A 1GZ5A 4XEUA 3CUKA 3PHBE 2RCYA 4WXHA 3BWEA 2X1HA 1BIFA 2XLCA 3UV3A 2J0VA 5JWRA 2BKXA 2BFOA 2FCRA 4FFMA 4LZJA 2ZI6A 2GN0A 1EUDB 1FTYA 1QSGA 4I55F 5FKJA 2Z8YM 3PQ8A 2YJGA 2EFYA 3FKSD 4J3NA 3IO5A 4FT2A 4AKEA 1L8LA 1C3EA 1O6GA 4GUAA 4R8SA 9MHTA 2PMFA 5H3CA 5FOTA 1IOWA 1EPUA 3NXSA 3RIHA 4J3FA 2BRUC 2HF8A 4HWOA 5CTJA 1RKBA 3EIOA 1MBZA 3TD9A 4KXNA 5CFRA 3DZIA 2QE6A 3LVRE 1P9OA 3SQDA 4B7AA