1R50A

Bacillus subtilis lipase a with covalently bound sc-ipg-phosphonate-inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed Evolution of Bacillus subtilis Lipase A by Use of Enantiomeric Phosphonate Inhibitors: Crystal Structures and Phage Display Selection
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase
total genus 63
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r50A00
3LLCA 3V1NA 4DLNA 3L1JA 4E11A 2Y6VA 4H7EA 2HL6A 3EF3A 4KAFA 4Y2RA 2HA4A 3C70A 1LGYA 4AX4A 1J2EA 1ORWA 3KSRA 4N8SA 4BAUA 2O7RA 1UK9A 3GFFA 1XZMA 1VLQA 1UFOA 4C89A 4GLBA 4B80A 2PBLA 1O6GA 1SFRA 2I3DA 4KE8A 4AZ0A 2H7YA 1LZLA 3I2IA 3R0VA 2RIPA 3NOXA 1EDEA 4ROTA 4J0GA 4FMPA 1ACLA 1GPNA 3ESCA 4Q05A 4W1SA 4HXEB 2ECFA 3SX4A 1JU4A 2DCMA 1CUAA 3NWOA 1WHTA 1ZIYA 2ACKA 3W9BA 3VJLA 4BP9A 2AJBA 4BC1A 2QXUA 4OB6A 4DM7A 4BDSA 5LZ5A 4FLEA 3WK9A 2ZYHA 3W06A 5C8ZA 4EY8A 1AKNA 5A6VA 4HRXA 4EY7A 4Y2TA 5LYYA 1DINA 3OURA 4ITVA 5ALKA 1MAHA 3UMJA 1IUNA 4IH1A 1ISPA 4CFSA 4G4JA 2H9YA 1LBSA 3VXKA 4MJ3A 3STUA 2VATA 3O4IA 4AO8A 3A2MA 4G1FA 1JJBA 5FP0A 2HHAA 1USWA 1VXRA 3O9MA 3WYNA 1VZ3A 1J1IA 2JGLA 5AICA 4I4CA 5DNVA 5E4TA 3R3UA 5ALPA 3R40A 2JGMA 3R3YA 5JYCA 2NW6A 3S8YA 2WTMA 5D7BA 5EFZA 2W6CX 2V96A 5JADA 1XZDA 4L0CA 4GDMA 5A7FA 1XRRA 3D4LA 3VJKA 5AKJA 4E15A 1G66A 3FVTA 1BS9A 3KXPA 1EDBA 5AIBA 2HFJA 4HVTA 3HEAA 6YASA 3O95A 2XMZA 2WHQA 4MQMA 1MX9A 1QIMA 4RE5A 2WIJA 3I2GA 4LYEA 2H1IA 4B82A 5LZ2A 1XKLA 3LIIA 3C8DA 4UPDA 4EY6A 4U2FA 1XQVA 4M0MA 5DYTA 1KEZA 5CH8A 3BDVA 4JUIA 3OM8A 4O08A 1EDDA 2FUKA 3ZPXA 5ALIA 4U2CA 5CXUA 1WOMA 5EIHA 4J7AA 5K3FA 4N8DA 1ZI6A 1TRHA 3AUKA 5AM1A 3WWEA 3I1YA 5HFNA 3CCCA 2PU7A 2HRRA 2XUPA 2QOEA 1CUEA 2VF2A 4OB8A 4Y2VA 3B3QA 2WFLA 3HI4A 5ALJA 4CCWA 3PICA 5CMLA 5JASA 3F8SA 4KE6A 1ETHA 2OAGA 3Q0TA 3TJMA 3FLEA 1MNAA 1QTIA 4DNPA 2Y2VA 4QE3A 5AOBA 4QDXA 3DL4A 3QMMA 1XRQA 4N5HX 3FBWA 3FOBA 2HM7A 1VKHA 4BB0A 4ZXFA 1PJAA 2XLCA 4Q3LA 4TGLA 1SOMA 1UK8A 3QBJA 1MTZA 1NX9A 4AN0A 3STXA 5C7YA 1XFDA 3A2NA 5JD4A 5HF6A 1ODTC 3W05A 5AM4A 3IURA 5IVHA 3STYA 1XZLA 3WKCA 1W4LA 3FYUB 3UUFA 5AM0A 3HC7A 5DNUA 2ONCA 1TCBA 3H0CA 5DWDA 3F9CA 1E8MA 1B41A 4DNOA 1IMJA 4N8EA 5SYNA 3K2IA 4DYHA 1GQSA 1FFBA 4X92A 2PX6A 3D3NA 4OU5A 3FNBA 5ALYA 1P0IA 2WUFA 4BRSA 3DEAA 4H7FA 5AKEA 3W04A 4B83A 2AJLI 2PVSA 5DTJA 4J0KA 1BN7A 4UHBA 2FX5A 5H3HA 4KRYA 2XMDA 3AFIA 1UOOA 3G0GA 5CXXA 1WM1A 1XZIA 1YAHA 5ALDA 3ED1A 2H7XA 1CVLA 3D2AA 1RP1A 2HA3A 2G5TA 3O0DA 4U2DA 1LPBB 4BVKA 1X70A 4FBLA 2ROQA 1L7QA 1LPSA 2W22A 1H2ZA 3C6BA 5YASA 4ARBA 1VJ5A 3D2BA 1GZ7A 4BZZA 2BGRA 3T4UA 2ACEA 5HKAA 2B4KA 4QDTA 2JEZA 1ZJ5A 3I1IA 3IUNA 3F98A 4INZA 1EVQA 2HA0A 2OCIA 3EIOA 4L3WA 4X00A 3R3ZA 1UKBA 4Q34A 3D7RA 1HPLA 4PO3X 4WFJA 4OYYA 1DWOA 3R3XA 5ALGA 4KAJA 3K6KA 3W2TA 1FFDA 1SCKA 3WZMA 4FKBA 1UK6A 3UUEA 4HS9A 3KWFA 2VJCA 1IZ7A 1QGED 2JBWA 3CCBA 1XZJA 1LPMA 2PSDA 4WDRA 2WIGA 4Y7DA 1CV2A 1CIJA 1F0PA 5JAPA 3D2CA 1ZICA 2QVBA 3G0IA 5K5EA 3D0KA 3QH4A 5JAOA 4EB0A 5ALLA 3QMVA 5EIEA 2X8BA 3G0CA 5ALXA 2OXEA 5A71A 1ZGBA 2PSHA 5HQ3B 1N5RA 3WK4A 4RPCA 4H0CA 2JGEA 2PM8A 2PSFA 2IX9A 5AI5A 4UHEA 2XB6A 2VTVA 5AKGA 4BTVA 4KE9A 4AMZA 4Y2YA 3VISA 2XMSA 1E5TA 1LPNA 1U8EA 2EDAA 4G4GA 5AM5A 2BJHA 1EINA 4Y2PA 1JJFA 1R9MA 1QONA 4BAZA 1EK1A 2WSLA 4QDZA 3WA6A 1A7UA 2ES4A 1KU0A 1X2BA 1SCIA 3VVLA 2RHTA 1QIEA 1FSSA 2GZSA 4NVRA 2AJCA 5ALVA 3ZLVA 4LIPD 4GW3A 2HRQA 1CUFA 3GZJA 2Q0XA 1CUSA 3RARA 1DQZA 2IIVA 2CJPA 3I2FA 1YS1X 4Y2SA 4XWGA 5CT6A 5AI9A 4XIIA 3VJMA 5ALHA 3I28A 4X71A 2WIDA 3A2LA 5K3AA 4RGYA 7YASA 2LIPA 5IVDA 1D07A 4AN1A 2WIKA 3BIWA 4EZIA 4WCVA 2WIFA 1K6EA 5JATA 1CUYA 5CBKA 3H2HA 4OYLA 2HDWA 1UK7A 5AJHA 5BV7A 3DL7A 1XZHA 2XMQA 2JEYA 1FJ2A 2C7BA 1QJ4A 4CIBA 2VEOA 1GT6A 1QE3A 3WKDA 3CN9A 4JYPA 2WHPA 2OQVA 4QZVA 4H7HA 1QO7A 2GYUA 4QLAA 5AM2A 1W75A 1CUIA 2GYVA 3NGMA 1F0NA 1E89A 3GA7A 4DMKA 2BUAA 5IVIA 2OCKA 3I6ZA 1ZGCA 5SYMA 2B9VA 5KWIA 3JW8A 5FPPA 4GEGA 1XQYA 3ANSA 4KAAA 4X90A 2GBCA 1HDEA 4FNMA 4KJXA 3BF8A 3TRDA 2QKYA 1UOQA 5HK9A 3H17A 1ZIXA 4C4XA 3ZWQA 4E14A 3IVMA 4BC0A 2QJWA 2QS9A 3C5WP 4GBGA 5AI8A 2C58A 2RGUA 3QZUA 4I3FA 5DJ5A 1DT5A 2WTNA 1CUDA 2XUGA 5DYWA 4CIAA 4PNZA 1Y37A 5AK4A 5I7UA 2B20A 2WM2A 2WILA 4OU4A 1YA8A 2PSJA 1UXOA 2B61A 5T4EA 1QIJA 4EBBA 4UHFA 5JZBA 3V1KA 3FCXA 2CKMA 4DTCA 1XLVA 3M82A 3AJAA 4B81A 3IUJA 5EHXA 4CG2A 1C4XA 5CH5A 5D3ZA 3QYJA 2FJPA 3WKAA 2HU8A 2I78A 3H2GA 3KWJA 1FFEA 1YB7A 5AK5A 5BWBA 3BE8A 4X6UA 1ODSA 3HRHA 5EIAA 1K63A 4Q3OA 2VAXA 3DKRA 5HZGA 2CMFA 2C4HA 2WUEA 5LLSA 3C8HA 3GUUA 1UKAA 1S8OA 5ISMA 2ZYIA 3FYUC 4B0PA 2XQKA 1JKMA 1Q0RA 4MEBA 4HZGA 4KYVA 5C8VA 1EX9A 1XLUA 5I9IA 2DFPA 3MGAA 1RYYA 4LXIA 4UHCA 3WL6A 3PI6A 5HFAA 3H2JA 1Z68A 2PUJA 1P0QA 4QWMA 4PQEA 1G42A 1EB9A 4X91A 3HLKA 3TEJA 2OGZA 1LLFA 3IBTA 4J0IA 4PV7A 3C43A 3ESAA 1TQHA 2HA6A 3RM3A 3AZOA 1ZD4A 5LKAA 5CW2A 5LIPA 4DSZA 1QO9A 3H1AA 2C5GA 1CEXA 2Y6UA 3DD5A 3DJYA 1PFQA 3H1BA 5EHNA 3H2KA 3FYUA 3WK7A 1WCYA 4UBNA 1DQYA 3F96A 5AI4A 5LZ8A 4KEAA 2FJ0A 3OC0A 3G9XA 2XMGA 2JGIA 1XZCA 3WMRA 3GELA 5JALA 4LYDA 1ZI8A 4YK7A 1UOPA 4AXBA 2ZJ7A 5JAHA 5FPQA 1THGA 2VT7A 5ALWA 4XVCA 3DYVA 1R88A 2PKYX 3RLIA 4ARAA 1AGYA 1F6WA 3FWHA 1ACJA 1XZFA 4ETWA 3C87A 3C6XA 3IUMA 4P93A 1IZ8A 3WJ2A 1B6GA 2XUKA 2Y1KA 1WPRA 4NS4A 1WHSA 4UHDA 1WB5A 1TK3A 4IH4A 4KRXA 1J06A 4HRYA 5EGNA 1E3QA 1GPKA 3DOHA 3I6YA 4A5SA 1JU3A 2OG1A 2HADA 3OOSA 4K2AA 3PUHA 4F21A 2YXPX 5ALSA 1Q0ZA 4QDOA 3FLAA 1R50A 2DHDA 3WWOA 5CTAA 3STTA 3FCYA 2YYSA 3L1IA 1ZI9A 3DYIA 3PF9A 1IVYA 2CB9A 1Q83A 2J3DA 1WB6A 4AO7A 1VA4A 3C6ZA 5CRIA 4X97A 1A8SA 4ZREA 5T4FA 1JJIA 4IHAA 4BTLA 1C7JA 3AZPA 1ORVA 4BCCA 1LNSA 3E3AA 5AKLA 1AC5A 4DGQA 3DKKA 4EA6A 2WKWA 4UBIA 1YAJA 3GBSA 5ALTA 3R3WA 3PDCA 2WG0A 5ALQA 1NU6A 5E2IA 3SK0A 3G0DA 5LZ7A 4BYMA 5FLKA 4Q3KA 1Q84A 3G7NA 1WB4A 5AO9A 1FFAA 3WWDA 4ZRDA 3WWCA 5CT4A 2WU4A 4QWWA 3MVEA 3WWPA 5LP1A 4H7JA 1CR6A 1HBJA 1U4NA 2R8BA 2I03A 3L1HA 2HU7A 4OD0A 1XRPA 2O2HA 5CT8A 3AINA 1AURA 3I2KA 1CQWA 2R11A 2OAEA 1BROA 5EI5A 3AIOA 4UBMA 2V97A 3N0TA 1QFMA 4BP8A 4X6YA 1LBTA 3O4JA 1THTA 4ZWNA 4PSUA 4KE7A 2Z5GA 4AQDA 4F0JA 4A16A 1HKHA 5DYYA 3OPMA 1EA5A 2DQYA 2O7VA 3FSGA 4ZV7A 4OB7A 1CUUA 3AIKA 1QLWA 4FTWA 3NUZA 5JARA 4B85A 4CI9A 4J03A 3E4DA 3LIPA 1MO2A 3EQ8A 3BWXA 3D5EA 2ZJFA 3DDUA 4C01A 1ODCA 4PSCA 1R3DA 1HL7A 3JWEA 1X2EA 2G5PA 1G5FA 1NU8A 4BAGA 5ALRA 3HJUA 3M81A 5K3FB 3H2IA 1GPLA 5F4ZA 1I6WA 2J4CA 3G9UA 2QR5A 5FKJA 4BBZA 2XMRA 5FXMA 2CBGA 3QITA 3DQZA 3QPAA 3G9ZA 4H7IA 5E4YA 3EQ9A 5C81A 5T4BA 2DHCA 2X76A 2HIHA 4N5IX 4FNGA 2I3ZA 3B5EA 2OLEA 2O2GA 2QZPA 4LXGA 3WI7A 4QNNA 4FLFA 4U2EA 3F97A 3PF8A 3T52A 4NZZA 5AKHA 5BOVA 1WPXA 1CLEA 5KWJA 1L7AA 4MWSA 2GYWA 3WL5A 4MYSA 4M0EA 1CUVA 2XQJA 2H7CA 4WDQA 4H77A 4UHHA 1CUCA 1Y7HA 2BUCA 3ICWA 1DX6A 2XE4A 3C5VA 1TCAA 4J3JA 1BCRA 4BE9A 1MJ5A 2X5XA 1EI9A 2XQGA 4G8DA 5ALZA 2CUTA 4B9EA 3LCRA 5HF8A 5LKRA 4UFOA 1KU6A 3C45A 3DOIA 5I8PA 1DWPA 1H2YA 3HSSA 2WQZA 2XUOA 3KDAA 4Y9SA 1YS2X 4GXNA 4DSAA 5K3DA 3HXKA 4XX1A 4G5XA 3WIOA 3H19A 2BUBA 3IB3A 3AILA 1DX4A 3Q8WA 3EQ7A 1CUWA 3E0XA 1SCQA 5A2GA 1P0MA 3HABA 2Z3ZA 5JZ9A 4K5QA 4QEKA 4L9AA 5AM3A 2HA7A 1CQZA 4MXDA 1XRNA 4D9JA 3WA7A 1MX1A 2QM0A 3LS2A 1RWQA 1YCDA 1QIKA 1GQRA 1MU0A 3MUNA 1MX5A 4QLOA 3F67A 1MT3A 1VOTA 4CG1A 4OUKX 5A7GA 1W52X 4C6HA 2EEPA 3U0VA 3A70A 4KR0A 2WFMA 3OTQA 2JF0A 1E66A 1QIGA 5C8XA 4XJVA 3WK5A 1DU4A 1R1DA 3DCNA 2XMCA 3S2ZA 4GHWA 4J0CA 2K2QB 1QFSA 3QMWA 1GXSA 5CT5A 2XUIA 5D3KA 2QMQA 2VQ6A 2WLSA 4Z49A 2HFKA 4U2BA 5K3EA 2ORYA 5AOAA 4OPMA 3ZLUA 1EB8A 2OCGA 1U65A 4Q1VA 2HA5A 3K9BA 1U2EA 2WHPB 1H22A 4X6XA 2BAGA 5HCUA 3R41A 5AHXA 3EBLA 5ESRA 2RAUA 4ZGBA 3G9TA 4JYMA 1M33A 4CG3A 2ZVDA 3G8YA 2V9ZA 4G8BA 1XRLA 3VVMA 3HYSA 3BF7A 1YASA 2CZQA 1IUOA 4MYDA 4OSEA 4UBKA 3O4HA 4B7ZA 1JT2A 4DMCA 1E8NA 4QDUA 4UBLA 1P0PA 1TAHA 4BE4A 3WLAA 1QIFA 5ALOA 4I19A 2XUQA 3WJ1A 3ANTA 2VAVA 1K8QA 1CUXA 1EHYA 1AQLA 1QOZA 4V2IA 3WKBA 5AOCA 3STWA 2OPHA 3M3DA 4CCYA 4DNFA 1W76A 4GECA 4J0JA 2RONA 2AJ8A 1JMYA 2CEKA 4RNCA 3AZQA 4F60A 5LZ4A 5AH0A 4P08A 4H18A 4IQ4A 1R4ZA 4X95A 1MAAA 3ZLTA 5AKYA 4M0FA 2Z8XA 4HAIA 5LZ9A 3IUQA 2AXEA 2WJ4A 3A6ZA 4JNCA 1T2NA 4FOLA 2XDWA 3R3VA 2WHRA 1FFCA 2J4FA 5A7HA 3D59A 5JZSA 4EUSA 5J3JA 5FRDA 4BCBA 2RHWA 4BDTA 2JGJA 2ZYSA 4ZV9A 4B9AA 2ZSHA 3FAKA 4G9GA 3VDXA 3O9VA 1QZ3A 5AP9A 4AO6A 1L7RA 4FHZA 4GWLA 5ALUA 3STVA 1OCEA 4L72A 4G4IA 1UKCA 1K5PA 3WZLA 3BXPA 3N2ZB 3CXUA 5AKZA 1A8UA 3VKFA 2WFZA 4J0DA 5ALFA 1YR2A 2XT0A 5CT9A 1E8DA 4K6KA 5CH3A 2PU5A 1MN6A 4LHEA 1H23A 2XUHA 3V1LA 2YASA 1Y7IA 1VE7A 4JEIA 5AKXA 4FFVA 2C0PA 2ZJ6A 4KACA 3ICVA 2JGKA 3B12A 4TVKA 5D6OA 5KREA 4GI1A 3WKEA 5CURA 4H7KA 1CUGA 4W1PA 1ZJ4A 3FLBA 1F8UA 3YASA 3BJMA 1QIIA 2XQFA 1YB6A 1XZGA 3P2MA 3DS8A 4P9NA 1GKKA 4A23A 3TGLA 1A88A 3DNMA 4K6GA 1VE6A 3ZV7A 5HKBA 4HXGA 1DT3A 2V98A 3MUOA 4PF1A 4UFPA 3H18A 4U2GA 3DLTA 1EXWA 2WU3A 2DQZA 3BDIA 1EK2A 2HA2A 2G63A 3V9AA 3V1MA 3G0BA 2IITA 2PUHA 2C0QA 4BATA 2DSNA 5ALMA 1BCSA 5IKXA 1TIBA 4WFIA 1XLWA 1W6RA 1GKLA 1VXOA 2Z8ZA 3AIMA 4X94A 4DMHA 2GBGA 3JYHA 1BEZA 4Y2QA 1XQXA 5EHZA 2GZRA 2GBFA 1YA4A 3W9UA 1H2XA 2BFNA 4ZI5A 1AX9A 4BVLA 5HF5A 1A8QA 2D0DA 1T4MA 3BJRA 3RKSA 2VT6A 1OXMA 2VJAA 2C5FA 5K3CA 4EHBA 1PV1A 1QIHA 2DHEA 2BKLA 2Z3WA 2D5LA 3FVRA 5EHQA 1VZ2A 4FDMA 1ZD5A 2OCLA 2XQIA 1LPPA 4WJLA 1JMKC 3SC2A 4MWTA 2XLBA 2OGSA 3OG9A 4PSDA 4C88A 1O6FA 4W63A 1W1IA 4AMYA 5A62A 5AIAA 2XUAA 1MPXA 1LZKA 5FOQA 4BCDA 3V48A 5AKIA 5HK8A 1XZAA 3I2JA 4W1RA 1XZEA 4JH0A 3BL8A 4G8CA 4UUQA 3IULA 2WG1A 1CUBA 3QPDA 1CFJA 4Q82A 1VA5A 2XUDA 3KOOA 3RK4A 5JD6A 2QT9A 3X3HA 1ZD3A 1UWCA 3IIIA 4EY4A 5IVKA 3I2HA 1UZAA 5AK3A 3WL7A 1BN6A 2RI6A 1TKRA 3GROA 1H2WA 4DNQA 2PSEA 1QTRA 2WJ6A 2G4LA 3H04A 2QJRA 4FWBA 2WUDA 3FSGD 4Y2JA 2QUAA 4WY5A 4YPVA 3QPCA 4X93A 5IH7A 3IA2A 1R9NA 2QXTA 1K4YA 2QUBA 3PFCA 4G9EA 5HF9A 2VA9A 3PFBA 2AJDA 4WY8A 4Y2UA 3WL8A 5DLPA 1DWQA 4J0HA 1AUOA 1JI3A 4S0XA 2WUGA 4QA9A 3WK8A 4B6GA 1LPOA 4BZWA 1BEEA 5FV4A 3IDAA 5DNWA 5AK6A 2XI4A 1JFRA 1EH5A 1N8SA 3CN7A 2YH2A 2VSQA 4AB1A 4C4YA 5HQ3A 4BVJA 4LKOA 2Y2UA 3U1TA 1J07A 3FYTA 5FUMA 4H35A 3E1GA 3M83A 4YASA 4AZ3A 5JAUA 1ZD2P 2E3JA 5JD5A 2VJBA 1CUHA 3O4GA 2PL5A 3PUIA 4K6HA 1BE0A 5AI6A 1IUPA 4NMWA 4BRZA 4F5ZA 3ILSA 3QVMA 2XUFA 3HACA 4YX9A 4DMFA 1ZOIA 1XKTA 4UFNA 1CUJA 2UZ0A 5AKKA 4FFWA 2VJDA 3ESBA 1G4HA 2EDCA 4C87A 2JIDA 5DTIA 1UT6A 2O2IA 2GBIA 2ZYRA 4TPKA 3SWWA 3BIXA 1TCCA 4MQLA 3WYDA 4H7DA 2WG2A 5JANA 4W9RA 4HTAA 4Y2XA 1LPAB 2QRUA 2J3QA 5K3BA 1OILA 3ZI7A 1BU8A 5KBYA 3G02A 4X85A 3PE6A 2QTBA 4LXHA 3LP5A 1SC9A 1N1MA 2ZSIA 2WJ3A 4DIUA 5FDFA 1DTEA 1YSCA 5T4HA 3KD2A 4FBMA 1HLGA 2BCEA 1XQWA 1BRTA 4C4ZA 2JGFA 2OQIA 2WFLB 5AI0A 1QIDA 4IH9A 4B84A 4E46A 3C6YA 2XUJA 5BWCA 3WK6A 2P8SA 1N5MA 2HU5A 4IO0A 1XZBA 2BGNA 4OCZA 4CCYB 1XZKA 4W1QA 4MEAA 3I6MA 3WIBA 1CRLA 2PPLA 3QM1A 4P92A 1CUZA 5E4JA 1AMNA 3ESDA 4PW0A 1CPYA 2OGTA 4B0OA 4UBOA 4X3CA 4UBJA 4RE6A 3HZOA 4HXFB 1EVEA 4X7BA 1GGVA 3WQHA 5JIBA 1MNQA 2DR0A 1XRMA 4FLMA 5ALEA 1AZWA 1HQDA 4WFKA 2XMBA 1XROA 5ALNA 4EY5A 1C7IA
chains in the Genus database with same CATH superfamily
1HT3A 2BSXA 3D4BA 2PJRA 1V8PA 4GL2A 3DHEA 4A9AA 3GV0A 3T0GA 4GZ5A 4H7EA 2OFPA 1ADCA 2HL6A 2GD2A 3EF3A 3WV4A 4E21A 4HGOA 1NLZA 4KAFA 3RO7A 5L3ZA 2O20A 1EGVB 1T0BA 4L95C 1LGYA 4AX4A 1J2EA 1VDZA 2BEUA 2VXOA 3CX7A 2KHZA 2Y1CA 5DDIP 1N1GA 2DJ5A 3KSRA 3VVCA 1EK6A 3CVOA 2GI4A 2Q6KA 821PA 2B7BA 1UK9A 1XZMA 1CW2B 1SUIA 3ORRA 1UP6A 3N70A 3T0FA 1IOLA 4R7ZA 4R3UC 4RZQA 4HBZA 1AV6A 5KPDA 4DCTA 2PBLA 2VIIA 4WUTA 3LTNC 2YXDA 1W96A 2BD0A 1I3CA 4EKYA 2DBRA 3N6RA 1JTEA 1G2OA 1NONA 4YQEA 1LZLA 1W2GA 4MAAA 4B3TB 4FN5A 2J6IA 2BM9A 1W88B 1CQXA 4KLRA 4YAEA 3AKDA 1QB8A 5AMXA 2RIPA 4QUKA 3NOXA 2V3VA 1FSPA 2OO5C 1H05A 1FUKA 3EN0A 4K03A 3GLRA 5IF3A 2QVYX 1ACLA 4KQ9A 4LDQA 5CDGA 3W5BA 3E3OA 5HJ2A 2CV2A 3RKRA 2JI8A 3ESCA 4NEQA 4Q9KA 2WR8A 4CMBA 4HXEB 1C7FA 3RIXA 1E2FA 3SICE 4B32A 2P7HA 4Y6PA 3PT5A 2ZBUA 3UT0A 3IUYA 4PYOA 5ERXA 1PZXA 5TPZA 3M34A 2Q2VA 3QNMA 3LKVA 1GNLA 2XEDA 3AKEA 3HADA 3O1JC 3VJLA 5JNSA 1GXSB 4BFWA 5K0ZA 4GYKA 3EWNA 3IEXA 4BC1A 1KO5A 2QXUA 3GGCA 4OB6A 3ZTWA 4DM7A 5BR7A 2HR1A 4K6FA 4BDSA 1L5QA 2P4UA 4JLDA 5LZ5A 1FW8A 1NATA 5HCNA 1IBSA 3O3NB 3W06A 3F9RA 3ZCSA 5C8ZA 1R00A 4PPFA 4RK7A 1NFRA 2CUNA 1C8BA 4YMTA 2GNPA 3MAAC 4KFTA 4C4PA 2Y27A 5A6VA 3I5AA 4PAQA 3DEZA 3T3NA 4HYEA 3W6NA 5LYYA 3U37A 4R9UC 5BYJA 1K7EB 2IUFA 3HMKA 1PYDA 2DFLA 3MFYA 3QXSA 5KB3A 1VPWA 1SOWA 4ER7A 1TYZA 4A0FA 1MAHA 1Y8AA 2CVPA 3L0IB 5JHGB 4YRQA 5ICEA 1N0VC 3FGPA 4ND2A 5JDIC 5E3IA 5ITSA 3NRJA 2C95A 2QRLA 3UMJA 1K2VN 3F2IA 1Z5OA 4I5EA 4IVQA 1FXSA 3KEFA 2C94A 1TVKB 3OM1A 2VTDA 3E05A 4HEJA 1O9GA 1V5WA 4IKPA 4P81A 4HWGA 1UDWA 4J1TA 4RM3A 3SQLA 4O25A 3DT8A 2I1QA 3GUHA 4QO7A 1ELOA 1KAOA 5EGSA 4DYDA 3A2MA 2VK8A 4OVKA 1CYDA 3EXG1 4YMSA 4GGMX 2TMKA 1NASA 2LE0A 1QXSA 4IW3B 5KYKA 3BS4A 1YOVA 2YXLA 3JQAA 1SY7A 4OV6B 2EKZA 5FI3A 5FWYB 1ZVMA 2WBLC 3A6EA 3ZZ0A 2VH1A 2NUTB 3IO3A 2SICE 3IQFA 5HJ5A 1KDYA 5AVKA 2A67A 3WYNA 1BZYA 1F14A 3BSFA 3D43A 3PHHA 4F7WA 3WLIA 3EIUA 1QB7A 1J1IA 1G4UR 1YQXA 1G59A 2V7QA 6ADHA 1WD5A 1RLUA 1BX3A 4F5EA 3RFXA 5DNVA 2B9EA 1BHQ1 2J3IA 4ZAVA 1ICIA 4IEIA 3CQ9A 3O6VA 2QX4A 2J1LA 5B1HA 1LNZA 3DXFA 4UOZA 5BNWA 5IKMA 1VFNA 2TS1A 3AF2A 4GVPA 2XDQA 2NO6A 2YYYA 2O5CA 3S8YA 2WTMA 1M75A 1XVLA 3ZDRA 3ZYZA 2JJ1D 5CVJA 2Q2QA 1R0ZA 5L6MB 4EI2A 4OQMA 5D7BA 3MHTA 2OYRA 4R2LA 1WA5A 4GPEA 4GG1A 1QFJA 1S2GA 2DQ4A 3MJRA 3SQOA 3ZHRA 4EEXA 3AJDA 4EYKA 5C4MA 1ZJZA 3WHLA 3H5NA 2BF4A 2B83A 2R1UA 4J16C 4MVWA 3H5OA 1RPNA 2G80A 2V96A 1RPAA 2OZEA 3NS7A 3O8OA 1JEYA 1L6IA 1EMDA 1XZDA 2OXFA 3F78A 3OKFA 3HPQA 3NHRA 4L4XA 2H4ZA 4D0NA 2YNMC 3W4IA 5KWEA 1M1ZA 4E15A 1Q7CA 2LR0A 3EPPA 1G66A 2GEDA 3FVTA 3KD3A 1P4JA 1AHHA 4GI5A 3HRKA 3BB3A 2XCQA 3KETA 1D9ZA 3DWFA 3MAGA 1JR3A 4FHEA 3R77A 4HR7A 1DPGA 2VDWB 2F3SA 3NCTA 3HEAA 2CSUA 3Q9SA 4QAQA 1U8FO 4MQMA 3BILA 1Y5RA 3Q2OA 1L8AA 3Q6NA 4U0JA 4RAQA 5BN5A 1DJMA 2WIJA 2PX0A 1A9RA 3SMVA 5IVPA 4B82A 5JRDS 2IZZA 1E3DA 2DUJA 2IPAB 4OL9A 3PDIA 4KU4A 5DXJA 1H3EA 1QRRA 3GHHA 2ZBDA 1KVTA 1B6SA 2R8XA 3O8NA 3ND7A 3SPXA 2QNRA 4LHYA 2O8CB 4GWGA 2OBFA 2PL9A 3VI3B 2G5CA 3OTGA 3EEYA 3UUGA 5L7WA 4Q1BA 4UPDA 4EY6A 4I1VA 4KW7A 4XEUA 1U0LA 3R3SA 4YT2A 4ND1A 2OR3A 3WWZA 4P0QB 4U2FA 2VHXA 1LLQA 1XQVA 1XTTA 1DI0A 2G8LA 3IJRA 4OM7A 4D42A 1RWMA 3QKSB 1KEPA 2O05A 1YL7A 5LNK1 5ADVA 3DLAA 2LBPA 3AKYA 5TIIA 3U7GA 1II9A 3IAM6 1BYIA 3OM8A 5E7IA 4FEEA 1JEDA 1Y5NA 3UT5B 4WVLA 3RC2A 2A5JA 3GG2A 4RV5A 3ENWA 2YKGA 2AZTA 1RTTA 5G0TA 1SXJA 2QLJA 4CM9D 2P78A 4IHJF 2D1SA 5LB4A 2P91A 3V3KA 1SVUA 5L40A 4IMIB 3C5CA 4FW8A 4M7RA 5CFQA 3QVGB 5CXUA 3EAGA 1OHHD 1DCTA 5EIHA 4J7AA 1PL8A 4JYZA 1GNPA 1NT4A 1P3JA 2ARKA 2QUHA 3B8EA 4O1MA 4QFDA 4DXAA 1XX6A 1PJRA 1O1YA 5DGTA 3D31A 2HBYA 2HPZA 1YT5A 3A9TA 2O2YA 3QHQA 3C1OA 1TRHA 1FP6A 2ICAA 2H63A 2AZDA 4MHTA 3HV2A 1J25A 5AVZA 1T4GA 1TADA 1D2RA 1NVKA 2MINA 4REMA 4BO7A 2RHGB 2C00A 3DKPA 3H9CA 1VPDA 3ETEA 1JB9A 2ZAOA 5EJ2A 4B73A 2HRRA 3KG2A 3KZ1E 3ONFA 5D2CA 5JEEA 5KJ1A 4XB1A 1TTQB 2XUPA 3GLIA 9ATCA 1K1EA 5FOXA 1EUCB 3TRIA 5I7FA 3F2VA 2VF2A 2WQ7A 2HUPA 2NMVA 1G16A 3E9CA 1XEAA 3IRUA 3OF5A 3LUCA 2QRHA 3D8BA 4QQFA 4AECA 3B3QA 3RHZA 3C7DB 2NXWA 4L8WB 3HSYA 2W2OA 3TLMA 4NCXA 3WMFA 4TQAA 3PICA 5CMLA 1H4VB 3G8AA 1Y1RA 1Y8QA 3OTIA 5F35A 2OAGA 2XA1A 1P2BA 3CNHA 3TJMA 5IDVA 3Q11A 2AMVA 3FNFA 4KQWA 3E9QA 1MNAA 5AJZA 5DNDA 1KDPA 5B1YA 2EIHA 5KPJA 1QTIA 1NN3A 2HBRA 2R3SA 5IT9A 5JXHA 4HXYA 1EYZA 3HA3A 3PWSA 5I7SA 4C4TA 1OBCA 3DL4A 3NAMA 1HDYA 3RUAA 1FXUA 4M8LA 4WV3A 3WGMA 3FOBA 5EEGA 1JS1X 1MGOA 4EMSA 2Y1EA 4P82A 4PQRA 3CTMA 5EPOA 2DU8A 3U7FB 4LNUB 4OMFG 2XVMA 4LC9A 3IOEA 3EG5A 3JY6A 3F4KA 3E35A 1A5TA 4QQKA 3V33A 3D8HA 5ILQA 2WWWA 2IWRA 1GAQA 2XLCA 2AUNA 2ZTMA 2EW1A 4Q3LA 1NT2A 4RHYA 3CR7A 3HJCA 1LDMA 4HN4B 5DGDA 1NKSA 1SOMA 4TGLA 1LH0A 4CE6A 3G2LA 4BXOB 3DE6X 3LL7A 3QBJA 4WKBA 2GUWA 1AKYA 1KI6B 1P1HA 2HLPA 2Q8NA 4PGMA 4JA0A 2QZJA 1BMTA 3V1TC 4RTSA 4I4NA 3MYRA 3K71B 1K8ZB 1H2FA 4BNXA 1T2CA 3ZGZA 3TX6A 3DXYA 1ATIA 1SZPA 5FHQA 3SXUB 4BO3A 1DRJA 2BZSA 1NV8A 2GEVA 2X86A 1CNEA 1NLUA 3H5AA 3TZKA 3VZQA 2CLCX 5BNZA 4DV7B 3T7AA 1V1RA 2OOKA 3VOSA 3H5VA 4C7VA 3HFJA 1CT9A 5AM4A 4J3FA 4EPWA 3IURA 4I14A 1XVIA 2RG7A 3VOBA 1AMOA 5IVHA 1T15A 3AHIA 3QWHA 4QBKA 3PFIA 1NJSA 2WV9A 4ONEA 1JSXA 5JPIA 4FZRA 3ZGLA 1IZ9A 3M1LA 1X1CA 4MP8A 4BUCA 2HPAA 3FYUB 4MRNA 3FR7A 3UUFA 1UIMA 1ZISA 5AM0A 4DIEA 1TJ4A 4D56A 3CE9A 1GZVA 1FLAA 2BZ0A 3BFXA 4IS3A 3JVIA 1QCYA 5DWDA 3L3BA 4HDKB 1GZUA 4ND5A 4PLTA 5CUQA 3NORA 3WXMA 2Y71A 2CXUA 5JH7A 3DTVB 4S1OA 4TS4A 1SCNE 3ROEA 2BMVA 1IMJA 5JO0A 1ORRA 2OY0A 5LBTA 5IMSA 1XPRA 3KDPA 3K2IA 3MGBA 2B4QA 1UFRA 2GBPA 1E5QA 2X9NA 4YCJA 4AZ0B 3K0EA 2QL5A 4OU5A 3UKOA 4ALKA 5DTQA 1QQ7A 1XEWX 2Z6VA 4CL3A 1X1RA 1VIMA 2OLJA 1P0IA 2GS9A 4J1QA 4C4SA 4RZSA 1ZWKA 3PLAE 3PKIA 3C16C 3NV9A 3VI4B 2R85A 4YWJA 2SECE 1BXGA 3L0YA 2CFTA 2YIMA 3SJUA 1XJCA 3KL2A 5AKEA 3IR5A 4J0QA 4UDOA 5ILGA 4FB5A 3CVJA 3LUJA 1TZBA 3QPBA 5DTJA 2RHCA 1THZA 1FYXA 1SEPA 3G3EA 3OU6A 4P4TA 4RGQA 4EB6A 3AMVA 5BO5A 2CDNA 4FZ5A 3TZCA 5IHPA 1WNFA 6Q21A 1XYGA 1M66A 2WYVA 2I2XB 1R12A 3F71A 5K0SA 1UOOA 3H5WA 2VK4A 1SRRA 4DCCA 5CXXA 3EC2A 2CVHA 1ZONA 5FUWA 3W9SA 3BIOA 5TX7A 2PUEA 2POCA 2JI6A 2QENA 4AJJA 4LOKA 2CDBA 1GZ3A 5L3SB 3EEOA 1OQAA 2JIBA 1E5XA 1T5BA 5DGCA 2PGNA 4RXUA 2D59A 4DRYA 1C1XA 4PZUA 3PJRA 2YV2A 3PUYA 4TLBA 3JZIA 2HJWA 4KR9A 4WL0A 4F6RB 3L7LA 3RC1A 2IW1A 2Z5LA 4C6TB 2G5TA 4BV3A 4URYR 1F5SA 2O0MA 1WUTA 1LPBB 2HDNB 3JQGA 3R6GA 2JFPA 3OOHA 3HDVA 1L7QA 3SYKA 4BNIA 4DM3A 5FTLA 2PGLA 2W22A 2QZSA 4RJJA 4EMBA 3KQHA 1S3GA 1T29A 5IZCA 1VJ5A 2C1EA 2ZI5A 3C5EA 2L0XA 2RBGA 3D2BA 4H9GA 4LOLA 1G60A 2KLHA 2OO5A 2XD4A 4YUVA 2QVLA 5KNBD 4XDHA 2W2LD 1B93A 3DL2A 5F2EA 1CVIA 3SM9A 4CVNA 5HKAA 5KJFA 1ZJ5A 3I1IA 3MC1A 2ID9A 1MAVA 2O8BA 3PD1A 3UV3A 3RG8A 5L45A 3IUNA 4II3A 1WRBA 5F2OA 4FGWA 1REQA 2I4OA 2IF0A 3IHLA 2VUIB 4UE3S 1KJYA 1MHPA 3SS7X 4GOOD 4A0SA 1I24A 2GQ0A 2CDAA 1GJRA 3PEWA 2YHBA 3NOOA 1FY2A 1OLSB 2JBAA 2FPPB 3GEMA 4FCWA 4TKVA 4D9GA 3N7UA 1TQ4A 2PLRA 5AVVA 1IONA 3LO5A 3DDCA 2R1TB 2ZK7A 5KCMA 4JT2A 4N40A 3GT4A 3MA0A 5FCDA 4DA8A 5GV8A 4GPAA 4R98A 4RTLA 3HSKA 4QYIB 3N3AC 1KDVA 1WE2A 1EVKA 4MDHA 5TMBA 1NI4B 4O4LF 4YY3B 2YDXA 3NWJA 3A14A 3JSAA 4NV1A 2I8CA 3OF2A 3M70A 4CPDA 1RXEA 1P4SA 4WKPA 2W2NA 1BIFA 2F43A 1T9HA 3CLHA 3H8WA 2XIQA 1DFGA 4NJEA 3B2EA 3IT2A 5JDCA 3P27A 2Q9BA 3FVQA 1M3SA 2PIAA 2QDXA 1KYZA 1ZNXA 1EG2A 3GD5A 2JKZA 3OX2A 4WXHA 1F4VA 4HJRA 3VNRA 4ND3A 4TSRA 5JWOA 2QQ5A 1VHQA 1I14A 2CCKA 3IP8A 3ZH2A 3T3HA 4V3CA 3U4AA 5A4FS 5LYJF 1W0CA 4UNQA 1EFRA 2PIDA 5IAGA 4HZUA 2Q9UA 3JPYA 4PO8A 1NIPA 5G0UA 1IZ7A 4XDZA 4BASA 2R96A 2V6FA 3SVTA 1LF0A 3GT7A 5LCXA 3RBXA 4BWYA 5SICE 1QHNA 2LKCA 2W8BA 3F6EX 3M3PA 4JXJA 1LPMA 2DAPA 5H80A 3RC9A 4P35A 1OKKA 4MAMA 8ADHA 2AQKA 2ZGVA 4GRDA 4Y7DA 1TJ3A 1W5EA 4EG7A 2OPBA 4ESVA 3R9XB 2TECE 3ELYA 1CV2A 1LJUA 2CMDA 1ZK1A 2Q3LA 1CF4A 2ODNA 1F17A 2QVBA 5DNEA 2BSQA 4MCJA 4MKXA 3D0KA 2QR3A 3QH4A 1O03A 2XZTA 3IKVA 4CKCA 1E2HA 4U7TB 4EB0A 5ALLA 1EUDA 3QMVA 1NRWA 4XVUA 5EIEA 4JP8A 3KPVA 4PC3A 5EWMA 3TCXB 3EH2A 4DG5A 5JJ5A 3BFVA 4QOHA 3ROPA 3G0CA 1L4KA 1EXVA 4KFUA 1IY8A 3P2EA 4WGGA 1PGQA 1ZJJA 4FP9A 4MR9B 5TRTA 5IXJA 3KPUA 4F11A 2GDZA 3G1TA 1U3UA 1YS4A 1LI4A 3IEVA 1YVUA 3E2IA 4GP7A 5TNXA 2FZGA 2IX9A 1U80A 1GGJA 2CY0A 2XGMA 2IQIA 2XB6A 2VTVA 1IB6A 5LJIA 3PGKA 4DLSA 2V55B 4DV3B 3SYNA 1IEXA 4FGKA 2HYIC 3UXMA 2EV9A 1WMFA 2BFFA 3DEIA 3MRXA 3GJ6A 1E2QA 5JNVA 1I6MA 1E5TA 5SY6A 2A57A 3IPRA 5A4KA 1SM4A 2AI3A 4H0NA 2BJHA 1KR5A 2SNIE 2II6A 2VSFA 4M1OA 1IVSA 1R9MA 1MEEA 4L7VA 1EK1A 1QJCA 4QDZA 1AF7A 3AB7A 3IKJA 1SXQA 1GRQA 4HDRA 3BE6A 3T9CA 1MB3A 2YUIA 4I81A 4RH3A 1UKYA 2ES4A 1ZM3A 2WJWA 4D4KA 4RYDA 1H8EA 2J9YB 4OLFA 3CRZA 3K2EA 1NC3A 3ELWA 1SB9A 1GZ6A 2BEVA 3WYBA 4HHEA 5CDFE 3BL6A 4U6QA 4DAEA 4Q37A 3TGPA 3K9WA 2EJCA 4OXIA 4NVRA 6REQB 3D6JA 1NMSA 1ODKA 1BGWA 3M33A 1WY7A 1ISGA 2P6NA 1FYVA 2ZE8A 5K0BA 1A1SA 1W47A 4B34A 3DF7A 3CINA 3GAFA 4JL6A 4LIPD 4QREA 4RGBA 2WP8J 3DKIA 3EPRA 3FAZA 4D4MA 4EP1A 1DGQA 1WLSA 1M9NA 5TMDA 2XWQA 3PC4A 1CUFA 3NHBA 3ACCA 4M1KA 2KE5A 4DRXB 3EWAA 4D92A 1Y1KE 1NMYA 4WE3A 4EPVA 4EKEA 3F6RA 1CUSA 2J4DA 1B2RA 2OHOA 1DQZA 2WAXA 3VNBA 1TVMA 1W59A 3I2FA 2WP0A 1ZK0A 3CUUA 4XWGA 2JHCA 1IY1A 2MDTA 4ND8A 1WZUA 2G04A 3BMXA 2I2CA 3L7DA 2RHJA 3WSVA 2G0AA 3I28A 4B45A 3KU4A 1E6MA 1N5OX 5F73A 2KBEA 3P97A 5LYJA 1M0EA 1Q20A 2HK7A 4QU0A 3U3RA 1F6BA 2J9XB 2W4IA 3O38A 5PGMA 5K20A 3A2LA 4RK1A 1HE5A 1LDGA 3OZEA 4S0ZA 4LBYA 5FADA 2ZQ5A 1S96A 4LQCA 3VZDA 3LHFA 4HQLA 3TLGB 3ZE2B 1FSGA 1UKEA 2FDCA 1E2LA 4EVIA 3E1KA 2FRDC 1U3CA 1B3BA 3Q7IA 4B3XA 5LXTB 3DDZX 1NJ6A 1QF9A 5CJ2A 5JATA 4GI2A 3RUDA 3C24A 4TX1A 2L19A 3EIQA 4YCDA 5MGBA 4AX8A 1UK7A 1DDOA 2B5VA 3TCKA 5BV7A 3AV3A 4NTZA 4XWTA 3K9FC 3O8RA 1OAAA 2DTXA 1X7WB 1A2KC 3LE8A 4CIBA 2RB4A 2VEOA 2PVCA 4IOKA 3CN9A 1M0WA 4MZDA 4MITA 3VO8A 3HK2A 3PEEA 1ADGA 3HU5A 1Z08A 2P6PA 1FDRA 2PV0A 4LZPA 1NBWB 4ZEXA 2YQ5A 3QKRB 3KL4A 4C06A 3WSWA 1CRWG 2C7RA 3N75A 3GNTA 3IO5A 5JMPA 1DADA 4EL5A 3BERA 2P2NA 1ZH6A 3OBBA 2EEZA 1CUIA 3SXJA 3WYCA 3QG1A 3VVBA 1JA1A 1JG4A 3UH1A 5J58A 3JS5A 3WBBA 1IEWA 1PJ4A 4LE2A 5CLHA 1H4SA 2ZIXB 4O0MA 3TKYA 4KR2A 4ZTUB 3C2QA 1MQAA 1ND6A 1JZSA 1P18A 1YONA 4RPGA 3HUEA 2FMUA 1JZQA 3NHJA 5BV2P 2ASEA 5B7QA 5KYTA 1AQUA 1G21A 2AMFA 5B2ZA 4Z0NA 5EKDA 5LDGA 3OX1A 1XN1A 1R4MB 3DZCA 3I58A 3P9RA 3NEAA 4Q1AA 4KAAA 2VOJA 2NO4A 1K97A 5DULA 4L02A 4RCVA 2GBCA 3ZXUB 2H5EA 5FOTA 1LJ8A 3IDZA 4TZKA 1AHNA 5FPHA 1MP0A 3G2MA 3RGWS 1O58A 3GLKA 1JU9A 1TZ2A 3OHPA 3QENA 1KZ7B 4EVQA 1EG7A 4LXYA 4P7KA 5M3BA 5T3YA 4F4DA 5HK9A 1SVMA 4P0PB 3GEGA 2FLVA 2CZCA 1BVUA 3MCVA 3K5HA 4RK0A 1FDVA 1H2HA 1UBSB 3I6BA 3IVMA 4BC0A 4E14A 3PHIA 4Z0TA 1DKPA 1P60A 3CNEA 3C5WP 1OOEA 1H5QA 3IB6A 3JR3A 1N9KA 3PCTA 1L2TA 3RTDA 5F7XA 3U60B 3QZUA 4JLBA 4BKRA 3KZOA 3WGUA 4V0KA 5BQFA 2HOQA 5FAKA 1GKUB 3D54D 4NYJQ 2ZUWA 4ZCTA 3LGXA 4WN9B 1SIBE 1JIUA 2DY1A 3VR5H 2XUGA 4D8WA 1Y80A 2XWJI 3RRJA 2H2HA 3X0DA 2PX8A 4PNZA 4RF2A 1F7UA 5GOTA 2I6FA 4F3CA 4EB6B 3BMOA 4NR0A 1O6CA 3ROKA 1CBUA 4M0DA 4C2BA 4ENVA 4JSRA 4TV9A 4TZ0A 1UXOA 3B13B 4Z3OA 4MS3A 5HILA 4EBBA 2FW9A 1A4UA 2BLNA 4QYSA 4UHFA 4AM8A 4S1VA 1KZ9A 1E7MA 2JLSA 3OY2A 3FCXA 4ZU3A 3T7IA 3UJ8A 1T9ZA 2CKMA 2VZLA 1OV4A 3BK2A 4RMHA 3QF4B 2VTBB 4B33A 4Z6KA 1ECGA 3IPXA 2JIZD 4U0KA 1Z5NA 3HKEA 4IOMA 2BBTA 3AJAA 4LWOA 2NT3A 3RSHA 2W8ZA 3TM5A 3UJCA 1R6AA 4MVJM 1DIRA 5LN1A 5D3ZA 1FU7A 4B7UA 4DIMA 3ZDDA 2YS7A 4KN9S 1RI5A 2DBYA 1M8JA 2C9MA 2FJPA 2HU8A 2I78A 2WWTA 3G6WA 4KI0A 3H2GA 4X1KB 3WKAA 3KBBA 5IM4A 1FZQA 3LY8A 1EQUA 1LI5A 4NOJA 5GJCA 3OJ0A 2GHRA 1FFEA 2AFIA 4RDIA 4V1CI 5AK5A 3ZEIA 3R5JA 5BWBA 4EECA 1QOPB 1RZRA 2J07A 3BE8A 3NWEA 4EJ0A 2QW1A 4B2IA 3FTEA 4P83A 3L77A 4BQEA 1HR0B 3HRHA 5HIKA 1XMJA 1GPBA 1XB2A 2FR8A 3CBQA 3QA3E 3TMKA 5E3JA 3UQYS 4F4CA 2VAXA 3HCCA 4ZVPA 5KSWB 4RHFA 4ZEVA 3LDGA 3MLBA 2UUOA 3RTAA 1CJVC 2H00A 3G1UA 3L8ZA 1GP2A 2L69A 3NHYA 3DAFA 1ZRSA 3ONEA 3C8HA 3GUUA 1X87A 1GA6A 4IICA 4NZPA 2I7TA 3PR1A 3Q1KA 5CGZA 5ISMA 1RAFA 4MQ4A 4Q9AA 3L18A 4XVRA 4F2PA 1J8DA 1MJHA 1FMFA 2ZYIA 4YMHA 3FYUC 5TT1A 1XJ5A 3M6AA 2XYRA 3SBEA 1G3IA 2Q28A 5KNDA 1GNTA 1DTWA 1ETUA 3QRWA 4IJUA 5DX8A 5AJWA 1W9MA 1UBTS 1L0BA 2F1KA 4G63A 2YICA 4JJ4A 4LZNA 4AQYB 5KYXA 1BEUB 4RUKA 4P7FA 5F52A 2YV1A 1HFJA 5EQJB 1TA4A 3RS9A 2AX4A 5I9IA 3TQIA 4B44A 5IT0A 1R6BX 2QB5A 5HGXA 1OE0A 1TVKA 4MW2A 2FRXA 4PZLA 1S9DA 2AOWA 2CXOA 4MVJD 1M83A 4G86A 4O4JB 2IRWA 1U0EA 3JZAA 4W8GA 1EHIA 3NB0A 5EESA 3UUWA 3DFZA 1D6NA 1XNGA 1OT3A 2WDZA 1MOQA 4MJ7A 1Q0PA 2JH3A 1RRGA 2A78A 4R9VA 5K6AA 4BV9A 2OV8A 3S81A 1JH8A 2Y1LA 4H6PA 1X1BA 4I50F 5B4TA 3P4YA 3S2YA 3QVKA 2G1PA 2V7EA 1N2CA 4D82A 4NBUA 2A5DA 3QVLA 4E4YA 3HLKA 1HKUA 4Y8VA 2K7FA 1DG1G 4EVSA 1GYPA 3PP8A 3PGLA 3SC3A 1LLFA 4NYMQ 1G18A 1J42A 3SYLA 1W7AA 1GY8A 4YWHA 4KX3A 3TOXA 4NNPA 3TSAA 1TQHA 2NG1A 4D9NA 1WXFA 4CKBA 2HB6A 3RM3A 2CLHB 2Z30A 2V7TA 1Z6XA 3DD1A 1O94D 2H65A 3GJRA 4BO5A 2GYYA 2HDHA 3E82A 5HFJA 2ACVA 1ZYUA 3MJDA 5CW2A 1QO9A 1KEUA 1KEEB 2XD9A 1J39A 3H1AA 4HSEA 4GC9A 5HMLA 2C5GA 3AXTA 4G1MB 5KTNA 2FCAA 2PS1A 2M6LA 2B8JA 1YRQA 4YRBA 4YACA 3WBFA 1XHFA 4NV0A 5IPFA 3EXHC 1XFAA 2C59A 3H4MA 4JT4A 3OJFA 4N5NA 1UINA 5EHNA 5LXTA 3H2KA 3DBHB 2HLHA 1KAGA 2QTRA 3HG7A 3P45A 4E30A 4KHZA 4ZO6A 3COSA 4OTZA 2HD4A 1OFHA 1E79A 3RJ9A 1J8QA 1SU7A 5E8JA 5A9RA 4JVMA 2VPTA 3HY4A 4K9LA 4M1YA 1L7OA 5J9FA 1PV4A 1L4HA 1XMSA 5AI4A 4DPLA 3L7OA 2EZ8A 1XCBA 3NFYA 1C9EA 3JYLA 3O93A 4IV8A 2IYZA 4QD3A 1CD5A 2ZW9A 1OU4A 3RIHA 5B6PA 2FJ0A 2E6KA 2FPUA 3OI7A 3LDFA 4XYMA 5IEBA 4JQYA 2R6ZA 1RRFA 2XMGA 4GUDA 2YTZA 4UNPA 4AF6A 5ECWA 3ZX5A 1II0A 2MU1A 3R6WA 4GM1A 5GPBA 1CQIA 4S1PA 2OMKA 2JATA 2WM8A 3VR6A 3SSNA 5K6TA 3ELBA 2IXEA 3GCDA 3VFDA 4MW7A 5JAHA 2ZJ7A 4LYHA 4Z5XA 1YL5A 3ZK7A 2Q5OA 4F92B 4HNSA 4JR0A 3SR0A 1NQAO 1I6KA 4YB8A 5C9ZA 2AC7A 5I7AA 3L01A 5J4LA 1VB5A 2KM1A 3JZFA 4GZMA 3VKHA 1C1DB 2J6HA 3BZBA 4UNRA 3DYVA 4GAEA 5IAKA 3W1WA 2I2AA 2EKLA 1VIAA 1AGYA 1F6WA 1W8IA 2QAIA 1E1QA 3GFVA 3BH0A 1UR5A 1VHLA 1AQ6A 3R75A 4AP9A 3C87A 3FZNA 5EJFA 1KAHA 4GICA 4MW6A 4A7PA 9LDBA 3RRMA 3AO0B 4RABA 2X2PA 3EZXA 1GNRA 1GFIA 3OF3A 1Q7BA 1U8CB 4ID9A 2QAGB 5A1JA 5KTMA 1AA6A 4YX9A 1D0IA 1NULA 1X7XB 2I4NA 1Y6FA 2VVTA 4CM1A 3SIPA 5FTKA 1VC2A 1YRWA 3A2KA 3FTNA 3SNHA 3ZDBA 4M1EA 1R16A 1PFKA 4NL4H 4YAGA 1IFXA 2ZUVA 1EX6A 1E7RA 2YOFA 3L02A 4RL6A 2C3MA 3PX2A 4NBNA 3V8EA 1F4PA 3S70A 1G7TA 1RWKA 2YJGA 3JQBA 5KYVA 3R8XA 3UPUA 3GJ4A 3L7AA 4O2AF 3VR4D 4GKJB 2OXCA 4YRSA 3A10A 1FDIA 2ZUCA 3IQDB 3M3HA 4KRXA 1J06A 1PNQA 1QUFA 2G7MC 4PRKA 3L82B 1U8AA 2A0WA 4YJ3F 1QHHA 2HEGA 4CT0A 5IBCA 1M5TA 1KKUA 3BXHA 4LWZA 5M29A 1GPKA 2PK3A 1JHXA 1NVDA 3G1WA 1I3MA 1NPDA 4GM4A 5DFAA 8OHMA 3T9EA 3AUUA 3OOSA 3KUKA 4K2AA 2OEPA 3PUHA 5I9NA 3H6GA 1ESDA 3EJWA 4E32A 1BDHA 5LWHA 1LBEA 2DECA 3HVKA 1AN0A 1R5JA 4BJ3A 1D1TA 3QQ5A 3K0HA 2E1PA 3RYFB 1MEOA 2OTCA 2XA9A 4QDOA 4FGSA 4DOMA 4EW6A 1R50A 2WYWA 2XZLA 2WDPA 5UKDA 3WLFA 3RDPA 2QTGA 4BO1A 3MWKA 3TEMA 4DQLA 4X44A 2P3LA 3ZVMA 3S2GA 4DV6B 1UEIA 2OM6A 2I4RA 1IWBB 2YYSA 2Z2JA 3FW1A 3DYIA 5B3JC 5K7SA 2XB2A 4YUAA 3MBKA 2FSHA 5CFLA 1DPFA 3EH1A 1W6UA 3BEOA 4MCIA 1IVYA 2CB9A 1Z4KA 1L8LA 3LF1A 3MM4A 5REQA 1AOXA 4AO7A 4B43A 1CY4A 3PZRA 3I1FA 2GEBA 2PEZA 4JLSA 4K46A 5GQSA 2X5KO 3EDRA 1A8SA 3HWWA 4ZREA 3TMYA 4DLVA 4KPGA 5K51A 4BTLA 1C7JA 3U4HA 1X14A 4BNUA 1ONOA 1AXGA 2CLKB 4BCCA 5JWHA 4NONA 2A33A 1USIA 4NCNA 3IAHA 1U0JA 1WDTA 421PA 4BGDA 2QP9X 3GEEA 3GO4A 2VAWA 2GHQA 1UMDB 3ENVA 2PWBA 1DNPA 3G82C 3GYGA 3OE7D 5DN9A 3A28A 5J5CA 4DGQA 4KHPB 1G21B 1GL6A 2WKWA 2HQOA 3QUSA 4YFYA 5G1NA 2IUSA 4D3FA 2H5JA 4AJ9A 2FSFA 5J47A 4M99A 4EFDA 3G9QA 1YJ8A 3EGIA 2P9CA 4IF4A 3RVKA 2IKQA 1FX0A 3OQVA 4H31A 1HTWA 1CFZA 1KMHB 3EDMA 3R3WA 4IJWA 3WNZA 1RBYA 4GOND 4XA8A 3B60A 4I4LA 3RNLA 4BN0A 2O2ZA 3SK0A 3G0DA 4HRVA 2MSLA 3BSYA 4QUGA 5JNUA 3T1YB 2XBMA 3G79A 1I0IA 1GUDA 4PHFA 5FLKA 2XRMA 1QP8A 1T9GS 1Q84A 4HNQA 4BFTA 3A4TA 3AGPA 1IHXA 2QTHA 3THWB 4Q9JA 4DQVA 1T6YA 2R44A 2Q5EA 4GLLA 1U9YA 4YAIA 5AO9A 3OETA 3B82A 3WWDA 1PJ2A 1VYHA 1MCZA 4ZRDA 1Y1LA 3NRBA 2FK7A 1O94C 5CT4A 3A6PC 3SIRA 2WU4A 4DC9A 4PN7A 1UMDA 1YZKA 2NZWA 4YGYA 2ZTSA 3WWPA 4Q66C 1V2GA 3K4QA 3N2KA 1EFTA 2IEZA 2X4LA 1VPLA 5COAA 1C7QA 5EHGA 4I9FA 3EBOA 4N7MA 3C41J 1LA2A 2ODTX 1OH6A 1T6BY 3A37A 1QGOA 1P62B 4XM0A 1QGYA 4YRDA 3NO4A 4DR2B 5GP1A 2QA5A 1PG0A 1RMYA 1N8TA 1ZU5A 4UTOA 5E7JA 4CU2A 1V8DA 4YR7A 2O8EB 2G82A 3Q1LA 2FPMA 1I2BA 1JIVA 2YIDA 3QE9Y 4ZO8A 1BROA 3SBOA 2V4ZA 1YJXA 3AL0C 4AY5A 4DJJA 2GN6A 8GPBA 2VDWA 5CM8B 1QFMA 2VZ0A 4IJ5A 2X1LA 4M8IA 3KQSA 4GP9A 5L7YA 4F71A 4QVIA 1T91A 1GPDG 1KKMA 4MB0A 3OZFA 4K81B 5FNVF 4X1KA 1EP3B 4W5NA 1H2AS 2VXCA 4IUYA 4HL6A 3HN2A 4MHSA 1LSUA 4PSUA 3IIMA 4KZPA 4Q4LA 5FLYA 1HDGO 5FULA 1ZXXA 3BWDD 3U1BA 4AQDA 5FI0B 1R4NA 3GXOA 3WDLA 2LKDA 4QFCA 4YROA 3BRSA 4A16A 3U6BA 4DSOA 1BMDA 4RHUA 5DYYA 5LP6C 5A3RA 1KJ8A 5CBPB 1ZIPA 2CW5A 1ZVVA 5BQOA 1UPAA 2Q5CA 1KSGA 1Q6YA 2A5YB 1ZAKA 1F1JA 1PGPA 1BXGB 3KPJA 4KGZA 1Q74A 4G0YA 3UA3A 3K8OE 1JDUA 2CNKA 3LTEA 5EP4A 4OLBA 1UP7A 4OB7A 2PKQP 1N4DA 1YZLA 3O26A 1NW6A 1JWLA 3TIXB 1YR1A 3AIKA 4ZXPA 1WUKS 3ZGOA 5KNBA 1J2RA 4W8OA 1QLWA 4XPIB 3RWOA 3MJ4A 1R0CA 2P7IA 3NUZA 5B1EA 1KI2A 1H0SA 3HA7A 4NJMA 4LFAB 1B42A 1NFFA 1CZLA 2W2XA 4Q7LA 5FO0A 2CUZA 2E7ZA 2HGSA 1JEQA 1QO0A 2NU7A 4ND4A 3FB4A 1FBNA 2O1WA 1MO2A 3PUZA 4O4IA 1OTXA 5BOSB 3P9SA 5AQEA 1AZSC 1ZM4A 2BMAA 1XCJA 1NXPA 3SHTA 2D7CA 1LVGA 2GJAA 4ON9A 2D1FA 2PMWB 3TRHA 1YZGA 1I5EA 5F5LA 3LLUA 2F9MA 2ZJFA 3DDUA 1QGUB 1ODCA 4C01A 1BVYF 4Q4HB 3TSWA 2A1UA 2NGRA 2NLOA 2PJDA 4X1OA 5E9JA 1TUGA 5J2TF 3WVNA 5F7OA 4G0UA 5KTRA 3JWEA 1P1CA 1X2EA 2D5IA 1J2YA 1YI8A 1X7ZB 2PMKA 2QX7A 2ZATA 4JX8A 1ADJA 1E1CA 4MV8A 1SU6A 3GLTA 4DCUA 1ORDA 3PL5A 1UDBA 2QTZA 4PFKA 3W5UA 3M81A 2IY9A 3QXXA 1AKEA 4YRRA 4YQZA 5EQTA 4XGNA 3BXFA 3VYVA 4WEOA 2PL1A 2Q1XA 2XRFA 2VQDA 4LVCA 4YBZA 1OGYA 4XDYA 1GAJA 2W11A 2FA9A 2X58A 1NJ1A 2J4CA 4Z3KA 5DTMA 3T1HB 4JJ7A 4X7PA 4BBZA 1ML3A 4CETA 3QSYA 1FPMA 1XF9A 2CBGA 3ZKAA 4F4UA 5H3LA 1RMQA 3S99A 2PA0A 5J4HA 4TROA 1Z2EA 2BKEA 1Z35A 2IIPA 1BGVA 3ONDA 4MDFA 3MIZA 1J00A 2EVWX 4H7IA 1VL2A 1HF3A 2JK0A 4MROA 4R8RA 3MZ0A 4IXMA 5E4YA 3BRQA 2DHCA 4YXWA 2Q1WA 3QJ5A 4N5IX 5T4BA 1LUAA 1JJVA 1QHXA 2CXHA 4Q4HA 3HP7A 5EE5B 5T67A 3GAZA 3X1KA 3LT4A 5BSEA 2ZS8A 3ZJ4A 1KZGB 2QIPA 2ZIEA 3MERA 2OZPA 4DVGA 3GUYA 1JQ3A 4TRNA 1Q12A 5CA0F 5K6RA 4M36A 2Z08A 4OXQA 2SKDA 3OWOA 1W2HA 4KREA 1IU9A 1SUBA 5I9BA 1J0XO 3WI7A 4QNNA 4RHCA 4QOJA 1NX6A 4CIWA 5FA6A 4U2EA 2D62A 2WYOA 4D9CA 1QU2A 4JGIA 4P5DA 1ECLA 1YR9A 1U3DA 4EIWA 5FEMA 3T52A 3B1FA 4PICA 3TCNA 3AESB 3UMCA 2ZSUA 1WPXA 1XSEA 6NULA 2QTAA 4BO8A 1USVA 5FBVB 2Y0DA 2R5WA 4N12A 3AVWA 3EOBI 3F8TA 3GRPA 3PSAA 2ANCA 4RA6A 2VH5R 3V4VB 4OI0A 3FM9A 2C2MA 2WKQA 3MCUA 4GSLA 5CA1B 3PA8A 4DFDA 3B53X 4WDQA 1SIUA 4H77A 4LZJA 4V38A 1CNFA 3NOQA 4LOJA 2FR0A 5A6SB 4PG5A 4J3JA 3K0CC 5EN4A 2ZJAA 5KYNA 3R9XA 3HVIA 2OHFA 3ZIDA 5BORA 4HF7A 5TR9A 2XQGA 2UZ4A 3KWMA 4G8DA 3IEPA 3QFRA 2CUTA 2HU2A 2E82A 3BK1A 5ALZA 4A5OA 3LCRA 3KZXA 2WWIA 3VUEA 1I7NA 3O7MA 3C7CB 4GMHA 4KO3S 1OFUX 1SC1A 1Z16A 2OYSA 4RDXA 5IDXA 2XNKA 3AOEA 1KHHA 2WYIA 1UAGA 3KPYA 3K09C 4L1KA 3UMGA 4TKUB 1I33A 1JTVA 2AN5A 3DTVD 4DLPA 2EOAA 2JZCA 3KDAA 5HEKA 4G81A 4FMCF 3WGTA 2GXAA 4NE9A 2OBYA 5G1OA 3EGDA 1KO7A 1KJJA 1YS2X 4LGYA 3GLUA 5KVQA 3VGJA 5K3DA 1KAMA 2KMLA 1MO5A 1E7SA 1TXGA 1YFZA 4NU0A 2OO3A 4Z7OB 4J91A 1R6TA 4LXTA 4E5DA 2WF7A 1E1RD 3EQ7A 4E2YA 1W1WA 3P9XA 4MW1A 5JPDA 2FFJA 3PJDA 2JGNA 2Q4BA 1PEDA 3KYIB 1BW9A 1BNCA 1QRUA 3EW7A 4TTAA 4C5CA 4DA0A 3W7BA 1RZVA 4DXHA 2RGDA 1Y4SA 1E5LA 1RLMA 3WLNA 3KHUA 1P0MA 3HABA 3IGFA 5A2GA 4S1WA 1KGSA 1M7HA 1SEVA 5JZ9A 1TFUA 1NJ5A 1ZC3A 2XCIA 2YHSA 3OU7A 1L7NA 4K5QA 4JBXA 4CQJA 1N1DA 2YHUA 3O31A 4NHOA 4UCXA 4QARA 2HA7A 4M9UA 5JR3A 1Z9BA 3I76A 3OY7A 5EXTA 2Y1DA 1AHPA 1I9GA 1Y5MA 4MXDA 5FYQA 3RWBA 5JVDA 1MX1A 4TKUA 3CKKA 4FW9A 3KSAC 4UVHA 1OZHA 1YHZA 1MU0A 4XB2A 2CVQA 1KOGA 1Q5PA 5JS2A 1ZN7A 3UB4A 2ZPAA 1JI0A 4YRMA 4RTKA 3F67A 2RCYA 5K1ZA 1GQ2A 1G5PA 2G77B 1QM5A 3DMDA 4O29A 4HNGA 4KUEA 3LXXA 4FYPA 4FFDA 3ZGXA 1TL7C 2BFMA 4EPYA 4QBHA 4RFSB 2F1OA 4C6HA 2QD1A 2EEPA 3A70A 3RBAA 5EIWA 2NV6A 2HK6A 4DZTA 1TZCA 2UXBB 4Q7KA 5KYYA 1PEYA 2JF0A 4DHWA 4J8PA 4PZDA 3N58A 4A6DA 3JQ7B 5HQTA 3VHXA 3V80A 4E5UA 1M1NB 2Q6VA 2CLIB 3SHFA 1DU4A 5DT2A 4KXXA 3UCFA 3M6VA 3QUCA 2OZLB 3HN7A 3LU1A 4PWZA 3UG6A 4LJYA 3EXAA 1HQKA 4GHWA 3HTXA 1GQOA 1AD2A 4FT4A 4HGZA 4RC9A 1KP2A 1LX6A 2HPVA 2WVHA 1UBKS 3GJTA 3E9RA 1W4CA 2Z0MA 3GRCA 4IDCA 4KYUA 4V0ME 3VMFA 1WV0A 4OQEA 3UJ9A 4H3KB 5K99A 3KXIA 3UMBA 1GXSA 3H11B 3PU6A 4FOTA 1IBLB 1WZNA 1AGRA 1GEEA 2JI9A 2YJ6A 1XAIA 3AI7A 3PRJA 3X2FA 2QMQA 5D8DA 2DBZA 3GLIB 3HU3A 4J76A 2DVMA 3DVSX 5MN4A 1Y3HA 5BSGA 2WNIA 3EQZA 5LBIA 2ORYA 1CC1S 1J7KA 1PUJA 1E0JA 3L0PA 2CNWD 2YZGA 1JIQA 3OSUA 3ER9A 5TLSA 1XP8A 4LJ4A 1EB8A 4X24A 4F84A 2OCGA 1U65A 2X7JA 4FYMA 4JXXA 2QY6A 3WIEA 1E6EA 3KZKA 1FLNA 1T6XA 1U2EA 1ZXBA 3PNMA 4BX2A 1B26A 1WEKA 4A6EA 5A02A 2YVAA 2OCAA 3ETLA 3ZQ6A 5HCUA 2P0YA 5G3ZA 1QHFA 3KSZO 1NP6A 2AX3A 5IUJC 3QG5A 2FE1A 2ORIA 3FCSB 5ESRA 3TIVA 4LRUA 2I2WA 3ZZ1A 4ZGBA 1C41A 2C5LA 2XB4A 4LECA 4JY7A 2B8TA 3FE2A 4CG3A 2NX2A 2ECOA 4CMIA 3ICQB 3MMNA 1FFYA 4XWAA 5JSUA 3SFTA 1OGJA 1SVNA 1K89A 1FP4A 1QYIA 5KNBH 5H1YA 1DARA 2ZVDA 1HNNA 3LD9A 2V9ZA 1N0HA 4C0AC 5IFKA 4U7HA 1OX5A 5T5QA 3T4XA 1KH1A 1V45E 2Y0CA 1XRLA 3A9WA 3E5NA 3G5LA 1C4WA 4B2PA 4YV7A 2ZZMA 2UZIR 5LC1A 1JSZA 3BTUA 3FG9A 3NEPX 3OJWA 2CZQA 4MYDA 3L0SA 1E0DA 1ZJWA 2O2DA 1R37A 2PKXA 1WVGA 3RBVA 1KDRA 2RHHA 3CNOA 4ER0A 2CL5A 5C3UA 4H4CA 3GN2A 3KQWA 1E8NA 4U00A 3HVHA 1KF0A 1GFZA 3HR7A 1TAHA 4MUNA 3PKJA 3PXUA 4TXMA 1M10A 2RGCA 5CPFA 1O6BA 5DSZA 2F8MA 3P9CA 1RYEA 1B0UA 4XUEA 2FXVA 4UMDA 4DLZA 3N39C 5BPFA 4AU1A 1AHIA 1GTJ1 3UGTA 4X45A 4QOIA 1OD6A 1QLJA 4DSNA 2AEMA 3NNNA 5DPMA 4CKCB 3DTNA 3HR8A 4RWEA 4AF8A 4RJIA 4WEQA 3WRXA 4YC7A 1YS6A 3F3MA 4WK2B 4MPRA 1P2DA 3BWCA 4M38A 3WJ7A 5BMVB 1K8QA 2QJOA 3IT0A 3V4FA 1TU0A 1G5TA 2Z4RA 4D9FA 4V2IA 2BH9A 2XJ4A 3C7KA 3K0AA 3WKBA 2QD3A 4JGBA 5DYIA 3STWA 2K87A 4OOEA 5JXWA 4B3HA 4IFBA 4G0VA 4DNFA 1ZBQA 5JNWA 3JQQA 2Z8YA 1QU3A 4N41A 5BUZA 2PXCA 1FXWF 2MSKA 3SKVA 1UP4A 2C7PA 4RNCA 1O6ZA 4WNCA 2C9YA 1EXNA 3GQBB 1I2MA 3CUVA 4ARZA 2A0KA 4F60A 3ZU6A 1X7XA 5HWSA 2B5OA 5LZ4A 3IT1A 2AXPA 3ZJTA 1UPCA 2QRJA 3PD0A 4KTTE 1H5UA 5JROA 5AW6A 1DUVG 1GL3A 4F9TA 4EY3A 4H18A 3EUAA 4E51A 2AEJA 1E94E 3SXPA 1MAAA 2H52A 3CWQA 3INYA 4TRJA 1S2MA 2JGDB 3KEQA 3Q40A 1O4VA 3LMKA 5AKYA 4HDRB 4XVHA 3AR6A 4ZK2A 5HP4A 3AEZA 2CCJA 3D5TA 4XD7A 2BGLA 3IUQA 2YC4C 3BWYA 4ALLA 2CCGA 1M5RA 3WLLA 1GU0A 1ABBA 2CLSA 4RLSA 2X0EA 1N9GB 1O2DA 4AS3A 4ZARA 2RCNA 1NNI1 1Y9AA 1BRMA 2X9LA 3EUFA 1KAQA 3N2EA 3R3VA 4GPZA 3UXEA 2P68A 3L4JA 4X5OA 2H48A 1UDCA 3GQVA 3H7AA 4QYWA 4BNLA 4UW9A 4DC1A 4JJIA 3LDHA 1AUQA 4EYQA 3ZVKA 5KSOA 1M2EA 4PO9A 2GAFA 4YP1A 4CM4B 4WN3A 5LQKA 3HUUA 4DUGA 3M1IA 3GPDG 4ZAFA 3ZCXA 1SOAA 2WE7A 1AKQA 4BCBA 4J4HA 1ECJA 5GONB 5LR6A 3WGOA 4G5YA 4LGVA 1SCJA 3C3MA 6REQA 4CGZA 1CZKA 3B5IA 1KIAA 3O91A 3PNOA 5CXSA 4YIHA 2QM8A 1XPJA 2JIMA 1KOJA 3PQ8A 2ZSHA 3Q3IA 3MT9A 4KNWA 4FB4A 2BKUA 3CVXA 4LJRA 1Y4AE 1O96B 2R7NA 1PS9A 3FHCB 3QBDA 5DOVA 4YUWA 1QZ3A 3LAWA 1PVOA 1H65A 2FB9A 4GPTA 4EHNA 2C9BA 4E03A 3OZUA 2I22A 5E9AA 4DWJA 2NOAA 2CEAA 1IEVA 2CHGA 4AO6A 1FRFS 3MTGA 4QGHA 2BP7B 1M8PA 1Z56C 3A1CA 2CXNA 4ZCLA 3E8MA 5EOVA 4YO8A 1KAEA 4DREA 4K2HA 3K94A 3O47A 3OMXA 4TYNA 2QV0A 4IUCS 3EXIB 3OZRA 1RM3A 4FKMA 4ZAGA 3NVAA 1TW3A 2PKRA 1RYFA 3H0KA 2H1WA 4BNYA 4D8UA 4DJDC 3TWOA 1X7HA 4O2BB 1V47A 4AKEA 2ECQA 2I34A 4V0QA 1Z0UA 2TMDA 1DAIA 4Q6BA 4TT3A 5JMTA 3REFA 4KLZA 3HYRA 2HMUA 1I6LA 2PRJA 4FT2A 1OI4A 2ID4A 3JRNA 3PQ7A 4IVNA 3KOWA 4CKBB 1RHKA 1W93A 5DBOA 2CV1A 1G7SA 2O59A 1EESA 2W6JA 2R7AA 2AN9A 4RETA 1GIAA 1KP3A 1NBMA 1ULSA 1WV1A 3NKVA 1ZP6A 1IHPA 1SJ9A 3Q4GA 1YR2A 1KMNA 1EBBA 2IYPA 1E8DA 2AZ4A 2BGIA 2XT0A 1GADO 1D7OA 4D3YA 4F38A 5IG2A 5CH3A 3TAXA 1YNOA 3CY6A 3NXKA 1H1TA 4LF5B 1MN6A 4LHEA 2GM5A 1IH8A 2RAFA 5DLEA 4CMAA 4M9SA 3V1LA 2BGTA 4D9IA 1S8FA 4P84A 1EBFA 4OHUA 3VKGA 4UDNA 5AKXA 2EAUA 3CMCO 1G9TA 4GOLD 5KOIA 3VHLB 4EG0A 1BXRB 2R68A 3ZY6A 3AEXA 3DBVO 3WMEA 3EGVA 4O4LA 3DUWA 3ASUA 4YUYA 2WSSA 3B12A 2ATVA 5KREA 2ZAIA 3AG6A 3GZNA 2QRKA 3HB7A 5AHWA 1U9ZA 2EF1A 4Y1RB 4D9MA 5F23A 2MSNA 4TTTS 1CUGA 1ODJA 3AF4A 1JDTA 3DMGA 1F8UA 4FILA 1QR6A 3CCFA 1VMKA 2RJ3A 3BJMA 3H42B 1BE1A 1YB6A 5AXAA 1TAGA 2FFBA 1T3LA 3DS8A 3ZBUA 2AKEA 4DR5B 2P0EA 4CF4A 3TLBA 1A88A 2QG4A 2PLWA 2QI9F 3P2KA 1VE6A 1P4HA 1X9GA 3K96A 4IDPA 4HS4A 4XIJA 3SVZA 2FEOA 3QUQA 1UWLA 5DK4A 3SBDA 4CBVA 3NHMA 4QEZA 1YQWA 4I1SA 1H9AA 1HUQA 3BXOA 1W5SA 5KBYA 3EFOA 2FN9A 3AF6A 4PIVA 4JI7B 2BFOA 3DLTA 2NO0A 2WWVD 3MB5A 4YJGB 5BRNA 3D7SA 5BN3A 1EXWA 3IAAA 4HLCA 1TO1E 1OXSC 4GR5A 1W73A 5A3SA 1J49A 2HA2A 1OLUB 3TGWA 5F5NA 4HRAA 5JC8A 4GPBA 1M34A 4N0EA 4E1VA 2Y1OA 2VXBA 4WKOA 3I72A 2O23A 3SE0A 4XJTA 2AI2A 5CEJA 2YXEA 2FPGA 3NBKA 2DZDA 4NAVA 2FWPA 1M6EX 3TFQA 3IKTA 3QBEA 4R05A 4MH0R 3EXEA 1DCFA 2ZRNA 5ALMA 4AUKA 3M6XA 1Y89A 2JFWA 1XLWA 3LPCA 4CM4A 2BL4A 5AOVA 1GKLA 2VTEA 2OD9A 5LP6B 1EWTA 1CY0A 1MVOA 2HF8A 2QPOA 3AIMA 2A9VA 1MVLA 2G5GX 1PTJA 3BHIA 2D8MA 3GJYA 3OESA 4X94A 2FAXA 1BXKA 1ONBA 2OKGA 4XM2A 4YECA 1JWBB 5FNVB 5EYPB 5ULLA 4YT8A 1XDDA 2HSJA 4I1IA 1VGVA 2BRUC 4CDNA 1BEZA 5AHKA 1V3QE 4X60A 4YCSA 2G17A 2C7QA 2BYTA 3EVDA 1XQXA 4NICA 3DW3X 2RFLA 1P6XA 3U13A 3VH4A 1YCGA 2X42A 4HQRA 4P2BA 2ZRAA 4XLZA 4AAYA 2QI9C 4D8VA 2IH2A 2OQRA 4G09A 1H2XA 1QMPA 5J5VA 9GPBA 1T8PA 4OHBA 4CKZA 2Q45A 1XMVA 2BFNA 2PWPA 4ZI5A 2FMTA 5HF5A 2EJVA 1JHYA 4EENA 2G83A 3CLUD 3KTAA 1ZXLA 3AEUB 3LQKA 5A03A 2X0RA 4RANA 3CLRD 5C31A 2Y1XA 4JN6B 2AR0A 5JS6A 1LJLA 3KEGA 1OX4B 3BJRA 1VLZA 1LWOA 5AJXA 1MF7A 3HCNA 2O8NA 2XOEA 4ZEOA 3OZIA 4P7BA 3CH5A 2O06A 4EGFA 3T8YA 1JDBC 2J3LA 3RJ5A 4TKLA 2Z3WA 4QQNA 1L1EA 4RSHA 5EHIA 3T9DA 1K0FA 1VIDA 2VNHA 3DT6A 1QVAA 3PC6A 4M53A 1M74A 5JRZA 5E6UB 4B3DA 2PXHA 5DBFA 4G24A 4UTPA 5KQLA 1P5HA 1YB5A 2BFEB 1Q1EA 2PH7A 2WSYB 2XNHA 2RI0A 2YS6A 1KGDA 4PTLA 5HBRA 4JYBA 2OD7A 4DR7B 2F59A 1RWNA 2GO7A 1GUFA 3D8RA 3EFBA 2Q4DA 4UVGA 1V11A 4LPSA 1BTOA 5BVGB 3GBVA 1PDVA 1QH1B 2ISQA 3VPCA 4QGSA 5BV8A 5I9TA 1K6IA 1IAQA 2J09A 4MWTA 2OGSA 4KQFA 2JD2A 1PR6A 1XLTC 1NKVA 3P9YA 5H9VA 2HNBA 4PSDA 1TECE 1H6CA 1YDWA 4TKVB 1L1FA 4FFNA 3S7TA 4F4HA 1Z12A 3D3WA 4W63A 5B7PA 1D4ZA 3T5DA 4CEJB 2D1YA 1W48A 4RLQA 4BEBA 5C3MA 5A62A 1IZ0A 3AVQA 2YXNA 2HAEA 4P4SA 4D98A 4YRLA 2QP4A 1LZKA 4YP6A 4AY4A 1WZCA 2WWHA 4MWZA 4PNHA 1OWPA 2CLDX 4NXMB 3BD9A 3V48A 2FW6A 2O57A 5HK8A 1IDN1 1PLLA 5FXMA 1OLSA 2F43B 1MX3A 2N1MA 4JH0A 5ESXA 3CVWA 2R6AA 1B0PA 4KO8A 4UUOA 3P9KA 4MRVA 1GCAA 3DE0X 4ZP1A 4LJ9A 3WLMA 3QPDA 4Q82A 3RK4A 2XUDA 3SZRA 5BWOA 4UM5A 2OL4A 3OHMA 2OLKA 1NRIA 1FP1D 1XMPA 1Z82A 4FYXA 2RIRA 4LF7B 3CMMA 1CEYA 2ACWA 1KEVA 1UWCA 3IIIA 1SOUA 2DPXA 2I7XA 1U0TA 2FY8A 1XCPA 3S5JA 3WL7A 1M2KA 3K72B 3FPBA 1XPOA 1DRVA 1FX1A 1S2LA 2HWYA 2RI6A 4E1BA 3GROA 2EF0A 3L2OB 5EJIA 4CEIB 1W5TA 1IQRA 1QTRA 2EFYA 3F5FA 3P94A 2ZZNA 2ZRFA 1LRLA 1UFKA 2G4LA 1CQIB 2QJRA 1XZQA 2O2SA 2H1SA 2ZB4A 4FWBA 4PFQA 3ROTA 4H08A 1MB4A 1E3JA 4ZO7A 2FP3A 4MP3A 4YPVA 3C3XA 3RNOA 3WFIA 1P9NA 4B3BA 3KV1A 2IHKA 4F3NA 3TUIC 3VUFA 4XLLA 2G7ZA 3PQ5A 3MUEA 5IP5A 4KK4A 4FX5A 1OAOC 2PANA 3RVBA 2QX9A 4ZZ3A 3UF0A 1Y4UA 2FPIB 2VA9A 3PFBA 3IAEA 3IQXA 4LHSA 4DIFA 1M2JA 5DYNA 1PL0A 2A1IA 5DLPA 4WESB 4J0HA 1AUOA 4AYXA 3SF0A 5DRTA 3ZZTA 4FHFA 2PFKA 1ZJYA 2O1SA 2WUGA 4QA9A 4RV9A 4BFLA 1V16B 4RLHA 3ZU4A 3T1OA 1LPOA 1QPGA 1L9KA 5GM2A 5BUCA 3TJRA 1RZRD 2C0CA 4QQRA 1VPEA 1Z0SA 2RHOA 2NACA 1GAWA 3GPCA 5CM9C 2WVGA 1EX1A 4XSGA 3L6DA 4IGIA 1A9OA 1CG6A 3RUFA 5AK6A 2XI4A 1JFRA 4B31A 3GCWA 1KJQA 1SD5A 4RFSA 5H02A 3AETB 3CN7A 4URFA 3ET4A 2W43A 1XCLA 2HF2A 3IXQA 1UM9B 1LV8A 4P32A 4OI1A 5IWAB 2VUUA 4PU0A 2VSQA 4AMVA 3PC3A 3R6TA 3WGKA 2GZ3A 3I04M 3OJEA 4R2WA 5HQ3A 3ZK9A 1IXYA 3LGSA 3UFBA 2Y2UA 2QTTA 1NQ5A 2UZ3A 4RXTA 3VPHA 3MWEB 2MYPA 4K3VA 1KK2A 3N76A 5CNKA 2D2FA 2ATIA 4J7UA 2ZWVA 4YDSA 1COWA 3BHJA 3N7AA 4BQFA 4MUEA 2I67A 4F5YA 3Q87B 4WUVA 1LQUA 1YNSA 1TKBA 3AL3A 3GMSA 1F8FA 2ZYVX 4NDAA 4Y0AA 5JAUA 1TQ8A 1JR2A 4A27A 5BN4A 5BWNA 4OBXA 4RZ2A 5JCOC 3I4FA 3O4GA 2HHLA 1OYYA 4K6HA 1BE0A 1IUPA 3EBPA 3NGXA 5ICCA 4F5ZA 2WZBA 3P8ZA 1IXKA 3I5YA 3ILSA 3OZCA 3QVMA 3LK6A 1J5EB 1EUQA 3IJPA 1WPQA 3O2JA 4CIVA 4CLOB 5JXGA 4DCGA 1HETA 1VL6A 1XKTA 5FA5A 3CUYA 4FYWA 5JD5A 4MYUA 4PAGA 1X3SA 1D5WA 1Q21A 1KTIA 4MPPA 5TE9A 2NU6B 4F8YA 1ZOOA 1T24A 2Q99A 2VJDA 1SHKA 2EDCA 4FD2A 2JIDA 2R7KA 1UXGA 3MW8A 4CGYA 5T8KA 2CBXA 1E9BA 4TPKA 2HCBA 3L46A 2Q9AA 2IX3A 3ZVNA 1FIUA 2A7QA 3AJEA 4LZLA 1N92A 3I39X 3UCXA 4Z1OA 3L04A 3AEYA 3GC6A 2WTAA 4LJSA 4JKYA 4XYBA 4MQLA 1O94A 3WYDA 2PO5A 4FJ2A 3RVMA 3V32A 4XI9A 1CR4A 1QTNA 4M6WA 4NC9A 1VE9A 4JUAA 1RQGA 3EVGA 3LFTA 3WQBA 3KOZA 3ON5A 5G0WA 2X77A 4JODA 5BYKA 5ICGA 1BX0A 1AQIA 2QRUA 2J3QA 4PZPA 3CJQA 4HGNA 5TB5A 4P58A 1OILA 1BU8A 1A4IA 2I1WA 2QP3A 3NJRA 1VB3A 2IT1A 3OZSA 4RMGA 2ZITA 1HMPA 2P90A 4U8GA 1JTFA 2J32A 2N9UA 3TJZA 1AGNA 4OYRA 1Z47A 1KQGA 1G4AE 4MVJH 4AUNA 4M0PA 2X2EA 1F2UB 4DV2B 3I9MA 4LXHA 1GLGA 2P6MA 3FOAA 3OEEA 4HLQB 1ABEA 3DWGA 5BRAA 5CA1A 5FDFA 2GUGA 4NBRA 3O2QB 1KQNA 5M04A 1K9SA 4FBMA 1SRQA 1ORIA 4YR9A 1HDXA 2QE6A 3K73O 1XQWA 1CY8A 3G89A 1M2NA 4TLCA 5DEOA 3KKMA 2IEYA 5E7MA 3RSGA 2MR5A 2X5OA 1PR3A 2RBEA 3QELB 5FD8A 4CNQA 4B75A 5K2MA 1G98A 1RXIA 1QIDA 1BYUA 4IH9A 4EHDA 5AUNB 4E46A 1U1GA 2FEAA 1HLDA 2VSXA 1KHTA 3BSWA 2R86A 5EJMA 3WK6A 4MVJE 4F5DA 1P74A 4KWHA 4TWRA 4H15A 1NZJA 4DILA 1LQ2A 3C14C 3DXZA 4YRTA 2JVKA 1XZBA 2BGNA 2I76A 1OY1A 4B17A 1S5PA 2EBHX 1VE5A 3WO1A 1NPTO 5A4IS 1IM2A 1U81A 4XDGA 4YMGA 3B85A 1VCHA 1ZBDA 4FFSA 2G70A 1CRLA 3VR3A 3U09A 2FZVA 3IE0A 3UJ7A 1S7CA