1R50A

Bacillus subtilis lipase a with covalently bound sc-ipg-phosphonate-inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Directed Evolution of Bacillus subtilis Lipase A by Use of Enantiomeric Phosphonate Inhibitors: Crystal Structures and Phage Display Selection
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 63
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r50A00
5CRIA 1K63A 1WM1A 4K6KA 4X6XA 1R9MA 4OSEA 2Q0XA 2HU8A 2OCIA 1QGED 1R88A 2BGRA 4H7FA 2WSLA 2H7YA 3WKDA 1ZOIA 2G63A 3AIMA 5LZ4A 1QTRA 3KWJA 4X6UA 2V9ZA 2OAGA 2XMDA 1AURA 4J0KA 2XUGA 4OPMA 5AI6A 4UBMA 2VJBA 3FLAA 1CV2A 2WIGA 2ACKA 5AJHA 5FRDA 1YB7A 2OCGA 3FYUA 3JWEA 4I19A 2WU3A 3BIWA 1N5RA 2QMQA 1ZD4A 3G0IA 4E15A 3E4DA 4Q3OA 4EB0A 3IUNA 4MQLA 1XZMA 2XB6A 2DFPA 4Q3LA 4B85A 1XRRA 4J0GA 4UHBA 2XUHA 3F98A 1A8SA 3VVMA 5HKAA 4C4YA 1QIEA 2JEZA 5ALLA 2ZVDA 2C58A 4QDTA 5AM5A 3BIXA 3WWOA 2J3DA 4B0PA 2ROQA 4AMZA 2CEKA 4PO3X 3QZUA 3WK6A 5LZ9A 1GPLA 5A2GA 4IH9A 4X7BA 1LPAB 1CUHA 2VAVA 5DJ5A 1CLEA 1QIDA 5AKZA 5JAPA 1O6GA 5CH3A 5HF9A 2NW6A 1G66A 1PFQA 2AJCA 2OGZA 4RE5A 2HU7A 4L9AA 1EA5A 1Q0ZA 2VJCA 4Y7DA 2CJPA 2GBIA 1LGYA 4U2BA 4CFSA 1LZLA 4B6GA 2D5LA 5AKJA 4HXFB 5IVIA 3V1MA 3G9ZA 2OCLA 4NMWA 4X6YA 3VJLA 5LZ7A 2CBGA 4GECA 1LPBB 2I3DA 3C5WP 3F9CA 5FXMA 4W1SA 3C6YA 5CBKA 4H7KA 3PE6A 4FMPA 3G02A 1R1DA 3HYSA 3IA2A 4TGLA 5CTAA 5HFAA 4C4XA 5ALZA 1XRNA 3STYA 5ESRA 4C01A 4HRXA 3STWA 4B0OA 3A2NA 2RONA 5CW2A 4WY8A 4ZREA 1M33A 5J3JA 1U2EA 3DKRA 3K9BA 1GKKA 3H0CA 5JZBA 4J7AA 4BVJA 1A88A 1CUAA 2VQ6A 2PPLA 3FYUB 3QMVA 1QFSA 2XMZA 5LZ5A 1CUVA 1JT2A 3JYHA 2PSFA 3C6ZA 5KWIA 2V98A 3WKAA 4O08A 1W1IA 3VJKA 4ZWNA 3H04A 3AJAA 1YB6A 3G0CA 1Y7HA 5ALSA 2BUAA 3IUQA 4FWBA 3P2MA 2AXEA 2PKYX 1IMJA 2VT6A 1CPYA 3O4IA 2G4LA 1LPOA 4HTAA 4EY4A 1NU8A 2PSDA 5ALNA 3G9XA 1TAHA 2EDAA 2RI6A 5T4EA 4N5IX 3A2LA 4U2CA 4E46A 1SFRA 4UBJA 4BCBA 1LZKA 1VZ3A 2PU5A 2Z3WA 1WOMA 4QNNA 5AM4A 2DSNA 2WUEA 2HFKA 4AQDA 3WL7A 4J3JA 4DMHA 2WHQA 1LBTA 5JZ9A 5BOVA 1JI3A 1WCYA 1R3DA 2WHPA 3DCNA 3D0KA 1XZHA 4OD0A 4FHZA 3KD2A 4QDUA 4IO0A 5HKBA 1VXOA 3W05A 2O2HA 4BC0A 2HADA 5CT8A 1ZD2P 1GZ7A 4X90A 1LPPA 3ESBA 2W22A 1A8UA 3W2TA 3BXPA 1CUBA 3HSSA 3JW8A 5FDFA 4C4ZA 3R3XA 4X93A 3A6ZA 5EIHA 2PSJA 4OUKX 3C70A 3WYDA 3L1HA 3HRHA 1QO7A 3H17A 3B5EA 5AM1A 5FPPA 1ZJ4A 4UUQA 3OC0A 4P9NA 5KREA 1VOTA 2XUOA 2HA5A 4BC1A 2PBLA 2ZYIA 2GYUA 3SC2A 3WJ2A 1DWPA 3CXUA 2C5FA 2BUCA 1UXOA 3R3VA 2Z3ZA 3I6YA 3R3UA 3WIBA 1UOQA 3EBLA 5C7YA 2PL5A 3IBTA 1ODTC 4KACA 5CT9A 2QXUA 2Y6UA 1EB9A 5AM2A 3FLEA 3G0DA 3D7RA 3AUKA 3FNBA 2J4CA 1GGVA 1MAAA 2XUJA 1T2NA 5CT4A 3ZLUA 1XFDA 2AJ8A 1U8EA 3GA7A 4EY7A 3PFCA 3RARA 5ALWA 3R0VA 5LZ2A 5AKLA 4C89A 4F0JA 1XZKA 1EVQA 4DIUA 2B9VA 4WDRA 5BWCA 3G9UA 4FBMA 4XVCA 4QLAA 5ALKA 1AC5A 1LPMA 2GYVA 4MQMA 1QONA 1UOPA 4U2FA 2OPHA 1GQSA 1UK8A 4BAGA 4BTVA 4WJLA 4WCVA 1HDEA 2WHPB 4BE4A 4H18A 1XZAA 3FVRA 1UKAA 3D59A 1MU0A 3O95A 3CCBA 1QO9A 2OAEA 4AN1A 1K6EA 4OYYA 5C8VA 2R11A 3OOSA 1P0QA 3V48A 4WY5A 5JYCA 4KE8A 4PSCA 2EEPA 3WK4A 2HIHA 4DYHA 2WJ4A 3HJUA 1X2EA 3O4JA 5K5EA 6YASA 2UZ0A 1VLQA 3M83A 4MXDA 3Q0TA 4H7DA 4OB6A 4IH4A 1LNSA 3C87A 2VF2A 2FX5A 1CQWA 3H1AA 2ACEA 5EHQA 4K5QA 4BYMA 4U2EA 5EIEA 5F4ZA 1SCKA 4J03A 5DLPA 3BJRA 1YASA 4A16A 4HS9A 1K4YA 4YK7A 4L0CA 5HK8A 1UZAA 2JIDA 3D2BA 3GBSA 4H7IA 4X92A 4DMFA 5AH0A 3VXKA 3PUIA 2GBCA 2B20A 2QT9A 4W1PA 5HF8A 1XKTA 2JF0A 5AI4A 4WFIA 2WJ3A 1N5MA 1XZJA 1XRMA 2HHAA 1ODCA 4WFKA 1W75A 5FP0A 3FYUC 1OXMA 4FOLA 5EGNA 4CIBA 2VJDA 4I4CA 4MWTA 3R3WA 5K3FA 1QIHA 1MNQA 4KAFA 4GLBA 1DQZA 1XRPA 3X3HA 1J06A 2C5GA 5K3CA 4B80A 4JH0A 1EXWA 1EDDA 2DR0A 3ANTA 3I6ZA 3STVA 1TQHA 1CUFA 4UFOA 4LXIA 3M82A 1BCRA 3C6XA 4BAUA 3F96A 3RLIA 1ZIYA 1QIMA 1Q83A 4A23A 5E4JA 2HL6A 1QIJA 1YAHA 5K3AA 3GFFA 4B81A 3WYNA 4KAAA 1CUCA 1KU0A 2OGTA 4FNMA 1DX4A 4PF1A 2QOEA 3N0TA 4BB0A 1XQXA 2WU4A 1U4NA 2IITA 1CUXA 4LKOA 1R9NA 3I2GA 2FJPA 1AZWA 5ALQA 2OQVA 3DLTA 4ZV9A 3O9VA 4CI9A 4Y2PA 1ODSA 2RHWA 1TCBA 4WDQA 3MGAA 2Y2VA 4HXEB 4UFPA 5IVHA 3AFIA 5E2IA 3QMWA 1IUPA 1IVYA 3QH4A 3FLBA 4JEIA 4J0HA 1KEZA 2WG0A 5CH5A 4ZGBA 4B9EA 2JGEA 5IKXA 1X70A 3BDVA 3FAKA 2WFZA 4E14A 4EY6A 2E3JA 4DNOA 3F97A 4UHFA 4HZGA 4X00A 3KWFA 1QLWA 2O7VA 3PUHA 3FCYA 1CUEA 2FUKA 3VDXA 5JALA 2CMFA 4BBZA 2WUDA 3L1JA 2XUQA 1J07A 5A6VA 1A7UA 1GXSA 2PSEA 4NS4A 1G42A 1G5FA 1RWQA 2QZPA 2VEOA 4INZA 1LBSA 5FOQA 3KSRA 3HABA 5LYYA 1W4LA 5AI8A 3RM3A 1THGA 5FPQA 2HRQA 1OCEA 2QXTA 2WIKA 4MEBA 4KE7A 3ZI7A 2PU7A 3WL6A 4KR0A 4FNGA 4J0IA 2EDCA 3H2KA 4C6HA 5ALYA 2ZYSA 5JZSA 1UFOA 3I6MA 4H7HA 5K3FB 4CIAA 2WHRA 2WFLA 1EK2A 4OU5A 1N8SA 5AK5A 3V9AA 5AK4A 1XZEA 1HKHA 1SCQA 1ORVA 3ILSA 5ALXA 4B7ZA 4QDZA 3WWCA 3O4HA 3W9UA 2PM8A 5HF5A 2ZJ6A 1WB5A 3I2HA 4C87A 3LIIA 5EHXA 3WLAA 4OCZA 1FFDA 3DNMA 3EQ8A 3I2KA 2HA0A 3O0DA 4K6GA 4Q3KA 3AINA 5AK3A 2VSQA 2XDWA 4TPKA 1DTEA 3WQHA 3AIOA 4UPDA 3D4LA 4X94A 5A7HA 1MX9A 4BP8A 2PX6A 2QUAA 1U65A 1CFJA 3QPAA 5EI5A 2RHTA 5IVDA 4H77A 5YASA 2HA7A 5DNVA 1XZLA 3H2HA 4W63A 1C4XA 3H1BA 2RIPA 1QE3A 3GROA 3SWWA 3BL8A 3FCXA 4KRYA 2PSHA 4NVRA 1YA4A 4BCCA 4AN0A 1JU3A 1UT6A 1CUZA 1EDBA 1FFCA 1VE6A 1W52X 3QBJA 1QZ3A 3S8YA 1HQDA 3T52A 2OXEA 2H7XA 2XUKA 1EINA 4TVKA 1JKMA 5AKGA 1YA8A 4BRZA 1R50A 3WJ1A 4FTWA 1VJ5A 2V97A 3QYJA 4V2IA 3R3ZA 2DHCA 3L1IA 4GDMA 2WUGA 4PW0A 2DQYA 1YR2A 1UKBA 1ZGBA 5AKXA 1MX5A 2WFMA 1UOOA 4J0DA 2WFLB 5JATA 2XMRA 1K8QA 2CZQA 2QRUA 3DL4A 5D7BA 1MAHA 3OG9A 2W6CX 5IH7A 5KBYA 4ZXFA 1L7QA 1UKCA 3A70A 5AO9A 1XQYA 2QVBA 4EUSA 4Y2XA 3LS2A 3EQ7A 4DGQA 5A62A 2G5TA 4N8EA 4N8DA 1Y7IA 2Z8XA 2X5XA 2WM2A 3WZMA 3I1IA 4P92A 1XZGA 5AP9A 1LLFA 5AOBA 3CN7A 4KYVA 3QPCA 2GZRA 2H1IA 1JMKC 4DNFA 4G8BA 4CG2A 5C8XA 5ALFA 3OM8A 3W9BA 4PV7A 2VAXA 4U2DA 3D5EA 3WA7A 3W04A 2JGFA 1QOZA 2XQIA 3EIOA 4PQEA 4C88A 3I2JA 1BEEA 5DTIA 1ZD5A 1IUOA 1F0NA 3NOXA 1CUDA 4JNCA 4DLNA 4GEGA 4KE6A 5JD5A 1CUGA 5I7UA 2K2QB 1ZI9A 3H18A 2QKYA 1XLWA 4FLFA 5ALGA 7YASA 1ZIXA 4AB1A 2XQGA 4UFNA 2P8SA 1VA5A 3I28A 5AHXA 2X8BA 5AKYA 4J0JA 1J1IA 4UBKA 2BAGA 3STUA 2OLEA 5CXXA 5AICA 3IURA 4G9EA 2O7RA 3GUUA 1BCSA 5K3BA 3UUEA 2C4HA 4Y2SA 1WHSA 4W1QA 3KOOA 1VXRA 1YS1X 4D9JA 2PVSA 1L7RA 5AM3A 1CRLA 2WIDA 3BDIA 3WL8A 3I1YA 4ETWA 4EA6A 1DWOA 5LP1A 3IB3A 4G1FA 4G4IA 4AZ3A 5ALHA 1EHYA 4H7EA 2DHEA 2WUFA 5JIBA 5LKAA 3TEJA 2OCKA 1DQYA 1OILA 3AZOA 4WFJA 2WTNA 1QFMA 2XMQA 2JBWA 4EY5A 3WZLA 1ACJA 2C0PA 5JASA 4FFVA 2ZJ7A 3DEAA 3ANSA 1LPSA 1EDEA 5ALIA 4JYMA 1ETHA 4X85A 2HM7A 2WG2A 1JFRA 4LYEA 4BVKA 2JEYA 3SX4A 4LXGA 3IVMA 4DMCA 3E3AA 1BRTA 1VKHA 2VTVA 1FFEA 1H2ZA 4HRYA 5AM0A 3FSGD 3QITA 4EY8A 4H35A 5FV4A 3O4GA 1ZGCA 3QMMA 5AKIA 1IZ8A 1H2WA 2XE4A 1R4ZA 3C5VA 2B61A 2WILA 1Q84A 2ZYRA 3LIPA 3WI7A 3R3YA 1QJ4A 4FLEA 3BWXA 4ZI5A 2IX9A 5BV7A 3ESAA 2PUHA 5LKRA 3TJMA 3EQ9A 4Z49A 5LLSA 2JGMA 2J4FA 3MVEA 4EBBA 4Y2TA 3PICA 4XX1A 4BE9A 5HQ3A 3VJMA 3NWOA 3PI6A 3R40A 4OB8A 2RGUA 2O2IA 2YH2A 2HA2A 4G8CA 3UUFA 5HFNA 5ALRA 4BTLA 3G8YA 2QM0A 3FWHA 3MUOA 2VT7A 4PSDA 3DJYA 1O6FA 2WTMA 3AIKA 4BP9A 5DNUA 1SC9A 2ZJFA 4EHBA 1XLUA 4FLMA 2HA4A 2B4KA 2JGIA 4JYPA 1YSCA 4RPCA 5AI9A 4G4JA 3ICWA 4DSAA 3D2CA 5BWBA 3AZQA 1RYYA 1H23A 3W06A 5AK6A 4Y2RA 5ALMA 1UWCA 2XMCA 2QUBA 4P93A 2HA6A 4X91A 4Q1VA 4QA9A 3B12A 5ALJA 5SYNA 1LPNA 3FOBA 1ACLA 1BROA 3IIIA 3VVLA 2QJRA 4BZWA 3A2MA 1HBJA 1FFAA 3FVTA 1G4HA 3WIOA 1YCDA 2GZSA 2XUAA 4EZIA 3U0VA 2GBFA 1TCAA 1WB4A 3F8SA 3MUNA 4G8DA 5JD6A 3N2ZB 1P0PA 4ITVA 3WL5A 3WA6A 3RKSA 2XUIA 4CCYA 1P0IA 3ICVA 5HZGA 1QTIA 1VE7A 1F8UA 4GW3A 4QDXA 5ALPA 1WPRA 1TIBA 2Z8ZA 3GELA 2XUPA 3DOHA 2CUTA 4YPVA 2WG1A 5EIAA 3NGMA 3ZLTA 1CQZA 1CR6A 4KEAA 5D3KA 1XKLA 2BCEA 3BF7A 3D3NA 3ZWQA 4DSZA 1MJ5A 1BN7A 1UK6A 2XT0A 3KDAA 1USWA 1MPXA 2CB9A 5T4HA 1MX1A 5EHNA 2AJDA 1CUWA 2DCMA 3HI4A 1E8DA 2C7BA 5HQ3B 5ALEA 4LYDA 3E1GA 2ORYA 2XQFA 4RNCA 4U2GA 2Y2UA 5JARA 3EF3A 1XLVA 4MEAA 4L72A 2HU5A 5D6OA 2XMBA 1ZI8A 4G9GA 2D0DA 3LLCA 1GQRA 5HF6A 4BDTA 1EH5A 5DWDA 3PFBA 4UHDA 1EVEA 1XZFA 4W9RA 3V1LA 4BZZA 3C45A 4QLOA 5ALUA 1A8QA 3M3DA 4BDSA 4QZVA 3DD5A 3K6KA 4Y2VA 1MTZA 2I03A 4XJVA 3CN9A 1ZICA 2OQIA 2ZSIA 4PSUA 5IVKA 3RK4A 4N5HX 4M0FA 4BRSA 3ZV7A 1H2YA 4DM7A 1CIJA 3PDCA 1THTA 1PV1A 1N1MA 2WIFA 4OYLA 3WWEA 3I2IA 1CUYA 4ARBA 4KJXA 4Y2JA 2QR5A 1NX9A 2YYSA 4CCYB 2ECFA 3U1TA 3UMJA 2AJBA 4JUIA 4AO8A 5SYMA 4A5SA 4BAZA 4DNPA 3C8HA 1E66A 2FJ0A 4B84A 1AGYA 1CUUA 2DHDA 2Y1KA 2WLSA 3IUMA 4FFWA 1CVLA 2XQJA 5AKKA 2JGLA 4H7JA 1AUOA 3HACA 4GI1A 3S2ZA 5HCUA 2XMSA 4Y2QA 4BCDA 2H7CA 3VISA 3H2IA 1XZBA 5A71A 5CURA 1DT5A 4B9AA 1WHTA 2HDWA 4IH1A 3V1KA 1Z68A 1CUSA 5CT6A 4F5ZA 2G5PA 1E8MA 4NZZA 1DT3A 4F21A 3GZJA 3QM1A 5DYYA 5JADA 5CMLA 2YXPX 5E4YA 3C43A 5H3HA 2ONCA 5AKEA 3BE8A 1XROA 2HFJA 4CG3A 2XUFA 5JD4A 1Q0RA 3OPMA 3HEAA 1K5PA 1BEZA 1I6WA 2CKMA 3WK9A 3DOIA 3B3QA 4UBOA 1H2XA 4Q05A 4IQ4A 1EI9A 4YASA 3CCCA 5T4BA 4DMKA 1NU6A 3WKEA 1VA4A 3DYVA 5DNWA 1MN6A 2BJHA 4I3FA 1E8NA 4GHWA 5T4FA 4X3CA 1TK3A 3H2JA 4AMYA 4G4GA 2BUBA 1TRHA 5AI5A 2VA9A 5DYTA 1CEXA 3AILA 4P08A 1SCIA 3V1NA 4XIIA 2HA3A 1TKRA 1ORWA 2HRRA 3G0BA 5FLKA 3KXPA 1IZ7A 2VATA 2J3QA 2ES4A 2LIPA 1F6WA 1GPKA 4UBLA 5HK9A 1BS9A 2JGJA 3E0XA 4Y2UA 4K2AA 2XLBA 3IDAA 3G0GA 1GPNA 4M0MA 1BN6A 1UK9A 3BF8A 4GXNA 3WKBA 5E4TA 5K3DA 4X97A 1XZCA 3H19A 1WPXA 1DU4A 4N8SA 2QJWA 5FKJA 5JANA 1W76A 3I2FA 4RE6A 4UHHA 5A7FA 3WK8A 4E11A 1XQVA 1FSSA 1C7JA 2QS9A 5ISMA 5JAUA 1TCCA 4UBNA 4QDOA 4CG1A 3WKCA 2O2GA 2I3ZA 3YASA 1P0MA 1ZI6A 1HLGA 5D3ZA 5AKHA 4LIPD 3K2IA 3ZLVA 1YS2X 2OGSA 5I8PA 1J2EA 3STXA 1WB6A 4HXGA 2JGKA 4ROTA 2XLCA 1YAJA 3LCRA 1JJFA 2PUJA 2C0QA 4X95A 1DWQA 1B6GA 3DDUA 3G7NA 4G5XA 4UHCA 1XRQA 3OURA 2XQKA 1BU8A 3R41A 3ZPXA 2Z5GA 4GBGA 5C8ZA 1AX9A 1F0PA 1RP1A 2WJ6A 1HPLA 5CH8A 4X71A 5ALOA 4H0CA 2WKWA 4HVTA 3LP5A 1BE0A 3NUZA 3D2AA 4UBIA 2XMGA 4DNQA 1XZIA 3IULA 3FSGA 4FKBA 3T4UA 4AO7A 2YASA 4BVLA 1DINA 1S8OA 4YX9A 3H2GA 4OB7A 5AIAA 1QIKA 3WK5A 3C8DA 4QE3A 1L7AA 4LHEA 2QTBA 4J0CA 5JAOA 2WQZA 1EB8A 1D07A 3IUJA 4QWMA 4ARAA 3F67A 3ESCA 4B82A 1EX9A 1T4MA 2GYWA 3DQZA 1JJIA 3STTA 1H22A 4FBLA 1CUJA 2WIJA 1AMNA 4B83A 3VKFA 3DYIA 4MYDA 3HLKA 4DTCA 3M81A 4Y2YA 4Y9SA 4PNZA 5ALDA 2GBGA 4L3WA 2DQZA 4W1RA 1VZ2A 1SOMA 2VJAA 4MYSA 5DYWA 1ISPA 3TRDA 2BFNA 2BGNA 1ZD3A 1FFBA 1GKLA 4IHAA 4HAIA 1DX6A 2OG1A 1HL7A 5AI0A 4ZV7A 5AIBA 4Q34A 4GWLA 2H9YA 4OU4A 2R8BA 4AX4A 5AOAA 1EK1A 3OTQA 3QPDA 5EFZA 3ED1A 2X76A 1Y37A 3AZPA 1QIIA 1UK7A 5LZ8A 3FYTA 3WK7A 1XQWA 4FDMA 5DTJA 2AJLI 5K3EA 1E89A 3HXKA 1ZJ5A 3PF9A 2IIVA 2Y6VA 4S0XA 5CT5A 4AO6A 4UHEA 1E3QA 4XWGA 3WMRA 4KAJA 3WWDA 2XI4A 4ZRDA 2I78A 1W6RA 3C6BA 3PF8A 3SK0A 5EHZA 1FJ2A 5I9IA 1AQLA 2XUDA 1IUNA 4BATA 5ALTA 4LXHA 1MNAA 1PJAA 4CCWA 1JJBA 3ESDA 5A7GA 3QVMA 4RGYA 2RAUA 4MJ3A 4QWWA 2V96A 5AOCA 4M0EA 5C81A 1JMYA 4QEKA 1XZDA 3DL7A 1C7IA 3DKKA 4Q82A 5ALVA 3DS8A 1MO2A 1XRLA 2ZYHA 3BJMA 3FBWA 4AZ0A 1E5TA 1QIFA 1CUIA 4K6HA 4MWSA 5KWJA 3HC7A 1AKNA 1QIGA 1X2BA 1MT3A 5LIPA 5JAHA 4KRXA 3TGLA 4F60A 5CXUA 3G9TA 4KE9A 1JU4A 1GT6A 1KU6A 3HZOA 2BKLA 5FUMA 3Q8WA 3O9MA 3WWPA 2ZSHA 1B41A 4AXBA
chains in the Genus database with same CATH superfamily
1NW3A 4GMHA 1I4TD 5JDCA 4D97A 1RLIA 2AEFA 4DCGA 1R9MA 2CBZA 4OSEA 1BWRA 2IZ1A 2ZIUB 3GEHA 3TNYA 3CWCA 3IERA 4D6XA 4XR9A 4YRRA 3W8EA 2HPVA 3VNSA 1QGED 2JRLA 3N76A 1XEWY 1IRXA 3QE9Y 3AVPA 1CTQA 4LZWA 2YN0A 2X7XA 4B3DA 2O4UX 1ZOIA 3AIMA 1HG0A 1I51A 4PYMA 1P7ZA 2P8JA 5FAKA 2HEGA 3ML1A 3S68A 4YAEA 5KYNA 3IE0A 1BE1A 1QTRA 2QG9A 2C9YA 3AF3A 5LXTB 3W5BA 2J7KA 3L06A 3L6CA 1UC9A 3KZXA 2H8GA 2N9UA 4KLNA 3RTBA 3AESA 1T8SA 2OAGA 2VBGA 2OGWA 2VP2A 5B4TA 5KYXB 3GAFA 3KX2A 3M3HA 4PIVA 1K7SN 4GH5A 4G4SO 1B14A 3WBFA 1N6RA 1RPAA 3JQFC 2XUGA 4IAOA 3K8OE 2VJBA 4B3MB 1J5EB 2M98A 2XPCA 1CV2A 3V9PA 4HV4A 1XIVA 3IILA 3TTYA 5LDHA 1RCFA 2ACKA 3LUFA 4YR7A 1DKMA 1MDBA 1N2GA 1PUXA 2QA5A 1C0KA 4AF6A 3JWEA 3RTEA 1Z4PX 4M6WB 1LFAA 1N5RA 4Y0VA 3D8BA 2Q3HA 4BVEA 2CNNA 2Z5LA 2MINA 4Q3OA 4TYPA 1U90A 4URZR 5EJ2A 4B1FA 4BLQA 3NYWA 1RP7A 2OYCA 2QD3A 4UMVA 1K27A 1TVKB 2ADFA 2G9UA 5TPWB 2YJGA 3K32A 4IEFB 4MI9A 3FNEA 2PL9A 3KOZA 1Y8QB 2DFPA 1O9GA 3FROA 2GH1A 4OI2A 4PGMA 4TL7A 5GM1A 4Q3LA 1WUKS 4E1AA 4D9EA 4P4SB 5C2JB 1ZH6A 2HWYA 5J23A 3GFBA 4UHBA 3UW3A 1H0KA 4LDQA 1ZU5A 3MWFA 4WOBA 5HKAA 3BMNB 5FAXA 3NHRA 4JJ8A 1MXFA 1GNTA 3MOIA 4JLDA 2I87A 3LU1A 1P75A 3TQCA 1PQYA 4P7BA 4PGGA 5CITA 1OXXK 3PCRB 1DKPA 1HLPA 1PR0A 2W2PA 1NN3A 5CCXA 1IEQA 1ZJWA 1H9AA 1BW9B 1SG6A 3CC8A 1SXIA 3EQ2A 3N0RA 1F14A 3WWOA 4RY8A 2I1VB 4B0PA 1QKKA 3SYNA 1NR5A 3ZGOA 2CEKA 4P3PA 4PO3X 1XCMA 5DGCA 2QYTA 2R1TB 5DE3A 2R5NA 5GINE 5FV7A 4NPCA 5A2GA 1H1TA 2F3QA 5AJXA 4TSRA 3B48A 3TIFA 4EHLA 1XTUA 3T7DA 5JQGB 1C1DB 1QRAA 4HB0A 5F5XA 1A7KA 4EB3A 5FUBA 3ADBA 3HKDA 1X7YA 5JMPA 1G17A 1CLEA 4OGKA 1AKVA 3OHMA 4DV2B 3E3OA 1KFBB 1O6GA 1V2HE 3B38A 2DVMA 2D6FA 1BDHA 5DHFA 1N34B 1TYBE 3HY6A 3UGKA 1OW3B 3R7WB 4F2GA 2RH8A 2FYTA 4V0QA 1PWZA 2REQA 1KAQA 4GZ6A 4G84A 2PL1A 1PFQA 2WT4A 3EIXA 5TARA 4DEXA 1EQUA 2OGZA 3TVTA 1OT3A 2FEAA 5P21A 3JTMA 1RWNA 5FHRA 4RE5A 5HVNA 4FYXA 5K1ZA 3DM5A 4L9AA 3CRZA 1H69A 1YH3A 1Q0ZA 3DFUA 4GGMX 2QLFA 2VJCA 3QG5A 4Y7DA 1UPFA 5CB8A 4DA4A 1ORIA 1FNMA 4YJHB 3PUZA 5DYIA 4CFSA 3HFJA 2H4XA 2EQ5A 4WLOA 4XQ9A 1TO1E 5EJ6A 8OHMA 2IIBA 5AKJA 2YFHA 5TSDA 5FQNA 5BW4A 3SNHA 5CM8B 4FYIA 1YXMA 2AE1A 2GERA 2GTIA 2NV2B 2X23A 5JCZA 4RO0A 4B3JA 2OCLA 3EASA 3D5QA 2WC1A 5HEKA 4QJIA 2CBGA 2P5TB 3RLFA 4HDQB 1WE2A 2EFEB 6AT1A 4ADSG 3EIQA 1L7BA 3S1AB 4Q7QA 3BD8A 5F1PA 1ZJ6A 1CY2A 3F9CA 1GL3A 1X1TA 1XTZA 1YZUA 3LT1A 4ENVA 4RADA 1JBQA 4H7KA 4M9CA 3EPPA 2YRFA 3OAAD 4JC0A 3FGZA 4OQPA 4H3HB 4FMPA 4BGEA 5KOYA 1SXJA 1D0VA 1O95C 3F90A 2C8VA 3ZQUA 1R1DA 1SUWA 3PYLA 4HRAA 3KTDA 4RIEA 5KKNB 5ALZA 1XRNA 4LRYA 3STYA 5J63A 4HDAA 3DGEC 4H27A 4R0VA 1PG2A 5F2NA 5KCZA 3CZQA 4ZVVA 3STWA 1BX0A 4A1FA 3OTOB 3PKIA 3GPLA 1NXXA 1M1ZA 5CW2A 1MRSA 4RKQA 3ABIA 3KTAB 1Z22A 1JFFB 3C8UA 3CZPA 3VZQA 1ORHA 5BSUA 3ZWXA 2ST1A 1A88A 4NG5A 1CUAA 5ADVA 3FWPA 3CX6A 1P17A 4NHEA 2PHZA 4LV5B 5FULA 4BEBA 1NBME 4NESA 2GPWA 2YIMA 2CHFA 1L8OA 1Q6ZA 1W5AA 1QFSA 3IQEA 4BB6A 4LHYA 1EFKA 2OC9A 1D8AA 3T5AA 1FB5A 1L6IA 4A73A 3TI7A 2O5VA 2YX1A 1WSAA 1EUYA 3OEHD 4ZO6A 3T3OA 1P31A 5BNFA 2BI7A 1CVIA 1XK7A 4I1SA 4UXJA 2FMKA 2A4MA 2XBLA 1QQ5A 5KWIA 2QRGA 2XA1A 1L4BA 4G1EB 1GADO 4JT8A 3MTEA 4IUBS 2QD2A 1W1IA 4JY7A 5HUQA 2ZUFA 4ECAA 1O8BA 3SXPA 3THRA 3IP7A 1Y3HA 3Q40A 4DT1B 2EZ4A 1A2BA 1YB6A 3G0CA 1Y7HA 5AR1A 3K6SB 3SG0A 5ALSA 1ZSNA 2J3LA 4UVHA 3I8OA 4FSHA 4TWIA 3ELUA 4DSUA 1GQ2A 1GZ6A 3IUQA 3MFQA 1V4VA 3HJHA 5JRZA 4QPZA 4XYMA 2ECPA 1X7WB 3LKBA 2G9QA 1CPYA 2G4LA 1RJFA 4DB4A 2C29D 1M67A 1NU8A 1TZ2A 2H8KA 3OZUA 2EGHA 3FDJA 2XWBF 1UBTS 2EYQA 3KDSE 5ALNA 5GTDA 5JSZA 2ATCA 4TYWA 2CLOB 3FCUB 5AHRA 1W5BA 2AX3A 1JT9A 5HP4A 1IFXA 2NSLA 2QAIA 2ZDGA 3A2LA 4CKBB 4DR4B 3JQ9C 2PMCA 4AIRA 1YQGA 3AWDA 1JEQA 2UYQA 2HNAA 4X9XA 1SFRA 4BGVA 5CA1A 1RI3A 2G8LA 1ZEJA 2P6RA 1BXZA 1PS0A 2AA3A 3A05A 5EE9A 5I9TA 3T7KA 1UBSB 3ZDZB 2NOAA 2OFWA 3H5RA 4M1WA 3RSGA 3QE2A 3LOUA 2P5YA 1BJRE 1R3UA 3OPYA 3VR3D 3M2PA 3GYGA 1QYIA 3UHOA 4MDHA 4YRDA 4P5DA 1V0JA 4L8WB 1L3CA 1ISSA 5AJUA 1A3CA 3VC1A 1W7AA 2YOGA 1VG1A 2DSNA 4J9VA 4J3JA 4KYTA 4OHZA 4YC7A 1II8B 4DMHA 3BHNA 4YQZA 3HWSA 2UDPA 4J2HA 5EKTA 4K46A 1LBTA 4MVJG 4TN1A 2GJ4A 5AW5A 1JI3A 1Z6PA 4LOKA 4RXUA 2IY9A 2OK7A 1J21A 3ZWPA 2F2TA 3RVJA 2PUTA 3KZCA 4ETIA 4YRAA 4KHZA 1TGVA 4YAJA 4C21A 1OGYA 2WF5A 2J46A 4ZC8A 1RRPA 2KYRA 1E79D 1MHPA 2W8BB 4CF5A 4I1UA 3DO8A 2K6GA 2HSGA 4U6NA 3OE1A 4FD3A 4BC0A 3VAYA 2I6FA 1MF7A 1UM9B 2BHSA 3SBOA 5KTMA 1OBHA 1H93A 1D03A 4HG2A 2Q7DA 3ESBA 3EVDA 2I2BA 4FDTA 4DCSA 4DVJA 1PFUA 3C3PA 4QYWA 4N1AA 4YBRA 2VSOA 5HKKD 5KQLA 4OTZA 2BTQA 4EX7A 3BL6A 3BXPA 2BI8A 1LF5A 1KNQA 2ATXA 4MJ7A 3NDJA 1IZ9A 4YXWA 4ZCRA 4KDFA 3LY5A 1P1BA 4Q47A 1L6RA 5CAEA 1RRFA 1FTNA 3NEPX 1IEXA 3NTUA 2D2XA 2ZB2A 2I8AA 3AHHA 4H1HA 2C4TA 2Q6IA 1GG2A 2R6GA 3DMFA 3R3XA 1OAOC 2C2ZA 4MKHA 5SZJA 3IUSA 3PT9A 4Y1FA 4DN6A 4LJ6A 1PJ3A 2PS0A 3I01M 5ILGA 3ROQA 3MD9A 1M3SA 4PX3A 4GNRA 4EH1A 2VPIA 4GMGA 4ZU1X 3ZU4A 1Z8DA 2RAVA 3PYXA 1QO7A 3RFTA 3RJTA 3ZU3A 3AVYA 1JEOA 4DV3B 1NW9B 3C85A 3UY4A 2RCNA 2OXIA 4UUQA 2ATIA 3FDZA 3RI3A 4C6TA 2DMRA 1NN5A 2X2FA 5GZ1A 4D2IA 2JLSA 3QVOA 1G8KA 2V7WA 3HCFA 4NOLA 3L82B 4N6NA 2XUOA 4B6EA 1OXBB 4KQIA 1G8HA 3D31A 3TF5A 2PBLA 1FTGA 1G98A 2AYXA 1RXYA 5FFMA 2BT4A 3N8GA 4YXFA 1SKQA 5LQRA 2FFJA 1DWPA 4BBJA 1GAXA 3E5NA 4GQIA 1IXZA 1GZ3A 4WLEA 4EG4A 1WETA 3EPJA 3R3VA 3Q8KA 4CTKA 3H9EO 4MS4B 1H6CA 1X8XA 3MMPA 1H2EA 1UOQA 2N0SA 2ZIVB 4RGBA 2FPOA 5IW8A 2PL5A 1W581 1PF7E 3IBTA 5TJHA 5EIBD 1MA0A 2M1ZA 3PCXA 5A02A 5L7WA 4Q1CA 1AQNA 3OQJA 3IAEA 4QDKA 1YRHA 3G0DA 1GKUB 3D64A 1JE1A 4X1KB 3THXB 4CF6A 3VA7A 3D7RA 2YYYA 1IN6A 2DPGA 3AUKA 3CISA 4YAOA 3ZH2A 3NEYA 1RI5A 3B3JA 1NRIA 3JZAA 3V6MA 3KPJA 2YXDA 5DHQA 1MABB 1KDVA 4OFWA 2HLNA 3QWFA 5P8WA 5GZ3A 1ZDMA 2R85A 4Q3AA 5A2QA 4L4ZA 3GJSA 3UHAA 4QYXA 4DR7B 4UE6A 2Z83A 2I8CA 2QLTA 1KS9A 2VG8A 1NBOA 2AJ8A 3LUCA 1WMBA 2X0FA 3Q8XB 3SE7A 2VSNA 4EY7A 4YUXA 2HY7A 6NULA 8ABPA 1GARA 3AR4A 3U7QA 1JE0A 1HZZC 1AKRA 1GZ5A 1HFJA 2C2OA 3QX9A 1YS4A 3QWBA 1GU7A 5BRNA 1MB0A 2ZB3A 5FI1B 1T2UA 2H2FA 4IMJB 4WUVA 5JSHA 5JAUA 2IOFK 1GOTA 2B0JA 2Y92A 3FFAA 3Q7SA 4PY2A 1XZKA 1Y34E 3MNFA 4OF4A 4R9SA 1QK3A 2CXNA 2JLZA 1CQIA 3N7TA 5BWCA 4FBMA 3FPFA 1GQYA 2FPIA 3R9XB 3H5NA 5CFQA 4FBGA 3HG7A 4UVEA 2QTZA 1FQJA 1KIAA 2ZBUA 2JIZA 2X9GA 2AI2A 4FYWA 4OXNA 5FWYB 3U26A 5IWCA 3T9BA 1BX3A 1K2WA 4WJLA 3DWGA 3FZQA 4HGNA 2WYOA 2NO6A 3JATA 4L1KA 4IS2A 4IDGA 4GZ5A 2WM3A 4YGYA 4XWYA 2TSYB 1HDEA 3GJ4A 1UZUA 4WCVA 3BTOA 421PA 2OXTA 4HD8A 5H8WA 3RQSA 3SBDA 1O03A 1Q0HA 3QYPA 3WYCA 5BMVA 1UKAA 3D59A 1MU0A 2FSVA 2YV2A 5DT9A 1E0SA 1LX7A 2NSYA 2PQ2A 3O95A 2BM1A 3TN7A 4BU1A 1QO9A 1USGA 4UW9A 1TT7A 1HXHA 1LQTA 3TD9A 2VJLA 3EGOA 3IXLA 4KBFA 3UMFA 1M66A 4XUDA 1A5TA 1M76A 4AJLA 4C29A 1UH5A 4DLUA 4KR3A 1G2IA 5AQ1A 3GCGA 3D4OA 1IONA 1Y6GA 4JXZA 3GJTA 1O8CA 3IVCA 4NV1A 2AJTA 5F51A 1GYRA 1LDGA 1LI5A 1QCDA 3EVBA 2BP7A 2QQEA 4FFOA 5T3YA 1JF8A 1XP8A 2I6SA 3RVKA 3M4JA 2VH5R 1HEYA 1JR3D 2A30A 2QV0A 2K5UA 3H16A 3RTAA 1KJIA 2J6BA 1A8PA 4KE8A 1T8TA 2QPAA 3WO0A 3B6KA 5KQSA 3WK4A 2HIHA 3W3AA 1QRUA 3Q88A 3CY6A 2WJ4A 3HJUA 4UD2A 4ZT7A 2K4MA 2D5AA 5JLAA 5TQ0A 3VUFA 5JFTA 3OECA 4NAVA 4JMLA 3IDZA 1F5SA 1VLQA 2UZ0A 1G9SA 2A1TR 2P0YA 2PGOA 3Q0TA 2QZZA 3DQQA 1BKYA 3EUEA 4RXMA 1Z06A 2IUTA 4E5UA 4CQMA 3ZWBA 1O3YA 4CZ2A 4IH4A 3FNFA 3T5CA 2HI0A 4FN5A 3Q5DA 5DI9A 3FFBA 2M6SA 1E1NA 4HNSA 2OSBA 3LJKA 2P79A 3NCHA 1AU9A 4BNYA 3Q7RA 2FWIA 3AKDA 4OP3A 2IH5A 2IVZA 4IQ8A 3ZZTA 4FOSA 1J97A 1NLFA 1DKQA 3BDAA 2LNDA 4FCTA 4GYJA 4MW0A 1DRVA 2Q4EA 1IQUA 2R65A 5BP7A 2QRLA 3H2ZA 2COKA 1KHTA 4L51A 2EFHB 2I54A 1PZXA 4RX1A 1LKZA 1YRAA 4MPPA 3EGXA 1SZJG 2EWVA 4A16A 2JA2A 5COQA 4L0CA 4DBLC 1D2EA 4F8JA 5KB3A 3G5MA 5F1OA 3T3NA 4LBYA 4YR9A 3I92A 1UKEA 2WPDD 3ZWAA 4Y67A 3CPJB 4HLCA 4PCUA 5LQKA 2IW3A 1YJBA 2OBXA 3GOQA 3K30A 4NMHA 1CQPA 1Y1PA 3UO8B 5HCIA 5B55A 3RR2A 5AW2A 4JHXA 1P60A 2VPPA 2XCQA 4HDOB 3PUIA 1Z0JA 1Z74A 2ZRKA 2P9FA 2BGLA 5B1HA 1QP4A 3HWRA 4TLBA 2DERA 5B3LA 1VPTA 1GRVA 3E22B 2ILVA 3IEUA 4Y6RA 4XJTA 2M6LA 1XKTA 1WKVA 5I4KA 1X9GA 3KAPA 5IFKA 1SA0B 1SVSA 2WJ3A 2AUMA 3B7GA 5ER6A 5KMGA 1KKUA 2JCGA 1E3EA 4C3VA 4PZUA 3UENA 5F12A 4TWAA 4OKNA 3V4LA 1FNSA 3WFIA 1YZYA 1R37A 1RHMA 1W75A 2PGNA 4HK4A 1A50B 2ZIAA 3O2QB 3MWDA 4DCMA 1W88B 2P6MA 1LTQA 4OQXA 2H4JA 3NHKA 1ATIA 2FPRA 1E2LA 1H8HD 2WP0A 1IBMB 3KS9A 3LZCA 3TTTA 3M6AA 3EVTA 3NS7A 4I9NA 3A10A 2GJSA 2GM5A 4CHTA 4UHKA 4OG2A 2EW8A 1MNQA 4HQLA 4IQGA 4KAFA 4LOAA 4IKEA 4QVGA 3GG2A 3ZZMA 2ZSAA 5JMOA 1PQ4A 2V4MA 3K2EA 1J06A 3RU7A 2A4KA 2GLTA 2PZAA 4B2PA 5DHAA 2E18A 3LSTA 2XWSA 3GFSA 3QNMA 3E5RA 3FMFA 3STVA 3PHHA 4NF2A 3ONNA 4KXNA 1B8UA 1IVNA 1MAWA 3IEIA 2O8FB 3LPCA 2BSQA 3GJ3A 1QQ7A 1RYZA 2J0UA 1H42A 1V39A 2PZEA 3IJEB 3NBKA 5CA1F 2ZK7A 5C1DA 1NT2A 4GKKB 3ZV4A 2C54A 4HEA1 3SKXA 2A14A 1E2JA 1UMCA 3EXG1 2QUZA 1I14A 3O94A 2X7JA 3QPWA 4AFNA 1FDWA 4KZPA 3S4YA 4UMDA 1J42A 1V1RA 1ZLYA 5K0ZA 1JN0A 2ISSD 1BTOA 1VYTA 5K3AA 4BNHA 1N0UA 1PT8A 2PRJA 1T36A 4FFDA 5TY0A 5IRCD 1DSSG 4HWPA 2PZ8A 1WXQA 1RWPA 3RUHA 1WF3A 4KAAA 2OGTA 2ODBA 2BKEA 5B58C 5FJJA 2GT1A 2GLXA 3GEIA 4RA6A 5ADUS 1DX4A 4YP0A 2QOEA 5TPZD 2NZ8A 1EFHA 4BB0A 4JBXA 3KQKA 1GQOA 3IT0A 1UBFA 3AB7A 1QB7A 2D7CA 2WU4A 4GXRA 4OMFG 1KYYA 5GV7A 1PR2A 3SXUA 5IG2A 3ZHXA 1U4NA 4JLKA 2F1OA 4RKFA 1NMYA 1DE0A 4H9GA 3B9QA 3JD0A 1OXVA 2BFEA 1J49A 1TW2A 3RYHB 2ZJ2A 4UEJA 3GAAA 1UBUS 4JJ7A 3GDWA 3FOFC 3E84A 1CF9A 4DM4A 4E88A 4CI9A 1F4PA 4NQZA 4HDKA 3AM5A 4LXXA 4Y2PA 4ZOLA 4DCTA 4XAQA 1DC6A 1DIBA 2HREA 2GM9A 1PEYA 4TKLA 3A0UA 1QB8A 2RHWA 3IA7A 1VJTA 4BO1A 4QU0A 4XTCS 5BSGA 1TCBA 2J7PD 2I2CA 3IAM6 1VIDA 2OAP1 3LXXA 1QDEA 4PRLA 4N0PA 3IELA 3VKWA 4YO8A 5JAMA 3EDMA 5AESA 1E3IA 3PPVA 3T1VA 3IALA 4JDUA 3ODPA 2XRMA 3EW7A 2FOIA 5E2IA 1CZOA 3TNFA 1OX6A 1IVYA 2DQ4A 4M55A 3B6ZA 1U1IA 3TOZA 4JEIA 4J0HA 3ZQJA 4B75A 1DBWA 4JEUA 4ZGBA 1TA9A 1KXJA 1CRZA 2WWIA 4IX1A 2YV5A 5LQCA 1X70A 1NVDA 1WXHA 2HQ1A 3Q11A 2WFZA 3MK31 4YY3B 3SS8A 2OTCA 2GZHA 4K1XA 4OXIA 3R77A 1RRCA 3OA2A 4J76A 5GJBA 3D7MA 3WS7A 1QLWA 3WLRA 4MR9A 4EJ0A 1DCKA 4EW6A 2D0PB 4Z5XA 1PQUA 1I4OA 3PUHA 4MP6A 4QJ4A 3U7IA 5CDHA 2RGGA 2BH2A 1NBMA 2ACVA 3I52A 4ZODA 4AK9A 4QARA 1AXRA 2BHLA 1AN0A 1EJ6A 4M22A 4R8SA 5I47A 5CD1A 1USVA 3KZMA 3JARB 4OH1A 1Q77A 3HBMA 5A6VA 1B42A 1A7UA 1GXSA 4RV9A 4HN9A 3FZNA 1G42A 1TKBA 1RWQA 2QZPA 4INZA 4BN5A 2FZVA 4MUYA 3NEJA 1OJ7A 3OU7A 1XDUA 2AVNA 3LT0A 3O3OB 1X1CA 3NALA 3NC4A 4DRZA 3TMKA 4UEWA 2JGDA 1YHZA 4PIMA 3HXOA 2ZM6B 3DAOA 1EIZA 3K16A 2FQXA 3JQQA 5FX2A 2IH4A 4UUOA 4QHSA 2WAXA 3E7PA 4GU5A 1YS9A 4H60A 4MEBA 3RH0A 3ZI7A 5EE3A 4AF8A 2IX3A 2YWXA 2QTWB 3K9NA 4HNTA 2Y71A 4KR0A 3IEPA 1FQOA 4FNGA 4MCAA 4ZAVA 3AI7A 2OA0A 2YHUA 2GF0A 3FG9A 4YT2A 1XCLA 4UXHA 2XCOA 3I6MA 4H7HA 1PSWA 3EFOA 4HN2A 3E2MA 2UV8A 1T6ZA 2Y1EA 1C3EA 1ZXBA 5EWJA 2ZU6A 3TMAA 1CY7A 5JPCA 2W48A 3BOSA 3D3EA 4LY9A 4UPEA 4EO7A 4F8EA 4ZPXA 4OHVA 5IJAA 4S05A 4LX0A 4LY3A 1HKHA 2FWJA 4KFTA 2OFFA 4CLOB 4ZT2A 1CBUA 5B53A 1XJ5A 1MGOA 3CB4A 4FGUA 2V55B 10MHA 5IFLA 2VHQA 2P1DA 4RIFA 3T7EA 4AG3A 2PUFA 5AUPB 4DE5A 2AYZA 1P5RA 4QDZA 5CJPA 1L8QA 2WTAA 4QVKA 5DBGA 5HMLA 2FRDC 1OV4A 3QU2A 5HF5A 4Z7JA 3Q12A 3TW6A 4C87A 2OMKA 1NXPA 1VJCA 1QPBA 3AYXB 1P6XA 5BRAA 4B8YA 1Z73A 3WLAA 3FPJA 4KNYA 2AG1A 1XELA 2NPIA 4CNQA 1VSUA 3TMYA 3RGWS 2D1QA 1DQNA 4BLUA 3EQ8A 4KUGA 3A1CA 3H9JA 3I2KA 1XWIA 2HA0A 3O0DA 4IF6A 2GASA 3H3XA 3IMKA 4Q3KA 3ENNA 1IN1A 3AINA 2XT9A 1RZRA 2I2WA 1R6UA 3IQZA 2PS3A 4ZYZA 3CKLA 1DADA 4OL0A 4YP5A 5CBPB 4JI7B 4P7KA 3WQSB 3KEMA 4DS3A 2F62A 2ZWVA 5ESXA 1MV5A 3IODA 2MYNA 3WGNA 2GZDA 3CEHA 2WWTA 2VWGA 4G1BA 3OLVA 3UYKA 4QSHA 2Y77A 4EB6A 1KFJB 3ST7A 5BMVF 5MGNA 3IKMB 4ZVTA 2PX6A 2QUAA 2DQSA 3HCRA 2IEIA 4Z4IA 1CFJA 1Q15A 3K0EA 1GR1A 3GFPA 4KXFB 4V03A 2Q2OA 2ZPTX 5EI5A 1NLMA 3FPCA 4YRIA 1T4GA 2C97A 1TM4E 1Z5NA 2XQVA 1L5OA 3SN6A 4ZT3A 2HA7A 3CNBA 4Y6QA 5YASA 2CMDA 4KQMA 4NCKA 2X0DA 4W63A 1T9BA 2FCAA 4RF3A 3DH0A 1X15A 4OV6B 2I7DA 3DZGA 3VO9A 3EC2A 3RU9A 3IP8A 2BI4A 2Q0SA 3BEDA 4G0PA 2BM8A 2FUEA 3NYIA 4KSBA 2IYYA 2PSHA 4NVRA 1FUEA 3SQXA 5KKCA 2CL7X 4FYHA 1LS6A 3LD9A 4JGBA 1RM5A 4OIFA 1BMFA 2VP4A 1LH0A 5BR4A 4JJKA 3TB6A 1CUZA 2ZPAA 5CLQA 3P9SA 4MIOA 5A0FA 1EDBA 1SPBS 3DWEX 4OOEA 4YP9A 4IIVA 1WCIB 4Z3DA 2IZOA 3NHJA 3AR3A 4LRWA 3USES 3U4MA 2CVQA 3PDHA 4JQCA 4KH1A 1K0UA 2AL7A 3QBJA 3NXSA 4ZDKA 4MUMA 3TLGA 1GAWA 3GPCA 2J8ZA 3KD3A 2PCJA 4Q7KA 3NKLA 2V7QA 3BG5A 2PZJA 2X14A 3UK0A 1J0DA 1EINA 2D0IA 1I13A 4GAEA 2V65A 4QG7A 4ZIRA 1K89A 2JGRA 3RS4A 5KX5A 3O8OA 3JQFA 4F3KA 1QGOA 3L7KA 5TMDA 1WDKA 2O8NA 3L0SA 3NR2A 2XB8A 3UAWA 1GL9B 1OLSB 1R7RA 4K9MA 4PSKA 3PS9A 3S2SA 3Q15C 2AI3A 4RU1A 4PG6A 2XOEA 1JFVA 1K3UB 1ZW6A 2OZLA 1FZQA 3NHWA 1L4UA 1YA8A 3M6MD 4IJQA 4B4KA 3MA0A 4EI8A 1X7ZB 2XYRA 1V9CA 4FKZA 2V1XA 4RDHA 4OP2A 1FP6A 5ECYA 2I4MA 3G13A 3LH5A 3O6VA 4FTWA 1CNEA 1VJ5A 5GONB 3UJHA 1KH1A 2V97A 4JXJA 1A4UA 5G1PA 2BMFA 1TE2A 3DE2X 4G67A 4V2IA 4YRQA 5ITVA 5BWLA 3R3ZA 2YJ6A 2VDRB 5HDQA 3KELA 4O4LB 4MVJE 1AQ6A 1B8NA 1YRBA 5L7YA 2WUGA 1DAMA 4HZUB 2JFUA 4ZVUA 2OCAA 4JI2B 3AQ4A 1U8AA 3KFXA 1JHQA 2CFRA 3HB0A 1YR2A 3FB1A 1KC3A 3KFLA 2Q0HA 3QY9A 4O4JB 1ZNZA 5AKXA 1KSHA 5KJ6A 3B52X 3KQVA 2C1XA 4RZSA 1V1MB 2QNRA 2JAPA 2YL2A 4YMSA 5EJ8A 1PTJA 1TYCA 2CE7A 1SZPA 4J0DA 2JDID 2WFLB 1E2IA 2XMRA 1MC5A 2ZAMA 4OSOA 4TL8A 2HWKA 5G41A 1E69A 3SHVA 5KVCA 2BLLA 4XD2A 4H31A 3T1QA 1FLAA 5C18A 4HF7A 3BXXA 3OPNA 3IPYA 3PUJA 2FLWA 2Z1NA 1TIPA 4KQ1A 1ESEA 4BFZA 2QRUA 3GJYA 3G2JA 3V7WA 4LYYA 3L9WA 3EIEA 5A5EA 4CTOA 4MV0A 3OCJA 1JBKA 4OKIA 1LWNA 3E53A 1NVUQ 3F5SA 2F9MA 2W6CX 2A0FA 3PSHA 4XEHA 3TECE 2PV0A 1XQYA 3OIUA 2EWMA 2RBEA 4XLLA 3MAJA 4UTZA 2BFDA 5A6SB 2QVBA 1KPIA 1KAMA 2XMPA 4UDYX 4D45A 4EP1A 1DS6A 3ESXA 4S04A 3U13A 1W8IA 1KEUA 3BVPA 2PPVA 1KK3A 3V4RA 2PN1A 2DTDA 2QX8A 2ZBPA 4L85A 4REQB 3VOTA 1WUHS 4BEVA 4MPRA 4F6RB 1RPNA 1VG9B 2EKLA 4LDAA 1I4EB 2ODNA 4MCJA 2NSJA 4PLFA 4QOIA 1AF4A 5TB5A 3WB1A 5A62A 4RULA 4N8DA 3E9EA 4BJ1A 4D8XA 5JJCA 1C0EA 1SC3A 1W94A 2CLLB 3C14C 3JZIA 4A4DA 3VHXA 4PHFA 5ICEA 4MUIA 2DWPA 1Q19A 4NFYA 1I2CA 2CCGA 1GDDA 2OUKA 3N9IA 4FHFA 3TBKA 2HDHA 4B2LA 2P62A 4WK4B 3DEFA 4AJOA 2HNKA 2QTVB 1K2VN 4IFIA 4P2GA 4PPQA 2Z2XA 4NHOA 4ER0A 3RJ5A 1BNCA 4M7RA 1ZHHA 3ADOA 1JI0A 3QEOA 2FLVA 1HE2A 1JMKC 2PMKA 3CTMA 3NVAA 5CVUA 3WHPA 3CNNA 3ZWDA 4EPTA 2BEWA 4G8BA 1HT3A 4LSGA 3TLCA 5ALFA 2PK3A 1NKSA 1GNLA 3OM8A 4II2A 4NOJA 3W8NA 2Y3IA 3TQFA 5I7OA 4LJAA 2VSFA 4NZ9A 4XQEA 5FI0B 4BQEA 1V7ZA 2QP9X 2VAXA 2EQBA 2IU0A 1KC1A 4P6VF 2JFGA 4U2DA 3K6RA 2PAFA 3CM0A 1H05A 3P9YA 3B1KA 3W04A 2WI8A 2BELA 4YCJA 3P9XA 3VHQA 4GBED 3ZTYA 1HEUA 2ZRGA 2GJ9A 3WWZA 3P9QA 2W4IA 3SXJA 4C0JA 5BN1A 5C7OO 1ONSA 2DBRA 3K1AA 3KUKA 1IJFA 3JD4A 3BICA 3ANYB 4DQ0A 1BDMA 1HK7A 2NYRA 5HR5A 1Z6AA 2DYKA 1XC7A 4JWKA 3HFSA 4PC2A 3I2JA 4ZOLF 2NQ8A 5DTIA 4JYAB 2J5KA 1Y9JA 3WLSA 2R7NA 5EJ5A 2Z4SA 4R1UA 5DHRA 1QGZA 4MS3B 3RVBA 3OKPA 4UU1A 5KHLB 4EA8A 3M8KA 4KE6A 5DM4A 5JD5A 2JFBA 2K2QB 3N7UA 4KN8A 2J5QA 3GK3A 4IJVA 3SOPA 4KREA 5BYJA 2NU6B 5A0TA 3AF2A 2A9PA 2G5GX 1ILEA 3ROKA 5TC4A 1N9KA 2XQGA 2PJZA 1AUPA 3QUAA 2BKAA 1ULAA 2P8SA 1N7IA 2G1JA 3ZU6A 4HNAA 3A1FA 3SPXA 4M98A 4OK3A 1CZRA 1KYVA 4JQYA 2Q6TA 3NORA 4LJ8A 4J0JA 2XCTB 1JGTA 5H3LA 3AHCA 2QLMA 5LQSA 4NXMB 4Z99A 4S1OA 4F92B 2I6TA 4WNAB 1FSGA 1NM5A 2IHVA 4LTMA 3BAFA 1IY2A 3BRWD 4YPOA 1VE3A 1SXQA 1KO5A 2O23A 2DRIA 2O7RA 2WOOA 2UVPA 2XX3A 3GUUA 1VGQA 2RG1A 4G9EA 1V16A 4UAVA 5CGZA 2C4HA 4XWWA 5DKFA 2XGJA 3TVDA 2ENWA 3WLNA 2BKVA 3CNQS 1U8YA 2Q1UA 3KRTA 2FPXA 2PVSA 1G38A 2H4ZA 3S2YA 3KR0A 4JYBA 2LPMA 2R8EA 3FMPB 4C3ZA 3T9AA 3ILHA 3WL8A 1GU0A 1DBRA 4MWBA 1NVWQ 1TVCA 3I1YA 4ALMA 3RC1A 1FS4A 2JI4A 1RLMA 1RZVA 3MBIA 4Z0NA 4N03A 3U16A 1GAJA 3PNMA 4YXWD 1JEEA 4ZP1A 1E6UA 1UP6A 1G8FA 4G4IA 2AFIE 2AZMA 1JXAA 4G1FA 4N6OA 2ZB7A 5ALHA 4TYNA 3GMSA 2WUFA 3CG0A 4RPKA 5JE8A 4M9XA 3C4VA 2VXYA 1NLYA 3JR7A 1GILA 2F43A 1K7YA 2XWQA 3PTLA 1FNDA 2BR4A 2OCKA 1DQYA 1R0WA 4GI2A 4BX9A 1ULUA 2EJTA 4DXAA 2FR8A 4WFJA 3T38A 2ZRBA 4XM1A 3OEED 1PCXA 2FXVA 4I46A 2B1GA 1NL3A 1N0WA 4LRTB 4MWZA 3RDPA 4CG0A 4BFUA 5KEIA 5LM3A 4EPRA 2XMQA 1SR8A 4EA9A 4HVLA 1M8PA 2JBWA 3JQ9A 4WWHA 4EY5A 1NATA 1W2GA 3HKCB 3D0QA 3MINA 3VZBA 3J81A 4QYTA 4Y3UA 4NDAA 1CE8B 4XEUA 2WV7A 1GA4A 4PLYA 4LGYA 3JASA 1ZMBA 4YMIA 2ZJ7A 3PXEA 3PC7A 3ROZA 3PYMA 2R1VA 5M7EA 2QN1A 4AKSA 1RKBA 4WSOA 2GB4A 3EY9A 4DXDA 2WZBA 3L7OA 2O5EA 5JJKA 2GPBA 4D26A 3LK7A 2WZCA 4IGFA 3QKUA 4J1TC 5DSTA 2UZ1A 4IOKA 3EH2A 2HPHA 2W11A 3EEOA 4AD8A 3ZHTA 4LF8B 3GRVA 3IB6A 1ZPDA 3TXAA 3KT6A 2HM7A 1QLJA 1I9GA 4HH1A 1VHJA 3T0GA 2VJPA 2WJPA 3PFNA 3PGKA 2E1RA 2HQRA 4P5PA 2C5AA 3C4QA 1NE7A 5JVDB 4PONA 3PPXA 2IGTA 4CMCA 2QTNA 1G16A 3CCFA 2O3SA 4WXHA 3H6KA 2E9SA 4WEOA 2H9AA 4BNGA 3E3AA 3I61A 2GRAA 2XNSA 2VTVA 5EKDA 5G0WA 4FQ8A 5LDDC 2Q41A 4I0WB 3O8QA 1XCBA 3IOMA 3UMRA 1BVRA 1C1XB 1H2ZA 1MFPA 2HMAA 2B5WA 4P80A 2FX2A 5DIFA 3H3JA 4QASA 3AEUA 1XAJA 2HLDA 2R6R1 4CLRB 5JXGA 5JZMA 3LPMA 4L73A 2MCFA 3MWKA 1ZGCA 4RQUA 3I4LA 4TLMB 4EI2A 4N5NA 3NT4A 3A0RB 3SDZA 3QUCA 2GX6A 4HMQA 4XARA 2G5CA 3I39X 1QC5A 1J56A 1KPGA 4GI5A 1R4ZA 1UFRA 3P9RA 2HQSA 3UUGA 3AG5A 4F85A 3NX4A 4IUDS 4YJ2A 3VR2D 5FT9A 4CTJA 4HUQA 1O6CA 2IDZA 1E6EA 5FOQA 2V4ZA 1Q84A 1EM8B 2AXPA 5FL7A 3I1FA 2RE8A 4M99A 3GEBA 4GYWA 1M75A 5B7PA 3HPRA 1ZK3A 2YQZA 3WI7A 4DR1B 3ESAA 3CB2A 4TMYA 5FADA 3HB1A 3P96A 4FJ1A 4GLFA 2PUHA 3DOCA 3GQBB 5LKRA 4N0MA 4YMUA 3B3AA 2VQFB 2G67A 3IDFA 1Y9EA 3H11B 4L28A 2ZQYA 3MWGA 3MCZA 4FX2A 5DBIA 4K87A 2V03A 2YKGA 2YMPA 4HVCA 3WP0A 2J4FA 3GEPA 2NVWA 2YICA 3EF1A 1I36A 3IT2A 3I04M 4RLQA 4CQLB 1D4AA 3CO0S 4EBBA 2PUEA 3AMVA 2B8JA 1D1TA 1JQAA 2AQ8A 3PICA 5HIMA 1XMPA 2XCRB 3OP1A 1GTG1 2VK4A 1XTSA 3I34X 4MKIA 1DJNA 1MC1A 2C2MA 1JIQA 3I83A 4F11A 2JEOA 5DBOA 5U4XA 5KX5F 3NWOA 4HNHA 4OB8A 2YH2A 4FB4A 3I53A 2Q45A 3BMOB 4C0QC 2R48A 4E12A 2HUPA 1Y5LA 4S2EA 3O2SB 5ALRA 3UTCA 3O75A 1EVLA 3ANXA 2YTZA 3I8XA 4R40A 3SY8A 4XOUA 2XVAA 1VKOA 2V4UA 3SIPA 1KYTA 4DDKA 2JLWA 1FXSA 1V6SA 2C4MA 3QHAA 1QNFA 1JG4A 2NT4A 1JPJA 1KJNA 4AZ3B 4HYQA 4DC1A 4KXVA 1IRIA 1IL0A 1IEWA 1O6FA 4MWDA 4C4TA 3PEVA 2AMVA 4Q1DA 3AIKA 2O07A 4U39A 5JH7A 3CLSC 1JEYB 1W96A 4FWIB 1TNDA 1A4XA 2ZJFA 3M6FA 3WRYA 3E03A 4EHBA 5A4FS 2GEJA 3IP1A 4RWEA 4FLMA 3GHHA 2IW1A 4O2RA 4WQMA 3OUZA 1M1UA 5CX1B 2JGIA 4IGEA 4OFXA 4FFLA 1SOAA 3O7MA 2YVKA 4UE2A 3C3XA 4RTSA 4UEQA 1HZZA 1AN9A 3PT5A 4IFBA 4BJ5A 3OSZA 3LYLA 4UNNA 5I7RA 2HSEA 2WTUA 5AVRA 3FHTA 1DKNA 1ISRA 2FDRA 5F9HA 1H23A 1RYBA 3O74A 1Y42X 1RYNA 1A9YA 4PAOA 3QUBA 3UC5A 1RHQA 4KTVE 3DVQX 4A2QA 3B82A 4DREA 5IBRA 3VVCA 1SCBA 1UODA 2JCXA 1A7AA 5C7IO 4R2XA 3S6JA 4Q1VA 3RC3A 3KQUA 4QA9A 3MT8A 4POOA 2Q21A 2ON6A 5ELMA 3R9WA 1QM5A 4RS3A 1V6CA 3DBVO 4HB4A 5DWQA 2DLDA 1EFPA 2DPYA 1CY8A 2MSKA 2NZUG 3IIIA 1RMYA 1KPHA 2BE7A 4WKBA 1MFZA 3ZXXA 1OH7A 1H0SA 3A2MA 5CCEA 1YDGA 2Q5EA 3MUFA 4R7GA 4XR4A 1J2YA 1N7JA 2IP2A 3KZKA 3N8DA 4UZFA 2E4XA 5D6NA 4NK4A 3WIEA 3M5CA 3ZOKA 2RC5A 2FAXA 2HCFA 1ODJA 3MGBA 5KZMB 4TMWA 1UZMA 1HSZA 2YVUA 3DR3A 2BE9A 1U6JA 4BIIA 3R8FA 2B4QA 4DRXA 4G0YA 1QHIA 1WB4A 3F8SA 3T3DA 3U31A 3WLFA 4JUFA 2JGAA 4UM7A 5LWHA 4JD5A 4RTNA 4KGDA 3R24A 4WZ6A 4MS1B 3RKSA 2JKZA 4HDNB 4R8KA 3ZWCA 4CCYA 1VL5A 5B57C 3QV1A 1H2FA 1F7VA 3IIJA 3ICVA 2IPOA 2VCHA 1I3KA 1PT9A 3IMCA 4TM8A 3SDSA 3H1PA 3OOEA 3P0EA 4IO1A 4D9MA 2A9JA 3A7EA 5HZGA 5KSZA 2Z2JA 4YCLA 3FTQA 2ZG6A 3HDQA 1VE7A 5EINA 2AB0A 5H9WA 3VH2A 3AEKA 3FYCA 2QL5A 4IFEA 2HMVA 2Z8ZA 1K3FA 4O63O 4RIIA 2A0XA 3DOHA 4YJ3F 2CUTA 5BSRA 2A9FA 2WG1A 4Y98A 1XSEA 2Z6UA 1HTWA 1USUA 5JYDA 2NSHA 3OPQA 1JLHA 3FDXA 1P39A 3ZLTA 3IHKA 1PSZA 1CR6A 2X3FA 5FD8A 1EX1A 2W93A 3SLGA 1OFUA 5D3KA 2Q5IA 1SD5A 4P98A 1W30A 1KI1A 3P1JA 2BCEA 3KM0A 4WBNB 4DSZA 4G9BA 1L5VA 4RTRA 2QTGA 1MJ5A 1KJZA 3DV9A 4ND7A 1XR3A 3UCXA 3WXBA 4P58A 5ITWA 1BXGB 3RGGA 4JJIA 2AS0A 2JIMA 2BR3A 4KVFA 1YVUA 3DMTC 1X1RA 2XT0A 3DOUA 4FM9A 1CR2A 2RHOA 1DWUA 3TG2A 1KOJA 1WP9A 1MPXA 1N2EA 1OZFA 1T5SA 3QG1A 4R31A 3KKOA 4ND5A 3RC7A 5DCUA 5T4HA 2WKQA 3HEBA 1R6XA 2ZXUA 4X60A 2QUKA 2JJMA 3S7TA 1CUWA 3HI4A 4RZHA 2BV3A 4MVCA 1DX9A 4XGIA 1VBKA 5HQ3B 5CNKA 3PWSA 5SV2A 3VSAA 3AOGA 3RC8A 3UJDA 3HZHA 5B7GA 3TW8B 4FMDB 1S8AA 3EPRA 2ADMA 1D1SA 1XXHB 2Y2UA 2WWVD 4DIMA 1QVWA 4YJKA 1CETA 3DZFA 4AWBA 4BX3A 2CLMB 3EODA 5JZOA 1KEWA 1SVLA 1N2XA 2AGVA 2GLUA 2P30A 5EQFA 4L72A 3IIKA 1V25A 1S9DA 3AGPA 2VDQB 2Z9BA 3CH6A 2ZCVA 2ODQA 5DU2A 1SNYA 3W4JA 4GC5A 4MVJA 5AUOB 2AXNA 4QYIA 1SIBE 1SWVA 1GQRA 1OHHD 4CLDA 4JELA 2F1KA 2XCSB 5THXA 1RC1A 2FPPB 2QE7A 3IBYA 4PBSA 5EZSA 1N1DA 3AVOA 5LYJA 5TMBA 2QDXA 4BNTA 4BZZA 3RFFA 4E33A 2ZUDA 2QRPA 3C45A 3WSTA 3AF4A 4XWTA 3L6BA 4LY0A 3PJRA 3T3EA 2FQWA 4DLXA 1UMBB 3FSRA 1GGFA 1CJCA 3ER6A 1GPH1 3MMNA 3Q3VA 5C5DA 2IYNA 4EB8A 1L7MA 1D7OA 4W4TA 1RIIA 2ZE5A 3IXMA 4HAUA 1T6BY 4LE2A 1YA6A 2Q8NA 2G3YA 4Q1BA 4CV1A 4JN6B 1NA5A 2DUWA 2ID7A 3FMVA 3K6KA 3KC2A 1MTZA 2I03A 4PAMA 4V38A 2W2NA 3IPLA 3ZWNA 1F3OA 2C5EA 1UKYA 4OJKA 5DI3B 1QFXA 4F2DA 1W85A 3V8VA 1YOBA 1YTLA 2PEZA 1PZGA 2PAAA 3K09C 3W79A 5IVKA 2G1PA 3RK4A 4NCNA 4ZN6A 3EPKA 1N0HA 4F7WA 3O4FA 4ZVSA 4N5HX 1FY2A 2ATVA 1K68A 3A4YA 3ONWA 1WZUA 2K7ZA 4ZEXA 3ZV7A 1ZAKA 2F67A 1I7DA 1JIXA 4ZVQA 4DM7A 1CIJA 5FBQB 1Q1QA 5K4AA 3HJGA 1N1MA 3PR1A 3WWEA 2QB5A 2DH6A 2N3ZA 1M2EA 1F8FA 5EVJA 4F3TA 2OLKA 1U81A 4PRZA 1T8RA 1WXWA 1JZSA 1NMQA 1JFSA 1J00A 4Y2JA 4Q02A 5FEUA 5I4CA 1ULZA 4FSXA 1N9GB 3VU9B 3EXHB 1TEVA 1FX0A 4TRRA 4A10A 1UZLA 1DAHA 3H3FA 5EIXA 2AFHA 3FCAA 2X6RA 2Q3BA 4A2PA 3N70A 5SYMA 1XD9A 2QMYA 5K4GA 2O1EA 2PV7A 2XDQA 2BGGA 6CHYA 2QSYA 3JTEA 5C7LO 2YHIA 3CR3C 3TQQA 1ISGA 4BMNA 5T7BA 1KVRA 1T5BA 3OEWA 1E3MA 2JLVA 1CUUA 1DV2A 2DHDA 3BHIA 4PLHA 4B3BA 1MJGM 1UBNA 1UEIA 4B73A 3PTAA 3OZRA 5CFPA 3BHMA 1D04A 1A69A 2NVUA 1RE1A 5DV9A 3CZ9A 2Q0QA 2JGLA 4H7JA 1O0SA 2ATEA 1M5TA 1BOFA 4Q9AA 2YV4A 4C20A 1AUOA 3HACA 3K1JA 4J16A 1JHDA 4Y2QA 4I8XA 4CIXA 1XD2B 3DKIA 2FE1A 3GUCA 4ZYTA 4CKXA 4WZAB 1UCFA 4UVIA 3VZPA 4YRNA 3OFNA 1JLKA 1FDUA 3LQKA 4WA8A 1U7PA 4FZJA 3KYDA 1WR8A 1WHTA 3CLUC 1KJYA 3IXQA 2MTBA 5J4VA 5HIIA 4JROA 3EWSA 2VI5A 3G89A 4MWGA 5DN6A 4YJ2F 1HORA 1Q1NA 3Q6IA 4NJMA 3R7SA 4RPJA 3TK1A 1E7QA 1NIPA 1E1CB 1SBIA 1WZNA 1ZC3A 3BXOA 1JX6A 1PD0A 4QD3A 5CT6A 2DFDA 2Q2NA 4XVHA 4BLSA 4QM7A 2PLWA 2G5PA 4NZZA 3NKFA 4WINA 1RYHA 2ZOSA 4ARCA 2P4SA 3B3GA 2JLQA 4PG5A 3HB5X 3Q9UA 3QM1A 3PXXA 4PTYA 5DYYA 2ZKIA 4OJMX 4FEEA 2I6QA 1QHGA 4FP9A 1QYXA 1UJ6A 1VL2A 3EAGA 1T4BA 3N86A 3MSCA 4OGGA 4DCUA 1YQEA 1V5IA 4X3OA 5CMLA 1Y9DA 1ZM7A 2JIQA 2PR2A 5K6TA 5C3MA 3GF4A 3ZX5A 5FORA 4X45A 1Y98A 3C43A 5E9JA 2Q99A 2R2AA 2H2GA 3RROA 4X62B 1NMEA 1XROA 4DWOA 4BBAA 2XUFA 4N5MA 2J1LA 2YJTD 2YV3A 3PD7A 1V5WA 5K0TA 2FN7A 4MUAA 5A05A 5JJLA 1TUIA 2FF5A 2C1ZA 1I6WA 5C35A 5IMSA 3ZDCA 1MB9A 3P9ZA 1DIRA 3QEMA 2JH8A 4IWNA 2AZXA 1ZSVA 2B92A 2PL3A 3RU3A 1RPJA 3V4OA 1H2XA 4DPLA 3CF4G 2QT0A 4K6FA 1JPUA 1NURA 1O77A 2MSCB 2Q8PA 1H3FA 1Z15A 3GEMA 1EI9A 3FETA 3L5KA 4MOWA 4IVRA 4NZYA 4QULA 4YASA 1WDWB 5GM2A 5B64A 4N39A 1U8FO 5TXGA 4K0KB 4IUYA 4DMKA 3RKRA 1ULTA 1T9KA 3RS3A 3OZIA 3Q85A 3WKEA 5DN9A 2Y1GA 1F8GA 1VA4A 3LO5A 4JSRA 3ZHZA 1YMVA 5FPHA 1UXJA 3MGCA 621PA 1JLRA 5FLXA 3BD9A 4GIBA 2WYHA 5MGBA 1W44A 4I3FA 3B85A 5JH7F 1E4OA 4X3CA 1E4EA 4QEZA 1ENPA 4KWIA 1GSHA 5K0EA 5JDIC 2PH5A 1WO8A 3DT8A 4KAXA 4W5RA 4LSMA 3F6YA 1BFDA 1EVZA 2X0KA 1L7NA 2VA9A 4BEWA 3BK1A 4NZPA 2ODPA 3I9JA 3HWWA 2PX8A 1GYQA 3PEEA 1O58A 1WUIS 1DBQA 1YWGO 4YJDA 4PAWA 1SCIA 3TLJA 3V1NA 4IMPA 4B4WA 4TV8B 1TKRA 3VVBA 1E92A 2HRRA 1J09A 5HM6A 3G0BA 1NSYA 5C1BA 1VPWA 4G26A 1A5SB 3HYNA 4POAA 5CPFA 5JEDA 4YCSA 1C30B 5FLKA 1CP2A 1HURA 1ZP6A 2O3RA 3HKBA 2G71A 4EDFA 1HQKA 2C2YA 2ZRHA 3FAZA 1AGPA 1QV7A 2CHQA 3DT9A 3LOPA 3F4LA 3LLUA 3MERA 1MCZA 1PDVA 3KKNA 2LIPA 1UJCA 1XQ6A 3M5WA 3AQIA 1PR9A 3G2OA 2EF0A 3TM4A 2R6JA 5KNDD 3CR8A 4LF7B 2PX3A 3D4PA 5K99A 4CCAA 4K2AA 1SBYA 1WEKA 4HGZA 4N9WA 4W8OA 3EF0A 4UTNA 1UBMS 3AH8A 3DDHA 5HE8A 3GGCA 5BMOA 4HO1X 2ZPUA 1GPNA 4GXNA 3WKBA 7REQB 3NLLA 3TCKA 1PVDA 2R7KA 5E4TA 3U7RA 3REGA 3PNQA 1P7YA 1JP7A 3SHTA 1PR1A 1XZCA 3PFFA 1GGKA 1JDZA 1LBIA 3GDOA 4BQIA 2YWJA 3H19A 4JC5A 2BZGA 1D2AA 1F7UA 3GNSA 1W76A 2DTEA 1SKYB 3CZAA 3IIMA 1XJQA 1OTYA 1XVVA 3PNBA 3R7AA 4L27A 5A7FA 1XNQB 2OGUA 3WK8A 2JAXA 4H3SA 2VDLB 1S1CA 5IYZA 4GGPA 2IHBA 3GGOA 3TCXB 5K3SA 2FSHA 3IE2A 4TKUA 4OQZA 1U2RA 5ISMA 4N3GA 2FPGA 2G0NA 3GJZA 4KQFA 2G76A 1JEJA 1N5KA 3EIWA 4MPJA 1TCCA 1W0KA 2O05A 4IG9A 2DP4E 4QDOA 4CG1A 5HZHA 3DVAB 2RGYA 3G2IA 3S8MA 4F96A 3GCZA 3KQSA 4TS1A 3WKCA 3WAGA 3TR6A 3U81A 4JK3A 4DC0A 3WVNA 3QBDA 1P0MA 2OILA 3DXZA 4F3CA 1HLGA 2VZ0A 2GDZA 4KMRA 1RHRA 4MTCA 1W5EA 4UVDA 5D3ZA 5C3UA 5EEGA 3A1UA 4J7XA 3CW9A 3GZNA 3SGLA 3ZQ4A 4MAAA 1K7CA 1W5TA 3COPA 4QNMA 5EJ7A 2ONYA 5B4VA 1YS2X 3V3KA 3STXA 4I8IA 1WB6A 4Q4JA 4M9UA 3PDUA 4YT5A 1ELOA 1TLFA 3G2QA 4ROTA 1U3FA 5JXWA 2EG5A 1FFHA 2IHYA 2CY0A 3IESA 3ZD7A 4DQVA 4HSEA 2R1UA 4ZAXA 3B78A 1AKWA 2PUJA 2QPLA 3DBRA 1HSOA 4ZDWA 4C0BA 4X95A 1I3NA 1B6GA 5H0IA 5CFNA 2QN8A 1BC5A 1KDPA 2E5FA 3DDUA 4HQOA 4CIDA 1K5HA 4J49A 4TWBA 1BA3A 4INPA 3SYTA 1KJQA 4EGAA 3RT9A 1Z36A 1B15A 2VPZA 3JAKB 5EQJB 2LIVA 1N2CB 3WAKA 4F86A 1S2NA 2FUG1 3DPIA 4MB6A 2W6IA 4MA0A 3KBOA 2BFOA 3KBBA 4G63A 5AHWA 3LDGA 5PNTA 5CVJA 4JHLA 2Q28A 4AULA 5C8ZA 2YC4C 1TZJA 3SDBA 4E32A 1WXGA 1N3LA 3LHIA 2KHZA 1AX9A 4K2HA 2C4VA 2F3RA 4JJZA 3OT5A 5ICMA 1ZOPA 4M89A 1GNPA 3QXHA 4R69A 4HQ0A 5JNTA 2OO5C 4GO1A 4RH0A 5BURA 4F9GA 4ZQGA 2P3OA 3U5ZB 2H29A 4BMCA 2X5NA 1PYDA 4PM4A 4KR9A 2ZLBA 1PN3A 5GY7A 3TTXA 2BFFA 5H81A 4Z1MA 4FHDA 4MVJF 1E4YA 4ER6A 4C7OA 4L16A 4AKIA 3T3IA 4Y2GA 3KWMA 1GZSA 2V6JA 5C5IA 1V3TA 1L8XA 4L6CA 3P0HA 4PLZA 3ZU2A 3D2AA 3UUWA 4UBIA 3OU6A 5K6AA 1ZGGA 2YNMA 5LYJF 1HDOA 5IF3A 3LQYA 3PFHA 4FD2A 4GGOA 3LC7O 4YI3A 4YMTA 2P9YA 4FKBA 3E27A 1DG3A 2BJVA 5E3IA 3LFUA 3PQCA 1E7RA 5IUKC 2P9EA 1RXEA 4Q9LA 1KWKA 3DUFA 1Z4OA 3U3OA 3X1MA 4ROSA 4B3CA 3AK4A 1RHJA 1ENOA 4QE3A 5IC6A 4QT0A 2QG4A 1L7AA 3KO8A 1DELA 4LHEA 2VHVA 1NYTA 3AJDA 3FI0A 3ZE0B 1ESMA 1EWRA 3T61A 3VPAA 2WQZA 1OWOA 1J8DA 1RW4A 3H13A 4MW4A 3W5CA 1G60A 3QELB 5CLLA 1P7WA 3TQRA 4Q9NA 3ZDQA 3DT6A 5CA1B 1PYOA 1EB8A 3EEYA 3P27A 1NYRA 2B3DA 4TUYF 1L5NA 4BP3A 1V26A 4CNBA 5JFOA 3E9QA 3M4XA 4AF7A 3IE1A 4KLZA 5TEWA 1O96A 3WLQA 3AKZA 1XNGA 2GYWA 3EZNA 1SC6A 3L0CA 4PLGA 3P71T 1QP8A 2SECE 2Z98A 1A9OA 4QO7A 3UT0A 2XIJA 1J7KA 2IYSA 1JJIA 3DLIA 4MV6A 3IAFA 2AN3A 4TTSA 4MR8B 4CMBA 4M86A 4FYVA 4PO1A 2Q2VA 5HXAA 2AF3C 3LBFA 4RD1A 5JCOA 4JI0B 2C9ZA 3CRNA 3DYIA 4QTTB 1W1WA 4ZZ2A 2GZ1A 2B1JA 1NKVA 2J9YB 1OWNA 4YP7A 1OGJA 3HLKA 4IIBA 1NONA 1YL6A 3OZDA 1XEFA 4JJGA 5EWMA 1M1YB 4CUJA 4DTCA 1ORDA 3NOVA 4L3VA 1FMLA 1FSZA 4YBZA 3HO6A 1VYVA 2EKZA 1E20A 1BQ4A 2WTEA 1QKIA 4BEJA 3HY3A 3W77A 4DKXA 4LW8A 3A28A 4RZ3A 4GMKA 2HSJA 1HDYA 1YGYA 2P2GA 5G4LA 4OX9Y 5ICCA 2C7OA 2R87A 4JR2A 3QYAA 2WMNB 3RTDA 4MWEA 3DMRA 4Z4FA 1VZ2A 1PNTA 3F7MA 4QQNA 3JQBA 3RNOA 5BQFA 3BSYA 3RD5A 5ED0A 1EDOA 2BTQB 3K9CA 4DW8A 2Y67A 4XYGA 3PQEA 3LWBA 5DYWA 3UB4A 1SVNA 1ISPA 4KXUA 1RADA 4BVFA 4Z1OA 4RHEA 1A04A 1R12A 4UREA 3HV0A 3ETNA 1KDYA 1PW7A 1I7QB 4W82A 2WU8A 4RD2A 1RU3A 1ZD3A 4BHTA 1B6RA 2IK8A 3TZQA 4IOMA 2GD2A 1FFBA 1T9HA 3NJ4A 1GKLA 4A8TA 4D4GA 2VXCA 4KXWA 4HAIA 2OG1A 2VJNA 3BRQA 3WGVA 5AIBA 5B12A 4Q34A 2FX3A 5KS2A 4LHWA 1HV8A 1Q44A 3IQXA 4RPIA 4F5YA 2YJ5A 3RF6A 1H2BA 3QU5A 4W5NA 1OMOA 4K28A 4BX8A 3DAFA 3IBCA 4AX4A 1GUYA 2WM9B 1TJNA 3K3PA 3LPDA 5EVCA 3W7BA 3VC2A 1EUDB 1MIOB 4HLUC 5LLDA 3U09A 4LF6B 2NP6A 1M0SA 2AVDA 2Q6LA 3L7LA 3QPDA 3ED1A 3R3SA 4V0LA 5FI3A 3JYLA 2ZBFA 3RFVA 4BN4A 3AZPA 3D8NA 5K7SA 4E08A 3OTGA 3HP7A 3NHYA 4EUKA 4AROA 1C2YA 1CY0A 4MLDA 3AIIA 3M1AA 2DJ5A 1GSIA 1UANA 3FPKA 3GGJA 4CIYA 4NI5A 3LVBA 3CG4A 5M04A 1B0UA 2YRXA 3WIVA 4UVGA 1HYEA 1YULA 1D6MA 3QK7A 1MB2A 2VUUA 4GUDA 1E94E 1E89A 1G21A 3C6QA 1ZJ5A 2NZJA 1G20B 3PR3A 3CW8X 1S02A 4BJHB 2Y68A 5KYXA 2X1HA 1NW6A 4R9VA 1R27A 3KUXA 5CB0A 4ZOCA 3F46A 4E0BA 3PIRA 3GH3A 4AO6A 4AWXA 1R6BX 2VH1A 4UOEA 2Q3LA 4LRSB 4D9GA 1OY1A 4X00A 4IDAA 1QV6A 2P5UA 4XWGA 2B37A 1IY1A 4HWOA 2VCYA 3NATA 5FBHA 2CCJA 2VNHA 4R3NA 3VC7A 4BQPA 1E62A 1FSFA 1GPBA 2XI4A 4FONA 4M6WA 3NXKA 3AHJA 1B6SA 3JQ8A 1NUUA 3CE6A 4MKZA 4RY9A 2B99A 2J9FB 4UXIA 3THYA 3C6BA 2EBHX 3PF8A 3SK0A 5EHZA 3DDSA 1IXYA 2XAAA 5KTNA 1PG5A 1TVKA 5TPWA 1AQLA 4K9OA 5DSXA 4TTIA 5E3JA 3E2PA 4IDCA 1Y8QA 2I2XB 1QPZA 1SN7A 3C7AA 5AJYA 3UJCA 1FK8A 1SKBA 2C9BA 4OHCA 2BHRA 3NC0C 1AA6A 3HU2A 4C2UA 4NU8X 4P4SA 4PC6A 3U7QB 3L7IA 4OJNA 4AN4A 2K87A 3HNPA 2IY8A 1DC7A 1N6IA 1TQ6A 3MTAA 4LE1A 4ZMSA 4EJSB 5LR6A 3BMNA 4HX2A 3MIIA 2GEUA 2BEKA 3QOFA 4NH4A 3FVVA 1XCGB 4CCWA 3KB1A 4BZQA 4LJSA 1JJBA 2I6GA 2JI7A 2O3UA 3A06A 4MV9A 4KV9A 1JQKA 1CQIB 1SB9A 1Z47A 3PWZA 2Y99A 4YLYA 3I5MA 1BW9A 1N2BA 4UDXX 3RB8A 2FPIB 5IAKA 3L7CA 4DADA 1N3BA 1PJ2A 2PFKA 3DXXA 3ZNQA 3BMQA 1UDXA 3DR5A 3OQPA 4RW0A 4TQGA 4F8YA 1T3GA 2HLHA 2R1TA 4UKDA 2YWCA 1LK0A 3DBLB 1X8KA 3SCZA 1HE5A 1E7MA 1CERA 2CXQA 3V32A 3UOGA 3MJ4A 5FFFA 1XA4A 2EGUA 1JG2A 2FHSA 2H0AA 2VYNA 3WLEA 4F1KA 5K05A 1APBA 1C1DA 1BG6A 2HXGA 2IZZA 1OZ0A 1JG6A 4D4KA 3FBWA 1NSTA 1V7QA 2D5IA 3P9IA 1F1BA 4GICA 3CLVA 5JSYA 1RAIA 3GWGA 4RMJA 4O4HB 3AU8A 3AUXA 3GA5A 4EARA 1BA2A 1ILWA 3K7EA 4K6HA 4BWYA 3HJTA 3R7WA 4ZCMA 2ZDHA 5KQMA 2LR0A 4DUZB 1UAGA 3ZJYA 3HC7A 3TJZA 4AZWA 2Z9CA 1E32A 1JA1A 3M9WA 1RC0A 3G2MA 3I9V1 5KOHB 1RLOA 5B1YA 3SIWA 3U49A 3WMWA 1BKSB 3OY7A 4ZQIA 2GJ8A 4TT3A 3EDQA 5JCJA 1KKLA 3GPIA 3KLBA 1U3CA 2H4WA 3NHLA 2W6JA 3ZTWA 1XHLA 5FQOA 5CYFA 1NI4A 4J75A 4MV4A 2EJWA 1CYDA 1XVLA 5EGSA 1NQXA 3CVXA 2IYQA 4FUTA 4YJHA 2ZYAA 2V54A 2VAPA 3QTBA 1RPTA 2PEYA 3OKAA 2ZI3A 3HZOA 4IVNA 4C7BA 2EZ9A 5FOVA 1QTQA 1R0LA 2P65A 4JSYA 5BN3B 1JKIA 3H83A 1Q2UA 2OHJA 1Y0BA 3O9MA 2H2WA 1KZ7B 4P53A 1AE1A 1PR4A 1V5GA 1YUBA 3CLRD 2YZ7A 1BOOA 3G2PA 1SHJA 3KIPA 4ND6A 1YQXA