1R55A

Crystal structure of the catalytic domain of human adam 33
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
203
structure length
203
Chain Sequence
TRKYLELYIVADHTLFLTRHRNLQHTKQRLLEVANYVDQLLRTLDIQVALTGLEVWTERDRSRVTQDANATLWAFLQWRRGLWAQRPHDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMAHEIGHSLGLSHDPDGCCVEAAAESGGCVMAAATGHPFPRVFSACSRRQLRAFFRKGGGACLSNAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADAM 33
publication title Crystal structre of the catalytic domain of human ADAM33
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 203
sequence length 203
ec nomenclature ec 3.4.24.-:
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1r55A00
1R1JA 3EHYA 2DW1A 1C7KA 5L7FA 3OHOA 4I03A 3WV3A 4H49A 4GF1A 1PWPA 4PKWA 1I1IP 3LQ0A 3F1AA 1G12A 2V4BA 4JP4A 3DL1A 1HTDA 1JANA 1GKDA 966CA 3GBOA 3HDAP 3HDBA 3G5CA 1YQYA 5LABA 2Y6DA 1WNIA 1BUVM 1JKYA 3Q2HA 3TSKA 3LE9A 1G9KA 1AYKA 1UTTA 4G9LA 2OVXA 3LJZA 1SATA 1JAQA 3UVCA 1DMTA 4DD8A 1CIZA 2A8HA 1MNCA 3L0TA 1S4BP 4Q1LA 2D1NA 2N8RA 2RJQA 3LQBA 2MZHA 1DTHA 3L0VA 1UMTA 1CGLA 1SU3A 2D1OA 1IADA 1D8FA 2ERQA 2DDYA 1GKCA 3RTSA 3V96B 3O2XA 1PWUA 5CZMA 1QIAA 2XS4A 4H30A 4IUWA 1IAGA 1QJIA 1A86A 3DSLA 5I4OA 4A3WA 4XM7A 1YOUA 2W14A 4PKQA 1JAOA 830CA 2OW1A 1I76A 1PWVA 3EHXA 2OW9A 3EDIA 4XM8A 4GR3A 2JSDA 1IABA 3N2UA 1MMQA 4AUOA 2OVZA 4PKTA 1EUBA 3KEJA 2OW0A 3VI1A 1UEAA 4PKVA 2TCLA 1OO9A 1ATLA 2CKIA 5CXAA 1O0TA 1ZP5A 3K7LA 1IAEA 1XUDA 3HY7A 1R55A 3AIGA 2E3XA 3HY9A 4H76A 3KHIA 5BPAA 4JPAA 1MMPA 4JQGA 2XS3A 3KEKA 4H84A 1BUDA 3LUNA 1ASTA 3DPFA 3K7NA 4QKZA 5BOTA 4A7BA 2WO8A 3U1RA 1CQRA 1B3DA 1GE5A 2MZIA 1QJJA 3AYUA 1HV5A 2AYKA 5BOYA 3LILA 3LJTA 5D1UA 1UMSA 4AYKA 1G05A 2JIHA 1R1HA 3F19A 2JNPA 4L6TA 1D7XA 2FV9A 4IN9A 3LJGA 2OXUA 3LIKA 3RTTA 1JH1A 4HX3A 3DWBA 1D5JA 4DF9A 3TS4A 3TT4A 4FVLA 3F18A 1Y93A 2WOAA 1K7IA 4WKEA 3VTGA 1OS2A 1GE7A 1BKCE 5B5PA 5I43A 1K7GA 2JT5A 1BM6A 1AKLA 1J7NA 2X3AA 1QICA 1A85A 3LMCA 3KWVC 1OS9A 1ZS0A 2X3CA 3LUMA 1KUHA 1FLSA 1PWWA 1IACA 2K9CA 2MLSA 3WV2A 1XURA 1ROSA 3O64A 1D8MA 1GE6A 1RMZA 2HU6A 4J4MA 3LKAA 3LEAA 4WZVA 4H1QA 4GUYA 4I35A 1I73A 2OY2A 3ZVSA 2I47A 3HBVP 1BQQM 3DNGA 3P24A 1CGEA 1SLNA 4CTHA 5D7WA 4FXQA 4WF6A 5I2ZA 2FV5A 2MZEA 3ELMA 1H71P 1KBCA 1ZTQA 2K2GA 1XFXA 1JJ9A 1OM7A 4L63A 4GR8A 3WV1A 2POJA 4GWNA 1YP1A 2YB9A 3OHLA 2MLRA 2KRJA 4JIJA 4PKUA 4XM6A 2ERPA 1K7QA 3KECA 4H3XA 1C8TA 1G4KA 1XFVA 3EDGA 2J83A 5D1SA 5CUHA 1ZVXA 1MMBA 3I7GA 1BSWA 3LK8A 2DW2A 4ZR5A 1CXVA 1XUCA 5H8XA 1JIWP 3KMEA 5I0LA 1BQOA 3MA2A 5D2BA 1IAAA 3F16A 2CLTA 456CA 3B92A 2OW2A 4JA1A 1L6JA 4DPEA 3N2VA 1FBLA 3TVCA 1KUIA 4EFSA 5I3MA 2W15A 2OZRA 2E2DA 2EROA 1XFWA 3DPEA 1XFZA 1ZXVA 5B5OA 2J0TA 4AIGA 2QPJA 1RM8A 1CAQA 1XFUA 1G49A 1BIWA 5JMYA 1HOVA 3LGPA 1R1IA 3EDHA 3Q2GA 3G42A 1BKCA 4H2EA 4AXQA 4L19A 3BA0A 2X7MA 4R3VA 1QUAA 1KUGA 2Y6CA 5D1TA 2O36A 3LIRA 3KRYA 1HY7A 5D3CA 1EB6A 2OXZA 3NX7A 2WO9A 3HB2P 4H82A 1SRPA 1XFYA 4PKRA 2OXWA 4PKSA 1GXDA 2AIGP 1JIZA 1YCMA 1CK7A 2DW0A 1MMRA 4XCTA 3I7IA 4WKIA 4ON1A 2X3BA 1CGFA 2W13A 1ZXCA 3ZXHA 1JK3A 1SLMA 1JAPA 1BKCI 1BZSA 1USNA 2JT6A 1GO8P 3ZUKA 4ILWD 1KUFA 5I12A 1R54A 2YIGA 1Q3AA 1Y0VA 4DV8A 4WK7A 3P1VA 1OM6A 4FXYP 2OY4A 3E8RA 3B8ZA 3KMCA 2O3EA 2OI0A 1B8YA 4FU4A 2USNA 1Z3JA 3CKIA 4GQLA 4G0DA 1SMPA 3F17A 4GR0A 4XBHA 1HFSA 2PJTA 1QIBA 2DDFA 1KUKA 1Y8JA 3F15A 2Z2DA 4GWMA 1UTZA 1O0QA 1ND1A 3AYKA 1KAPP 3HYGA 1GO7P 2L0RA 2SRTA 3EDZA 3EWJA 3SHIA 2W0DA 1FM1A 5L79A 1HFCA 1C3IA 1EAKA 1OMJA 1OM8A 1AF0A 3HBUP 2W12A 3B2ZA 4HMAA 1PWQA 3USNA 2RJPA 4IJOA
chains in the Genus database with same CATH superfamily
1R1JA 3EHYA 2DW1A 1C7KA 5L7FA 3OHOA 4I03A 3WV3A 4H49A 4GF1A 1PWPA 4PKWA 1I1IP 3LQ0A 3F1AA 1G12A 2V4BA 1TVIA 4JP4A 3DL1A 1HTDA 1JANA 1GKDA 966CA 3GBOA 3HDAP 3HDBA 3G5CA 1YQYA 5LABA 2Y6DA 1WNIA 1BUVM 3DTKA 1JKYA 3Q2HA 3TSKA 3LE9A 1G9KA 1AYKA 1UTTA 4G9LA 2OVXA 3LJZA 1SATA 1JAQA 3UVCA 1DMTA 4DD8A 1CIZA 1XM5A 2A8HA 1MNCA 3L0TA 1S4BP 4Q1LA 2D1NA 2N8RA 2RJQA 3LQBA 2MZHA 1DTHA 3L0VA 1UMTA 1CGLA 1SU3A 2D1OA 1OZ9A 1IADA 1D8FA 2ERQA 2DDYA 1GKCA 3RTSA 3V96B 3O2XA 1PWUA 5CZMA 1QIAA 2XS4A 4H30A 4IUWA 1IAGA 1QJIA 1A86A 3DSLA 5I4OA 4A3WA 4XM7A 1YOUA 2W14A 4PKQA 1JAOA 830CA 2OW1A 1I76A 1PWVA 3EHXA 2OW9A 3EDIA 4XM8A 4GR3A 2JSDA 1IABA 3N2UA 1MMQA 4AUOA 2OVZA 4PKTA 1EUBA 3KEJA 2OW0A 3VI1A 1UEAA 4PKVA 2TCLA 1OO9A 1ATLA 2CKIA 5CXAA 1O0TA 1ZP5A 3K7LA 1IAEA 1XUDA 3HY7A 1R55A 3AIGA 2E3XA 3HY9A 4H76A 3KHIA 4L7AA 5BPAA 4JPAA 1MMPA 4JQGA 2XS3A 3KEKA 4H84A 1BUDA 3LUNA 1ASTA 3DPFA 3K7NA 4QKZA 5BOTA 4A7BA 2WO8A 3U1RA 1CQRA 1B3DA 1GE5A 2MZIA 1QJJA 3AYUA 3DTEA 1HV5A 2AYKA 5BOYA 3LILA 3LJTA 5D1UA 1UMSA 4AYKA 1G05A 2JIHA 1R1HA 3F19A 2JNPA 4L6TA 1D7XA 2FV9A 4IN9A 3LJGA 2OXUA 3LIKA 3RTTA 1JH1A 4HX3A 3DWBA 1D5JA 4DF9A 3TS4A 3TT4A 4FVLA 3F18A 1Y93A 2WOAA 1K7IA 4WKEA 3VTGA 1OS2A 1GE7A 1BKCE 5B5PA 5I43A 1K7GA 2JT5A 1BM6A 1AKLA 1J7NA 2X3AA 1QICA 1A85A 3LMCA 3KWVC 1OS9A 1ZS0A 2X3CA 3LUMA 1KUHA 1FLSA 1PWWA 1IACA 2K9CA 2MLSA 3WV2A 1XURA 1ROSA 3O64A 1D8MA 1GE6A 1RMZA 2HU6A 4J4MA 3LKAA 3LEAA 4WZVA 4H1QA 4GUYA 4I35A 1I73A 2OY2A 3ZVSA 2I47A 3HBVP 1BQQM 3DNGA 3P24A 1CGEA 1SLNA 4CTHA 5D7WA 4FXQA 4WF6A 5I2ZA 2FV5A 2MZEA 3ELMA 1H71P 1KBCA 1ZTQA 2K2GA 1XFXA 1JJ9A 1OM7A 4L63A 4GR8A 3WV1A 1XAXA 2POJA 4GWNA 1YP1A 2YB9A 3OHLA 2MLRA 2KRJA 4JIJA 4PKUA 4XM6A 2ERPA 1K7QA 3KECA 4H3XA 1C8TA 1G4KA 2YUFA 1XFVA 3EDGA 2J83A 5D1SA 5CUHA 1ZVXA 1MMBA 3I7GA 1BSWA 3LK8A 2DW2A 4ZR5A 1CXVA 1XUCA 5H8XA 1JIWP 3KMEA 5I0LA 1BQOA 3MA2A 5D2BA 1IAAA 3F16A 2CLTA 456CA 3B92A 2OW2A 4JA1A 1L6JA 4DPEA 3N2VA 1FBLA 3TVCA 1KUIA 4EFSA 5I3MA 2W15A 2OZRA 2E2DA 2EROA 1XFWA 3DPEA 1XFZA 1ZXVA 5B5OA 2J0TA 4AIGA 2QPJA 1RM8A 1CAQA 1XFUA 1G49A 1BIWA 5JMYA 1HOVA 3LGPA 1R1IA 3EDHA 3Q2GA 3G42A 1BKCA 4H2EA 4AXQA 4L19A 3BA0A 2X7MA 4R3VA 1QUAA 1KUGA 2Y6CA 5D1TA 2O36A 3LIRA 3KRYA 1HY7A 5D3CA 1EB6A 2OXZA 3NX7A 2WO9A 3HB2P 4H82A 1SRPA 1XFYA 4PKRA 2OXWA 4PKSA 1GXDA 2AIGP 1JIZA 1YCMA 1CK7A 2DW0A 1MMRA 4XCTA 3I7IA 4WKIA 4ON1A 2X3BA 1CGFA 2W13A 1ZXCA 3ZXHA 1JK3A 1SLMA 1JAPA 1BKCI 1BZSA 1USNA 2JT6A 1GO8P 3ZUKA 4ILWD 1KUFA 5I12A 1R54A 2YIGA 1Q3AA 1Y0VA 4DV8A 4WK7A 3P1VA 1OM6A 4FXYP 2OY4A 3E8RA 3B8ZA 3KMCA 2O3EA 2OI0A 1B8YA 4FU4A 2USNA 1Z3JA 3CKIA 4GQLA 4G0DA 1SMPA 3F17A 4GR0A 4XBHA 1HFSA 2PJTA 1QIBA 2DDFA 1KUKA 1Y8JA 3F15A 2Z2DA 4GWMA 1UTZA 1O0QA 1ND1A 3AYKA 3DTIA 1KAPP 3HYGA 1GO7P 2L0RA 2SRTA 3EDZA 3EWJA 3SHIA 2W0DA 1FM1A 5L79A 1HFCA 1C3IA 1EAKA 1OMJA 1OM8A 1AF0A 3HBUP 2W12A 3B2ZA 4HMAA 1PWQA 3USNA 2RJPA 4IJOA
chains in the Genus database with same CATH topology
1R1JA 3EHYA 2DW1A 1C7KA 5L7FA 3OHOA 4I03A 3WV3A 4H49A 4GF1A 1PWPA 4PKWA 1I1IP 3LQ0A 3F1AA 1G12A 2V4BA 4JP4A 3DL1A 1HTDA 1JANA 1GKDA 966CA 3GBOA 3HDAP 3HDBA 3G5CA 1YQYA 5LABA 2Y6DA 1WNIA 1BUVM 3DTKA 1JKYA 3Q2HA 3TSKA 3LE9A 1G9KA 1AYKA 1UTTA 4G9LA 2OVXA 3LJZA 1SATA 1JAQA 3UVCA 1DMTA 4DD8A 1CIZA 2A8HA 1MNCA 3L0TA 1S4BP 4Q1LA 2D1NA 2N8RA 2RJQA 3LQBA 2MZHA 1DTHA 3L0VA 1UMTA 1CGLA 1SU3A 2D1OA 1IADA 1D8FA 2ERQA 2DDYA 1GKCA 3RTSA 3V96B 3O2XA 1PWUA 5CZMA 1QIAA 2XS4A 4H30A 4IUWA 1IAGA 1QJIA 1A86A 3DSLA 5I4OA 4A3WA 4XM7A 1YOUA 2W14A 4PKQA 1JAOA 830CA 2OW1A 1I76A 1PWVA 3EHXA 2OW9A 3EDIA 4XM8A 4GR3A 2JSDA 1IABA 3N2UA 1MMQA 4AUOA 2OVZA 4PKTA 1EUBA 3KEJA 2OW0A 3VI1A 1UEAA 4PKVA 2TCLA 1OO9A 1ATLA 2CKIA 5CXAA 1O0TA 1ZP5A 3K7LA 1IAEA 1XUDA 3HY7A 1R55A 3AIGA 2E3XA 3HY9A 4H76A 3KHIA 4L7AA 5BPAA 4JPAA 1MMPA 4JQGA 2XS3A 3KEKA 4H84A 1BUDA 3LUNA 1ASTA 3DPFA 3K7NA 4QKZA 5BOTA 4A7BA 2WO8A 3U1RA 1CQRA 1B3DA 1GE5A 2MZIA 1QJJA 3AYUA 3DTEA 1HV5A 2AYKA 5BOYA 3LILA 3LJTA 5D1UA 1UMSA 4AYKA 1G05A 2JIHA 1R1HA 3F19A 2JNPA 4L6TA 1D7XA 2FV9A 4IN9A 3LJGA 2OXUA 3LIKA 3RTTA 1JH1A 4HX3A 3DWBA 1D5JA 4DF9A 3TS4A 3TT4A 4FVLA 3F18A 1Y93A 2WOAA 1K7IA 4WKEA 3VTGA 1OS2A 1GE7A 1BKCE 5B5PA 5I43A 1K7GA 2JT5A 1BM6A 1AKLA 1J7NA 2X3AA 1QICA 1A85A 3LMCA 3KWVC 1OS9A 1ZS0A 2X3CA 3LUMA 1KUHA 1FLSA 1PWWA 1IACA 2K9CA 2MLSA 3WV2A 1XURA 1ROSA 3O64A 1D8MA 1GE6A 1RMZA 2HU6A 4J4MA 3LKAA 3LEAA 4WZVA 4H1QA 4GUYA 4I35A 1I73A 2OY2A 3ZVSA 2I47A 3HBVP 1BQQM 3DNGA 3P24A 1CGEA 1SLNA 4CTHA 5D7WA 4FXQA 4WF6A 5I2ZA 2FV5A 2MZEA 3ELMA 1H71P 1KBCA 1ZTQA 2K2GA 1XFXA 1JJ9A 1OM7A 4L63A 4GR8A 3WV1A 2POJA 4GWNA 1YP1A 2YB9A 3OHLA 2MLRA 2KRJA 4JIJA 4PKUA 4XM6A 2ERPA 1K7QA 3KECA 4H3XA 1C8TA 1G4KA 2YUFA 1XFVA 3EDGA 2J83A 5D1SA 5CUHA 1ZVXA 1MMBA 3I7GA 1BSWA 3LK8A 2DW2A 4ZR5A 1CXVA 1XUCA 5H8XA 1JIWP 3KMEA 5I0LA 1BQOA 3MA2A 5D2BA 1IAAA 3F16A 2CLTA 456CA 3B92A 2OW2A 4JA1A 1L6JA 4DPEA 3N2VA 1FBLA 3TVCA 1KUIA 4EFSA 5I3MA 2W15A 2OZRA 2E2DA 2EROA 1XFWA 3DPEA 1XFZA 1ZXVA 5B5OA 2J0TA 4AIGA 2QPJA 1RM8A 1CAQA 1XFUA 1G49A 1BIWA 5JMYA 1HOVA 3LGPA 1R1IA 3EDHA 3Q2GA 3G42A 1BKCA 4H2EA 4AXQA 4L19A 3BA0A 2X7MA 4R3VA 1QUAA 1KUGA 2Y6CA 5D1TA 2O36A 3LIRA 3KRYA 1HY7A 5D3CA 1EB6A 2OXZA 3NX7A 2WO9A 3HB2P 4H82A 1SRPA 1XFYA 4PKRA 2OXWA 4PKSA 1GXDA 2AIGP 1JIZA 1YCMA 1CK7A 2DW0A 1MMRA 4XCTA 3I7IA 4WKIA 4ON1A 2X3BA 1CGFA 2W13A 1ZXCA 3ZXHA 1JK3A 1SLMA 1JAPA 1BKCI 1BZSA 1USNA 2JT6A 1GO8P 3ZUKA 4ILWD 1KUFA 5I12A 1R54A 2YIGA 1Q3AA 1Y0VA 4DV8A 4WK7A 3P1VA 1OM6A 4FXYP 2OY4A 3E8RA 3B8ZA 3KMCA 2O3EA 2OI0A 1B8YA 4FU4A 2USNA 1Z3JA 3CKIA 4GQLA 4G0DA 1SMPA 3F17A 4GR0A 4XBHA 1HFSA 2PJTA 1QIBA 2DDFA 1KUKA 1Y8JA 3F15A 2Z2DA 4GWMA 1UTZA 1O0QA 1ND1A 3AYKA 3DTIA 1KAPP 3HYGA 1GO7P 2L0RA 2SRTA 3EDZA 3EWJA 3SHIA 2W0DA 1FM1A 5L79A 1HFCA 1C3IA 1EAKA 1OMJA 1OM8A 1AF0A 3HBUP 2W12A 3B2ZA 4HMAA 1PWQA 3USNA 2RJPA 4IJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1J A;  3EHY A;  2DW1 A;  1C7K A;  5L7F A;  3OHO A;  4I03 A;  3WV3 A;  4H49 A;  4GF1 A;  1PWP A;  4PKW A;  1I1I P;  3LQ0 A;  3F1A A;  1G12 A;  2V4B A;  4JP4 A;  3DL1 A;  1HTD A;  1JAN A;  1GKD A;  966C A;  3GBO A;  3HDA P;  3HDB A;  3G5C A;  1YQY A;  5LAB A;  2Y6D A;  1WNI A;  1BUV M;  1JKY A;  3Q2H A;  3TSK A;  3LE9 A;  1G9K A;  1AYK A;  1UTT A;  4G9L A;  2OVX A;  3LJZ A;  1SAT A;  1JAQ A;  3UVC A;  1DMT A;  4DD8 A;  1CIZ A;  2A8H A;  1MNC A;  3L0T A;  1S4B P;  4Q1L A;  2D1N A;  2N8R A;  2RJQ A;  3LQB A;  2MZH A;  1DTH A;  3L0V A;  1UMT A;  1CGL A;  1SU3 A;  2D1O A;  1IAD A;  1D8F A;  2ERQ A;  2DDY A;  1GKC A;  3RTS A;  3V96 B;  3O2X A;  1PWU A;  5CZM A;  1QIA A;  2XS4 A;  4H30 A;  4IUW A;  1IAG A;  1QJI A;  1A86 A;  3DSL A;  5I4O A;  4A3W A;  4XM7 A;  1YOU A;  2W14 A;  4PKQ A;  1JAO A;  830C A;  2OW1 A;  1I76 A;  1PWV A;  3EHX A;  2OW9 A;  3EDI A;  4XM8 A;  4GR3 A;  2JSD A;  1IAB A;  3N2U A;  1MMQ A;  4AUO A;  2OVZ A;  4PKT A;  1EUB A;  3KEJ A;  2OW0 A;  3VI1 A;  1UEA A;  4PKV A;  2TCL A;  1OO9 A;  1ATL A;  2CKI A;  5CXA A;  1O0T A;  1ZP5 A;  3K7L A;  1IAE A;  1XUD A;  3HY7 A;  1R55 A;  3AIG A;  2E3X A;  3HY9 A;  4H76 A;  3KHI A;  5BPA A;  4JPA A;  1MMP A;  4JQG A;  2XS3 A;  3KEK A;  4H84 A;  1BUD A;  3LUN A;  1AST A;  3DPF A;  3K7N A;  4QKZ A;  5BOT A;  4A7B A;  2WO8 A;  3U1R A;  1CQR A;  1B3D A;  1GE5 A;  2MZI A;  1QJJ A;  3AYU A;  1HV5 A;  2AYK A;  5BOY A;  3LIL A;  3LJT A;  5D1U A;  1UMS A;  4AYK A;  1G05 A;  2JIH A;  1R1H A;  3F19 A;  2JNP A;  4L6T A;  1D7X A;  2FV9 A;  4IN9 A;  3LJG A;  2OXU A;  3LIK A;  3RTT A;  1JH1 A;  4HX3 A;  3DWB A;  1D5J A;  4DF9 A;  3TS4 A;  3TT4 A;  4FVL A;  3F18 A;  1Y93 A;  2WOA A;  1K7I A;  4WKE A;  3VTG A;  1OS2 A;  1GE7 A;  1BKC E;  5B5P A;  5I43 A;  1K7G A;  2JT5 A;  1BM6 A;  1AKL A;  1J7N A;  2X3A A;  1QIC A;  1A85 A;  3LMC A;  3KWV C;  1OS9 A;  1ZS0 A;  2X3C A;  3LUM A;  1KUH A;  1FLS A;  1PWW A;  1IAC A;  2K9C A;  2MLS A;  3WV2 A;  1XUR A;  1ROS A;  3O64 A;  1D8M A;  1GE6 A;  1RMZ A;  2HU6 A;  4J4M A;  3LKA A;  3LEA A;  4WZV A;  4H1Q A;  4GUY A;  4I35 A;  1I73 A;  2OY2 A;  3ZVS A;  2I47 A;  3HBV P;  1BQQ M;  3DNG A;  3P24 A;  1CGE A;  1SLN A;  4CTH A;  5D7W A;  4FXQ A;  4WF6 A;  5I2Z A;  2FV5 A;  2MZE A;  3ELM A;  1H71 P;  1KBC A;  1ZTQ A;  2K2G A;  1XFX A;  1JJ9 A;  1OM7 A;  4L63 A;  4GR8 A;  3WV1 A;  2POJ A;  4GWN A;  1YP1 A;  2YB9 A;  3OHL A;  2MLR A;  2KRJ A;  4JIJ A;  4PKU A;  4XM6 A;  2ERP A;  1K7Q A;  3KEC A;  4H3X A;  1C8T A;  1G4K A;  1XFV A;  3EDG A;  2J83 A;  5D1S A;  5CUH A;  1ZVX A;  1MMB A;  3I7G A;  1BSW A;  3LK8 A;  2DW2 A;  4ZR5 A;  1CXV A;  1XUC A;  5H8X A;  1JIW P;  3KME A;  5I0L A;  1BQO A;  3MA2 A;  5D2B A;  1IAA A;  3F16 A;  2CLT A;  456C A;  3B92 A;  2OW2 A;  4JA1 A;  1L6J A;  4DPE A;  3N2V A;  1FBL A;  3TVC A;  1KUI A;  4EFS A;  5I3M A;  2W15 A;  2OZR A;  2E2D A;  2ERO A;  1XFW A;  3DPE A;  1XFZ A;  1ZXV A;  5B5O A;  2J0T A;  4AIG A;  2QPJ A;  1RM8 A;  1CAQ A;  1XFU A;  1G49 A;  1BIW A;  5JMY A;  1HOV A;  3LGP A;  1R1I A;  3EDH A;  3Q2G A;  3G42 A;  1BKC A;  4H2E A;  4AXQ A;  4L19 A;  3BA0 A;  2X7M A;  4R3V A;  1QUA A;  1KUG A;  2Y6C A;  5D1T A;  2O36 A;  3LIR A;  3KRY A;  1HY7 A;  5D3C A;  1EB6 A;  2OXZ A;  3NX7 A;  2WO9 A;  3HB2 P;  4H82 A;  1SRP A;  1XFY A;  4PKR A;  2OXW A;  4PKS A;  1GXD A;  2AIG P;  1JIZ A;  1YCM A;  1CK7 A;  2DW0 A;  1MMR A;  4XCT A;  3I7I A;  4WKI A;  4ON1 A;  2X3B A;  1CGF A;  2W13 A;  1ZXC A;  3ZXH A;  1JK3 A;  1SLM A;  1JAP A;  1BKC I;  1BZS A;  1USN A;  2JT6 A;  1GO8 P;  3ZUK A;  4ILW D;  1KUF A;  5I12 A;  1R54 A;  2YIG A;  1Q3A A;  1Y0V A;  4DV8 A;  4WK7 A;  3P1V A;  1OM6 A;  4FXY P;  2OY4 A;  3E8R A;  3B8Z A;  3KMC A;  2O3E A;  2OI0 A;  1B8Y A;  4FU4 A;  2USN A;  1Z3J A;  3CKI A;  4GQL A;  4G0D A;  1SMP A;  3F17 A;  4GR0 A;  4XBH A;  1HFS A;  2PJT A;  1QIB A;  2DDF A;  1KUK A;  1Y8J A;  3F15 A;  2Z2D A;  4GWM A;  1UTZ A;  1O0Q A;  1ND1 A;  3AYK A;  1KAP P;  3HYG A;  1GO7 P;  2L0R A;  2SRT A;  3EDZ A;  3EWJ A;  3SHI A;  2W0D A;  1FM1 A;  5L79 A;  1HFC A;  1C3I A;  1EAK A;  1OMJ A;  1OM8 A;  1AF0 A;  3HBU P;  2W12 A;  3B2Z A;  4HMA A;  1PWQ A;  3USN A;  2RJP A;  4IJO A; 
#chains in the Genus database with same CATH topology
 1R1J A;  3EHY A;  2DW1 A;  1C7K A;  5L7F A;  3OHO A;  4I03 A;  3WV3 A;  4H49 A;  4GF1 A;  1PWP A;  4PKW A;  1I1I P;  3LQ0 A;  3F1A A;  1G12 A;  2V4B A;  1TVI A;  4JP4 A;  3DL1 A;  1HTD A;  1JAN A;  1GKD A;  966C A;  3GBO A;  3HDA P;  3HDB A;  3G5C A;  1YQY A;  5LAB A;  2Y6D A;  1WNI A;  1BUV M;  3DTK A;  1JKY A;  3Q2H A;  3TSK A;  3LE9 A;  1G9K A;  1AYK A;  1UTT A;  4G9L A;  2OVX A;  3LJZ A;  1SAT A;  1JAQ A;  3UVC A;  1DMT A;  4DD8 A;  1CIZ A;  1XM5 A;  2A8H A;  1MNC A;  3L0T A;  1S4B P;  4Q1L A;  2D1N A;  2N8R A;  2RJQ A;  3LQB A;  2MZH A;  1DTH A;  3L0V A;  1UMT A;  1CGL A;  1SU3 A;  2D1O A;  1OZ9 A;  1IAD A;  1D8F A;  2ERQ A;  2DDY A;  1GKC A;  3RTS A;  3V96 B;  3O2X A;  1PWU A;  5CZM A;  1QIA A;  2XS4 A;  4H30 A;  4IUW A;  1IAG A;  1QJI A;  1A86 A;  3DSL A;  5I4O A;  4A3W A;  4XM7 A;  1YOU A;  2W14 A;  4PKQ A;  1JAO A;  830C A;  2OW1 A;  1I76 A;  1PWV A;  3EHX A;  2OW9 A;  3EDI A;  4XM8 A;  4GR3 A;  2JSD A;  1IAB A;  3N2U A;  1MMQ A;  4AUO A;  2OVZ A;  4PKT A;  1EUB A;  3KEJ A;  2OW0 A;  3VI1 A;  1UEA A;  4PKV A;  2TCL A;  1OO9 A;  1ATL A;  2CKI A;  5CXA A;  1O0T A;  1ZP5 A;  3K7L A;  1IAE A;  1XUD A;  3HY7 A;  1R55 A;  3AIG A;  2E3X A;  3HY9 A;  4H76 A;  3KHI A;  4L7A A;  5BPA A;  4JPA A;  1MMP A;  4JQG A;  2XS3 A;  3KEK A;  4H84 A;  1BUD A;  3LUN A;  1AST A;  3DPF A;  3K7N A;  4QKZ A;  5BOT A;  4A7B A;  2WO8 A;  3U1R A;  1CQR A;  1B3D A;  1GE5 A;  2MZI A;  1QJJ A;  3AYU A;  3DTE A;  1HV5 A;  2AYK A;  5BOY A;  3LIL A;  3LJT A;  5D1U A;  1UMS A;  4AYK A;  1G05 A;  2JIH A;  1R1H A;  3F19 A;  2JNP A;  4L6T A;  1D7X A;  2FV9 A;  4IN9 A;  3LJG A;  2OXU A;  3LIK A;  3RTT A;  1JH1 A;  4HX3 A;  3DWB A;  1D5J A;  4DF9 A;  3TS4 A;  3TT4 A;  4FVL A;  3F18 A;  1Y93 A;  2WOA A;  1K7I A;  4WKE A;  3VTG A;  1OS2 A;  1GE7 A;  1BKC E;  5B5P A;  5I43 A;  1K7G A;  2JT5 A;  1BM6 A;  1AKL A;  1J7N A;  2X3A A;  1QIC A;  1A85 A;  3LMC A;  3KWV C;  1OS9 A;  1ZS0 A;  2X3C A;  3LUM A;  1KUH A;  1FLS A;  1PWW A;  1IAC A;  2K9C A;  2MLS A;  3WV2 A;  1XUR A;  1ROS A;  3O64 A;  1D8M A;  1GE6 A;  1RMZ A;  2HU6 A;  4J4M A;  3LKA A;  3LEA A;  4WZV A;  4H1Q A;  4GUY A;  4I35 A;  1I73 A;  2OY2 A;  3ZVS A;  2I47 A;  3HBV P;  1BQQ M;  3DNG A;  3P24 A;  1CGE A;  1SLN A;  4CTH A;  5D7W A;  4FXQ A;  4WF6 A;  5I2Z A;  2FV5 A;  2MZE A;  3ELM A;  1H71 P;  1KBC A;  1ZTQ A;  2K2G A;  1XFX A;  1JJ9 A;  1OM7 A;  4L63 A;  4GR8 A;  3WV1 A;  1XAX A;  2POJ A;  4GWN A;  1YP1 A;  2YB9 A;  3OHL A;  2MLR A;  2KRJ A;  4JIJ A;  4PKU A;  4XM6 A;  2ERP A;  1K7Q A;  3KEC A;  4H3X A;  1C8T A;  1G4K A;  2YUF A;  1XFV A;  3EDG A;  2J83 A;  5D1S A;  5CUH A;  1ZVX A;  1MMB A;  3I7G A;  1BSW A;  3LK8 A;  2DW2 A;  4ZR5 A;  1CXV A;  1XUC A;  5H8X A;  1JIW P;  3KME A;  5I0L A;  1BQO A;  3MA2 A;  5D2B A;  1IAA A;  3F16 A;  2CLT A;  456C A;  3B92 A;  2OW2 A;  4JA1 A;  1L6J A;  4DPE A;  3N2V A;  1FBL A;  3TVC A;  1KUI A;  4EFS A;  5I3M A;  2W15 A;  2OZR A;  2E2D A;  2ERO A;  1XFW A;  3DPE A;  1XFZ A;  1ZXV A;  5B5O A;  2J0T A;  4AIG A;  2QPJ A;  1RM8 A;  1CAQ A;  1XFU A;  1G49 A;  1BIW A;  5JMY A;  1HOV A;  3LGP A;  1R1I A;  3EDH A;  3Q2G A;  3G42 A;  1BKC A;  4H2E A;  4AXQ A;  4L19 A;  3BA0 A;  2X7M A;  4R3V A;  1QUA A;  1KUG A;  2Y6C A;  5D1T A;  2O36 A;  3LIR A;  3KRY A;  1HY7 A;  5D3C A;  1EB6 A;  2OXZ A;  3NX7 A;  2WO9 A;  3HB2 P;  4H82 A;  1SRP A;  1XFY A;  4PKR A;  2OXW A;  4PKS A;  1GXD A;  2AIG P;  1JIZ A;  1YCM A;  1CK7 A;  2DW0 A;  1MMR A;  4XCT A;  3I7I A;  4WKI A;  4ON1 A;  2X3B A;  1CGF A;  2W13 A;  1ZXC A;  3ZXH A;  1JK3 A;  1SLM A;  1JAP A;  1BKC I;  1BZS A;  1USN A;  2JT6 A;  1GO8 P;  3ZUK A;  4ILW D;  1KUF A;  5I12 A;  1R54 A;  2YIG A;  1Q3A A;  1Y0V A;  4DV8 A;  4WK7 A;  3P1V A;  1OM6 A;  4FXY P;  2OY4 A;  3E8R A;  3B8Z A;  3KMC A;  2O3E A;  2OI0 A;  1B8Y A;  4FU4 A;  2USN A;  1Z3J A;  3CKI A;  4GQL A;  4G0D A;  1SMP A;  3F17 A;  4GR0 A;  4XBH A;  1HFS A;  2PJT A;  1QIB A;  2DDF A;  1KUK A;  1Y8J A;  3F15 A;  2Z2D A;  4GWM A;  1UTZ A;  1O0Q A;  1ND1 A;  3AYK A;  3DTI A;  1KAP P;  3HYG A;  1GO7 P;  2L0R A;  2SRT A;  3EDZ A;  3EWJ A;  3SHI A;  2W0D A;  1FM1 A;  5L79 A;  1HFC A;  1C3I A;  1EAK A;  1OMJ A;  1OM8 A;  1AF0 A;  3HBU P;  2W12 A;  3B2Z A;  4HMA A;  1PWQ A;  3USN A;  2RJP A;  4IJO A; 
#chains in the Genus database with same CATH homology
 1R1J A;  3EHY A;  2DW1 A;  1C7K A;  5L7F A;  3OHO A;  4I03 A;  3WV3 A;  4H49 A;  4GF1 A;  1PWP A;  4PKW A;  1I1I P;  3LQ0 A;  3F1A A;  1G12 A;  2V4B A;  4JP4 A;  3DL1 A;  1HTD A;  1JAN A;  1GKD A;  966C A;  3GBO A;  3HDA P;  3HDB A;  3G5C A;  1YQY A;  5LAB A;  2Y6D A;  1WNI A;  1BUV M;  3DTK A;  1JKY A;  3Q2H A;  3TSK A;  3LE9 A;  1G9K A;  1AYK A;  1UTT A;  4G9L A;  2OVX A;  3LJZ A;  1SAT A;  1JAQ A;  3UVC A;  1DMT A;  4DD8 A;  1CIZ A;  2A8H A;  1MNC A;  3L0T A;  1S4B P;  4Q1L A;  2D1N A;  2N8R A;  2RJQ A;  3LQB A;  2MZH A;  1DTH A;  3L0V A;  1UMT A;  1CGL A;  1SU3 A;  2D1O A;  1IAD A;  1D8F A;  2ERQ A;  2DDY A;  1GKC A;  3RTS A;  3V96 B;  3O2X A;  1PWU A;  5CZM A;  1QIA A;  2XS4 A;  4H30 A;  4IUW A;  1IAG A;  1QJI A;  1A86 A;  3DSL A;  5I4O A;  4A3W A;  4XM7 A;  1YOU A;  2W14 A;  4PKQ A;  1JAO A;  830C A;  2OW1 A;  1I76 A;  1PWV A;  3EHX A;  2OW9 A;  3EDI A;  4XM8 A;  4GR3 A;  2JSD A;  1IAB A;  3N2U A;  1MMQ A;  4AUO A;  2OVZ A;  4PKT A;  1EUB A;  3KEJ A;  2OW0 A;  3VI1 A;  1UEA A;  4PKV A;  2TCL A;  1OO9 A;  1ATL A;  2CKI A;  5CXA A;  1O0T A;  1ZP5 A;  3K7L A;  1IAE A;  1XUD A;  3HY7 A;  1R55 A;  3AIG A;  2E3X A;  3HY9 A;  4H76 A;  3KHI A;  4L7A A;  5BPA A;  4JPA A;  1MMP A;  4JQG A;  2XS3 A;  3KEK A;  4H84 A;  1BUD A;  3LUN A;  1AST A;  3DPF A;  3K7N A;  4QKZ A;  5BOT A;  4A7B A;  2WO8 A;  3U1R A;  1CQR A;  1B3D A;  1GE5 A;  2MZI A;  1QJJ A;  3AYU A;  3DTE A;  1HV5 A;  2AYK A;  5BOY A;  3LIL A;  3LJT A;  5D1U A;  1UMS A;  4AYK A;  1G05 A;  2JIH A;  1R1H A;  3F19 A;  2JNP A;  4L6T A;  1D7X A;  2FV9 A;  4IN9 A;  3LJG A;  2OXU A;  3LIK A;  3RTT A;  1JH1 A;  4HX3 A;  3DWB A;  1D5J A;  4DF9 A;  3TS4 A;  3TT4 A;  4FVL A;  3F18 A;  1Y93 A;  2WOA A;  1K7I A;  4WKE A;  3VTG A;  1OS2 A;  1GE7 A;  1BKC E;  5B5P A;  5I43 A;  1K7G A;  2JT5 A;  1BM6 A;  1AKL A;  1J7N A;  2X3A A;  1QIC A;  1A85 A;  3LMC A;  3KWV C;  1OS9 A;  1ZS0 A;  2X3C A;  3LUM A;  1KUH A;  1FLS A;  1PWW A;  1IAC A;  2K9C A;  2MLS A;  3WV2 A;  1XUR A;  1ROS A;  3O64 A;  1D8M A;  1GE6 A;  1RMZ A;  2HU6 A;  4J4M A;  3LKA A;  3LEA A;  4WZV A;  4H1Q A;  4GUY A;  4I35 A;  1I73 A;  2OY2 A;  3ZVS A;  2I47 A;  3HBV P;  1BQQ M;  3DNG A;  3P24 A;  1CGE A;  1SLN A;  4CTH A;  5D7W A;  4FXQ A;  4WF6 A;  5I2Z A;  2FV5 A;  2MZE A;  3ELM A;  1H71 P;  1KBC A;  1ZTQ A;  2K2G A;  1XFX A;  1JJ9 A;  1OM7 A;  4L63 A;  4GR8 A;  3WV1 A;  2POJ A;  4GWN A;  1YP1 A;  2YB9 A;  3OHL A;  2MLR A;  2KRJ A;  4JIJ A;  4PKU A;  4XM6 A;  2ERP A;  1K7Q A;  3KEC A;  4H3X A;  1C8T A;  1G4K A;  2YUF A;  1XFV A;  3EDG A;  2J83 A;  5D1S A;  5CUH A;  1ZVX A;  1MMB A;  3I7G A;  1BSW A;  3LK8 A;  2DW2 A;  4ZR5 A;  1CXV A;  1XUC A;  5H8X A;  1JIW P;  3KME A;  5I0L A;  1BQO A;  3MA2 A;  5D2B A;  1IAA A;  3F16 A;  2CLT A;  456C A;  3B92 A;  2OW2 A;  4JA1 A;  1L6J A;  4DPE A;  3N2V A;  1FBL A;  3TVC A;  1KUI A;  4EFS A;  5I3M A;  2W15 A;  2OZR A;  2E2D A;  2ERO A;  1XFW A;  3DPE A;  1XFZ A;  1ZXV A;  5B5O A;  2J0T A;  4AIG A;  2QPJ A;  1RM8 A;  1CAQ A;  1XFU A;  1G49 A;  1BIW A;  5JMY A;  1HOV A;  3LGP A;  1R1I A;  3EDH A;  3Q2G A;  3G42 A;  1BKC A;  4H2E A;  4AXQ A;  4L19 A;  3BA0 A;  2X7M A;  4R3V A;  1QUA A;  1KUG A;  2Y6C A;  5D1T A;  2O36 A;  3LIR A;  3KRY A;  1HY7 A;  5D3C A;  1EB6 A;  2OXZ A;  3NX7 A;  2WO9 A;  3HB2 P;  4H82 A;  1SRP A;  1XFY A;  4PKR A;  2OXW A;  4PKS A;  1GXD A;  2AIG P;  1JIZ A;  1YCM A;  1CK7 A;  2DW0 A;  1MMR A;  4XCT A;  3I7I A;  4WKI A;  4ON1 A;  2X3B A;  1CGF A;  2W13 A;  1ZXC A;  3ZXH A;  1JK3 A;  1SLM A;  1JAP A;  1BKC I;  1BZS A;  1USN A;  2JT6 A;  1GO8 P;  3ZUK A;  4ILW D;  1KUF A;  5I12 A;  1R54 A;  2YIG A;  1Q3A A;  1Y0V A;  4DV8 A;  4WK7 A;  3P1V A;  1OM6 A;  4FXY P;  2OY4 A;  3E8R A;  3B8Z A;  3KMC A;  2O3E A;  2OI0 A;  1B8Y A;  4FU4 A;  2USN A;  1Z3J A;  3CKI A;  4GQL A;  4G0D A;  1SMP A;  3F17 A;  4GR0 A;  4XBH A;  1HFS A;  2PJT A;  1QIB A;  2DDF A;  1KUK A;  1Y8J A;  3F15 A;  2Z2D A;  4GWM A;  1UTZ A;  1O0Q A;  1ND1 A;  3AYK A;  3DTI A;  1KAP P;  3HYG A;  1GO7 P;  2L0R A;  2SRT A;  3EDZ A;  3EWJ A;  3SHI A;  2W0D A;  1FM1 A;  5L79 A;  1HFC A;  1C3I A;  1EAK A;  1OMJ A;  1OM8 A;  1AF0 A;  3HBU P;  2W12 A;  3B2Z A;  4HMA A;  1PWQ A;  3USN A;  2RJP A;  4IJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...