1R5AA

Glutathione s-transferase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
b'TTVLYYLPASPPCRSVLLLAKMIGVELDLKVLNIMEGEQLKPDFVELNPQHCIPTMDDHGLVLWESRVILSYLVSAYGKDENLYPKDFRSRAIVDQRLHFDLGTLYQRVVDYYFPTIHLGAHLDQTKKAKLAEALGWFEAMLKQYQWSAANHFTIADIALCVTVSQIEAFQFDLHPYPRVRAWLLKCKDELEGHGYKEINETGAETLAGLFRSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione transferase
publication title Identification, characterization and structure of a new Delta class glutathione transferase isoenzyme.
pubmed doi rcsb
source organism Anopheles cracens
molecule tags Transferase
total genus 75
structure length 214
sequence length 214
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1r5aA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1r5aA01
3TJJA 5D9XA 4MPGA 1B48A 2GTUA 3ZLPA 3TKQA 4EDYA 4PUFC 1G7OA 2KUCA 1U88A 2HI7A 1GUMA 2CVBA 2GS3A 2GZPA 2J23A 4GSSA 4ZB9A 1M0UA 1OC9B 3I6AA 4PURA 2IFQB 3TKPA 1QK8A 5HR3A 4GXZA 1HQOA 5DALB 5DCGA 5FWGA 3QPMA 4BVYB 5JCWA 2AB6A 1SD9A 4Z7XA 3TRXA 3F3RA 1SL1B 4GSNA 4ZL8A 1XW5A 1U3IA 2B7KA 3CXGA 2OE0A 4ZL9A 1X9MB 3WGDA 4NV5A 1PRXA 4L0WA 3GV1A 3L0HA 4GRFA 2R37A 3TJBA 4OFTA 1SL0B 1GWCA 2VLUA 6GSYA 5HR2A 3VK9A 3GH6A 3GKNA 2LKUA 4N30A 1T3BA 3EC3A 2FUG2 2IN3A 1RQMA 1G7EA 1BX9A 1EV4A 3PPUA 4EE0A 1V57A 2WJUA 4Q5QA 1EZKA 3VPQA 3A2VA 2CZ2A 1ERTA 1YEPA 4YH2A 1O8XA 3U5RE 3IXRA 3ZTLA 4WXTA 4POKA 1URMA 4ACSA 5DBQA 3ZL5A 2I3YA 3KMOA 4O32A 1AAZA 5A4VA 4ZXGA 2IMKA 1S3CA 2H73A 1B4PA 2C0DA 3KTLA 2VCWA 4KH7A 2B6MA 16GSA 4IW9A 4AJ6A 5DQSA 4IQAA 1XWGA 2FLSA 2YZUA 2TRXA 2DJ0A 4N0ZA 1BG5A 4X1UA 1AUCA 1ZZYA 4DSSA 4WF4A 1YQ1A 3F63A 4ECBA 1GNEA 3FY7A 4G0IA 2GSQA 5GAPD 4ECJA 3S9FA 4QQ7A 4IN0A 1F37A 4F9ZA 2JACA 3KXOA 7GSSA 3TKRA 5ID2B 2DBCA 2KHPA 3E0UA 5CAXA 1SK0A 4K1FA 5CRGA 1YEXA 2WB9A 3GSTA 2AAWA 5IOXA 2GQMA 3SWLA 3UVHA 2J9HA 2NVLA 2GT6A 4PUAA 4Q5NA 1R4WA 1N2AA 1F3BA 3ME7A 1GSDA 4HJ2A 3GL3A 5ELAA 2HSYA 5D93A 3UL3A 5ABRA 2O8VB 1OC8A 4ZB6A 3GKXA 5BMUA 1TOFA 1EP8A 1B4QA 2H1DA 5G2ZA 4BWQA 1W4VA 4HUAA 4TN8A 3DD3A 4MCUA 2JL4A 3H79A 4G2EA 1MEKA 2G0FA 1K0CA 2FCHA 3M8NA 5IPHA 3UVTA 5HFKA 4PQHA 1FAAA 4G10A 4JR4A 3ZVJD 3TCOA 5J3RA 2QGVA 5ECKB 1GSUA 2ZCTA 5ECSA 3TJGA 1GTBA 1J9BA 3O6TA 1J08A 4MPFA 2JSZA 1LJRA 4OO4A 4KX4A 4TR1A 3CRTA 1EOHA 3FR9A 3UJ1A 6GSXA 1ABAA 3C1SA 3FW2A 4V2LA 2EIOA 4MZCA 1T1VA 5ECRB 2N5FA 3GSSA 3A5WA 2VUPA 1HNCA 1M9BA 2H0GA 1PD21 3DYRA 2OKAA 2YZHA 4IGJA 2WGRA 1GH2A 1GUKA 2P5RA 3O76A 2LQQA 5IM9A 1GLPA 4QL9A 5COHA 3C8EA 2M80A 5DCHA 2B3SA 1TRUA 1WMJA 2GQKA 4YQUA 4CW9A 8GSSA 3HVSA 3FK8A 2CV4A 1IYHA 3VI7A 3UOMA 12GSA 1Z6MA 1Q98A 4TR3A 2ZNMA 2JZTA 3AY8A 2VL9A 3H8QA 2CVDA 2HRKB 2PVOC 3KIJA 2DMLA 3TGZA 2PN8A 4CDOA 5B6NA 3PR8A 1A2MA 4JR6A 5D9WA 2R5GA 3ZMLA 3FZ5A 4LL1B 1A2JA 1I9DA 5IIZA 2GZYA 1THXA 1O81A 2HZFA 1OYJA 4D73B 3C7MA 5JCGA 2V41A 9GSSA 2D2ZA 1THOA 1ST9A 3HY2A 1E6BA 2FGXA 2FWGA 3O3TA 2C4JA 4FIWA 3TRQA 2O85A 3CMIA 4FH8A 4FYUA 1SJ6A 3KH9A 4NAXA 1YKAA 4G9HA 4XS4A 2H66A 1JHBA 1OKDA 4I8BA 4TXOB 2HZEB 2K18A 5JWRB 3F0IA 1FG4A 3QOUA 1RK4A 2QSIA 1SKWB 2IMFA 1CQHA 2OJLA 1TU8A 4ULXA 2CZ3A 1XPVA 1O6JA 2C0GA 3MSZA 3PGTA 5HFGA 1A23A 1GP1A 2YWMA 3EURA 1U6TA 3TJKA 3KCMA 2K8VA 1A24A 3H4KA 4F82A 5AGYA 1YF1A 1SU9A 2V6KA 4AF2A 3ZZXA 1DE2A 1VF1A 2F3MA 4HQSA 1XW6A 4WKWA 4KSMA 3CBUA 4POMA 4I2TA 2HFDA 2EIRA 3E9JB 4XCSA 2MBSA 2A4VA 2MMNA 3IC8A 2H01A 5E59A 2F8FA 4HDEA 3VLNA 3HDCA 3GTUA 6GSVA 4KSOA 1UVZA 1TI1A 1GULA 20GSA 3F3QA 1GLQA 3M9JA 2HXKA 4ZILA 3F4TA 1EEMA 3ZMKA 3QCPA 1X5EA 2AV4A 3WYWA 1B9YC 3MDKA 3GX0A 1GTUA 4MA9A 4O5RA 1R7HA 4MJEA 2ALBA 4DSQA 3G7IA 2B5EA 1F2EA 1JLVA 2KLXA 2X8CA 5C00A 2VCQA 4WR4A 4AGSA 1PX7A 2PU9C 5CYYA 3M3MA 2H30A 1LU4A 1OC9A 3ZITA 3L4NA 1JZOA 5AIXA 3F6FA 3QR6A 1QMVA 2IFQA 3GL5A 5GAND 4DVCA 5DALA 1WPIA 2L6DA 3F4RA 3ZFBA 3IE3A 5KN1A 1O7UA 2KP1A 4BVYA 3KMNA 1ERWA 3Q74A 3OR5A 1BEDA 1OKTA 2OE3A 4ZIJA 2YOIA 1SL2B 1XXUA 1ZOFA 3WGXA 3N5OA 4F0CA 3ERFA 1UA5A 2O87A 2DJ3A 4JRRA 1SKRB 3F9UA 5KN0A 2HSNB 5IMCA 5FHIA 5G5EA 4EUYA 3Q18A 10GSA 2VD0A 2I9HA 1X5DA 2HLSA 6GSSA 2OADA 4MF5A 1M9AA 5D73A 5GSSA 1MDKA 5EY6A 3LJRA 3D4TA 4MDCA 1QUWA 2KOKA 4XS6A 5ECLB 1X0RA 2ES7A 2LUSA 2YJ7A 1OAZA 1TRSA 2H0HA 2TRCP 4YAVA 2EIQA 4IQ1A 2FWEA 4LMWA 1X9SB 4ECCA 3CTFA 5F0GA 3MWHA 3HJMA 5AISA 2B5YA 3G7JA 1FB0A 1XOAA 3FHKA 3IDVA 2QKEA 1ERVA 1YF0A 5H5RA 1HYUA 2H70A 5DJLA 4MJBA 4BPYA 2LJRA 3QAWA 2N5BA 3UAPA 1B9XC 3NZNA 5IO0A 2IMDA 5D96A 4JU5A 3ED3A 3E3EA 2VCVA 4KDXA 2OA7A 3P8WA 4HEA2 4MJAA 4IJIA 3GRXA 4MF7A 2HQTA 3HKRA 4XHMA 5CRHA 3QD9A 4E8EA 2C1YA 1PMTA 1MDIA 3HD5A 1V2AA 4PTSA 2H0IA 4F2IA 3A2WA 1ZYQB 2GLRA 2FA4A 1EWXA 3GUSA 3JCML 4NMUA 3PH9A 17GSA 5ID2A 3UMAA 5ECNB 3KGKA 3KP8A 3ME8A 2C3NA 5ECHB 2DIZA 3V1WA 3KTBA 1M2DA 2A2RA 5D9VA 4XTSA 3DGQA 4IP1A 4K9ZA 2CAQA 5H5QA 4BVXB 2H71A 1TP9A 2P5QA 1K3YA 1PSQA 4V1Ag 5EL8A 1EGRA 3EMXA 2VIMA 1O73A 3DIEA 1X9WB 1VGLA 3MAKA 1K0MA 4G19A 3RPPA 4MK3A 3UBLA 5KN3A 4EF0A 5ECIB 5INYA 2C0EA 2GZZA 5CRDA 1AIUA 2FY6A 2CA8A 3L9VA 2L6CA 4DEJA 4IP6A 1V58A 3GYKA 2PVQA 5DQYA 4AJ7A 4J2FA 2WZ9A 4F03A 4GQFA 4HU9A 4HS1A 2C0FA 1LBKA 4BL7B 2LSTA 3LYKA 2YNXA 2AUVA 1DBYA 1WWJA 2LEGA 1SENA 1K3LA 1Z7RA 2H6YA 3TRPA 4K6XA 3L9SA 3QAVA 3VURA 3D22A 5G30A 22GSA 2C8UA 3CSJA 1PGTA 4GTUA 3IV4A 4POLA 2KP2A 4RQXA 1USBA 1G6WA 1XWBA 1YKCA 4HZ4A 3BBYA 1QQ2A 3W8JA 3HZ8A 2JZRA 3QDNA 1RW1A 4IS0A 3TB2A 2BJXA 2I81A 4PXOA 1T4YA 1R5AA 1K0AA 1K0DA 3ZFLA 1WOUA 2L57A 2YN1A 1GTIA 2BMXA 2YWNA 4JE1A 1U3AA 4ZB8A 4L0UA 2JSYA 2IJYA 2NPBA 2YCDA 3HCZA 4I5QA 2OACA 2WULA 2B1LA 1FVJA 5HR1A 4HQZA 3EU3A 3US3A 1FO5A 2R4VA 2DJ2A 1SYXA 1UN2A 4KCEA 3VI5A 5A4WA 1NSWA 3BD2A 1XWKA 3HXSA 1JLWA 2GSSA 1TI3A 4WBRD 2L5LA 3IRAA 5A4UA 3W6GA 5KN2A 5CRWA 4WF5A 4OCFA 2HRKA 4MMMA 2IPAA 4KUNA 3GKKA 4J57E 1KBNA 3IBHA 4BA7A 1JZWA 4QL7A 5CNWA 3HVVA 1O8WA 2H76A 3DWVA 1MD3A 2OE1A 11GSA 5HFIA 2LTKA 2IL3A 2FD3A 2QC7A 1UC7A 1NHOA 3GHAA 4IVFA 5B6MA 1WJKA 5IMVA 2R2JA 1PL2A 4D73A 2RLIA 1YJ6A 1SYRA 5ECMB 2NTOA 3TJFA 1XBSA 2CQ9A 2IWTA 4I2UA 4JZQA 4TVEA 4X0XA 2ZUPA 3HJOA 2VCTA 3P90A 4OFNA 2MZCA 3EU4A 4YQVA 3UIWA 5F8BA 3FR3A 3I69A 1B8XA 4L5OA 4ZL7A 1ACVA 4V2MA 4FQUA 1XW9A 6GSTA 4MABA 2JADA 13GSA 5ECQB 4TXOA 1ZGNA 2HZEA 3I43A 3RPNA 1TDIA 3IK9A 3IR4A 3G7YA 3D6IA 3UARA 1NHYA 3SBCA 5B7CA 4KCAA 4TXVA 1Z5YE 2PUKC 2F9SA 2K9FA 5ENUA 3QFAC 1BJXA 4I97A 5DAKB 5F05A 1R26A 1TW9A 2C3TA 1T8EB 3KZQA 1YY7A 4K7OA 1PX6A 1PKWA 4PX1A 5J4UA 1SK2A 2F51A 5DJMA 4KB3A 4RI6A 5D8IA 2HYXA 2C80A 1XCCA 4Q5RA 2JZSA 2VM1A 2C3QA 3GURA 3ZVJA 3VWWA 3UBKA 2X8GA 5F07A 3MNGA 2MMAA 2NDOA 3IC4A 1GSEA 5GZZB 2VCZA 3ERGA 3K8NA 1HNAA 4K0GA 1F6MC 3DXBA 5G31A 3FZ4A 2WFCA 2XHFA 2R6KA 3GIXA 3WGEA 5J9CA 4OO5A 4JEDA 2LRTA 5ELGA 5HR0A 1FVKA 5FT3A 4NV2A 3LYPA 5AIVA 2B7JA 1ERUA 2WRTA 1MDJA 3Q6OA 1M2BA 4V2NA 1TK5B 4K0NA 2REMA 1Z9HA 5CO3A 2RUFA 2JU5A 1Z7PA 1VF4A 4TRXA 2V1MA 2XPEA 3FR6A 4ISDA 2G2QA 5CREA 3GMFA 1V9WA 1FHEA 1ZL9A 2VAFA 1T7PB 2FNOA 3CYNA 2V2GA 3VWVA 4IJ3A 4LMVA 1PA3A 4OFMA 3LGCA 1Y6EA 1CQGA 1OE8A 3G9BA 2WS2A 4O7HA 4F0BA 3IHQA 4GWRA 4KW6A 18GSA 4ML1A 2OBIA 2HNLA 2LJAA 1VRSD 4RQRA 2CT6A 4HU7A 2FA8A 1H75A 3BOAA 3VPTA 4HJMA 3EMPA 2VCXA 1K0BA 2HSMB 3TOTA 4KF9A 2MMOA 1XOBA 2CVKA 4ILFA 1FOVA 1A2LA 3LEFA 2N5AA 2XC2A 5G5FA 3PINA 5E4WA 2DSAA 4G0LA 2I1UA 4P3YB 2VOCA 3HVXA 3CSIA 2MBTA 1GSSA 1GNWA 4H86A 3GNJA 4IELA 1YDKA 2AHEA 2XPDA 4PNFA 3WD6A 4LA1A 2YJHA 2IMEA 2LV3A 3U6VA 2H1AA 1YZXA 2E7PA 1JZDA 3IK7A 3EWLA 3VFIA 3IAM2 5IPGA 2E2MA 1PN9A 3IPZA 3FZ9A 1XZOA 4KNDA 1AXDA 5L71A 1M7TA 2P0GA 2MYGA 4ML6A 4L5LA 1VF3A 2IIYA 1ML6A 6GSWA 5H5SA 3KM6A 4ZBDA 4MZWA 3TDGA 3F4SA 3WT1A 5B8AA 1XWAA 1QXHA 1GSQA 3I9V2 3CTGA 5F06A 1SKSB 4OWYA 1WP0A 3ZYWA 5J9BA 5GSTA 2HT9A 4MH3A 3M9KA 2HE3A 3BCKA 4V1Ap 1MD4A 5LD0A 4MLYA 3H1NA 1E2YA 3LFLA 3EINA 4BVXA 2V6OA 1PKZA 3FKFA 4PQ1A 2K6VA 2WCIA 4ID0A 2VLTA 4NWYA 4POBA 4PQIA 3DVWA 1EEJA 1WE0A 2UZ8A 2P31A 2H74A 1TU7A 4GCIA 4E8HA 5J41A 4EVMA 2LS5A 3TKSE 2GSTA 5LNKe 2WDUA 1F3AA 3M0FA 4JBBA 3F8UA 4EDZA 2AYTA 1PL1A 4K7IA 1KTEA 4EKZA 4K2DA 3J7Yk 4PGTA 2L59A 3RAZA 3FRCA 4HZ2A 2DIYA 2PMTA 1W89A 2MMZA 4L8EA 5LCZA 1BQ7A 5IMDA 4BL7A 3VWUA 2VM2A 4TW5A 4EC0A 2LNSA 1TJDA 3APSA 2H72A 2RIIA 4MH2A 5B8BA 3UEMA 2CAIA 1C72A 1A8YA 5IMFA 2ON7A 5DVBA 3GH9A 3HZ4A 3KH7A 3LORA 2VL2A 3A3TA 3WT2A 1ON4A 19GSA 4NPBA 4AJ8A 1BAYA 4IKHA 4WBJA 1PQNA 5G1KA 2H6XA 2PPTA 5KEJA 4BWSA 4FYBA 3LXTA 1ILOA 4YAPA 5JWOB 1GSFA 1SK1A 2RUEA 3FEUA 1AQWA 4HOJA 1GSYA 5JWQB 1S3AA 4MJCA 1V40A 3HHVA 1OVNA 2IMIA 3IA1A 4KDUA 3L9UA 5ECOB 1QGVA 2GDRA 3TKSA 4DSSB 2ON5A 5ECPB 3DKSA 5CP1A 3CRUA 3LQ7A 4MP4A 1R5PA 1FB6A 1BYEA 4Q5FA 1A0RP 4NHWA 2PGTA 4LLRA 4LL4B 2VLVA 2GGTA 3ZRDA 4OCEA 1OE7A 3D21A 1KNGA 5IQYA 2H6ZA 3A2XA 2H75A 1EOGA 2BTOT 2YV7A 2OBKA 2EC4A 3GKMA 1K3OA 1Q4JA 4N11A 1DUGA 5EVOA 1SJZA 5HQPA 2YV9A 2YANA 1NW2A 1TKDB 4WETA 3HA9A 3N9JA 1SD8A 4K7NA 2YP6A 1TRWA 3VWXA 3F6DA 2O89A 2R3XA 4KE3A 4PNGA 4DSRA 1ZMAA 2VL2C 1JZRA 2HRNA 4CHSA 2E2GA 3NOFA 4O92A 3FYGA 1TXXA 2RM5A 3GFKA 3ZIJA 2YPMA 3P7XA 2CX3A 3RHBA 2DLXA 4KAEA 3DVXA 2E0QA 1AQXA 3CSHA 3QAGA 3EYTA 1S3DA 2Z9SA 4RI7A 3RDWA 1SJIA 2FWFA 4OMVA 1OC3A 3QMXA 5IOWA 1Z6NA 2L5OA 5DAKA 3TKSC 3APQA 4X43A 3RBTA 2TIRA 2DC5A 3NIVA 3D0ZA 3Q19A 3QFBC 1A8LA 4GLTA 2H1GA 2H1BA 2H8LA 4WR5A 4J56E 3TUEA 4TR1B 5IO2A 4FO5A 3ZREA 1ZCPA 1ZYEA 2PERA 5G1LA 2LRCA 2HRAA 3HJPA 4TOPA 2RM6A 3J7Yb 1T4ZA 14GSA 4IBPA 5IMAA 6GSUA 2CX4A 4GQCA 4N10A 3APOA 5A5KA 3DMLA 4MF6A 3D5JA 2L4CA 3GX8A 2B1KA 4MZBA 2YWOA 2F8AA 1G6YA 2GVPA 1GTAA 1JFUA 1O85A 1M2AA 2HSHA 2AJQB 1Y25A 2DJKA 2LNTA 2FHEA 5DDLA 2B5XA 4XIHA 1XVWA 2A2SA 3W8SA 1MTCA 1J0FA 1A0FA 4ECIA 5EPFA 1AC1A 5AN1A 3L78A 3HYPA 1X5CA 2FWHA 3R2QA 3KEBA 4KDYA 1XVQA 4NHZA 4TR4A 3EVIA 1XFLA 2NBSA 1K0NA 1AQVA 1DSBA 1XIYA 4IHUA 2GSRA 4TKYA 1EV9A 3RHCA 3BCIA 2GQLA 2VL3A 2X8HA 5D9TA 2M72A 3DEXA 4WEYA 1TTZA 3R3EA 5C04A 1EP7A 3GA4A 5JCUA 3C1RA 3LXZA 3KJYA 3DRNA 2DJJA 1TK8B 2L4QA 3C73A 2LRNA 4USSA 1Z3EA 3KP9A 4KGIA 1M99A 2LQOA 4ZBAA 1KEBA 2XBIA 3BJ5A 4FYCA 2VD1A 2GT5A 4KA0A 4GSTA 3D4MA 1GL8A 3KD0A 1XWCA 4GF0A 1FW1A 1DE1A 3C71A 1V98A 2O7KA 1EGOA 1K0OA 3H93A 4XS4B 1GRXA 2HRFA 4OD7A 1GUHA 1TK0B 3IAS2 1G0TA 1WRYA 3LWAA 1TRVA 3LG6A 1H4OA 3GN3A 4EO3A 2X99A 4XRAA 2X64A 2XBQA 2HSMA 1T00A 2I4AA 3LSZA 4RUVA 2K8SA 3ZIVA 3TOUA 4NXIA 1VF2A 1N8JA 5J5NA 4XS1A 1HNBA 1HD2A 1F9MA 2PBJA 2V32A 3EE2A 4G0KA 1WIKA 2PWJA 4ZBBA 3M1GA 1QFNA 4I6XA 3ERWA 4EL1A 1NM3A 4YQMA 2DJ1A 2YWIA 3GTUB 4K8MA 2DMMA 1IYIA 3ISOA 2H19A 2VO4A 3IOSA 1AW9A 1I5GA 2M46A 3P2AA 1U87A 4HI7A 3FZAA 2LJKA 4XRDA 4EXJA 5IMZA 4TR0A 4N0VA
chains in the Genus database with same CATH superfamily
3TJJA 5D9XA 4MPGA 1B48A 2GTUA 1PFOA 3ZLPA 3TKQA 2R0GA 4EDYA 4PUFC 1G7OA 2KUCA 1U88A 2HI7A 1GUMA 2CVBA 2GS3A 2GZPA 2J23A 4GSSA 4W66A 4ZB9A 1M0UA 1OC9B 3I6AA 4PURA 2IFQB 3TKPA 1QK8A 5HR3A 1ZYNA 4GXZA 1HQOA 5DALB 5DCGA 5FWGA 3QPMA 4BVYB 5JCWA 2AB6A 1SD9A 4Z7XA 3TRXA 3F3RA 1SL1B 4GSNA 4ZL8A 1XW5A 1U3IA 2B7KA 3CXGA 2OE0A 3A5IA 4ZL9A 1X9MB 3WGDA 4NV5A 1PRXA 4L0WA 3GV1A 3L0HA 4GRFA 2R37A 3TJBA 4OFTA 1SL0B 1GWCA 2VLUA 6GSYA 1BG1A 5HR2A 3VK9A 3GH6A 3GKNA 2LKUA 4N30A 1TXUA 1M3JA 1T3BA 3EC3A 2FUG2 3IHGA 2IN3A 1RQMA 1G7EA 1BX9A 1EV4A 3PPUA 4EE0A 1V57A 2WJUA 4Q5QA 1EZKA 3VPQA 3A2VA 2CZ2A 1ERTA 1YEPA 4YH2A 1O8XA 3U5RE 3IXRA 3ZTLA 4WXTA 4POKA 1URMA 4ACSA 5DBQA 3ZL5A 2I3YA 3KMOA 4O32A 1AAZA 5A4VA 4ZXGA 5A1NA 2IMKA 1S3CA 2H73A 2WVXB 1B4PA 2C0DA 3KTLA 2VCWA 4KH7A 2B6MA 16GSA 4IW9A 4AJ6A 5DQSA 4IQAA 1XWGA 2FLSA 2YZUA 4AKXB 2TRXA 2EFDA 2DJ0A 4EIQA 4N0ZA 1BG5A 4X1UA 5A34A 1SVMA 1AUCA 1ZZYA 4DSSA 4WF4A 1YQ1A 3F63A 4ECBA 1GNEA 3FY7A 4G0IA 2GSQA 5GAPD 4ECJA 3S9FA 4QQ7A 4IN0A 4YKFA 1F37A 4F9ZA 2A2PA 2JACA 3KXOA 7GSSA 2R0CA 2WW3A 3TKRA 5ID2B 2DBCA 2KHPA 4PI2C 3E0UA 5CAXA 1SK0A 3FMWA 4K1FA 5CRGA 1YEXA 2WB9A 3GSTA 2AAWA 5IOXA 2GQMA 3SWLA 3UVHA 2J9HA 2NVLA 2GT6A 4PUAA 4Z2TA 4Q5NA 1R4WA 1N2AA 1F3BA 3ME7A 1GSDA 4HJ2A 3GL3A 5ELAA 2HSYA 2O5VA 5D93A 3UL3A 5ABRA 2O8VB 1OC8A 4ZB6A 3GKXA 5BMUA 1TOFA 1EP8A 1B4QA 1PN0A 2H1DA 5G2ZA 4BWQA 1W4VA 4HUAA 2QA1A 4TN8A 3DD3A 4MCUA 2JL4A 3H79A 4G2EA 1MEKA 2G0FA 1K0CA 2FCHA 3M8NA 5IPHA 3UVTA 5HFKA 4PQHA 1FAAA 4G10A 4JR4A 3ZVJD 3TCOA 5J3RA 2QGVA 5ECKB 1GSUA 2ZCTA 5ECSA 3TJGA 1GTBA 1J9BA 3O6TA 1J08A 4CY6A 4MPFA 2JSZA 1LJRA 4OO4A 4AKIA 4KX4A 4TR1A 3CRTA 1EOHA 3FR9A 3UJ1A 1FOHA 6GSXA 1ABAA 3C1SA 3FW2A 4V2LA 2EIOA 4MZCA 1T1VA 5ECRB 2N5FA 3GSSA 3A5WA 2VUPA 1HNCA 1M9BA 4O5UA 2H0GA 1PD21 3DYRA 2OKAA 2YZHA 4IGJA 2WGRA 1GH2A 1GUKA 2P5RA 3O76A 2LQQA 5IM9A 1GLPA 4QL9A 5COHA 3C8EA 2M80A 5DCHA 2B3SA 1TRUA 1WMJA 2GQKA 4YQUA 4CW9A 8GSSA 3HVSA 3FK8A 2CV4A 1IYHA 3VI7A 3UOMA 12GSA 1Z6MA 1Q98A 4TR3A 2ZNMA 2JZTA 3AY8A 2VL9A 3H8QA 2CVDA 2HRKB 2PVOC 3KIJA 2DMLA 3TGZA 2PN8A 4CDOA 5B6NA 3PR8A 1A2MA 4JR6A 4A5PA 5D9WA 4E68A 2R5GA 3ZMLA 3FZ5A 4LL1B 1BF5A 1A2JA 1I9DA 5IIZA 2GZYA 1THXA 1O81A 2HZFA 1OYJA 4D73B 3C7MA 3HMJG 5JCGA 2V41A 9GSSA 2D2ZA 1THOA 1ST9A 3HY2A 1E6BA 2FGXA 2FWGA 2WW0A 1I1IP 3O3TA 2C4JA 4FIWA 3TRQA 2O85A 3CMIA 4FH8A 4FYUA 1SJ6A 3KH9A 4EIPA 4MNNA 4NAXA 1YKAA 4G9HA 4XS4A 2X4AA 2H66A 1JHBA 1OKDA 4I8BA 4TXOB 2HZEB 1S4BP 2K18A 5JWRB 3F0IA 1FG4A 3QOUA 1RK4A 2QSIA 1SKWB 2IMFA 1CQHA 2OJLA 1TU8A 4ULXA 2CZ3A 1XPVA 1O6JA 2C0GA 3MSZA 3PGTA 5HFGA 1A23A 1GP1A 2YWMA 3CWGA 3EURA 1U6TA 3TJKA 4BIKA 3KCMA 2K8VA 1A24A 3H4KA 4F82A 5AGYA 1YF1A 1SU9A 2V6KA 4AF2A 3ZZXA 1DE2A 1N25A 1VF1A 2F3MA 4HQSA 1XW6A 4WKWA 4KSMA 3CBUA 4POMA 4I2TA 2HFDA 2EIRA 3E9JB 4XCSA 2MBSA 2A4VA 2MMNA 5KOWA 3IC8A 5KOXA 2H01A 5E59A 2F8FA 4HDEA 3VLNA 3HDCA 2QA2A 3GTUA 6GSVA 4KSOA 1UVZA 1TI1A 1GULA 20GSA 3F3QA 4YKGA 1GLQA 3M9JA 1XG8A 2HXKA 4ZILA 3F4TA 1EEMA 3ZMKA 3QCPA 1X5EA 2AV4A 3WYWA 1B9YC 3MDKA 3GX0A 1GTUA 4MA9A 4O5RA 1R7HA 4MJEA 2ALBA 4DSQA 3G7IA 2B5EA 1F2EA 1JLVA 2KLXA 2X8CA 5C00A 2VCQA 4WR4A 4AGSA 1PX7A 2PU9C 5CYYA 3M3MA 2H30A 1LU4A 1OC9A 3ZITA 3L4NA 1JZOA 5AIXA 3F6FA 3QR6A 1QMVA 2IFQA 3GL5A 5GAND 4DVCA 5DALA 1WPIA 2L6DA 3F4RA 3ZFBA 3IE3A 5KN1A 1O7UA 4K5RA 2KP1A 4BVYA 2O3EA 3KMNA 1ERWA 3Q74A 3OR5A 1BEDA 1OKTA 4AKHA 2OE3A 4ZIJA 2YOIA 1SL2B 1XXUA 1ZOFA 3WGXA 3N5OA 1YEWC 4F0CA 3ERFA 1UA5A 2O87A 4HSCX 2DJ3A 4JRRA 1SKRB 3RGBC 3F9UA 5KN0A 2HSNB 5IMCA 5FHIA 5G5EA 4EUYA 3Q18A 10GSA 2VD0A 2I9HA 1X5DA 2HLSA 6GSSA 2OADA 4MF5A 1M9AA 5D73A 5GSSA 1MDKA 5EY6A 3LJRA 3D4TA 4PHZC 4MDCA 1QUWA 2KOKA 4XS6A 5ECLB 1X0RA 2ES7A 2LUSA 2YJ7A 1OAZA 1TRSA 2H0HA 2TRCP 4YAVA 2EIQA 4IQ1A 2FWEA 4LMWA 1X9SB 4ECCA 3CTFA 5F0GA 2WVXA 3MWHA 3HJMA 5AISA 2B5YA 3G7JA 1FB0A 1XOAA 3FHKA 3IDVA 2QKEA 1ERVA 1YF0A 5H5RA 1HYUA 2H70A 5DJLA 4MJBA 4BPYA 5J47A 2LJRA 3QAWA 2N5BA 3UAPA 1B9XC 3NZNA 5IO0A 2IMDA 5D96A 4JU5A 3ED3A 3E3EA 2VCVA 4KDXA 2OA7A 3P8WA 4HEA2 4MJAA 2WW1A 4IJIA 3GRXA 4MF7A 2HQTA 3HKRA 4XHMA 5CRHA 3QD9A 4E8EA 2C1YA 4FXYP 1PMTA 1MDIA 3HD5A 1V2AA 4PTSA 2H0IA 4F2IA 3A2WA 1ZYQB 2GLRA 2FA4A 1EWXA 3GUSA 2R0PA 3JCML 4NMUA 3PH9A 17GSA 5ID2A 4X4JA 3UMAA 5ECNB 3KGKA 3KP8A 3ME8A 2C3NA 5ECHB 2DIZA 3V1WA 3KTBA 1M2DA 2A2RA 5D9VA 4XTSA 3DGQA 4IP1A 4K9ZA 2CAQA 5H5QA 4BVXB 2H71A 2P5QA 1TP9A 1K3YA 1PSQA 4V1Ag 5EL8A 1EGRA 3EMXA 2VIMA 1O73A 3DIEA 1X9WB 1VGLA 3MAKA 1K0MA 4G19A 3RPPA 4MK3A 3UBLA 5KN3A 4EF0A 5ECIB 5INYA 2C0EA 2GZZA 5CRDA 1AIUA 2FY6A 2CA8A 3L9VA 2L6CA 4DEJA 4IP6A 1V58A 3GYKA 2PVQA 5DQYA 4AJ7A 2UV8G 4J2FA 2WZ9A 4F03A 4GQFA 4HU9A 4HS1A 2C0FA 1M3IA 1LBKA 4BL7B 2LSTA 3LYKA 2YNXA 2AUVA 1DBYA 1WWJA 2LEGA 1SENA 1K3LA 1Z7RA 2H6YA 3TRPA 4K6XA 3L9SA 3QAVA 3VURA 3D22A 5G30A 22GSA 2C8UA 3CSJA 1PGTA 4GTUA 3IV4A 4POLA 2KP2A 4RQXA 1USBA 1G6WA 1XWBA 1YKCA 4HZ4A 3BBYA 1QQ2A 3W8JA 3HZ8A 2JZRA 3QDNA 1RW1A 4IS0A 3TB2A 2BJXA 2I81A 4PXOA 1T4YA 1R5AA 1K0AA 1K0DA 3ZFLA 1WOUA 2L57A 2YN1A 1SVLA 1GTIA 2BMXA 2YWNA 4JE1A 1U3AA 4ZB8A 4L0UA 2JSYA 2IJYA 2NPBA 2YCDA 3HCZA 4I5QA 2OACA 2WULA 2B1LA 1FVJA 5HR1A 4HQZA 3EU3A 3US3A 1FO5A 2R4VA 2DJ2A 1SYXA 1UN2A 4KCEA 3VI5A 5A4WA 1NSWA 3BD2A 1XWKA 3HXSA 1JLWA 2GSSA 1TI3A 4WBRD 2L5LA 3IRAA 5A4UA 3W6GA 5KN2A 2WVZA 3LW9A 5CRWA 4WF5A 4OCFA 2HRKA 4MMMA 2IPAA 4KUNA 3GKKA 4J57E 1KBNA 3IBHA 4BA7A 1JZWA 4QL7A 5CNWA 3HVVA 1O8WA 2H76A 3DWVA 1MD3A 2OE1A 11GSA 5HFIA 2LTKA 2IL3A 2FD3A 2QC7A 1UC7A 1NHOA 3GHAA 4IVFA 5B6MA 1WJKA 5IMVA 2R2JA 1PL2A 4D73A 2RLIA 1YJ6A 1SYRA 5ECMB 4GDFA 2A4HA 2NTOA 3TJFA 1XBSA 2CQ9A 2IWTA 4I2UA 4JZQA 4TVEA 4X0XA 2ZUPA 3HJOA 2VCTA 3P90A 4OFNA 2MZCA 3EU4A 4YQVA 3UIWA 5F8BA 3FR3A 3I69A 1B8XA 4L5OA 4ZL7A 4QMKA 1ACVA 4V2MA 4FQUA 1XW9A 6GSTA 4MABA 2JADA 13GSA 5ECQB 4TXOA 1ZGNA 2HZEA 3I43A 3RPNA 1TDIA 3IK9A 3IR4A 3G7YA 3D6IA 3UARA 1NHYA 3SBCA 5B7CA 4KCAA 4TXVA 1Z5YE 2PUKC 2F9SA 2K9FA 5ENUA 3QFAC 1BJXA 4I97A 5DAKB 5F05A 1R26A 1TW9A 2C3TA 1T8EB 3KZQA 1YY7A 4K7OA 1PX6A 1PKWA 4PX1A 5J4UA 1SK2A 2F51A 5DJMA 4KB3A 4RI6A 5D8IA 2DKHA 2HYXA 2C80A 1XCCA 4Q5RA 2JZSA 2VM1A 2C3QA 3GURA 3ZVJA 3VWWA 3UBKA 2X8GA 5F07A 3MNGA 2MMAA 2NDOA 3IC4A 1GSEA 5GZZB 2VCZA 3ERGA 3TU3B 3K8NA 1HNAA 4K0GA 1F6MC 3DXBA 2H1LA 5G31A 3FZ4A 2WFCA 2XHFA 2R6KA 3GIXA 3WGEA 5J9CA 4OO5A 4JEDA 2LRTA 5ELGA 5HR0A 1FVKA 5FT3A 4NV2A 3LYPA 5AIVA 2B7JA 1ERUA 2WRTA 1MDJA 3Q6OA 1M2BA 4V2NA 1TK5B 4K0NA 2REMA 1Z9HA 5CO3A 2RUFA 2JU5A 1Z7PA 4ZB7A 1VF4A 4TRXA 2V1MA 2XPEA 3FR6A 4ISDA 4PI0C 2G2QA 5CREA 3GMFA 1V9WA 1SVOA 1FHEA 1ZL9A 2VAFA 1T7PB 2FNOA 3CYNA 2V2GA 3VWVA 4IJ3A 4LMVA 1PA3A 4OFMA 2X49A 3LGCA 1Y6EA 1CQGA 1OE8A 4AI6A 2HSNA 3G9BA 2WS2A 4O7HA 4F0BA 3IHQA 4GWRA 4KW6A 1S3RA 18GSA 4ML1A 2OBIA 2HNLA 2LJAA 1VRSD 4RQRA 2CT6A 4HU7A 2FA8A 1H75A 3BOAA 3VPTA 2O36A 4HJMA 3EMPA 2VCXA 1K0BA 2HSMB 3TOTA 4KF9A 2MMOA 1XOBA 2CVKA 5A5HB 4ILFA 1FOVA 1A2LA 3LEFA 2N5AA 2XC2A 3CQFA 5G5FA 3PINA 5E4WA 3EPTA 2DSAA 4G0LA 2I1UA 4P3YB 2VOCA 3HVXA 3CSIA 2MBTA 1GSSA 1GNWA 4H86A 3GNJA 4IELA 1YDKA 2AHEA 2XPDA 4PNFA 3WD6A 4LA1A 2YJHA 2IMEA 2LV3A 3U6VA 2H1AA 1YZXA 2E7PA 1JZDA 3IK7A 3EWLA 3VFIA 3IAM2 5IPGA 2E2MA 1PN9A 3IPZA 3FZ9A 1XZOA 4KNDA 1AXDA 5L71A 1M7TA 2P0GA 2MYGA 4ML6A 4L5LA 1VF3A 2IIYA 1ML6A 6GSWA 5H5SA 3KM6A 5J4YA 4ZBDA 4MZWA 3TDGA 3F4SA 3WT1A 5B8AA 1XWAA 5BRTA 1QXHA 1GSQA 4K2XA 3I9V2 3CTGA 5F06A 2EFCA 1SKSB 4OWYA 1WP0A 3ZYWA 5J9BA 5GSTA 2HT9A 4MH3A 3M9KA 2HE3A 3BCKA 4V1Ap 1MD4A 5LD0A 4MLYA 2OT3A 3H1NA 2WZSA 1E2YA 3LFLA 2VKZG 3EINA 4BVXA 2V6OA 1PKZA 3FKFA 4PQ1A 2K6VA 2WCIA 4ID0A 2VLTA 4NWYA 4POBA 4PQIA 3DVWA 1EEJA 1WE0A 2UZ8A 2P31A 2H74A 1TU7A 4GCIA 4E8HA 5J41A 4N3ZA 4EVMA 2LS5A 3TKSE 2GSTA 5LNKe 2WDUA 1F3AA 3M0FA 4JBBA 3F8UA 4EDZA 2AYTA 1PL1A 4K7IA 1KTEA 4EKZA 4K2DA 3CHXC 3J7Yk 4PGTA 2L59A 3RAZA 3FRCA 4HZ2A 2DIYA 2PMTA 1W89A 2MMZA 4L8EA 5LCZA 1BQ7A 5IMDA 4BL7A 4Z2UA 1ZYPA 3VWUA 2VM2A 4TW5A 4EC0A 2LNSA 1TJDA 3APSA 2H72A 2EFHA 2RIIA 4MH2A 5B8BA 3UEMA 2CAIA 1C72A 1A8YA 5IMFA 2ON7A 5DVBA 3GH9A 3HZ4A 3KH7A 3LORA 2VL2A 3A3TA 3WT2A 1ON4A 5A1NB 19GSA 4NPBA 4AJ8A 1BAYA 4IKHA 4WBJA 1PQNA 5G1KA 2H6XA 2PPTA 5KEJA 4BWSA 4FYBA 1YVLA 3LXTA 1ILOA 4YAPA 5JWOB 4K5SA 1GSFA 1SK1A 2RUEA 3FEUA 1AQWA 4HOJA 1GSYA 5JWQB 1S3AA 4MJCA 1V40A 3HHVA 1OVNA 2IMIA 5A34B 3IA1A 4KDUA 3L9UA 5ECOB 1QGVA 2GDRA 3TKSA 4DSSB 2ON5A 5ECPB 3DKSA 5CP1A 3CRUA 3LQ7A 4MP4A 1R5PA 1FB6A 1BYEA 4Q5FA 1A0RP 2EFEA 3MIXA 4NHWA 2PGTA 4LLRA 4LL4B 2VLVA 2GGTA 3ZRDA 2DKIA 4OCEA 1OE7A 3D21A 1KNGA 5IQYA 2H6ZA 3A2XA 2H75A 1EOGA 2BTOT 2YV7A 2OBKA 2EC4A 3GKMA 1K3OA 2WVYA 1Q4JA 4N11A 1DUGA 5EVOA 1SJZA 5HQPA 2YV9A 2YANA 1NW2A 1TKDB 1Y1UA 4WETA 3HA9A 3N9JA 1SD8A 4K7NA 2YP6A 1TRWA 3VWXA 3F6DA 2O89A 2R3XA 4KE3A 4PNGA 4DSRA 1ZMAA 2VL2C 1JZRA 2HRNA 4CHSA 2E2GA 3NOFA 4O92A 3FYGA 1TXXA 2RM5A 3GFKA 3ZIJA 5BMUB 2YPMA 3P7XA 2CX3A 3RHBA 2DLXA 4KAEA 3DVXA 2E0QA 1AQXA 3CSHA 3QAGA 3EYTA 1S3DA 2Z9SA 4RI7A 3RDWA 1SJIA 2FWFA 4OMVA 4AKGA 1OC3A 3QMXA 5IOWA 1Z6NA 2L5OA 5DAKA 3TKSC 3APQA 4X43A 3RBTA 2TIRA 2DC5A 3NIVA 3D0ZA 3Q19A 3QFBC 1A8LA 4GLTA 2H1GA 2H1BA 2H8LA 4WR5A 4J56E 3TUEA 4TR1B 5IO2A 4FO5A 3ZREA 1ZCPA 1ZYEA 2PERA 5G1LA 2LRCA 2HRAA 3HJPA 4TOPA 2RM6A 3J7Yb 1T4ZA 14GSA 4IBPA 5IMAA 6GSUA 2CX4A 4GQCA 4N10A 3APOA 5A5KA 3DMLA 4MF6A 3D5JA 2L4CA 3GX8A 2B1KA 4MZBA 2YWOA 2F8AA 1G6YA 4Z2RA 2GVPA 1GTAA 1JFUA 1O85A 1M2AA 2HSHA 2AJQB 1Y25A 2DJKA 2LNTA 2FHEA 5DDLA 2B5XA 4XIHA 1XVWA 2A2SA 3W8SA 1MTCA 1J0FA 1A0FA 4ECIA 5EPFA 2WW2A 1AC1A 5AN1A 3L78A 3HYPA 1X5CA 2FWHA 3R2QA 3KEBA 4KDYA 1XVQA 4NHZA 3RFRC 4TR4A 3EVIA 1XFLA 2NBSA 1K0NA 1AQVA 1DSBA 1XIYA 4IHUA 2GSRA 4TKYA 1EV9A 3RHCA 3BCIA 2GQLA 2VL3A 2X8HA 5D9TA 2M72A 3DEXA 4WEYA 1TTZA 3R3EA 5C04A 1EP7A 3HVNA 3GA4A 5JCUA 3C1RA 3LXZA 3KJYA 3DRNA 2DJJA 1TK8B 2L4QA 3C73A 2LRNA 4USSA 1Z3EA 3KP9A 4KGIA 1M99A 2LQOA 4ZBAA 1KEBA 2XBIA 3BJ5A 4FYCA 3MYDA 2VD1A 2GT5A 4KA0A 4GSTA 3D4MA 1GL8A 5J40A 3KD0A 1XWCA 4GF0A 1FW1A 1DE1A 3C71A 1V98A 2O7KA 1EGOA 1K0OA 3H93A 4XS4B 1GRXA 2HRFA 4OD7A 1GUHA 4ICYA 1TK0B 3IAS2 1G0TA 1WRYA 3LWAA 1TRVA 3LG6A 1H4OA 3GN3A 4EO3A 2X99A 4XRAA 2X64A 2XBQA 2HSMA 1T00A 2I4AA 3LSZA 5A5HA 4RUVA 2K8SA 3ZIVA 3TOUA 4NXIA 1VF2A 1N8JA 5J5NA 4XS1A 1HNBA 1HD2A 1F9MA 2PBJA 2V32A 3EE2A 4G0KA 1WIKA 2PWJA 4ZBBA 3M1GA 1QFNA 4CY8A 4I6XA 3ERWA 4EL1A 4O5QA 1NM3A 5J4VA 4YQMA 2DJ1A 2YWIA 3GTUB 2DMMA 4K8MA 1IYIA 3ISOA 2H19A 2VO4A 3IOSA 1AW9A 1I5GA 2M46A 3P2AA 1U87A 4G01A 4HI7A 2LJKA 3FZAA 4XRDA 4EXJA 5IMZA 4TR0A 4N0VA
chains in the Genus database with same CATH topology
3TJJA 5D9XA 4MPGA 1B48A 2GTUA 3ZLPA 3TKQA 2R0GA 4EDYA 4PUFC 1G7OA 2KUCA 1U88A 2HI7A 1GUMA 2CVBA 2GS3A 2GZPA 2J23A 4GSSA 4W66A 4ZB9A 1M0UA 1OC9B 3I6AA 4PURA 2IFQB 3TKPA 1QK8A 5HR3A 1ZYNA 4GXZA 1HQOA 5DALB 5DCGA 5FWGA 3QPMA 4BVYB 5JCWA 2AB6A 1SD9A 4Z7XA 3TRXA 3F3RA 1SL1B 4GSNA 4ZL8A 1XW5A 1U3IA 2B7KA 3CXGA 2OE0A 3A5IA 4ZL9A 1X9MB 3WGDA 4NV5A 1PRXA 4L0WA 3GV1A 3L0HA 4GRFA 2R37A 3TJBA 4OFTA 1SL0B 1GWCA 2VLUA 6GSYA 1BG1A 5HR2A 3VK9A 3GH6A 3GKNA 2LKUA 4N30A 1TXUA 1T3BA 3EC3A 2FUG2 3IHGA 2IN3A 1RQMA 1G7EA 1BX9A 1EV4A 3PPUA 4EE0A 1V57A 2WJUA 4Q5QA 1EZKA 3VPQA 3A2VA 2CZ2A 1ERTA 1YEPA 4YH2A 1O8XA 3U5RE 3IXRA 3ZTLA 4WXTA 4POKA 1URMA 4ACSA 5DBQA 3ZL5A 2I3YA 3KMOA 4O32A 1AAZA 5A4VA 4ZXGA 5A1NA 2IMKA 1S3CA 2H73A 1B4PA 2C0DA 3KTLA 2VCWA 4KH7A 2B6MA 16GSA 4IW9A 4AJ6A 5DQSA 4IQAA 1XWGA 2FLSA 2YZUA 4AKXB 2TRXA 2EFDA 2DJ0A 4EIQA 4N0ZA 1BG5A 4X1UA 5A34A 1SVMA 1AUCA 1ZZYA 4DSSA 4WF4A 1YQ1A 3F63A 4ECBA 1GNEA 3FY7A 4G0IA 2GSQA 5GAPD 4ECJA 3S9FA 4QQ7A 4IN0A 4YKFA 1F37A 4F9ZA 2A2PA 2JACA 3KXOA 7GSSA 2R0CA 3TKRA 5ID2B 2DBCA 2KHPA 3E0UA 5CAXA 1SK0A 3FMWA 4K1FA 5CRGA 1YEXA 2WB9A 3GSTA 2AAWA 5IOXA 2GQMA 3SWLA 3UVHA 2J9HA 2NVLA 2GT6A 4PUAA 4Z2TA 4Q5NA 1R4WA 1N2AA 1F3BA 3ME7A 1GSDA 4HJ2A 3GL3A 5ELAA 2HSYA 2O5VA 5D93A 3UL3A 5ABRA 2O8VB 1OC8A 4ZB6A 3GKXA 5BMUA 1TOFA 1EP8A 1B4QA 1PN0A 2H1DA 5G2ZA 4BWQA 1W4VA 4HUAA 2QA1A 4TN8A 3DD3A 4MCUA 2JL4A 3H79A 4G2EA 1MEKA 2G0FA 1K0CA 2FCHA 3M8NA 5IPHA 3UVTA 5HFKA 4PQHA 1FAAA 4G10A 4JR4A 3ZVJD 3TCOA 5J3RA 2QGVA 5ECKB 1GSUA 2ZCTA 5ECSA 3TJGA 1GTBA 1J9BA 3O6TA 1J08A 4CY6A 4MPFA 2JSZA 1LJRA 4OO4A 4AKIA 4KX4A 4TR1A 3CRTA 1EOHA 3FR9A 3UJ1A 1FOHA 6GSXA 1ABAA 3C1SA 3FW2A 4V2LA 2EIOA 4MZCA 1T1VA 5ECRB 2N5FA 3GSSA 3A5WA 2VUPA 1HNCA 1M9BA 4O5UA 2H0GA 1PD21 3DYRA 2OKAA 2YZHA 4IGJA 2WGRA 1GH2A 1GUKA 2P5RA 3O76A 2LQQA 5IM9A 1GLPA 4QL9A 5COHA 3C8EA 2M80A 5DCHA 2B3SA 1TRUA 1WMJA 2GQKA 4YQUA 4CW9A 8GSSA 3HVSA 3FK8A 2CV4A 1IYHA 3VI7A 3UOMA 12GSA 1Z6MA 1Q98A 4TR3A 2ZNMA 2JZTA 3AY8A 2VL9A 3H8QA 2CVDA 2HRKB 2PVOC 3KIJA 2DMLA 3TGZA 2PN8A 4CDOA 5B6NA 3PR8A 1A2MA 4JR6A 4A5PA 5D9WA 4E68A 2R5GA 3ZMLA 3FZ5A 4LL1B 1BF5A 1A2JA 1I9DA 5IIZA 2GZYA 1THXA 1O81A 2HZFA 1OYJA 4D73B 3C7MA 3HMJG 5JCGA 2V41A 9GSSA 2D2ZA 1THOA 1ST9A 3HY2A 1E6BA 2FGXA 2FWGA 3O3TA 2C4JA 4FIWA 3TRQA 2O85A 3CMIA 4FH8A 4FYUA 1SJ6A 3KH9A 4EIPA 4MNNA 4NAXA 1YKAA 4G9HA 4XS4A 2X4AA 2H66A 1JHBA 1OKDA 4I8BA 4TXOB 2HZEB 2K18A 5JWRB 3F0IA 1FG4A 3QOUA 1RK4A 2QSIA 1SKWB 2IMFA 1CQHA 2OJLA 1TU8A 4ULXA 2CZ3A 1XPVA 1O6JA 2C0GA 3MSZA 3PGTA 5HFGA 1A23A 1GP1A 2YWMA 3CWGA 3EURA 1U6TA 3TJKA 3KCMA 2K8VA 1A24A 3H4KA 4F82A 5AGYA 1YF1A 1SU9A 2V6KA 4AF2A 3ZZXA 1DE2A 1N25A 1VF1A 2F3MA 4HQSA 1XW6A 4WKWA 4KSMA 3CBUA 4POMA 4I2TA 2HFDA 2EIRA 3E9JB 4XCSA 2MBSA 2A4VA 2MMNA 5KOWA 3IC8A 5KOXA 2H01A 5E59A 2F8FA 4HDEA 3VLNA 3HDCA 2QA2A 3GTUA 6GSVA 4KSOA 1UVZA 1TI1A 1GULA 20GSA 3F3QA 4YKGA 1GLQA 3M9JA 2HXKA 4ZILA 3F4TA 1EEMA 3ZMKA 3QCPA 1X5EA 2AV4A 3WYWA 1B9YC 3MDKA 3GX0A 1GTUA 4MA9A 4O5RA 1R7HA 4MJEA 2ALBA 4DSQA 3G7IA 2B5EA 1F2EA 1JLVA 2KLXA 2X8CA 5C00A 2VCQA 4WR4A 4AGSA 1PX7A 2PU9C 5CYYA 3M3MA 2H30A 1LU4A 1OC9A 3ZITA 3L4NA 1JZOA 5AIXA 3F6FA 3QR6A 1QMVA 2IFQA 3GL5A 5GAND 4DVCA 5DALA 1WPIA 2L6DA 3F4RA 3ZFBA 3IE3A 5KN1A 1O7UA 4K5RA 2KP1A 4BVYA 3KMNA 1ERWA 3Q74A 3OR5A 1BEDA 1OKTA 4AKHA 2OE3A 4ZIJA 2YOIA 1SL2B 1XXUA 1ZOFA 3WGXA 3N5OA 4F0CA 3ERFA 1UA5A 2O87A 2DJ3A 4JRRA 1SKRB 3F9UA 5KN0A 2HSNB 5IMCA 5FHIA 5G5EA 4EUYA 3Q18A 10GSA 2VD0A 2I9HA 1X5DA 2HLSA 6GSSA 2OADA 4MF5A 1M9AA 5D73A 5GSSA 1MDKA 5EY6A 3LJRA 3D4TA 4MDCA 1QUWA 2KOKA 4XS6A 5ECLB 1X0RA 2ES7A 2LUSA 2YJ7A 1OAZA 1TRSA 2H0HA 2TRCP 4YAVA 2EIQA 4IQ1A 2FWEA 4LMWA 1X9SB 4ECCA 3CTFA 5F0GA 3MWHA 3HJMA 5AISA 2B5YA 3G7JA 1FB0A 1XOAA 3FHKA 3IDVA 2QKEA 1ERVA 1YF0A 5H5RA 1HYUA 2H70A 5DJLA 4MJBA 4BPYA 5J47A 2LJRA 3QAWA 2N5BA 3UAPA 1B9XC 3NZNA 5IO0A 2IMDA 5D96A 4JU5A 3ED3A 3E3EA 2VCVA 4KDXA 2OA7A 3P8WA 4HEA2 4MJAA 4IJIA 3GRXA 4MF7A 2HQTA 3HKRA 4XHMA 5CRHA 3QD9A 4E8EA 2C1YA 1PMTA 1MDIA 3HD5A 1V2AA 4PTSA 2H0IA 4F2IA 3A2WA 1ZYQB 2GLRA 2FA4A 1EWXA 3GUSA 2R0PA 3JCML 4NMUA 3PH9A 17GSA 5ID2A 4X4JA 3UMAA 5ECNB 3KGKA 3KP8A 3ME8A 2C3NA 5ECHB 2DIZA 3V1WA 3KTBA 1M2DA 2A2RA 5D9VA 4XTSA 3DGQA 4IP1A 4K9ZA 2CAQA 5H5QA 4BVXB 2H71A 2P5QA 1TP9A 1K3YA 1PSQA 4V1Ag 5EL8A 1EGRA 3EMXA 2VIMA 1O73A 3DIEA 1X9WB 1VGLA 3MAKA 1K0MA 4G19A 3RPPA 4MK3A 3UBLA 5KN3A 4EF0A 5ECIB 5INYA 2C0EA 2GZZA 5CRDA 1AIUA 2FY6A 2CA8A 3L9VA 2L6CA 4DEJA 4IP6A 1V58A 3GYKA 2PVQA 5DQYA 4AJ7A 2UV8G 4J2FA 2WZ9A 4F03A 4GQFA 4HU9A 4HS1A 2C0FA 1LBKA 4BL7B 2LSTA 3LYKA 2YNXA 2AUVA 1DBYA 1WWJA 2LEGA 1SENA 1K3LA 1Z7RA 2H6YA 3TRPA 4K6XA 3L9SA 3QAVA 3VURA 3D22A 5G30A 22GSA 2C8UA 3CSJA 1PGTA 4GTUA 3IV4A 4POLA 2KP2A 4RQXA 1USBA 1G6WA 1XWBA 1YKCA 4HZ4A 3BBYA 1QQ2A 3W8JA 3HZ8A 2JZRA 3QDNA 1RW1A 4IS0A 3TB2A 2BJXA 2I81A 4PXOA 1T4YA 1R5AA 1K0AA 1K0DA 3ZFLA 1WOUA 2L57A 2YN1A 1SVLA 1GTIA 2BMXA 2YWNA 4JE1A 1U3AA 4ZB8A 4L0UA 2JSYA 2IJYA 2NPBA 2YCDA 3HCZA 4I5QA 2OACA 2WULA 2B1LA 1FVJA 5HR1A 4HQZA 3EU3A 3US3A 1FO5A 2R4VA 2DJ2A 1SYXA 1UN2A 4KCEA 3VI5A 5A4WA 1NSWA 3BD2A 1XWKA 3HXSA 1JLWA 2GSSA 1TI3A 4WBRD 2L5LA 3IRAA 5A4UA 3W6GA 5KN2A 3LW9A 5CRWA 4WF5A 4OCFA 2HRKA 4MMMA 2IPAA 4KUNA 3GKKA 4J57E 1KBNA 3IBHA 4BA7A 1JZWA 4QL7A 5CNWA 3HVVA 1O8WA 2H76A 3DWVA 1MD3A 2OE1A 11GSA 5HFIA 2LTKA 2IL3A 2FD3A 2QC7A 1UC7A 1NHOA 3GHAA 4IVFA 5B6MA 1WJKA 5IMVA 2R2JA 1PL2A 4D73A 2RLIA 1YJ6A 1SYRA 5ECMB 4GDFA 2A4HA 2NTOA 3TJFA 1XBSA 2CQ9A 2IWTA 4I2UA 4JZQA 4TVEA 4X0XA 2ZUPA 3HJOA 2VCTA 3P90A 4OFNA 2MZCA 3EU4A 4YQVA 3UIWA 5F8BA 3FR3A 3I69A 1B8XA 4L5OA 4ZL7A 4QMKA 1ACVA 4V2MA 4FQUA 1XW9A 6GSTA 4MABA 2JADA 13GSA 5ECQB 4TXOA 1ZGNA 2HZEA 3I43A 3RPNA 1TDIA 3IK9A 3IR4A 3G7YA 3D6IA 3UARA 1NHYA 3SBCA 5B7CA 4KCAA 4TXVA 1Z5YE 2PUKC 2F9SA 2K9FA 5ENUA 3QFAC 1BJXA 4I97A 5DAKB 5F05A 1R26A 1TW9A 2C3TA 1T8EB 3KZQA 1YY7A 4K7OA 1PX6A 1PKWA 4PX1A 5J4UA 1SK2A 2F51A 5DJMA 4KB3A 4RI6A 5D8IA 2DKHA 2HYXA 2C80A 1XCCA 4Q5RA 2JZSA 2VM1A 2C3QA 3GURA 3ZVJA 3VWWA 3UBKA 2X8GA 5F07A 3MNGA 2MMAA 2NDOA 3IC4A 1GSEA 5GZZB 2VCZA 3ERGA 3TU3B 3K8NA 1HNAA 4K0GA 1F6MC 3DXBA 2H1LA 5G31A 3FZ4A 2WFCA 2XHFA 2R6KA 3GIXA 3WGEA 5J9CA 4OO5A 4JEDA 2LRTA 5ELGA 5HR0A 1FVKA 5FT3A 4NV2A 3LYPA 5AIVA 2B7JA 1ERUA 2WRTA 1MDJA 3Q6OA 1M2BA 4V2NA 1TK5B 4K0NA 2REMA 1Z9HA 5CO3A 2RUFA 2JU5A 1Z7PA 4ZB7A 1VF4A 4TRXA 2V1MA 2XPEA 3FR6A 4ISDA 2G2QA 5CREA 3GMFA 1V9WA 1SVOA 1FHEA 1ZL9A 2VAFA 1T7PB 2FNOA 3CYNA 2V2GA 3VWVA 4IJ3A 4LMVA 1PA3A 4OFMA 2X49A 3LGCA 1Y6EA 1CQGA 1OE8A 4AI6A 2HSNA 3G9BA 2WS2A 4O7HA 4F0BA 3IHQA 4GWRA 4KW6A 18GSA 4ML1A 2OBIA 2HNLA 2LJAA 1VRSD 4RQRA 2CT6A 4HU7A 2FA8A 1H75A 3BOAA 3VPTA 4HJMA 3EMPA 2VCXA 1K0BA 2HSMB 3TOTA 4KF9A 2MMOA 1XOBA 2CVKA 5A5HB 4ILFA 1FOVA 1A2LA 3LEFA 2N5AA 2XC2A 5G5FA 3PINA 5E4WA 3EPTA 2DSAA 4G0LA 2I1UA 4P3YB 2VOCA 3HVXA 3CSIA 2MBTA 1GSSA 1GNWA 4H86A 3GNJA 4IELA 1YDKA 2AHEA 2XPDA 4PNFA 3WD6A 4LA1A 2YJHA 2IMEA 2LV3A 3U6VA 2H1AA 1YZXA 2E7PA 1JZDA 3IK7A 3EWLA 3VFIA 3IAM2 5IPGA 2E2MA 1PN9A 3IPZA 3FZ9A 1XZOA 4KNDA 1AXDA 5L71A 1M7TA 2P0GA 2MYGA 4ML6A 4L5LA 1VF3A 2IIYA 1ML6A 6GSWA 5H5SA 3KM6A 5J4YA 4ZBDA 4MZWA 3TDGA 3F4SA 3WT1A 5B8AA 1XWAA 5BRTA 1QXHA 1GSQA 4K2XA 3I9V2 3CTGA 5F06A 2EFCA 1SKSB 4OWYA 1WP0A 3ZYWA 5J9BA 5GSTA 2HT9A 4MH3A 3M9KA 2HE3A 3BCKA 4V1Ap 1MD4A 5LD0A 4MLYA 2OT3A 3H1NA 1E2YA 3LFLA 2VKZG 3EINA 4BVXA 2V6OA 1PKZA 3FKFA 4PQ1A 2K6VA 2WCIA 4ID0A 2VLTA 4NWYA 4POBA 4PQIA 3DVWA 1EEJA 1WE0A 2UZ8A 2P31A 2H74A 1TU7A 4GCIA 4E8HA 5J41A 4N3ZA 4EVMA 2LS5A 3TKSE 2GSTA 5LNKe 2WDUA 1F3AA 3M0FA 4JBBA 3F8UA 4EDZA 2AYTA 1PL1A 4K7IA 1KTEA 4EKZA 4K2DA 3J7Yk 4PGTA 2L59A 3RAZA 3FRCA 4HZ2A 2DIYA 2PMTA 1W89A 2MMZA 4L8EA 5LCZA 1BQ7A 5IMDA 4BL7A 4Z2UA 1ZYPA 3VWUA 2VM2A 4TW5A 4EC0A 2LNSA 1TJDA 3APSA 2H72A 2EFHA 2RIIA 4MH2A 5B8BA 3UEMA 2CAIA 1C72A 1A8YA 5IMFA 2ON7A 5DVBA 3GH9A 3HZ4A 3KH7A 3LORA 2VL2A 3A3TA 3WT2A 1ON4A 5A1NB 19GSA 4NPBA 4AJ8A 1BAYA 4IKHA 4WBJA 1PQNA 5G1KA 2H6XA 2PPTA 5KEJA 4BWSA 4FYBA 1YVLA 3LXTA 1ILOA 4YAPA 5JWOB 4K5SA 1GSFA 1SK1A 2RUEA 3FEUA 1AQWA 4HOJA 1GSYA 5JWQB 1S3AA 4MJCA 1V40A 3HHVA 1OVNA 2IMIA 5A34B 3IA1A 4KDUA 3L9UA 5ECOB 1QGVA 2GDRA 3TKSA 4DSSB 2ON5A 5ECPB 3DKSA 5CP1A 3CRUA 3LQ7A 4MP4A 1R5PA 1FB6A 1BYEA 4Q5FA 1A0RP 2EFEA 3MIXA 4NHWA 2PGTA 4LLRA 4LL4B 2VLVA 2GGTA 3ZRDA 2DKIA 4OCEA 1OE7A 3D21A 1KNGA 5IQYA 2H6ZA 3A2XA 2H75A 1EOGA 2BTOT 2YV7A 2OBKA 2EC4A 3GKMA 1K3OA 1Q4JA 4N11A 1DUGA 5EVOA 1SJZA 5HQPA 2YV9A 2YANA 1NW2A 1TKDB 1Y1UA 4WETA 3HA9A 3N9JA 1SD8A 4K7NA 2YP6A 1TRWA 3VWXA 3F6DA 2O89A 2R3XA 4KE3A 4PNGA 4DSRA 1ZMAA 2VL2C 1JZRA 2HRNA 4CHSA 2E2GA 3NOFA 4O92A 3FYGA 1TXXA 2RM5A 3GFKA 3ZIJA 5BMUB 2YPMA 3P7XA 2CX3A 3RHBA 2DLXA 4KAEA 3DVXA 2E0QA 1AQXA 3CSHA 3QAGA 3EYTA 1S3DA 2Z9SA 4RI7A 3RDWA 1SJIA 2FWFA 4OMVA 4AKGA 1OC3A 3QMXA 5IOWA 1Z6NA 2L5OA 5DAKA 3TKSC 3APQA 4X43A 3RBTA 2TIRA 2DC5A 3NIVA 3D0ZA 3Q19A 3QFBC 1A8LA 4GLTA 2H1GA 2H1BA 2H8LA 4WR5A 4J56E 3TUEA 4TR1B 5IO2A 4FO5A 3ZREA 1ZCPA 1ZYEA 2PERA 5G1LA 2LRCA 2HRAA 3HJPA 4TOPA 2RM6A 3J7Yb 1T4ZA 14GSA 4IBPA 5IMAA 6GSUA 2CX4A 4GQCA 4N10A 3APOA 5A5KA 3DMLA 4MF6A 3D5JA 2L4CA 3GX8A 2B1KA 4MZBA 2YWOA 2F8AA 1G6YA 4Z2RA 2GVPA 1GTAA 1JFUA 1O85A 1M2AA 2HSHA 2AJQB 1Y25A 2DJKA 2LNTA 2FHEA 5DDLA 2B5XA 4XIHA 1XVWA 2A2SA 3W8SA 1MTCA 1J0FA 1A0FA 4ECIA 5EPFA 1AC1A 5AN1A 3L78A 3HYPA 1X5CA 2FWHA 3R2QA 3KEBA 4KDYA 1XVQA 4NHZA 4TR4A 3EVIA 1XFLA 2NBSA 1K0NA 1AQVA 1DSBA 1XIYA 4IHUA 2GSRA 4TKYA 1EV9A 3RHCA 3BCIA 2GQLA 2VL3A 2X8HA 5D9TA 2M72A 3DEXA 4WEYA 1TTZA 3R3EA 5C04A 1EP7A 3GA4A 5JCUA 3C1RA 3LXZA 3KJYA 3DRNA 2DJJA 1TK8B 2L4QA 3C73A 2LRNA 4USSA 1Z3EA 3KP9A 4KGIA 1M99A 2LQOA 4ZBAA 1KEBA 2XBIA 3BJ5A 4FYCA 3MYDA 2VD1A 2GT5A 4KA0A 4GSTA 3D4MA 1GL8A 5J40A 3KD0A 1XWCA 4GF0A 1FW1A 1DE1A 3C71A 1V98A 2O7KA 1EGOA 1K0OA 3H93A 4XS4B 1GRXA 2HRFA 4OD7A 1GUHA 4ICYA 1TK0B 3IAS2 1G0TA 1WRYA 3LWAA 1TRVA 3LG6A 1H4OA 3GN3A 4EO3A 2X99A 4XRAA 2X64A 2XBQA 2HSMA 1T00A 2I4AA 3LSZA 5A5HA 4RUVA 2K8SA 3ZIVA 3TOUA 4NXIA 1VF2A 1N8JA 5J5NA 4XS1A 1HNBA 1HD2A 1F9MA 2PBJA 2V32A 3EE2A 4G0KA 1WIKA 2PWJA 4ZBBA 3M1GA 1QFNA 4CY8A 4I6XA 3ERWA 4EL1A 4O5QA 1NM3A 5J4VA 4YQMA 2DJ1A 2YWIA 3GTUB 2DMMA 4K8MA 1IYIA 3ISOA 2H19A 2VO4A 3IOSA 1AW9A 1I5GA 2M46A 3P2AA 1U87A 4G01A 4HI7A 2LJKA 3FZAA 4XRDA 4EXJA 5IMZA 4TR0A 4N0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJJ A;  5D9X A;  4MPG A;  1B48 A;  2GTU A;  3ZLP A;  3TKQ A;  4EDY A;  4PUF C;  1G7O A;  2KUC A;  1U88 A;  2HI7 A;  1GUM A;  2CVB A;  2GS3 A;  2GZP A;  2J23 A;  4GSS A;  4ZB9 A;  1M0U A;  1OC9 B;  3I6A A;  4PUR A;  2IFQ B;  3TKP A;  1QK8 A;  5HR3 A;  4GXZ A;  1HQO A;  5DAL B;  5DCG A;  5FWG A;  3QPM A;  4BVY B;  5JCW A;  2AB6 A;  1SD9 A;  4Z7X A;  3TRX A;  3F3R A;  1SL1 B;  4GSN A;  4ZL8 A;  1XW5 A;  1U3I A;  2B7K A;  3CXG A;  2OE0 A;  4ZL9 A;  1X9M B;  3WGD A;  4NV5 A;  1PRX A;  4L0W A;  3GV1 A;  3L0H A;  4GRF A;  2R37 A;  3TJB A;  4OFT A;  1SL0 B;  1GWC A;  2VLU A;  6GSY A;  5HR2 A;  3VK9 A;  3GH6 A;  3GKN A;  2LKU A;  4N30 A;  1T3B A;  3EC3 A;  2FUG 2;  2IN3 A;  1RQM A;  1G7E A;  1BX9 A;  1EV4 A;  3PPU A;  4EE0 A;  1V57 A;  2WJU A;  4Q5Q A;  1EZK A;  3VPQ A;  3A2V A;  2CZ2 A;  1ERT A;  1YEP A;  4YH2 A;  1O8X A;  3U5R E;  3IXR A;  3ZTL A;  4WXT A;  4POK A;  1URM A;  4ACS A;  5DBQ A;  3ZL5 A;  2I3Y A;  3KMO A;  4O32 A;  1AAZ A;  5A4V A;  4ZXG A;  2IMK A;  1S3C A;  2H73 A;  1B4P A;  2C0D A;  3KTL A;  2VCW A;  4KH7 A;  2B6M A;  16GS A;  4IW9 A;  4AJ6 A;  5DQS A;  4IQA A;  1XWG A;  2FLS A;  2YZU A;  2TRX A;  2DJ0 A;  4N0Z A;  1BG5 A;  4X1U A;  1AUC A;  1ZZY A;  4DSS A;  4WF4 A;  1YQ1 A;  3F63 A;  4ECB A;  1GNE A;  3FY7 A;  4G0I A;  2GSQ A;  5GAP D;  4ECJ A;  3S9F A;  4QQ7 A;  4IN0 A;  1F37 A;  4F9Z A;  2JAC A;  3KXO A;  7GSS A;  3TKR A;  5ID2 B;  2DBC A;  2KHP A;  3E0U A;  5CAX A;  1SK0 A;  4K1F A;  5CRG A;  1YEX A;  2WB9 A;  3GST A;  2AAW A;  5IOX A;  2GQM A;  3SWL A;  3UVH A;  2J9H A;  2NVL A;  2GT6 A;  4PUA A;  4Q5N A;  1R4W A;  1N2A A;  1F3B A;  3ME7 A;  1GSD A;  4HJ2 A;  3GL3 A;  5ELA A;  2HSY A;  5D93 A;  3UL3 A;  5ABR A;  2O8V B;  1OC8 A;  4ZB6 A;  3GKX A;  5BMU A;  1TOF A;  1EP8 A;  1B4Q A;  2H1D A;  5G2Z A;  4BWQ A;  1W4V A;  4HUA A;  4TN8 A;  3DD3 A;  4MCU A;  2JL4 A;  3H79 A;  4G2E A;  1MEK A;  2G0F A;  1K0C A;  2FCH A;  3M8N A;  5IPH A;  3UVT A;  5HFK A;  4PQH A;  1FAA A;  4G10 A;  4JR4 A;  3ZVJ D;  3TCO A;  5J3R A;  2QGV A;  5ECK B;  1GSU A;  2ZCT A;  5ECS A;  3TJG A;  1GTB A;  1J9B A;  3O6T A;  1J08 A;  4MPF A;  2JSZ A;  1LJR A;  4OO4 A;  4KX4 A;  4TR1 A;  3CRT A;  1EOH A;  3FR9 A;  3UJ1 A;  6GSX A;  1ABA A;  3C1S A;  3FW2 A;  4V2L A;  2EIO A;  4MZC A;  1T1V A;  5ECR B;  2N5F A;  3GSS A;  3A5W A;  2VUP A;  1HNC A;  1M9B A;  2H0G A;  1PD2 1;  3DYR A;  2OKA A;  2YZH A;  4IGJ A;  2WGR A;  1GH2 A;  1GUK A;  2P5R A;  3O76 A;  2LQQ A;  5IM9 A;  1GLP A;  4QL9 A;  5COH A;  3C8E A;  2M80 A;  5DCH A;  2B3S A;  1TRU A;  1WMJ A;  2GQK A;  4YQU A;  4CW9 A;  8GSS A;  3HVS A;  3FK8 A;  2CV4 A;  1IYH A;  3VI7 A;  3UOM A;  12GS A;  1Z6M A;  1Q98 A;  4TR3 A;  2ZNM A;  2JZT A;  3AY8 A;  2VL9 A;  3H8Q A;  2CVD A;  2HRK B;  2PVO C;  3KIJ A;  2DML A;  3TGZ A;  2PN8 A;  4CDO A;  5B6N A;  3PR8 A;  1A2M A;  4JR6 A;  5D9W A;  2R5G A;  3ZML A;  3FZ5 A;  4LL1 B;  1A2J A;  1I9D A;  5IIZ A;  2GZY A;  1THX A;  1O81 A;  2HZF A;  1OYJ A;  4D73 B;  3C7M A;  5JCG A;  2V41 A;  9GSS A;  2D2Z A;  1THO A;  1ST9 A;  3HY2 A;  1E6B A;  2FGX A;  2FWG A;  3O3T A;  2C4J A;  4FIW A;  3TRQ A;  2O85 A;  3CMI A;  4FH8 A;  4FYU A;  1SJ6 A;  3KH9 A;  4NAX A;  1YKA A;  4G9H A;  4XS4 A;  2H66 A;  1JHB A;  1OKD A;  4I8B A;  4TXO B;  2HZE B;  2K18 A;  5JWR B;  3F0I A;  1FG4 A;  3QOU A;  1RK4 A;  2QSI A;  1SKW B;  2IMF A;  1CQH A;  2OJL A;  1TU8 A;  4ULX A;  2CZ3 A;  1XPV A;  1O6J A;  2C0G A;  3MSZ A;  3PGT A;  5HFG A;  1A23 A;  1GP1 A;  2YWM A;  3EUR A;  1U6T A;  3TJK A;  3KCM A;  2K8V A;  1A24 A;  3H4K A;  4F82 A;  5AGY A;  1YF1 A;  1SU9 A;  2V6K A;  4AF2 A;  3ZZX A;  1DE2 A;  1VF1 A;  2F3M A;  4HQS A;  1XW6 A;  4WKW A;  4KSM A;  3CBU A;  4POM A;  4I2T A;  2HFD A;  2EIR A;  3E9J B;  4XCS A;  2MBS A;  2A4V A;  2MMN A;  3IC8 A;  2H01 A;  5E59 A;  2F8F A;  4HDE A;  3VLN A;  3HDC A;  3GTU A;  6GSV A;  4KSO A;  1UVZ A;  1TI1 A;  1GUL A;  20GS A;  3F3Q A;  1GLQ A;  3M9J A;  2HXK A;  4ZIL A;  3F4T A;  1EEM A;  3ZMK A;  3QCP A;  1X5E A;  2AV4 A;  3WYW A;  1B9Y C;  3MDK A;  3GX0 A;  1GTU A;  4MA9 A;  4O5R A;  1R7H A;  4MJE A;  2ALB A;  4DSQ A;  3G7I A;  2B5E A;  1F2E A;  1JLV A;  2KLX A;  2X8C A;  5C00 A;  2VCQ A;  4WR4 A;  4AGS A;  1PX7 A;  2PU9 C;  5CYY A;  3M3M A;  2H30 A;  1LU4 A;  1OC9 A;  3ZIT A;  3L4N A;  1JZO A;  5AIX A;  3F6F A;  3QR6 A;  1QMV A;  2IFQ A;  3GL5 A;  5GAN D;  4DVC A;  5DAL A;  1WPI A;  2L6D A;  3F4R A;  3ZFB A;  3IE3 A;  5KN1 A;  1O7U A;  2KP1 A;  4BVY A;  3KMN A;  1ERW A;  3Q74 A;  3OR5 A;  1BED A;  1OKT A;  2OE3 A;  4ZIJ A;  2YOI A;  1SL2 B;  1XXU A;  1ZOF A;  3WGX A;  3N5O A;  4F0C A;  3ERF A;  1UA5 A;  2O87 A;  2DJ3 A;  4JRR A;  1SKR B;  3F9U A;  5KN0 A;  2HSN B;  5IMC A;  5FHI A;  5G5E A;  4EUY A;  3Q18 A;  10GS A;  2VD0 A;  2I9H A;  1X5D A;  2HLS A;  6GSS A;  2OAD A;  4MF5 A;  1M9A A;  5D73 A;  5GSS A;  1MDK A;  5EY6 A;  3LJR A;  3D4T A;  4MDC A;  1QUW A;  2KOK A;  4XS6 A;  5ECL B;  1X0R A;  2ES7 A;  2LUS A;  2YJ7 A;  1OAZ A;  1TRS A;  2H0H A;  2TRC P;  4YAV A;  2EIQ A;  4IQ1 A;  2FWE A;  4LMW A;  1X9S B;  4ECC A;  3CTF A;  5F0G A;  3MWH A;  3HJM A;  5AIS A;  2B5Y A;  3G7J A;  1FB0 A;  1XOA A;  3FHK A;  3IDV A;  2QKE A;  1ERV A;  1YF0 A;  5H5R A;  1HYU A;  2H70 A;  5DJL A;  4MJB A;  4BPY A;  2LJR A;  3QAW A;  2N5B A;  3UAP A;  1B9X C;  3NZN A;  5IO0 A;  2IMD A;  5D96 A;  4JU5 A;  3ED3 A;  3E3E A;  2VCV A;  4KDX A;  2OA7 A;  3P8W A;  4HEA 2;  4MJA A;  4IJI A;  3GRX A;  4MF7 A;  2HQT A;  3HKR A;  4XHM A;  5CRH A;  3QD9 A;  4E8E A;  2C1Y A;  1PMT A;  1MDI A;  3HD5 A;  1V2A A;  4PTS A;  2H0I A;  4F2I A;  3A2W A;  1ZYQ B;  2GLR A;  2FA4 A;  1EWX A;  3GUS A;  3JCM L;  4NMU A;  3PH9 A;  17GS A;  5ID2 A;  3UMA A;  5ECN B;  3KGK A;  3KP8 A;  3ME8 A;  2C3N A;  5ECH B;  2DIZ A;  3V1W A;  3KTB A;  1M2D A;  2A2R A;  5D9V A;  4XTS A;  3DGQ A;  4IP1 A;  4K9Z A;  2CAQ A;  5H5Q A;  4BVX B;  2H71 A;  1TP9 A;  2P5Q A;  1K3Y A;  1PSQ A;  4V1A g;  5EL8 A;  1EGR A;  3EMX A;  2VIM A;  1O73 A;  3DIE A;  1X9W B;  1VGL A;  3MAK A;  1K0M A;  4G19 A;  3RPP A;  4MK3 A;  3UBL A;  5KN3 A;  4EF0 A;  5ECI B;  5INY A;  2C0E A;  2GZZ A;  5CRD A;  1AIU A;  2FY6 A;  2CA8 A;  3L9V A;  2L6C A;  4DEJ A;  4IP6 A;  1V58 A;  3GYK A;  2PVQ A;  5DQY A;  4AJ7 A;  4J2F A;  2WZ9 A;  4F03 A;  4GQF A;  4HU9 A;  4HS1 A;  2C0F A;  1LBK A;  4BL7 B;  2LST A;  3LYK A;  2YNX A;  2AUV A;  1DBY A;  1WWJ A;  2LEG A;  1SEN A;  1K3L A;  1Z7R A;  2H6Y A;  3TRP A;  4K6X A;  3L9S A;  3QAV A;  3VUR A;  3D22 A;  5G30 A;  22GS A;  2C8U A;  3CSJ A;  1PGT A;  4GTU A;  3IV4 A;  4POL A;  2KP2 A;  4RQX A;  1USB A;  1G6W A;  1XWB A;  1YKC A;  4HZ4 A;  3BBY A;  1QQ2 A;  3W8J A;  3HZ8 A;  2JZR A;  3QDN A;  1RW1 A;  4IS0 A;  3TB2 A;  2BJX A;  2I81 A;  4PXO A;  1T4Y A;  1R5A A;  1K0A A;  1K0D A;  3ZFL A;  1WOU A;  2L57 A;  2YN1 A;  1GTI A;  2BMX A;  2YWN A;  4JE1 A;  1U3A A;  4ZB8 A;  4L0U A;  2JSY A;  2IJY A;  2NPB A;  2YCD A;  3HCZ A;  4I5Q A;  2OAC A;  2WUL A;  2B1L A;  1FVJ A;  5HR1 A;  4HQZ A;  3EU3 A;  3US3 A;  1FO5 A;  2R4V A;  2DJ2 A;  1SYX A;  1UN2 A;  4KCE A;  3VI5 A;  5A4W A;  1NSW A;  3BD2 A;  1XWK A;  3HXS A;  1JLW A;  2GSS A;  1TI3 A;  4WBR D;  2L5L A;  3IRA A;  5A4U A;  3W6G A;  5KN2 A;  5CRW A;  4WF5 A;  4OCF A;  2HRK A;  4MMM A;  2IPA A;  4KUN A;  3GKK A;  4J57 E;  1KBN A;  3IBH A;  4BA7 A;  1JZW A;  4QL7 A;  5CNW A;  3HVV A;  1O8W A;  2H76 A;  3DWV A;  1MD3 A;  2OE1 A;  11GS A;  5HFI A;  2LTK A;  2IL3 A;  2FD3 A;  2QC7 A;  1UC7 A;  1NHO A;  3GHA A;  4IVF A;  5B6M A;  1WJK A;  5IMV A;  2R2J A;  1PL2 A;  4D73 A;  2RLI A;  1YJ6 A;  1SYR A;  5ECM B;  2NTO A;  3TJF A;  1XBS A;  2CQ9 A;  2IWT A;  4I2U A;  4JZQ A;  4TVE A;  4X0X A;  2ZUP A;  3HJO A;  2VCT A;  3P90 A;  4OFN A;  2MZC A;  3EU4 A;  4YQV A;  3UIW A;  5F8B A;  3FR3 A;  3I69 A;  1B8X A;  4L5O A;  4ZL7 A;  1ACV A;  4V2M A;  4FQU A;  1XW9 A;  6GST A;  4MAB A;  2JAD A;  13GS A;  5ECQ B;  4TXO A;  1ZGN A;  2HZE A;  3I43 A;  3RPN A;  1TDI A;  3IK9 A;  3IR4 A;  3G7Y A;  3D6I A;  3UAR A;  1NHY A;  3SBC A;  5B7C A;  4KCA A;  4TXV A;  1Z5Y E;  2PUK C;  2F9S A;  2K9F A;  5ENU A;  3QFA C;  1BJX A;  4I97 A;  5DAK B;  5F05 A;  1R26 A;  1TW9 A;  2C3T A;  1T8E B;  3KZQ A;  1YY7 A;  4K7O A;  1PX6 A;  1PKW A;  4PX1 A;  5J4U A;  1SK2 A;  2F51 A;  5DJM A;  4KB3 A;  4RI6 A;  5D8I A;  2HYX A;  2C80 A;  1XCC A;  4Q5R A;  2JZS A;  2VM1 A;  2C3Q A;  3GUR A;  3ZVJ A;  3VWW A;  3UBK A;  2X8G A;  5F07 A;  3MNG A;  2MMA A;  2NDO A;  3IC4 A;  1GSE A;  5GZZ B;  2VCZ A;  3ERG A;  3K8N A;  1HNA A;  4K0G A;  1F6M C;  3DXB A;  5G31 A;  3FZ4 A;  2WFC A;  2XHF A;  2R6K A;  3GIX A;  3WGE A;  5J9C A;  4OO5 A;  4JED A;  2LRT A;  5ELG A;  5HR0 A;  1FVK A;  5FT3 A;  4NV2 A;  3LYP A;  5AIV A;  2B7J A;  1ERU A;  2WRT A;  1MDJ A;  3Q6O A;  1M2B A;  4V2N A;  1TK5 B;  4K0N A;  2REM A;  1Z9H A;  5CO3 A;  2RUF A;  2JU5 A;  1Z7P A;  1VF4 A;  4TRX A;  2V1M A;  2XPE A;  3FR6 A;  4ISD A;  2G2Q A;  5CRE A;  3GMF A;  1V9W A;  1FHE A;  1ZL9 A;  2VAF A;  1T7P B;  2FNO A;  3CYN A;  2V2G A;  3VWV A;  4IJ3 A;  4LMV A;  1PA3 A;  4OFM A;  3LGC A;  1Y6E A;  1CQG A;  1OE8 A;  3G9B A;  2WS2 A;  4O7H A;  4F0B A;  3IHQ A;  4GWR A;  4KW6 A;  18GS A;  4ML1 A;  2OBI A;  2HNL A;  2LJA A;  1VRS D;  4RQR A;  2CT6 A;  4HU7 A;  2FA8 A;  1H75 A;  3BOA A;  3VPT A;  4HJM A;  3EMP A;  2VCX A;  1K0B A;  2HSM B;  3TOT A;  4KF9 A;  2MMO A;  1XOB A;  2CVK A;  4ILF A;  1FOV A;  1A2L A;  3LEF A;  2N5A A;  2XC2 A;  5G5F A;  3PIN A;  5E4W A;  2DSA A;  4G0L A;  2I1U A;  4P3Y B;  2VOC A;  3HVX A;  3CSI A;  2MBT A;  1GSS A;  1GNW A;  4H86 A;  3GNJ A;  4IEL A;  1YDK A;  2AHE A;  2XPD A;  4PNF A;  3WD6 A;  4LA1 A;  2YJH A;  2IME A;  2LV3 A;  3U6V A;  2H1A A;  1YZX A;  2E7P A;  1JZD A;  3IK7 A;  3EWL A;  3VFI A;  3IAM 2;  5IPG A;  2E2M A;  1PN9 A;  3IPZ A;  3FZ9 A;  1XZO A;  4KND A;  1AXD A;  5L71 A;  1M7T A;  2P0G A;  2MYG A;  4ML6 A;  4L5L A;  1VF3 A;  2IIY A;  1ML6 A;  6GSW A;  5H5S A;  3KM6 A;  4ZBD A;  4MZW A;  3TDG A;  3F4S A;  3WT1 A;  5B8A A;  1XWA A;  1QXH A;  1GSQ A;  3I9V 2;  3CTG A;  5F06 A;  1SKS B;  4OWY A;  1WP0 A;  3ZYW A;  5J9B A;  5GST A;  2HT9 A;  4MH3 A;  3M9K A;  2HE3 A;  3BCK A;  4V1A p;  1MD4 A;  5LD0 A;  4MLY A;  3H1N A;  1E2Y A;  3LFL A;  3EIN A;  4BVX A;  2V6O A;  1PKZ A;  3FKF A;  4PQ1 A;  2K6V A;  2WCI A;  4ID0 A;  2VLT A;  4NWY A;  4POB A;  4PQI A;  3DVW A;  1EEJ A;  1WE0 A;  2UZ8 A;  2P31 A;  2H74 A;  1TU7 A;  4GCI A;  4E8H A;  5J41 A;  4EVM A;  2LS5 A;  3TKS E;  2GST A;  5LNK e;  2WDU A;  1F3A A;  3M0F A;  4JBB A;  3F8U A;  4EDZ A;  2AYT A;  1PL1 A;  4K7I A;  1KTE A;  4EKZ A;  4K2D A;  3J7Y k;  4PGT A;  2L59 A;  3RAZ A;  3FRC A;  4HZ2 A;  2DIY A;  2PMT A;  1W89 A;  2MMZ A;  4L8E A;  5LCZ A;  1BQ7 A;  5IMD A;  4BL7 A;  3VWU A;  2VM2 A;  4TW5 A;  4EC0 A;  2LNS A;  1TJD A;  3APS A;  2H72 A;  2RII A;  4MH2 A;  5B8B A;  3UEM A;  2CAI A;  1C72 A;  1A8Y A;  5IMF A;  2ON7 A;  5DVB A;  3GH9 A;  3HZ4 A;  3KH7 A;  3LOR A;  2VL2 A;  3A3T A;  3WT2 A;  1ON4 A;  19GS A;  4NPB A;  4AJ8 A;  1BAY A;  4IKH A;  4WBJ A;  1PQN A;  5G1K A;  2H6X A;  2PPT A;  5KEJ A;  4BWS A;  4FYB A;  3LXT A;  1ILO A;  4YAP A;  5JWO B;  1GSF A;  1SK1 A;  2RUE A;  3FEU A;  1AQW A;  4HOJ A;  1GSY A;  5JWQ B;  1S3A A;  4MJC A;  1V40 A;  3HHV A;  1OVN A;  2IMI A;  3IA1 A;  4KDU A;  3L9U A;  5ECO B;  1QGV A;  2GDR A;  3TKS A;  4DSS B;  2ON5 A;  5ECP B;  3DKS A;  5CP1 A;  3CRU A;  3LQ7 A;  4MP4 A;  1R5P A;  1FB6 A;  1BYE A;  4Q5F A;  1A0R P;  4NHW A;  2PGT A;  4LLR A;  4LL4 B;  2VLV A;  2GGT A;  3ZRD A;  4OCE A;  1OE7 A;  3D21 A;  1KNG A;  5IQY A;  2H6Z A;  3A2X A;  2H75 A;  1EOG A;  2BTO T;  2YV7 A;  2OBK A;  2EC4 A;  3GKM A;  1K3O A;  1Q4J A;  4N11 A;  1DUG A;  5EVO A;  1SJZ A;  5HQP A;  2YV9 A;  2YAN A;  1NW2 A;  1TKD B;  4WET A;  3HA9 A;  3N9J A;  1SD8 A;  4K7N A;  2YP6 A;  1TRW A;  3VWX A;  3F6D A;  2O89 A;  2R3X A;  4KE3 A;  4PNG A;  4DSR A;  1ZMA A;  2VL2 C;  1JZR A;  2HRN A;  4CHS A;  2E2G A;  3NOF A;  4O92 A;  3FYG A;  1TXX A;  2RM5 A;  3GFK A;  3ZIJ A;  2YPM A;  3P7X A;  2CX3 A;  3RHB A;  2DLX A;  4KAE A;  3DVX A;  2E0Q A;  1AQX A;  3CSH A;  3QAG A;  3EYT A;  1S3D A;  2Z9S A;  4RI7 A;  3RDW A;  1SJI A;  2FWF A;  4OMV A;  1OC3 A;  3QMX A;  5IOW A;  1Z6N A;  2L5O A;  5DAK A;  3TKS C;  3APQ A;  4X43 A;  3RBT A;  2TIR A;  2DC5 A;  3NIV A;  3D0Z A;  3Q19 A;  3QFB C;  1A8L A;  4GLT A;  2H1G A;  2H1B A;  2H8L A;  4WR5 A;  4J56 E;  3TUE A;  4TR1 B;  5IO2 A;  4FO5 A;  3ZRE A;  1ZCP A;  1ZYE A;  2PER A;  5G1L A;  2LRC A;  2HRA A;  3HJP A;  4TOP A;  2RM6 A;  3J7Y b;  1T4Z A;  14GS A;  4IBP A;  5IMA A;  6GSU A;  2CX4 A;  4GQC A;  4N10 A;  3APO A;  5A5K A;  3DML A;  4MF6 A;  3D5J A;  2L4C A;  3GX8 A;  2B1K A;  4MZB A;  2YWO A;  2F8A A;  1G6Y A;  2GVP A;  1GTA A;  1JFU A;  1O85 A;  1M2A A;  2HSH A;  2AJQ B;  1Y25 A;  2DJK A;  2LNT A;  2FHE A;  5DDL A;  2B5X A;  4XIH A;  1XVW A;  2A2S A;  3W8S A;  1MTC A;  1J0F A;  1A0F A;  4ECI A;  5EPF A;  1AC1 A;  5AN1 A;  3L78 A;  3HYP A;  1X5C A;  2FWH A;  3R2Q A;  3KEB A;  4KDY A;  1XVQ A;  4NHZ A;  4TR4 A;  3EVI A;  1XFL A;  2NBS A;  1K0N A;  1AQV A;  1DSB A;  1XIY A;  4IHU A;  2GSR A;  4TKY A;  1EV9 A;  3RHC A;  3BCI A;  2GQL A;  2VL3 A;  2X8H A;  5D9T A;  2M72 A;  3DEX A;  4WEY A;  1TTZ A;  3R3E A;  5C04 A;  1EP7 A;  3GA4 A;  5JCU A;  3C1R A;  3LXZ A;  3KJY A;  3DRN A;  2DJJ A;  1TK8 B;  2L4Q A;  3C73 A;  2LRN A;  4USS A;  1Z3E A;  3KP9 A;  4KGI A;  1M99 A;  2LQO A;  4ZBA A;  1KEB A;  2XBI A;  3BJ5 A;  4FYC A;  2VD1 A;  2GT5 A;  4KA0 A;  4GST A;  3D4M A;  1GL8 A;  3KD0 A;  1XWC A;  4GF0 A;  1FW1 A;  1DE1 A;  3C71 A;  1V98 A;  2O7K A;  1EGO A;  1K0O A;  3H93 A;  4XS4 B;  1GRX A;  2HRF A;  4OD7 A;  1GUH A;  1TK0 B;  3IAS 2;  1G0T A;  1WRY A;  3LWA A;  1TRV A;  3LG6 A;  1H4O A;  3GN3 A;  4EO3 A;  2X99 A;  4XRA A;  2X64 A;  2XBQ A;  2HSM A;  1T00 A;  2I4A A;  3LSZ A;  4RUV A;  2K8S A;  3ZIV A;  3TOU A;  4NXI A;  1VF2 A;  1N8J A;  5J5N A;  4XS1 A;  1HNB A;  1HD2 A;  1F9M A;  2PBJ A;  2V32 A;  3EE2 A;  4G0K A;  1WIK A;  2PWJ A;  4ZBB A;  3M1G A;  1QFN A;  4I6X A;  3ERW A;  4EL1 A;  1NM3 A;  4YQM A;  2DJ1 A;  2YWI A;  3GTU B;  4K8M A;  2DMM A;  1IYI A;  3ISO A;  2H19 A;  2VO4 A;  3IOS A;  1AW9 A;  1I5G A;  2M46 A;  3P2A A;  1U87 A;  4HI7 A;  3FZA A;  2LJK A;  4XRD A;  4EXJ A;  5IMZ A;  4TR0 A;  4N0V A; 
#chains in the Genus database with same CATH topology
 3TJJ A;  5D9X A;  4MPG A;  1B48 A;  2GTU A;  1PFO A;  3ZLP A;  3TKQ A;  2R0G A;  4EDY A;  4PUF C;  1G7O A;  2KUC A;  1U88 A;  2HI7 A;  1GUM A;  2CVB A;  2GS3 A;  2GZP A;  2J23 A;  4GSS A;  4W66 A;  4ZB9 A;  1M0U A;  1OC9 B;  3I6A A;  4PUR A;  2IFQ B;  3TKP A;  1QK8 A;  5HR3 A;  1ZYN A;  4GXZ A;  1HQO A;  5DAL B;  5DCG A;  5FWG A;  3QPM A;  4BVY B;  5JCW A;  2AB6 A;  1SD9 A;  4Z7X A;  3TRX A;  3F3R A;  1SL1 B;  4GSN A;  4ZL8 A;  1XW5 A;  1U3I A;  2B7K A;  3CXG A;  2OE0 A;  3A5I A;  4ZL9 A;  1X9M B;  3WGD A;  4NV5 A;  1PRX A;  4L0W A;  3GV1 A;  3L0H A;  4GRF A;  2R37 A;  3TJB A;  4OFT A;  1SL0 B;  1GWC A;  2VLU A;  6GSY A;  1BG1 A;  5HR2 A;  3VK9 A;  3GH6 A;  3GKN A;  2LKU A;  4N30 A;  1TXU A;  1M3J A;  1T3B A;  3EC3 A;  2FUG 2;  3IHG A;  2IN3 A;  1RQM A;  1G7E A;  1BX9 A;  1EV4 A;  3PPU A;  4EE0 A;  1V57 A;  2WJU A;  4Q5Q A;  1EZK A;  3VPQ A;  3A2V A;  2CZ2 A;  1ERT A;  1YEP A;  4YH2 A;  1O8X A;  3U5R E;  3IXR A;  3ZTL A;  4WXT A;  4POK A;  1URM A;  4ACS A;  5DBQ A;  3ZL5 A;  2I3Y A;  3KMO A;  4O32 A;  1AAZ A;  5A4V A;  4ZXG A;  5A1N A;  2IMK A;  1S3C A;  2H73 A;  2WVX B;  1B4P A;  2C0D A;  3KTL A;  2VCW A;  4KH7 A;  2B6M A;  16GS A;  4IW9 A;  4AJ6 A;  5DQS A;  4IQA A;  1XWG A;  2FLS A;  2YZU A;  4AKX B;  2TRX A;  2EFD A;  2DJ0 A;  4EIQ A;  4N0Z A;  1BG5 A;  4X1U A;  5A34 A;  1SVM A;  1AUC A;  1ZZY A;  4DSS A;  4WF4 A;  1YQ1 A;  3F63 A;  4ECB A;  1GNE A;  3FY7 A;  4G0I A;  2GSQ A;  5GAP D;  4ECJ A;  3S9F A;  4QQ7 A;  4IN0 A;  4YKF A;  1F37 A;  4F9Z A;  2A2P A;  2JAC A;  3KXO A;  7GSS A;  2R0C A;  2WW3 A;  3TKR A;  5ID2 B;  2DBC A;  2KHP A;  4PI2 C;  3E0U A;  5CAX A;  1SK0 A;  3FMW A;  4K1F A;  5CRG A;  1YEX A;  2WB9 A;  3GST A;  2AAW A;  5IOX A;  2GQM A;  3SWL A;  3UVH A;  2J9H A;  2NVL A;  2GT6 A;  4PUA A;  4Z2T A;  4Q5N A;  1R4W A;  1N2A A;  1F3B A;  3ME7 A;  1GSD A;  4HJ2 A;  3GL3 A;  5ELA A;  2HSY A;  2O5V A;  5D93 A;  3UL3 A;  5ABR A;  2O8V B;  1OC8 A;  4ZB6 A;  3GKX A;  5BMU A;  1TOF A;  1EP8 A;  1B4Q A;  1PN0 A;  2H1D A;  5G2Z A;  4BWQ A;  1W4V A;  4HUA A;  2QA1 A;  4TN8 A;  3DD3 A;  4MCU A;  2JL4 A;  3H79 A;  4G2E A;  1MEK A;  2G0F A;  1K0C A;  2FCH A;  3M8N A;  5IPH A;  3UVT A;  5HFK A;  4PQH A;  1FAA A;  4G10 A;  4JR4 A;  3ZVJ D;  3TCO A;  5J3R A;  2QGV A;  5ECK B;  1GSU A;  2ZCT A;  5ECS A;  3TJG A;  1GTB A;  1J9B A;  3O6T A;  1J08 A;  4CY6 A;  4MPF A;  2JSZ A;  1LJR A;  4OO4 A;  4AKI A;  4KX4 A;  4TR1 A;  3CRT A;  1EOH A;  3FR9 A;  3UJ1 A;  1FOH A;  6GSX A;  1ABA A;  3C1S A;  3FW2 A;  4V2L A;  2EIO A;  4MZC A;  1T1V A;  5ECR B;  2N5F A;  3GSS A;  3A5W A;  2VUP A;  1HNC A;  1M9B A;  4O5U A;  2H0G A;  1PD2 1;  3DYR A;  2OKA A;  2YZH A;  4IGJ A;  2WGR A;  1GH2 A;  1GUK A;  2P5R A;  3O76 A;  2LQQ A;  5IM9 A;  1GLP A;  4QL9 A;  5COH A;  3C8E A;  2M80 A;  5DCH A;  2B3S A;  1TRU A;  1WMJ A;  2GQK A;  4YQU A;  4CW9 A;  8GSS A;  3HVS A;  3FK8 A;  2CV4 A;  1IYH A;  3VI7 A;  3UOM A;  12GS A;  1Z6M A;  1Q98 A;  4TR3 A;  2ZNM A;  2JZT A;  3AY8 A;  2VL9 A;  3H8Q A;  2CVD A;  2HRK B;  2PVO C;  3KIJ A;  2DML A;  3TGZ A;  2PN8 A;  4CDO A;  5B6N A;  3PR8 A;  1A2M A;  4JR6 A;  4A5P A;  5D9W A;  4E68 A;  2R5G A;  3ZML A;  3FZ5 A;  4LL1 B;  1BF5 A;  1A2J A;  1I9D A;  5IIZ A;  2GZY A;  1THX A;  1O81 A;  2HZF A;  1OYJ A;  4D73 B;  3C7M A;  3HMJ G;  5JCG A;  2V41 A;  9GSS A;  2D2Z A;  1THO A;  1ST9 A;  3HY2 A;  1E6B A;  2FGX A;  2FWG A;  2WW0 A;  1I1I P;  3O3T A;  2C4J A;  4FIW A;  3TRQ A;  2O85 A;  3CMI A;  4FH8 A;  4FYU A;  1SJ6 A;  3KH9 A;  4EIP A;  4MNN A;  4NAX A;  1YKA A;  4G9H A;  4XS4 A;  2X4A A;  2H66 A;  1JHB A;  1OKD A;  4I8B A;  4TXO B;  2HZE B;  1S4B P;  2K18 A;  5JWR B;  3F0I A;  1FG4 A;  3QOU A;  1RK4 A;  2QSI A;  1SKW B;  2IMF A;  1CQH A;  2OJL A;  1TU8 A;  4ULX A;  2CZ3 A;  1XPV A;  1O6J A;  2C0G A;  3MSZ A;  3PGT A;  5HFG A;  1A23 A;  1GP1 A;  2YWM A;  3CWG A;  3EUR A;  1U6T A;  3TJK A;  4BIK A;  3KCM A;  2K8V A;  1A24 A;  3H4K A;  4F82 A;  5AGY A;  1YF1 A;  1SU9 A;  2V6K A;  4AF2 A;  3ZZX A;  1DE2 A;  1N25 A;  1VF1 A;  2F3M A;  4HQS A;  1XW6 A;  4WKW A;  4KSM A;  3CBU A;  4POM A;  4I2T A;  2HFD A;  2EIR A;  3E9J B;  4XCS A;  2MBS A;  2A4V A;  2MMN A;  5KOW A;  3IC8 A;  5KOX A;  2H01 A;  5E59 A;  2F8F A;  4HDE A;  3VLN A;  3HDC A;  2QA2 A;  3GTU A;  6GSV A;  4KSO A;  1UVZ A;  1TI1 A;  1GUL A;  20GS A;  3F3Q A;  4YKG A;  1GLQ A;  3M9J A;  1XG8 A;  2HXK A;  4ZIL A;  3F4T A;  1EEM A;  3ZMK A;  3QCP A;  1X5E A;  2AV4 A;  3WYW A;  1B9Y C;  3MDK A;  3GX0 A;  1GTU A;  4MA9 A;  4O5R A;  1R7H A;  4MJE A;  2ALB A;  4DSQ A;  3G7I A;  2B5E A;  1F2E A;  1JLV A;  2KLX A;  2X8C A;  5C00 A;  2VCQ A;  4WR4 A;  4AGS A;  1PX7 A;  2PU9 C;  5CYY A;  3M3M A;  2H30 A;  1LU4 A;  1OC9 A;  3ZIT A;  3L4N A;  1JZO A;  5AIX A;  3F6F A;  3QR6 A;  1QMV A;  2IFQ A;  3GL5 A;  5GAN D;  4DVC A;  5DAL A;  1WPI A;  2L6D A;  3F4R A;  3ZFB A;  3IE3 A;  5KN1 A;  1O7U A;  4K5R A;  2KP1 A;  4BVY A;  2O3E A;  3KMN A;  1ERW A;  3Q74 A;  3OR5 A;  1BED A;  1OKT A;  4AKH A;  2OE3 A;  4ZIJ A;  2YOI A;  1SL2 B;  1XXU A;  1ZOF A;  3WGX A;  3N5O A;  1YEW C;  4F0C A;  3ERF A;  1UA5 A;  2O87 A;  4HSC X;  2DJ3 A;  4JRR A;  1SKR B;  3RGB C;  3F9U A;  5KN0 A;  2HSN B;  5IMC A;  5FHI A;  5G5E A;  4EUY A;  3Q18 A;  10GS A;  2VD0 A;  2I9H A;  1X5D A;  2HLS A;  6GSS A;  2OAD A;  4MF5 A;  1M9A A;  5D73 A;  5GSS A;  1MDK A;  5EY6 A;  3LJR A;  3D4T A;  4PHZ C;  4MDC A;  1QUW A;  2KOK A;  4XS6 A;  5ECL B;  1X0R A;  2ES7 A;  2LUS A;  2YJ7 A;  1OAZ A;  1TRS A;  2H0H A;  2TRC P;  4YAV A;  2EIQ A;  4IQ1 A;  2FWE A;  4LMW A;  1X9S B;  4ECC A;  3CTF A;  5F0G A;  2WVX A;  3MWH A;  3HJM A;  5AIS A;  2B5Y A;  3G7J A;  1FB0 A;  1XOA A;  3FHK A;  3IDV A;  2QKE A;  1ERV A;  1YF0 A;  5H5R A;  1HYU A;  2H70 A;  5DJL A;  4MJB A;  4BPY A;  5J47 A;  2LJR A;  3QAW A;  2N5B A;  3UAP A;  1B9X C;  3NZN A;  5IO0 A;  2IMD A;  5D96 A;  4JU5 A;  3ED3 A;  3E3E A;  2VCV A;  4KDX A;  2OA7 A;  3P8W A;  4HEA 2;  4MJA A;  2WW1 A;  4IJI A;  3GRX A;  4MF7 A;  2HQT A;  3HKR A;  4XHM A;  5CRH A;  3QD9 A;  4E8E A;  2C1Y A;  4FXY P;  1PMT A;  1MDI A;  3HD5 A;  1V2A A;  4PTS A;  2H0I A;  4F2I A;  3A2W A;  1ZYQ B;  2GLR A;  2FA4 A;  1EWX A;  3GUS A;  2R0P A;  3JCM L;  4NMU A;  3PH9 A;  17GS A;  5ID2 A;  4X4J A;  3UMA A;  5ECN B;  3KGK A;  3KP8 A;  3ME8 A;  2C3N A;  5ECH B;  2DIZ A;  3V1W A;  3KTB A;  1M2D A;  2A2R A;  5D9V A;  4XTS A;  3DGQ A;  4IP1 A;  4K9Z A;  2CAQ A;  5H5Q A;  4BVX B;  2H71 A;  2P5Q A;  1TP9 A;  1K3Y A;  1PSQ A;  4V1A g;  5EL8 A;  1EGR A;  3EMX A;  2VIM A;  1O73 A;  3DIE A;  1X9W B;  1VGL A;  3MAK A;  1K0M A;  4G19 A;  3RPP A;  4MK3 A;  3UBL A;  5KN3 A;  4EF0 A;  5ECI B;  5INY A;  2C0E A;  2GZZ A;  5CRD A;  1AIU A;  2FY6 A;  2CA8 A;  3L9V A;  2L6C A;  4DEJ A;  4IP6 A;  1V58 A;  3GYK A;  2PVQ A;  5DQY A;  4AJ7 A;  2UV8 G;  4J2F A;  2WZ9 A;  4F03 A;  4GQF A;  4HU9 A;  4HS1 A;  2C0F A;  1M3I A;  1LBK A;  4BL7 B;  2LST A;  3LYK A;  2YNX A;  2AUV A;  1DBY A;  1WWJ A;  2LEG A;  1SEN A;  1K3L A;  1Z7R A;  2H6Y A;  3TRP A;  4K6X A;  3L9S A;  3QAV A;  3VUR A;  3D22 A;  5G30 A;  22GS A;  2C8U A;  3CSJ A;  1PGT A;  4GTU A;  3IV4 A;  4POL A;  2KP2 A;  4RQX A;  1USB A;  1G6W A;  1XWB A;  1YKC A;  4HZ4 A;  3BBY A;  1QQ2 A;  3W8J A;  3HZ8 A;  2JZR A;  3QDN A;  1RW1 A;  4IS0 A;  3TB2 A;  2BJX A;  2I81 A;  4PXO A;  1T4Y A;  1R5A A;  1K0A A;  1K0D A;  3ZFL A;  1WOU A;  2L57 A;  2YN1 A;  1SVL A;  1GTI A;  2BMX A;  2YWN A;  4JE1 A;  1U3A A;  4ZB8 A;  4L0U A;  2JSY A;  2IJY A;  2NPB A;  2YCD A;  3HCZ A;  4I5Q A;  2OAC A;  2WUL A;  2B1L A;  1FVJ A;  5HR1 A;  4HQZ A;  3EU3 A;  3US3 A;  1FO5 A;  2R4V A;  2DJ2 A;  1SYX A;  1UN2 A;  4KCE A;  3VI5 A;  5A4W A;  1NSW A;  3BD2 A;  1XWK A;  3HXS A;  1JLW A;  2GSS A;  1TI3 A;  4WBR D;  2L5L A;  3IRA A;  5A4U A;  3W6G A;  5KN2 A;  2WVZ A;  3LW9 A;  5CRW A;  4WF5 A;  4OCF A;  2HRK A;  4MMM A;  2IPA A;  4KUN A;  3GKK A;  4J57 E;  1KBN A;  3IBH A;  4BA7 A;  1JZW A;  4QL7 A;  5CNW A;  3HVV A;  1O8W A;  2H76 A;  3DWV A;  1MD3 A;  2OE1 A;  11GS A;  5HFI A;  2LTK A;  2IL3 A;  2FD3 A;  2QC7 A;  1UC7 A;  1NHO A;  3GHA A;  4IVF A;  5B6M A;  1WJK A;  5IMV A;  2R2J A;  1PL2 A;  4D73 A;  2RLI A;  1YJ6 A;  1SYR A;  5ECM B;  4GDF A;  2A4H A;  2NTO A;  3TJF A;  1XBS A;  2CQ9 A;  2IWT A;  4I2U A;  4JZQ A;  4TVE A;  4X0X A;  2ZUP A;  3HJO A;  2VCT A;  3P90 A;  4OFN A;  2MZC A;  3EU4 A;  4YQV A;  3UIW A;  5F8B A;  3FR3 A;  3I69 A;  1B8X A;  4L5O A;  4ZL7 A;  4QMK A;  1ACV A;  4V2M A;  4FQU A;  1XW9 A;  6GST A;  4MAB A;  2JAD A;  13GS A;  5ECQ B;  4TXO A;  1ZGN A;  2HZE A;  3I43 A;  3RPN A;  1TDI A;  3IK9 A;  3IR4 A;  3G7Y A;  3D6I A;  3UAR A;  1NHY A;  3SBC A;  5B7C A;  4KCA A;  4TXV A;  1Z5Y E;  2PUK C;  2F9S A;  2K9F A;  5ENU A;  3QFA C;  1BJX A;  4I97 A;  5DAK B;  5F05 A;  1R26 A;  1TW9 A;  2C3T A;  1T8E B;  3KZQ A;  1YY7 A;  4K7O A;  1PX6 A;  1PKW A;  4PX1 A;  5J4U A;  1SK2 A;  2F51 A;  5DJM A;  4KB3 A;  4RI6 A;  5D8I A;  2DKH A;  2HYX A;  2C80 A;  1XCC A;  4Q5R A;  2JZS A;  2VM1 A;  2C3Q A;  3GUR A;  3ZVJ A;  3VWW A;  3UBK A;  2X8G A;  5F07 A;  3MNG A;  2MMA A;  2NDO A;  3IC4 A;  1GSE A;  5GZZ B;  2VCZ A;  3ERG A;  3TU3 B;  3K8N A;  1HNA A;  4K0G A;  1F6M C;  3DXB A;  2H1L A;  5G31 A;  3FZ4 A;  2WFC A;  2XHF A;  2R6K A;  3GIX A;  3WGE A;  5J9C A;  4OO5 A;  4JED A;  2LRT A;  5ELG A;  5HR0 A;  1FVK A;  5FT3 A;  4NV2 A;  3LYP A;  5AIV A;  2B7J A;  1ERU A;  2WRT A;  1MDJ A;  3Q6O A;  1M2B A;  4V2N A;  1TK5 B;  4K0N A;  2REM A;  1Z9H A;  5CO3 A;  2RUF A;  2JU5 A;  1Z7P A;  4ZB7 A;  1VF4 A;  4TRX A;  2V1M A;  2XPE A;  3FR6 A;  4ISD A;  4PI0 C;  2G2Q A;  5CRE A;  3GMF A;  1V9W A;  1SVO A;  1FHE A;  1ZL9 A;  2VAF A;  1T7P B;  2FNO A;  3CYN A;  2V2G A;  3VWV A;  4IJ3 A;  4LMV A;  1PA3 A;  4OFM A;  2X49 A;  3LGC A;  1Y6E A;  1CQG A;  1OE8 A;  4AI6 A;  2HSN A;  3G9B A;  2WS2 A;  4O7H A;  4F0B A;  3IHQ A;  4GWR A;  4KW6 A;  1S3R A;  18GS A;  4ML1 A;  2OBI A;  2HNL A;  2LJA A;  1VRS D;  4RQR A;  2CT6 A;  4HU7 A;  2FA8 A;  1H75 A;  3BOA A;  3VPT A;  2O36 A;  4HJM A;  3EMP A;  2VCX A;  1K0B A;  2HSM B;  3TOT A;  4KF9 A;  2MMO A;  1XOB A;  2CVK A;  5A5H B;  4ILF A;  1FOV A;  1A2L A;  3LEF A;  2N5A A;  2XC2 A;  3CQF A;  5G5F A;  3PIN A;  5E4W A;  3EPT A;  2DSA A;  4G0L A;  2I1U A;  4P3Y B;  2VOC A;  3HVX A;  3CSI A;  2MBT A;  1GSS A;  1GNW A;  4H86 A;  3GNJ A;  4IEL A;  1YDK A;  2AHE A;  2XPD A;  4PNF A;  3WD6 A;  4LA1 A;  2YJH A;  2IME A;  2LV3 A;  3U6V A;  2H1A A;  1YZX A;  2E7P A;  1JZD A;  3IK7 A;  3EWL A;  3VFI A;  3IAM 2;  5IPG A;  2E2M A;  1PN9 A;  3IPZ A;  3FZ9 A;  1XZO A;  4KND A;  1AXD A;  5L71 A;  1M7T A;  2P0G A;  2MYG A;  4ML6 A;  4L5L A;  1VF3 A;  2IIY A;  1ML6 A;  6GSW A;  5H5S A;  3KM6 A;  5J4Y A;  4ZBD A;  4MZW A;  3TDG A;  3F4S A;  3WT1 A;  5B8A A;  1XWA A;  5BRT A;  1QXH A;  1GSQ A;  4K2X A;  3I9V 2;  3CTG A;  5F06 A;  2EFC A;  1SKS B;  4OWY A;  1WP0 A;  3ZYW A;  5J9B A;  5GST A;  2HT9 A;  4MH3 A;  3M9K A;  2HE3 A;  3BCK A;  4V1A p;  1MD4 A;  5LD0 A;  4MLY A;  2OT3 A;  3H1N A;  2WZS A;  1E2Y A;  3LFL A;  2VKZ G;  3EIN A;  4BVX A;  2V6O A;  1PKZ A;  3FKF A;  4PQ1 A;  2K6V A;  2WCI A;  4ID0 A;  2VLT A;  4NWY A;  4POB A;  4PQI A;  3DVW A;  1EEJ A;  1WE0 A;  2UZ8 A;  2P31 A;  2H74 A;  1TU7 A;  4GCI A;  4E8H A;  5J41 A;  4N3Z A;  4EVM A;  2LS5 A;  3TKS E;  2GST A;  5LNK e;  2WDU A;  1F3A A;  3M0F A;  4JBB A;  3F8U A;  4EDZ A;  2AYT A;  1PL1 A;  4K7I A;  1KTE A;  4EKZ A;  4K2D A;  3CHX C;  3J7Y k;  4PGT A;  2L59 A;  3RAZ A;  3FRC A;  4HZ2 A;  2DIY A;  2PMT A;  1W89 A;  2MMZ A;  4L8E A;  5LCZ A;  1BQ7 A;  5IMD A;  4BL7 A;  4Z2U A;  1ZYP A;  3VWU A;  2VM2 A;  4TW5 A;  4EC0 A;  2LNS A;  1TJD A;  3APS A;  2H72 A;  2EFH A;  2RII A;  4MH2 A;  5B8B A;  3UEM A;  2CAI A;  1C72 A;  1A8Y A;  5IMF A;  2ON7 A;  5DVB A;  3GH9 A;  3HZ4 A;  3KH7 A;  3LOR A;  2VL2 A;  3A3T A;  3WT2 A;  1ON4 A;  5A1N B;  19GS A;  4NPB A;  4AJ8 A;  1BAY A;  4IKH A;  4WBJ A;  1PQN A;  5G1K A;  2H6X A;  2PPT A;  5KEJ A;  4BWS A;  4FYB A;  1YVL A;  3LXT A;  1ILO A;  4YAP A;  5JWO B;  4K5S A;  1GSF A;  1SK1 A;  2RUE A;  3FEU A;  1AQW A;  4HOJ A;  1GSY A;  5JWQ B;  1S3A A;  4MJC A;  1V40 A;  3HHV A;  1OVN A;  2IMI A;  5A34 B;  3IA1 A;  4KDU A;  3L9U A;  5ECO B;  1QGV A;  2GDR A;  3TKS A;  4DSS B;  2ON5 A;  5ECP B;  3DKS A;  5CP1 A;  3CRU A;  3LQ7 A;  4MP4 A;  1R5P A;  1FB6 A;  1BYE A;  4Q5F A;  1A0R P;  2EFE A;  3MIX A;  4NHW A;  2PGT A;  4LLR A;  4LL4 B;  2VLV A;  2GGT A;  3ZRD A;  2DKI A;  4OCE A;  1OE7 A;  3D21 A;  1KNG A;  5IQY A;  2H6Z A;  3A2X A;  2H75 A;  1EOG A;  2BTO T;  2YV7 A;  2OBK A;  2EC4 A;  3GKM A;  1K3O A;  2WVY A;  1Q4J A;  4N11 A;  1DUG A;  5EVO A;  1SJZ A;  5HQP A;  2YV9 A;  2YAN A;  1NW2 A;  1TKD B;  1Y1U A;  4WET A;  3HA9 A;  3N9J A;  1SD8 A;  4K7N A;  2YP6 A;  1TRW A;  3VWX A;  3F6D A;  2O89 A;  2R3X A;  4KE3 A;  4PNG A;  4DSR A;  1ZMA A;  2VL2 C;  1JZR A;  2HRN A;  4CHS A;  2E2G A;  3NOF A;  4O92 A;  3FYG A;  1TXX A;  2RM5 A;  3GFK A;  3ZIJ A;  5BMU B;  2YPM A;  3P7X A;  2CX3 A;  3RHB A;  2DLX A;  4KAE A;  3DVX A;  2E0Q A;  1AQX A;  3CSH A;  3QAG A;  3EYT A;  1S3D A;  2Z9S A;  4RI7 A;  3RDW A;  1SJI A;  2FWF A;  4OMV A;  4AKG A;  1OC3 A;  3QMX A;  5IOW A;  1Z6N A;  2L5O A;  5DAK A;  3TKS C;  3APQ A;  4X43 A;  3RBT A;  2TIR A;  2DC5 A;  3NIV A;  3D0Z A;  3Q19 A;  3QFB C;  1A8L A;  4GLT A;  2H1G A;  2H1B A;  2H8L A;  4WR5 A;  4J56 E;  3TUE A;  4TR1 B;  5IO2 A;  4FO5 A;  3ZRE A;  1ZCP A;  1ZYE A;  2PER A;  5G1L A;  2LRC A;  2HRA A;  3HJP A;  4TOP A;  2RM6 A;  3J7Y b;  1T4Z A;  14GS A;  4IBP A;  5IMA A;  6GSU A;  2CX4 A;  4GQC A;  4N10 A;  3APO A;  5A5K A;  3DML A;  4MF6 A;  3D5J A;  2L4C A;  3GX8 A;  2B1K A;  4MZB A;  2YWO A;  2F8A A;  1G6Y A;  4Z2R A;  2GVP A;  1GTA A;  1JFU A;  1O85 A;  1M2A A;  2HSH A;  2AJQ B;  1Y25 A;  2DJK A;  2LNT A;  2FHE A;  5DDL A;  2B5X A;  4XIH A;  1XVW A;  2A2S A;  3W8S A;  1MTC A;  1J0F A;  1A0F A;  4ECI A;  5EPF A;  2WW2 A;  1AC1 A;  5AN1 A;  3L78 A;  3HYP A;  1X5C A;  2FWH A;  3R2Q A;  3KEB A;  4KDY A;  1XVQ A;  4NHZ A;  3RFR C;  4TR4 A;  3EVI A;  1XFL A;  2NBS A;  1K0N A;  1AQV A;  1DSB A;  1XIY A;  4IHU A;  2GSR A;  4TKY A;  1EV9 A;  3RHC A;  3BCI A;  2GQL A;  2VL3 A;  2X8H A;  5D9T A;  2M72 A;  3DEX A;  4WEY A;  1TTZ A;  3R3E A;  5C04 A;  1EP7 A;  3HVN A;  3GA4 A;  5JCU A;  3C1R A;  3LXZ A;  3KJY A;  3DRN A;  2DJJ A;  1TK8 B;  2L4Q A;  3C73 A;  2LRN A;  4USS A;  1Z3E A;  3KP9 A;  4KGI A;  1M99 A;  2LQO A;  4ZBA A;  1KEB A;  2XBI A;  3BJ5 A;  4FYC A;  3MYD A;  2VD1 A;  2GT5 A;  4KA0 A;  4GST A;  3D4M A;  1GL8 A;  5J40 A;  3KD0 A;  1XWC A;  4GF0 A;  1FW1 A;  1DE1 A;  3C71 A;  1V98 A;  2O7K A;  1EGO A;  1K0O A;  3H93 A;  4XS4 B;  1GRX A;  2HRF A;  4OD7 A;  1GUH A;  4ICY A;  1TK0 B;  3IAS 2;  1G0T A;  1WRY A;  3LWA A;  1TRV A;  3LG6 A;  1H4O A;  3GN3 A;  4EO3 A;  2X99 A;  4XRA A;  2X64 A;  2XBQ A;  2HSM A;  1T00 A;  2I4A A;  3LSZ A;  5A5H A;  4RUV A;  2K8S A;  3ZIV A;  3TOU A;  4NXI A;  1VF2 A;  1N8J A;  5J5N A;  4XS1 A;  1HNB A;  1HD2 A;  1F9M A;  2PBJ A;  2V32 A;  3EE2 A;  4G0K A;  1WIK A;  2PWJ A;  4ZBB A;  3M1G A;  1QFN A;  4CY8 A;  4I6X A;  3ERW A;  4EL1 A;  4O5Q A;  1NM3 A;  5J4V A;  4YQM A;  2DJ1 A;  2YWI A;  3GTU B;  2DMM A;  4K8M A;  1IYI A;  3ISO A;  2H19 A;  2VO4 A;  3IOS A;  1AW9 A;  1I5G A;  2M46 A;  3P2A A;  1U87 A;  4G01 A;  4HI7 A;  2LJK A;  3FZA A;  4XRD A;  4EXJ A;  5IMZ A;  4TR0 A;  4N0V A; 
#chains in the Genus database with same CATH homology
 3TJJ A;  5D9X A;  4MPG A;  1B48 A;  2GTU A;  3ZLP A;  3TKQ A;  2R0G A;  4EDY A;  4PUF C;  1G7O A;  2KUC A;  1U88 A;  2HI7 A;  1GUM A;  2CVB A;  2GS3 A;  2GZP A;  2J23 A;  4GSS A;  4W66 A;  4ZB9 A;  1M0U A;  1OC9 B;  3I6A A;  4PUR A;  2IFQ B;  3TKP A;  1QK8 A;  5HR3 A;  1ZYN A;  4GXZ A;  1HQO A;  5DAL B;  5DCG A;  5FWG A;  3QPM A;  4BVY B;  5JCW A;  2AB6 A;  1SD9 A;  4Z7X A;  3TRX A;  3F3R A;  1SL1 B;  4GSN A;  4ZL8 A;  1XW5 A;  1U3I A;  2B7K A;  3CXG A;  2OE0 A;  3A5I A;  4ZL9 A;  1X9M B;  3WGD A;  4NV5 A;  1PRX A;  4L0W A;  3GV1 A;  3L0H A;  4GRF A;  2R37 A;  3TJB A;  4OFT A;  1SL0 B;  1GWC A;  2VLU A;  6GSY A;  1BG1 A;  5HR2 A;  3VK9 A;  3GH6 A;  3GKN A;  2LKU A;  4N30 A;  1TXU A;  1T3B A;  3EC3 A;  2FUG 2;  3IHG A;  2IN3 A;  1RQM A;  1G7E A;  1BX9 A;  1EV4 A;  3PPU A;  4EE0 A;  1V57 A;  2WJU A;  4Q5Q A;  1EZK A;  3VPQ A;  3A2V A;  2CZ2 A;  1ERT A;  1YEP A;  4YH2 A;  1O8X A;  3U5R E;  3IXR A;  3ZTL A;  4WXT A;  4POK A;  1URM A;  4ACS A;  5DBQ A;  3ZL5 A;  2I3Y A;  3KMO A;  4O32 A;  1AAZ A;  5A4V A;  4ZXG A;  5A1N A;  2IMK A;  1S3C A;  2H73 A;  1B4P A;  2C0D A;  3KTL A;  2VCW A;  4KH7 A;  2B6M A;  16GS A;  4IW9 A;  4AJ6 A;  5DQS A;  4IQA A;  1XWG A;  2FLS A;  2YZU A;  4AKX B;  2TRX A;  2EFD A;  2DJ0 A;  4EIQ A;  4N0Z A;  1BG5 A;  4X1U A;  5A34 A;  1SVM A;  1AUC A;  1ZZY A;  4DSS A;  4WF4 A;  1YQ1 A;  3F63 A;  4ECB A;  1GNE A;  3FY7 A;  4G0I A;  2GSQ A;  5GAP D;  4ECJ A;  3S9F A;  4QQ7 A;  4IN0 A;  4YKF A;  1F37 A;  4F9Z A;  2A2P A;  2JAC A;  3KXO A;  7GSS A;  2R0C A;  3TKR A;  5ID2 B;  2DBC A;  2KHP A;  3E0U A;  5CAX A;  1SK0 A;  3FMW A;  4K1F A;  5CRG A;  1YEX A;  2WB9 A;  3GST A;  2AAW A;  5IOX A;  2GQM A;  3SWL A;  3UVH A;  2J9H A;  2NVL A;  2GT6 A;  4PUA A;  4Z2T A;  4Q5N A;  1R4W A;  1N2A A;  1F3B A;  3ME7 A;  1GSD A;  4HJ2 A;  3GL3 A;  5ELA A;  2HSY A;  2O5V A;  5D93 A;  3UL3 A;  5ABR A;  2O8V B;  1OC8 A;  4ZB6 A;  3GKX A;  5BMU A;  1TOF A;  1EP8 A;  1B4Q A;  1PN0 A;  2H1D A;  5G2Z A;  4BWQ A;  1W4V A;  4HUA A;  2QA1 A;  4TN8 A;  3DD3 A;  4MCU A;  2JL4 A;  3H79 A;  4G2E A;  1MEK A;  2G0F A;  1K0C A;  2FCH A;  3M8N A;  5IPH A;  3UVT A;  5HFK A;  4PQH A;  1FAA A;  4G10 A;  4JR4 A;  3ZVJ D;  3TCO A;  5J3R A;  2QGV A;  5ECK B;  1GSU A;  2ZCT A;  5ECS A;  3TJG A;  1GTB A;  1J9B A;  3O6T A;  1J08 A;  4CY6 A;  4MPF A;  2JSZ A;  1LJR A;  4OO4 A;  4AKI A;  4KX4 A;  4TR1 A;  3CRT A;  1EOH A;  3FR9 A;  3UJ1 A;  1FOH A;  6GSX A;  1ABA A;  3C1S A;  3FW2 A;  4V2L A;  2EIO A;  4MZC A;  1T1V A;  5ECR B;  2N5F A;  3GSS A;  3A5W A;  2VUP A;  1HNC A;  1M9B A;  4O5U A;  2H0G A;  1PD2 1;  3DYR A;  2OKA A;  2YZH A;  4IGJ A;  2WGR A;  1GH2 A;  1GUK A;  2P5R A;  3O76 A;  2LQQ A;  5IM9 A;  1GLP A;  4QL9 A;  5COH A;  3C8E A;  2M80 A;  5DCH A;  2B3S A;  1TRU A;  1WMJ A;  2GQK A;  4YQU A;  4CW9 A;  8GSS A;  3HVS A;  3FK8 A;  2CV4 A;  1IYH A;  3VI7 A;  3UOM A;  12GS A;  1Z6M A;  1Q98 A;  4TR3 A;  2ZNM A;  2JZT A;  3AY8 A;  2VL9 A;  3H8Q A;  2CVD A;  2HRK B;  2PVO C;  3KIJ A;  2DML A;  3TGZ A;  2PN8 A;  4CDO A;  5B6N A;  3PR8 A;  1A2M A;  4JR6 A;  4A5P A;  5D9W A;  4E68 A;  2R5G A;  3ZML A;  3FZ5 A;  4LL1 B;  1BF5 A;  1A2J A;  1I9D A;  5IIZ A;  2GZY A;  1THX A;  1O81 A;  2HZF A;  1OYJ A;  4D73 B;  3C7M A;  3HMJ G;  5JCG A;  2V41 A;  9GSS A;  2D2Z A;  1THO A;  1ST9 A;  3HY2 A;  1E6B A;  2FGX A;  2FWG A;  3O3T A;  2C4J A;  4FIW A;  3TRQ A;  2O85 A;  3CMI A;  4FH8 A;  4FYU A;  1SJ6 A;  3KH9 A;  4EIP A;  4MNN A;  4NAX A;  1YKA A;  4G9H A;  4XS4 A;  2X4A A;  2H66 A;  1JHB A;  1OKD A;  4I8B A;  4TXO B;  2HZE B;  2K18 A;  5JWR B;  3F0I A;  1FG4 A;  3QOU A;  1RK4 A;  2QSI A;  1SKW B;  2IMF A;  1CQH A;  2OJL A;  1TU8 A;  4ULX A;  2CZ3 A;  1XPV A;  1O6J A;  2C0G A;  3MSZ A;  3PGT A;  5HFG A;  1A23 A;  1GP1 A;  2YWM A;  3CWG A;  3EUR A;  1U6T A;  3TJK A;  3KCM A;  2K8V A;  1A24 A;  3H4K A;  4F82 A;  5AGY A;  1YF1 A;  1SU9 A;  2V6K A;  4AF2 A;  3ZZX A;  1DE2 A;  1N25 A;  1VF1 A;  2F3M A;  4HQS A;  1XW6 A;  4WKW A;  4KSM A;  3CBU A;  4POM A;  4I2T A;  2HFD A;  2EIR A;  3E9J B;  4XCS A;  2MBS A;  2A4V A;  2MMN A;  5KOW A;  3IC8 A;  5KOX A;  2H01 A;  5E59 A;  2F8F A;  4HDE A;  3VLN A;  3HDC A;  2QA2 A;  3GTU A;  6GSV A;  4KSO A;  1UVZ A;  1TI1 A;  1GUL A;  20GS A;  3F3Q A;  4YKG A;  1GLQ A;  3M9J A;  2HXK A;  4ZIL A;  3F4T A;  1EEM A;  3ZMK A;  3QCP A;  1X5E A;  2AV4 A;  3WYW A;  1B9Y C;  3MDK A;  3GX0 A;  1GTU A;  4MA9 A;  4O5R A;  1R7H A;  4MJE A;  2ALB A;  4DSQ A;  3G7I A;  2B5E A;  1F2E A;  1JLV A;  2KLX A;  2X8C A;  5C00 A;  2VCQ A;  4WR4 A;  4AGS A;  1PX7 A;  2PU9 C;  5CYY A;  3M3M A;  2H30 A;  1LU4 A;  1OC9 A;  3ZIT A;  3L4N A;  1JZO A;  5AIX A;  3F6F A;  3QR6 A;  1QMV A;  2IFQ A;  3GL5 A;  5GAN D;  4DVC A;  5DAL A;  1WPI A;  2L6D A;  3F4R A;  3ZFB A;  3IE3 A;  5KN1 A;  1O7U A;  4K5R A;  2KP1 A;  4BVY A;  3KMN A;  1ERW A;  3Q74 A;  3OR5 A;  1BED A;  1OKT A;  4AKH A;  2OE3 A;  4ZIJ A;  2YOI A;  1SL2 B;  1XXU A;  1ZOF A;  3WGX A;  3N5O A;  4F0C A;  3ERF A;  1UA5 A;  2O87 A;  2DJ3 A;  4JRR A;  1SKR B;  3F9U A;  5KN0 A;  2HSN B;  5IMC A;  5FHI A;  5G5E A;  4EUY A;  3Q18 A;  10GS A;  2VD0 A;  2I9H A;  1X5D A;  2HLS A;  6GSS A;  2OAD A;  4MF5 A;  1M9A A;  5D73 A;  5GSS A;  1MDK A;  5EY6 A;  3LJR A;  3D4T A;  4MDC A;  1QUW A;  2KOK A;  4XS6 A;  5ECL B;  1X0R A;  2ES7 A;  2LUS A;  2YJ7 A;  1OAZ A;  1TRS A;  2H0H A;  2TRC P;  4YAV A;  2EIQ A;  4IQ1 A;  2FWE A;  4LMW A;  1X9S B;  4ECC A;  3CTF A;  5F0G A;  3MWH A;  3HJM A;  5AIS A;  2B5Y A;  3G7J A;  1FB0 A;  1XOA A;  3FHK A;  3IDV A;  2QKE A;  1ERV A;  1YF0 A;  5H5R A;  1HYU A;  2H70 A;  5DJL A;  4MJB A;  4BPY A;  5J47 A;  2LJR A;  3QAW A;  2N5B A;  3UAP A;  1B9X C;  3NZN A;  5IO0 A;  2IMD A;  5D96 A;  4JU5 A;  3ED3 A;  3E3E A;  2VCV A;  4KDX A;  2OA7 A;  3P8W A;  4HEA 2;  4MJA A;  4IJI A;  3GRX A;  4MF7 A;  2HQT A;  3HKR A;  4XHM A;  5CRH A;  3QD9 A;  4E8E A;  2C1Y A;  1PMT A;  1MDI A;  3HD5 A;  1V2A A;  4PTS A;  2H0I A;  4F2I A;  3A2W A;  1ZYQ B;  2GLR A;  2FA4 A;  1EWX A;  3GUS A;  2R0P A;  3JCM L;  4NMU A;  3PH9 A;  17GS A;  5ID2 A;  4X4J A;  3UMA A;  5ECN B;  3KGK A;  3KP8 A;  3ME8 A;  2C3N A;  5ECH B;  2DIZ A;  3V1W A;  3KTB A;  1M2D A;  2A2R A;  5D9V A;  4XTS A;  3DGQ A;  4IP1 A;  4K9Z A;  2CAQ A;  5H5Q A;  4BVX B;  2H71 A;  2P5Q A;  1TP9 A;  1K3Y A;  1PSQ A;  4V1A g;  5EL8 A;  1EGR A;  3EMX A;  2VIM A;  1O73 A;  3DIE A;  1X9W B;  1VGL A;  3MAK A;  1K0M A;  4G19 A;  3RPP A;  4MK3 A;  3UBL A;  5KN3 A;  4EF0 A;  5ECI B;  5INY A;  2C0E A;  2GZZ A;  5CRD A;  1AIU A;  2FY6 A;  2CA8 A;  3L9V A;  2L6C A;  4DEJ A;  4IP6 A;  1V58 A;  3GYK A;  2PVQ A;  5DQY A;  4AJ7 A;  2UV8 G;  4J2F A;  2WZ9 A;  4F03 A;  4GQF A;  4HU9 A;  4HS1 A;  2C0F A;  1LBK A;  4BL7 B;  2LST A;  3LYK A;  2YNX A;  2AUV A;  1DBY A;  1WWJ A;  2LEG A;  1SEN A;  1K3L A;  1Z7R A;  2H6Y A;  3TRP A;  4K6X A;  3L9S A;  3QAV A;  3VUR A;  3D22 A;  5G30 A;  22GS A;  2C8U A;  3CSJ A;  1PGT A;  4GTU A;  3IV4 A;  4POL A;  2KP2 A;  4RQX A;  1USB A;  1G6W A;  1XWB A;  1YKC A;  4HZ4 A;  3BBY A;  1QQ2 A;  3W8J A;  3HZ8 A;  2JZR A;  3QDN A;  1RW1 A;  4IS0 A;  3TB2 A;  2BJX A;  2I81 A;  4PXO A;  1T4Y A;  1R5A A;  1K0A A;  1K0D A;  3ZFL A;  1WOU A;  2L57 A;  2YN1 A;  1SVL A;  1GTI A;  2BMX A;  2YWN A;  4JE1 A;  1U3A A;  4ZB8 A;  4L0U A;  2JSY A;  2IJY A;  2NPB A;  2YCD A;  3HCZ A;  4I5Q A;  2OAC A;  2WUL A;  2B1L A;  1FVJ A;  5HR1 A;  4HQZ A;  3EU3 A;  3US3 A;  1FO5 A;  2R4V A;  2DJ2 A;  1SYX A;  1UN2 A;  4KCE A;  3VI5 A;  5A4W A;  1NSW A;  3BD2 A;  1XWK A;  3HXS A;  1JLW A;  2GSS A;  1TI3 A;  4WBR D;  2L5L A;  3IRA A;  5A4U A;  3W6G A;  5KN2 A;  3LW9 A;  5CRW A;  4WF5 A;  4OCF A;  2HRK A;  4MMM A;  2IPA A;  4KUN A;  3GKK A;  4J57 E;  1KBN A;  3IBH A;  4BA7 A;  1JZW A;  4QL7 A;  5CNW A;  3HVV A;  1O8W A;  2H76 A;  3DWV A;  1MD3 A;  2OE1 A;  11GS A;  5HFI A;  2LTK A;  2IL3 A;  2FD3 A;  2QC7 A;  1UC7 A;  1NHO A;  3GHA A;  4IVF A;  5B6M A;  1WJK A;  5IMV A;  2R2J A;  1PL2 A;  4D73 A;  2RLI A;  1YJ6 A;  1SYR A;  5ECM B;  4GDF A;  2A4H A;  2NTO A;  3TJF A;  1XBS A;  2CQ9 A;  2IWT A;  4I2U A;  4JZQ A;  4TVE A;  4X0X A;  2ZUP A;  3HJO A;  2VCT A;  3P90 A;  4OFN A;  2MZC A;  3EU4 A;  4YQV A;  3UIW A;  5F8B A;  3FR3 A;  3I69 A;  1B8X A;  4L5O A;  4ZL7 A;  4QMK A;  1ACV A;  4V2M A;  4FQU A;  1XW9 A;  6GST A;  4MAB A;  2JAD A;  13GS A;  5ECQ B;  4TXO A;  1ZGN A;  2HZE A;  3I43 A;  3RPN A;  1TDI A;  3IK9 A;  3IR4 A;  3G7Y A;  3D6I A;  3UAR A;  1NHY A;  3SBC A;  5B7C A;  4KCA A;  4TXV A;  1Z5Y E;  2PUK C;  2F9S A;  2K9F A;  5ENU A;  3QFA C;  1BJX A;  4I97 A;  5DAK B;  5F05 A;  1R26 A;  1TW9 A;  2C3T A;  1T8E B;  3KZQ A;  1YY7 A;  4K7O A;  1PX6 A;  1PKW A;  4PX1 A;  5J4U A;  1SK2 A;  2F51 A;  5DJM A;  4KB3 A;  4RI6 A;  5D8I A;  2DKH A;  2HYX A;  2C80 A;  1XCC A;  4Q5R A;  2JZS A;  2VM1 A;  2C3Q A;  3GUR A;  3ZVJ A;  3VWW A;  3UBK A;  2X8G A;  5F07 A;  3MNG A;  2MMA A;  2NDO A;  3IC4 A;  1GSE A;  5GZZ B;  2VCZ A;  3ERG A;  3TU3 B;  3K8N A;  1HNA A;  4K0G A;  1F6M C;  3DXB A;  2H1L A;  5G31 A;  3FZ4 A;  2WFC A;  2XHF A;  2R6K A;  3GIX A;  3WGE A;  5J9C A;  4OO5 A;  4JED A;  2LRT A;  5ELG A;  5HR0 A;  1FVK A;  5FT3 A;  4NV2 A;  3LYP A;  5AIV A;  2B7J A;  1ERU A;  2WRT A;  1MDJ A;  3Q6O A;  1M2B A;  4V2N A;  1TK5 B;  4K0N A;  2REM A;  1Z9H A;  5CO3 A;  2RUF A;  2JU5 A;  1Z7P A;  4ZB7 A;  1VF4 A;  4TRX A;  2V1M A;  2XPE A;  3FR6 A;  4ISD A;  2G2Q A;  5CRE A;  3GMF A;  1V9W A;  1SVO A;  1FHE A;  1ZL9 A;  2VAF A;  1T7P B;  2FNO A;  3CYN A;  2V2G A;  3VWV A;  4IJ3 A;  4LMV A;  1PA3 A;  4OFM A;  2X49 A;  3LGC A;  1Y6E A;  1CQG A;  1OE8 A;  4AI6 A;  2HSN A;  3G9B A;  2WS2 A;  4O7H A;  4F0B A;  3IHQ A;  4GWR A;  4KW6 A;  18GS A;  4ML1 A;  2OBI A;  2HNL A;  2LJA A;  1VRS D;  4RQR A;  2CT6 A;  4HU7 A;  2FA8 A;  1H75 A;  3BOA A;  3VPT A;  4HJM A;  3EMP A;  2VCX A;  1K0B A;  2HSM B;  3TOT A;  4KF9 A;  2MMO A;  1XOB A;  2CVK A;  5A5H B;  4ILF A;  1FOV A;  1A2L A;  3LEF A;  2N5A A;  2XC2 A;  5G5F A;  3PIN A;  5E4W A;  3EPT A;  2DSA A;  4G0L A;  2I1U A;  4P3Y B;  2VOC A;  3HVX A;  3CSI A;  2MBT A;  1GSS A;  1GNW A;  4H86 A;  3GNJ A;  4IEL A;  1YDK A;  2AHE A;  2XPD A;  4PNF A;  3WD6 A;  4LA1 A;  2YJH A;  2IME A;  2LV3 A;  3U6V A;  2H1A A;  1YZX A;  2E7P A;  1JZD A;  3IK7 A;  3EWL A;  3VFI A;  3IAM 2;  5IPG A;  2E2M A;  1PN9 A;  3IPZ A;  3FZ9 A;  1XZO A;  4KND A;  1AXD A;  5L71 A;  1M7T A;  2P0G A;  2MYG A;  4ML6 A;  4L5L A;  1VF3 A;  2IIY A;  1ML6 A;  6GSW A;  5H5S A;  3KM6 A;  5J4Y A;  4ZBD A;  4MZW A;  3TDG A;  3F4S A;  3WT1 A;  5B8A A;  1XWA A;  5BRT A;  1QXH A;  1GSQ A;  4K2X A;  3I9V 2;  3CTG A;  5F06 A;  2EFC A;  1SKS B;  4OWY A;  1WP0 A;  3ZYW A;  5J9B A;  5GST A;  2HT9 A;  4MH3 A;  3M9K A;  2HE3 A;  3BCK A;  4V1A p;  1MD4 A;  5LD0 A;  4MLY A;  2OT3 A;  3H1N A;  1E2Y A;  3LFL A;  2VKZ G;  3EIN A;  4BVX A;  2V6O A;  1PKZ A;  3FKF A;  4PQ1 A;  2K6V A;  2WCI A;  4ID0 A;  2VLT A;  4NWY A;  4POB A;  4PQI A;  3DVW A;  1EEJ A;  1WE0 A;  2UZ8 A;  2P31 A;  2H74 A;  1TU7 A;  4GCI A;  4E8H A;  5J41 A;  4N3Z A;  4EVM A;  2LS5 A;  3TKS E;  2GST A;  5LNK e;  2WDU A;  1F3A A;  3M0F A;  4JBB A;  3F8U A;  4EDZ A;  2AYT A;  1PL1 A;  4K7I A;  1KTE A;  4EKZ A;  4K2D A;  3J7Y k;  4PGT A;  2L59 A;  3RAZ A;  3FRC A;  4HZ2 A;  2DIY A;  2PMT A;  1W89 A;  2MMZ A;  4L8E A;  5LCZ A;  1BQ7 A;  5IMD A;  4BL7 A;  4Z2U A;  1ZYP A;  3VWU A;  2VM2 A;  4TW5 A;  4EC0 A;  2LNS A;  1TJD A;  3APS A;  2H72 A;  2EFH A;  2RII A;  4MH2 A;  5B8B A;  3UEM A;  2CAI A;  1C72 A;  1A8Y A;  5IMF A;  2ON7 A;  5DVB A;  3GH9 A;  3HZ4 A;  3KH7 A;  3LOR A;  2VL2 A;  3A3T A;  3WT2 A;  1ON4 A;  5A1N B;  19GS A;  4NPB A;  4AJ8 A;  1BAY A;  4IKH A;  4WBJ A;  1PQN A;  5G1K A;  2H6X A;  2PPT A;  5KEJ A;  4BWS A;  4FYB A;  1YVL A;  3LXT A;  1ILO A;  4YAP A;  5JWO B;  4K5S A;  1GSF A;  1SK1 A;  2RUE A;  3FEU A;  1AQW A;  4HOJ A;  1GSY A;  5JWQ B;  1S3A A;  4MJC A;  1V40 A;  3HHV A;  1OVN A;  2IMI A;  5A34 B;  3IA1 A;  4KDU A;  3L9U A;  5ECO B;  1QGV A;  2GDR A;  3TKS A;  4DSS B;  2ON5 A;  5ECP B;  3DKS A;  5CP1 A;  3CRU A;  3LQ7 A;  4MP4 A;  1R5P A;  1FB6 A;  1BYE A;  4Q5F A;  1A0R P;  2EFE A;  3MIX A;  4NHW A;  2PGT A;  4LLR A;  4LL4 B;  2VLV A;  2GGT A;  3ZRD A;  2DKI A;  4OCE A;  1OE7 A;  3D21 A;  1KNG A;  5IQY A;  2H6Z A;  3A2X A;  2H75 A;  1EOG A;  2BTO T;  2YV7 A;  2OBK A;  2EC4 A;  3GKM A;  1K3O A;  1Q4J A;  4N11 A;  1DUG A;  5EVO A;  1SJZ A;  5HQP A;  2YV9 A;  2YAN A;  1NW2 A;  1TKD B;  1Y1U A;  4WET A;  3HA9 A;  3N9J A;  1SD8 A;  4K7N A;  2YP6 A;  1TRW A;  3VWX A;  3F6D A;  2O89 A;  2R3X A;  4KE3 A;  4PNG A;  4DSR A;  1ZMA A;  2VL2 C;  1JZR A;  2HRN A;  4CHS A;  2E2G A;  3NOF A;  4O92 A;  3FYG A;  1TXX A;  2RM5 A;  3GFK A;  3ZIJ A;  5BMU B;  2YPM A;  3P7X A;  2CX3 A;  3RHB A;  2DLX A;  4KAE A;  3DVX A;  2E0Q A;  1AQX A;  3CSH A;  3QAG A;  3EYT A;  1S3D A;  2Z9S A;  4RI7 A;  3RDW A;  1SJI A;  2FWF A;  4OMV A;  4AKG A;  1OC3 A;  3QMX A;  5IOW A;  1Z6N A;  2L5O A;  5DAK A;  3TKS C;  3APQ A;  4X43 A;  3RBT A;  2TIR A;  2DC5 A;  3NIV A;  3D0Z A;  3Q19 A;  3QFB C;  1A8L A;  4GLT A;  2H1G A;  2H1B A;  2H8L A;  4WR5 A;  4J56 E;  3TUE A;  4TR1 B;  5IO2 A;  4FO5 A;  3ZRE A;  1ZCP A;  1ZYE A;  2PER A;  5G1L A;  2LRC A;  2HRA A;  3HJP A;  4TOP A;  2RM6 A;  3J7Y b;  1T4Z A;  14GS A;  4IBP A;  5IMA A;  6GSU A;  2CX4 A;  4GQC A;  4N10 A;  3APO A;  5A5K A;  3DML A;  4MF6 A;  3D5J A;  2L4C A;  3GX8 A;  2B1K A;  4MZB A;  2YWO A;  2F8A A;  1G6Y A;  4Z2R A;  2GVP A;  1GTA A;  1JFU A;  1O85 A;  1M2A A;  2HSH A;  2AJQ B;  1Y25 A;  2DJK A;  2LNT A;  2FHE A;  5DDL A;  2B5X A;  4XIH A;  1XVW A;  2A2S A;  3W8S A;  1MTC A;  1J0F A;  1A0F A;  4ECI A;  5EPF A;  1AC1 A;  5AN1 A;  3L78 A;  3HYP A;  1X5C A;  2FWH A;  3R2Q A;  3KEB A;  4KDY A;  1XVQ A;  4NHZ A;  4TR4 A;  3EVI A;  1XFL A;  2NBS A;  1K0N A;  1AQV A;  1DSB A;  1XIY A;  4IHU A;  2GSR A;  4TKY A;  1EV9 A;  3RHC A;  3BCI A;  2GQL A;  2VL3 A;  2X8H A;  5D9T A;  2M72 A;  3DEX A;  4WEY A;  1TTZ A;  3R3E A;  5C04 A;  1EP7 A;  3GA4 A;  5JCU A;  3C1R A;  3LXZ A;  3KJY A;  3DRN A;  2DJJ A;  1TK8 B;  2L4Q A;  3C73 A;  2LRN A;  4USS A;  1Z3E A;  3KP9 A;  4KGI A;  1M99 A;  2LQO A;  4ZBA A;  1KEB A;  2XBI A;  3BJ5 A;  4FYC A;  3MYD A;  2VD1 A;  2GT5 A;  4KA0 A;  4GST A;  3D4M A;  1GL8 A;  5J40 A;  3KD0 A;  1XWC A;  4GF0 A;  1FW1 A;  1DE1 A;  3C71 A;  1V98 A;  2O7K A;  1EGO A;  1K0O A;  3H93 A;  4XS4 B;  1GRX A;  2HRF A;  4OD7 A;  1GUH A;  4ICY A;  1TK0 B;  3IAS 2;  1G0T A;  1WRY A;  3LWA A;  1TRV A;  3LG6 A;  1H4O A;  3GN3 A;  4EO3 A;  2X99 A;  4XRA A;  2X64 A;  2XBQ A;  2HSM A;  1T00 A;  2I4A A;  3LSZ A;  5A5H A;  4RUV A;  2K8S A;  3ZIV A;  3TOU A;  4NXI A;  1VF2 A;  1N8J A;  5J5N A;  4XS1 A;  1HNB A;  1HD2 A;  1F9M A;  2PBJ A;  2V32 A;  3EE2 A;  4G0K A;  1WIK A;  2PWJ A;  4ZBB A;  3M1G A;  1QFN A;  4CY8 A;  4I6X A;  3ERW A;  4EL1 A;  4O5Q A;  1NM3 A;  5J4V A;  4YQM A;  2DJ1 A;  2YWI A;  3GTU B;  2DMM A;  4K8M A;  1IYI A;  3ISO A;  2H19 A;  2VO4 A;  3IOS A;  1AW9 A;  1I5G A;  2M46 A;  3P2A A;  1U87 A;  4G01 A;  4HI7 A;  2LJK A;  3FZA A;  4XRD A;  4EXJ A;  5IMZ A;  4TR0 A;  4N0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...