1R62A

Crystal structure of the c-terminal domain of the two-component system transmitter protein nrii (ntrb)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
136
Chain Sequence
RVTESIHKVAERVVTLVSMELPDNVRLIRDYDPSLPELAHDPDQIEQVLLNIVRNALQALGPEGGEIILRTRTAFQLTLHGERYRLAARIDVEDNGPGIGLGLSIARNLIDQHSGKIEFTSWPGHTEFSVYLPIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitrogen regulation protein NR(II)
publication title Crystal Structure of the C-terminal Domain of the Two-Component System Transmitter Protein Nitrogen Regulator II (NRII; NtrB), Regulator of Nitrogen Assimilation in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 44
structure length 136
sequence length 156
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2003-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1r62A00
2YK9A 1UYHA 4HYMA 3LPSA 2YI7A 3T1KA 4AS9A 3A0WA 5J71A 3HHUA 2QG0A 2WI3A 3HZ5A 5J6AA 3T10A 4JQLA 4YKQA 4EFTA 4I5SA 1GKZA 1US7A 2YE9A 2YE3A 3MNRP 4ASFA 5M4PA 4DZYA 3Q5LA 2WI4A 4CWSA 2CH4A 3O2FA 4XD8A 3CGZA 4GT8A 2YGFA 1I59A 2K5BA 4O04A 3TUHA 1Y8NA 1YSRA 5D6QA 1AM1A 4ASBA 2IWSA 5L3JA 4MP7A 2YGEA 4FCRA 2H8MA 5FNDA 4YKUA 2WI6A 4L93A 2XDLA 2ZKJA 4H85A 2YGAA 4R1FA 4XC0A 4EEHA 1R62A 1YESA 3EKRA 1UYKA 3U2KA 2GQPA 2VCIA 1AJ6A 2YJXA 5M4KA 2XDXA 4FPPA 1UYLA 5FNFA 3R4MA 4XIPA 4MOTA 5F5RA 3K60A 2CCSA 2ZDXA 3G7EA 3Q5JA 3T2SA 3TZ4A 1B3QA 4NH7A 3HEKA 4HZ0A 4MB9A 2XDKA 2YECA 4YKRA 4BIUA 4BXIA 4XCJA 3OWBA 2YEGA 2XX4A 2GFDA 2XJXA 4CWQA 3CRKA 3D36A 1BXDA 2CCUA 3FT8A 3K97A 4KTNA 4HZ5A 2YKBA 4CWNA 4E02A 1TILA 1YC4A 3GIFA 3QDDA 4GGLA 1QYEA 2CGFA 2YEDA 3EHJA 2VWCA 2XK2A 5CPHA 4LWIA 4CWRA 3ZM7A 3A0YA 2FWZA 4V25A 3C11A 1YS3A 4JAVA 4JASA 1UYGA 2YI5A 1ZXNA 2ESAA 2WI5A 2YEHA 4O07A 3G75A 5IDMA 4ZVIA 5IN9A 3GIEA 1MU5A 4YKWA 5M4EA 4XIRA 4L94A 4NH9A 1ZW9A 2YEFA 4XITA 3NMQA 4HY1A 3FV5A 2HCHA 1I5DA 2BT0A 2QF6A 2Q8GA 4H7QA 4UROA 5BOCA 1BGQA 4GFNA 1Y4SA 2YEEA 5D7DA 4P8OA 3ZXOA 4BAEA 1YT2A 1GKXA 1H7UA 1ID0A 3FT5A 4YKZA 2IWXA 3INWA 2XDUA 2QG2A 4FCPA 1UYDA 4O05A 4AWPA 4E01A 4PRVA 4LWEA 2JKIA 2UWDA 3O6OA 2BU5A 5D7RA 1EA6A 3A0TA 4JAUA 2WERA 3B25A 5D7CA 2WEQA 2ZDYA 3K98A 1A4HA 2XHXA 2YE6A 3R4OA 4LPBA 4XKOA 3RLQA 5BODA 2YE7A 5CTYA 4XDMA 2Q8FA 3ZKBA 1UY7A 2JJCA 2YEIA 4B7PA 3U67A 2WI1A 4MP2A 2IORA 2QFOA 2IWUA 4EMVA 2YKCA 4BQGA 3ZKDA 4LWFA 3RLRA 1H7SA 2ZBKB 2HG1A 1YERA 1Y4UA 2XCMA 4X9LA 5M4NA 4W7TA 1Y8PA 4HXZA 2BU6A 2YEBA 4KSGA 3R92A 2YKIA 1Z59A 3KE6A 1UYIA 3D2RA 4PRXA 2O1VA 3H80A 4HY6A 4XTJA 4L91A 2Q8IA 2XJJA 4QPKA 3PEJA 4B6CA 3OW6A 5D6PA 3A0ZA 4XE2A 4AWQA 4URNA 2CCTA 4CE1A 1BKNA 4R3AA 3TZ0A 2YKEA 3EHGA 4P7AA 1Z5BA 4PL9A 4YKTA 1UYEA 4YKYA 2CG9A 3A0RA 4CWFA 3C0EA 1NHHA 3EHHA 2XX2A 2O1UA 1Y8OA 2YJWA 1AH8A 1UY8A 3O0IA 4NH8A 4U7OA 3WQ9A 1B62A 2BU7A 4ZKIA 3B27A 2XABA 4U7NA 2EXLA 2XD6A 3B24A 3BM9A 3HZ1A 4R3MA 1THNA 1Z5AA 1B63A 4EGHA 1TBWA 4FMTA 3SL2A 2FXSA 5FWKA 4MBCA 4E00A 4MPCA 4EFUA 1QY8A 4LP0A 3TTZA 4ASAA 2YE8A 1I5CA 1YC3A 4V26A 4DUHA 3LNUA 3H4LA 3T0HA 2XX5A 1GJVA 5FNCA 4O0BA 4XKAA 1TH8A 2H55A 2IOPA 2XJGA 4L90A 4LWHA 4KP4A 2PNRA 1UYMA 1U0ZA 1QZRA 2FWYA 2YK2A 2VCJA 2O1WA 3CWVA 2XDSA 1S14A 3DGEA 4YKXA 1YETA 3OPDA 4WUDA 4BIZA 3VHAA 3R4NA 2Q8HA 2AKPA 2Q2EB 4LWGA 3CGYA 4WUBA 4BQJA 1ZWHA 3GIGB 4CWOA 4KFGA 1TIDA 1YT1A 4EGKA 3A0XA 2WI7A 1UY9A 3EKOA 4CWPA 2VW5A 5F3KA 2BU8A 2C2AA 3G7BA 4URMA 4WUCA 2HKJA 4XKKA 3K99A 4EM7A 3U2DA 3B28A 4PU9A 4GQTA 2YEAA 3T0ZA 4HYPA 4ASGA 1UYCA 3GIGA 2BYIA 3TZ5A 1YT0A 3D0BA 2BYHA 5CTWA 2YI0A 1I58A 2YKJA 4MPNA 4KSHA 4XCLA 3VHDA 2WEPA 1AH6A 2YE4A 4O09A 3TZ2A 4AWOA 1Z5CA 2BRCA 3ZXQA 1KZNA 1U2OA 2BSMA 5CF0A 1BYQA 1NHIA 2BREA 3VHCA 1TC6A 1L0OA 3RKZA 4MPEA 3B26A 4H81A 4U93A 1KIJA 4CE2A 2BU2A 3INXA 3R4PA 3BMYA 1I5AA 3OMUA 1UYFA 4FCQA 4HXWA 4I3HA 3IEDA 1YC1A 3VADA 1PVGA 2YE2A 4L8ZA 3CRLA 1UY6A 2WI2A 3WHAA 1S16A 2FYPA 4QPJA 1JM6A 3QTFA 1MX0A 2BTZA 4GEEA 2YE5A 2IOQA 5GGZA 5M4MA 5CTXA 4GCZA 4XIQA 3OWDA 3Q5KA 1ZXMA 1AMWA 5C93A 1EI1A 4KQVA 4Q20A 2BZ5A 2XHTA 2YEJA 3HYZA 1I5BA 5M4HA 3EHFA 5IDJA 1OSFA 4EGIA 5CTUA 1NHJA 4CE3A 4K4OA 4CWTA 3R91A 3PEHA 3JZ3A 1TC0A 3RLPA 4URLA 2XHRA 2YI6A 1YSZA 2E0AA 3HYYA
chains in the Genus database with same CATH superfamily
2YK9A 1UYHA 4HYMA 3LPSA 2YI7A 2C1IA 3T1KA 4AS9A 3A0WA 5J71A 3HHUA 2QG0A 2WI3A 3HZ5A 5J6AA 3T10A 4JQLA 4YKQA 4EFTA 4I5SA 1GKZA 1US7A 2YE9A 2YE3A 3MNRP 4ASFA 5M4PA 4DZYA 3Q5LA 2WI4A 4CWSA 2CH4A 3O2FA 4XD8A 3CGZA 4GT8A 2YGFA 1I59A 2K5BA 4O04A 3TUHA 1Y8NA 1YSRA 5D6QA 1AM1A 4ASBA 2IWSA 5L3JA 4MP7A 2YGEA 4FCRA 2H8MA 5FNDA 4YKUA 2WI6A 4L93A 2XDLA 2ZKJA 4H85A 2YGAA 4R1FA 4XC0A 4EEHA 1R62A 1YESA 3EKRA 1UYKA 3U2KA 2GQPA 2VCIA 1AJ6A 2YJXA 5M4KA 2XDXA 4FPPA 1UYLA 5FNFA 3R4MA 4XIPA 4MOTA 5F5RA 3K60A 2CCSA 2ZDXA 3G7EA 3Q5JA 3T2SA 3TZ4A 1B3QA 4NH7A 3HEKA 4HZ0A 4MB9A 2XDKA 2YECA 4YKRA 4BIUA 4BXIA 4XCJA 3OWBA 2YEGA 2XX4A 2GFDA 2XJXA 4CWQA 3CRKA 3D36A 2E0AA 1BXDA 2CCUA 3FT8A 3K97A 4KTNA 4HZ5A 2YKBA 4CWNA 4E02A 1TILA 1YC4A 3GIFA 3QDDA 4GGLA 1QYEA 2CGFA 2YEDA 3EHJA 2VWCA 2XK2A 5CPHA 4LWIA 4CWRA 3ZM7A 3A0YA 2FWZA 4V25A 3C11A 1YS3A 4JAVA 4JASA 1UYGA 2YI5A 1ZXNA 2ESAA 2WI5A 2YEHA 4O07A 5JENA 3G75A 5IDMA 4ZVIA 5IN9A 3GIEA 1MU5A 4YKWA 5M4EA 4XIRA 4L94A 4NH9A 1ZW9A 2YEFA 3S5TA 4XITA 3NMQA 4HY1A 3FV5A 2HCHA 1I5DA 2BT0A 2QF6A 2Q8GA 4H7QA 4UROA 5BOCA 1BGQA 4GFNA 1Y4SA 2YEEA 5D7DA 4P8OA 3ZXOA 4BAEA 1YT2A 1GKXA 1H7UA 1ID0A 3FT5A 4YKZA 3LMMA 2IWXA 3INWA 2XDUA 2QG2A 4FCPA 4E72A 1UYDA 4O05A 4AWPA 4E01A 4PRVA 4LWEA 2JKIA 2UWDA 3O6OA 2BU5A 5D7RA 1EA6A 3A0TA 4JAUA 2WERA 3B25A 5D7CA 2WEQA 2ZDYA 3K98A 1A4HA 2XHXA 2YE6A 3R4OA 4LPBA 4XKOA 3RLQA 5BODA 2YE7A 5CTYA 4XDMA 2Q8FA 3ZKBA 1UY7A 2JJCA 2YEIA 4B7PA 3U67A 2WI1A 4MP2A 2IORA 2QFOA 2IWUA 4EMVA 2YKCA 4BQGA 3ZKDA 4LWFA 3RLRA 1H7SA 2ZBKB 2HG1A 1YERA 1Y4UA 2XCMA 4X9LA 5M4NA 4W7TA 1Y8PA 4HXZA 2BU6A 2YEBA 4KSGA 3R92A 2YKIA 1Z59A 3KE6A 1UYIA 3D2RA 4PRXA 2O1VA 3H80A 4HY6A 4XTJA 4L91A 2Q8IA 2XJJA 4QPKA 3PEJA 4B6CA 3OW6A 5D6PA 3A0ZA 4XE2A 4AWQA 4URNA 2CCTA 1F51A 4CE1A 1BKNA 4R3AA 3TZ0A 2YKEA 3EHGA 4P7AA 1Z5BA 4PL9A 4YKTA 1UYEA 4YKYA 2CG9A 3A0RA 4CWFA 3C0EA 1NHHA 3EHHA 2XX2A 2O1UA 1Y8OA 2YJWA 1AH8A 1UY8A 3O0IA 4NH8A 4U7OA 3WQ9A 1B62A 2BU7A 4ZKIA 3B27A 2XABA 4U7NA 2EXLA 2XD6A 3B24A 3BM9A 3HZ1A 4R3MA 1THNA 1Z5AA 1B63A 4EGHA 1TBWA 4FMTA 3SL2A 2FXSA 5FWKA 4MBCA 4E00A 4MPCA 4EFUA 1QY8A 4LP0A 3TTZA 4ASAA 2YE8A 1I5CA 1YC3A 4V26A 4DUHA 3LNUA 3H4LA 3T0HA 2XX5A 1GJVA 5FNCA 4O0BA 4XKAA 1TH8A 2H55A 2IOPA 2XJGA 4L90A 4LWHA 4KP4A 2PNRA 1UYMA 1U0ZA 1QZRA 2FWYA 2YK2A 2VCJA 2O1WA 3CWVA 2XDSA 1S14A 3DGEA 4YKXA 1YETA 3OPDA 4WUDA 4BIZA 3VHAA 3R4NA 2Q8HA 2AKPA 2Q2EB 4LWGA 3CGYA 4WUBA 4BQJA 1ZWHA 3GIGB 4CWOA 4KFGA 1TIDA 1YT1A 4EGKA 3A0XA 1IXMA 2WI7A 1UY9A 3EKOA 4CWPA 2VW5A 5F3KA 2BU8A 2C2AA 3G7BA 4URMA 4WUCA 2HKJA 4XKKA 3K99A 4EM7A 3U2DA 3B28A 4PU9A 4GQTA 2YEAA 3T0ZA 4HYPA 4ASGA 1UYCA 3GIGA 2BYIA 3TZ5A 1YT0A 3D0BA 2BYHA 5CTWA 2YI0A 1I58A 2YKJA 4MPNA 4KSHA 4XCLA 3VHDA 2WEPA 1AH6A 2YE4A 4O09A 3TZ2A 4AWOA 2HHIA 1Z5CA 2BRCA 3ZXQA 1KZNA 1U2OA 2BSMA 5CF0A 1BYQA 1NHIA 2BREA 3VHCA 1TC6A 1L0OA 3RKZA 4MPEA 3B26A 4H81A 4U93A 1KIJA 4CE2A 2BU2A 3INXA 2FTKA 3R4PA 3BMYA 1I5AA 3OMUA 1UYFA 4FCQA 4HXWA 4I3HA 3IEDA 1YC1A 3VADA 1PVGA 2YE2A 4L8ZA 3CRLA 1UY6A 2WI2A 3WHAA 1S16A 2FYPA 4QPJA 1JM6A 3QTFA 1MX0A 2BTZA 4GEEA 2YE5A 2IOQA 5GGZA 5M4MA 5CTXA 4GCZA 4XIQA 3OWDA 3Q5KA 1ZXMA 1AMWA 5C93A 1EI1A 4KQVA 4Q20A 2BZ5A 2XHTA 2YEJA 3HYZA 1I5BA 5M4HA 3EHFA 3CYGA 5IDJA 1OSFA 4EGIA 5CTUA 1NHJA 4CE3A 4K4OA 4CWTA 3R91A 3PEHA 3JZ3A 1TC0A 3RLPA 4URLA 2XHRA 2YI6A 1YSZA 2C1GA 3HYYA
chains in the Genus database with same CATH topology
2YK9A 1UYHA 4HYMA 3LPSA 2YI7A 3T1KA 4AS9A 3A0WA 5J71A 3HHUA 2QG0A 2WI3A 3HZ5A 5J6AA 3T10A 4JQLA 4YKQA 4EFTA 4I5SA 1GKZA 1US7A 2YE9A 2YE3A 3MNRP 4ASFA 5M4PA 4DZYA 3Q5LA 2WI4A 4CWSA 2CH4A 3O2FA 4XD8A 3CGZA 4GT8A 2YGFA 1I59A 2K5BA 4O04A 3TUHA 1Y8NA 1YSRA 5D6QA 1AM1A 4ASBA 2IWSA 5L3JA 4MP7A 2YGEA 4FCRA 2H8MA 5FNDA 4YKUA 2WI6A 4L93A 2XDLA 2ZKJA 4H85A 2YGAA 4R1FA 4XC0A 4EEHA 1R62A 1YESA 3EKRA 1UYKA 3U2KA 2GQPA 2VCIA 1AJ6A 2YJXA 5M4KA 2XDXA 4FPPA 1UYLA 5FNFA 3R4MA 4XIPA 4MOTA 5F5RA 3K60A 2CCSA 2ZDXA 3G7EA 3Q5JA 3T2SA 3TZ4A 1B3QA 4NH7A 3HEKA 4HZ0A 4MB9A 2XDKA 2YECA 4YKRA 4BIUA 4BXIA 4XCJA 3OWBA 2YEGA 2XX4A 2GFDA 2XJXA 4CWQA 3CRKA 3D36A 1BXDA 2CCUA 3FT8A 3K97A 4KTNA 4HZ5A 2YKBA 4CWNA 4E02A 1TILA 1YC4A 3GIFA 3QDDA 4GGLA 1QYEA 2CGFA 2YEDA 3EHJA 2VWCA 2XK2A 5CPHA 4LWIA 4CWRA 3ZM7A 3A0YA 2FWZA 4V25A 3C11A 1YS3A 4JAVA 4JASA 1UYGA 2YI5A 1ZXNA 2ESAA 2WI5A 2YEHA 4O07A 3G75A 5IDMA 4ZVIA 5IN9A 3GIEA 1MU5A 4YKWA 5M4EA 4XIRA 4L94A 4NH9A 1ZW9A 2YEFA 4XITA 3NMQA 4HY1A 3FV5A 2HCHA 1I5DA 2BT0A 2QF6A 2Q8GA 4H7QA 4UROA 5BOCA 1BGQA 4GFNA 1Y4SA 2YEEA 5D7DA 4P8OA 3ZXOA 4BAEA 1YT2A 1GKXA 1H7UA 1ID0A 3FT5A 4YKZA 2IWXA 3INWA 2XDUA 2QG2A 4FCPA 1UYDA 4O05A 4AWPA 4E01A 4PRVA 4LWEA 2JKIA 2UWDA 3O6OA 2BU5A 5D7RA 1EA6A 3A0TA 4JAUA 2WERA 3B25A 5D7CA 2WEQA 2ZDYA 3K98A 1A4HA 2XHXA 2YE6A 3R4OA 4LPBA 4XKOA 3RLQA 5BODA 2YE7A 5CTYA 4XDMA 2Q8FA 3ZKBA 1UY7A 2JJCA 2YEIA 4B7PA 3U67A 2WI1A 4MP2A 2IORA 2QFOA 2IWUA 4EMVA 2YKCA 4BQGA 3ZKDA 4LWFA 3RLRA 1H7SA 2ZBKB 2HG1A 1YERA 1Y4UA 2XCMA 4X9LA 5M4NA 4W7TA 1Y8PA 4HXZA 2BU6A 2YEBA 4KSGA 3R92A 2YKIA 1Z59A 3KE6A 1UYIA 3D2RA 4PRXA 2O1VA 3H80A 4HY6A 4XTJA 4L91A 2Q8IA 2XJJA 4QPKA 3PEJA 4B6CA 3OW6A 5D6PA 3A0ZA 4XE2A 4AWQA 4URNA 2CCTA 4CE1A 1BKNA 4R3AA 3TZ0A 2YKEA 3EHGA 4P7AA 1Z5BA 4PL9A 4YKTA 1UYEA 4YKYA 2CG9A 3A0RA 4CWFA 3C0EA 1NHHA 3EHHA 2XX2A 2O1UA 1Y8OA 2YJWA 1AH8A 1UY8A 3O0IA 4NH8A 4U7OA 3WQ9A 1B62A 2BU7A 4ZKIA 3B27A 2XABA 4U7NA 2EXLA 2XD6A 3B24A 3BM9A 3HZ1A 4R3MA 1THNA 1Z5AA 1B63A 4EGHA 1TBWA 4FMTA 3SL2A 2FXSA 5FWKA 4MBCA 4E00A 4MPCA 4EFUA 1QY8A 4LP0A 3TTZA 4ASAA 2YE8A 1I5CA 1YC3A 4V26A 4DUHA 3LNUA 3H4LA 3T0HA 2XX5A 1GJVA 5FNCA 4O0BA 4XKAA 1TH8A 2H55A 2IOPA 2XJGA 4L90A 4LWHA 4KP4A 2PNRA 1UYMA 1U0ZA 1QZRA 2FWYA 2YK2A 2VCJA 2O1WA 3CWVA 2XDSA 1S14A 3DGEA 4YKXA 1YETA 3OPDA 4WUDA 4BIZA 3VHAA 3R4NA 2Q8HA 2AKPA 2Q2EB 4LWGA 3CGYA 4WUBA 4BQJA 1ZWHA 3GIGB 4CWOA 4KFGA 1TIDA 1YT1A 4EGKA 3A0XA 2WI7A 1UY9A 3EKOA 4CWPA 2VW5A 5F3KA 2BU8A 2C2AA 3G7BA 4URMA 4WUCA 2HKJA 4XKKA 3K99A 4EM7A 3U2DA 3B28A 4PU9A 4GQTA 2YEAA 3T0ZA 4HYPA 4ASGA 1UYCA 3GIGA 2BYIA 3TZ5A 1YT0A 3D0BA 2BYHA 5CTWA 2YI0A 1I58A 2YKJA 4MPNA 4KSHA 4XCLA 3VHDA 2WEPA 1AH6A 2YE4A 4O09A 3TZ2A 4AWOA 1Z5CA 2BRCA 3ZXQA 1KZNA 1U2OA 2BSMA 5CF0A 1BYQA 1NHIA 2BREA 3VHCA 1TC6A 1L0OA 3RKZA 4MPEA 3B26A 4H81A 4U93A 1KIJA 4CE2A 2BU2A 3INXA 3R4PA 3BMYA 1I5AA 3OMUA 1UYFA 4FCQA 4HXWA 4I3HA 3IEDA 1YC1A 3VADA 1PVGA 2YE2A 4L8ZA 3CRLA 1UY6A 2WI2A 3WHAA 1S16A 2FYPA 4QPJA 1JM6A 3QTFA 1MX0A 2BTZA 4GEEA 2YE5A 2IOQA 5GGZA 5M4MA 5CTXA 4GCZA 4XIQA 3OWDA 3Q5KA 1ZXMA 1AMWA 5C93A 1EI1A 4KQVA 4Q20A 2BZ5A 2XHTA 2YEJA 3HYZA 1I5BA 5M4HA 3EHFA 5IDJA 1OSFA 4EGIA 5CTUA 1NHJA 4CE3A 4K4OA 4CWTA 3R91A 3PEHA 3JZ3A 1TC0A 3RLPA 4URLA 2XHRA 2YI6A 1YSZA 2E0AA 3HYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YK9 A;  1UYH A;  4HYM A;  3LPS A;  2YI7 A;  3T1K A;  4AS9 A;  3A0W A;  5J71 A;  3HHU A;  2QG0 A;  2WI3 A;  3HZ5 A;  5J6A A;  3T10 A;  4JQL A;  4YKQ A;  4EFT A;  4I5S A;  1GKZ A;  1US7 A;  2YE9 A;  2YE3 A;  3MNR P;  4ASF A;  5M4P A;  4DZY A;  3Q5L A;  2WI4 A;  4CWS A;  2CH4 A;  3O2F A;  4XD8 A;  3CGZ A;  4GT8 A;  2YGF A;  1I59 A;  2K5B A;  4O04 A;  3TUH A;  1Y8N A;  1YSR A;  5D6Q A;  1AM1 A;  4ASB A;  2IWS A;  5L3J A;  4MP7 A;  2YGE A;  4FCR A;  2H8M A;  5FND A;  4YKU A;  2WI6 A;  4L93 A;  2XDL A;  2ZKJ A;  4H85 A;  2YGA A;  4R1F A;  4XC0 A;  4EEH A;  1R62 A;  1YES A;  3EKR A;  1UYK A;  3U2K A;  2GQP A;  2VCI A;  1AJ6 A;  2YJX A;  5M4K A;  2XDX A;  4FPP A;  1UYL A;  5FNF A;  3R4M A;  4XIP A;  4MOT A;  5F5R A;  3K60 A;  2CCS A;  2ZDX A;  3G7E A;  3Q5J A;  3T2S A;  3TZ4 A;  1B3Q A;  4NH7 A;  3HEK A;  4HZ0 A;  4MB9 A;  2XDK A;  2YEC A;  4YKR A;  4BIU A;  4BXI A;  4XCJ A;  3OWB A;  2YEG A;  2XX4 A;  2GFD A;  2XJX A;  4CWQ A;  3CRK A;  3D36 A;  1BXD A;  2CCU A;  3FT8 A;  3K97 A;  4KTN A;  4HZ5 A;  2YKB A;  4CWN A;  4E02 A;  1TIL A;  1YC4 A;  3GIF A;  3QDD A;  4GGL A;  1QYE A;  2CGF A;  2YED A;  3EHJ A;  2VWC A;  2XK2 A;  5CPH A;  4LWI A;  4CWR A;  3ZM7 A;  3A0Y A;  2FWZ A;  4V25 A;  3C11 A;  1YS3 A;  4JAV A;  4JAS A;  1UYG A;  2YI5 A;  1ZXN A;  2ESA A;  2WI5 A;  2YEH A;  4O07 A;  3G75 A;  5IDM A;  4ZVI A;  5IN9 A;  3GIE A;  1MU5 A;  4YKW A;  5M4E A;  4XIR A;  4L94 A;  4NH9 A;  1ZW9 A;  2YEF A;  4XIT A;  3NMQ A;  4HY1 A;  3FV5 A;  2HCH A;  1I5D A;  2BT0 A;  2QF6 A;  2Q8G A;  4H7Q A;  4URO A;  5BOC A;  1BGQ A;  4GFN A;  1Y4S A;  2YEE A;  5D7D A;  4P8O A;  3ZXO A;  4BAE A;  1YT2 A;  1GKX A;  1H7U A;  1ID0 A;  3FT5 A;  4YKZ A;  2IWX A;  3INW A;  2XDU A;  2QG2 A;  4FCP A;  1UYD A;  4O05 A;  4AWP A;  4E01 A;  4PRV A;  4LWE A;  2JKI A;  2UWD A;  3O6O A;  2BU5 A;  5D7R A;  1EA6 A;  3A0T A;  4JAU A;  2WER A;  3B25 A;  5D7C A;  2WEQ A;  2ZDY A;  3K98 A;  1A4H A;  2XHX A;  2YE6 A;  3R4O A;  4LPB A;  4XKO A;  3RLQ A;  5BOD A;  2YE7 A;  5CTY A;  4XDM A;  2Q8F A;  3ZKB A;  1UY7 A;  2JJC A;  2YEI A;  4B7P A;  3U67 A;  2WI1 A;  4MP2 A;  2IOR A;  2QFO A;  2IWU A;  4EMV A;  2YKC A;  4BQG A;  3ZKD A;  4LWF A;  3RLR A;  1H7S A;  2ZBK B;  2HG1 A;  1YER A;  1Y4U A;  2XCM A;  4X9L A;  5M4N A;  4W7T A;  1Y8P A;  4HXZ A;  2BU6 A;  2YEB A;  4KSG A;  3R92 A;  2YKI A;  1Z59 A;  3KE6 A;  1UYI A;  3D2R A;  4PRX A;  2O1V A;  3H80 A;  4HY6 A;  4XTJ A;  4L91 A;  2Q8I A;  2XJJ A;  4QPK A;  3PEJ A;  4B6C A;  3OW6 A;  5D6P A;  3A0Z A;  4XE2 A;  4AWQ A;  4URN A;  2CCT A;  4CE1 A;  1BKN A;  4R3A A;  3TZ0 A;  2YKE A;  3EHG A;  4P7A A;  1Z5B A;  4PL9 A;  4YKT A;  1UYE A;  4YKY A;  2CG9 A;  3A0R A;  4CWF A;  3C0E A;  1NHH A;  3EHH A;  2XX2 A;  2O1U A;  1Y8O A;  2YJW A;  1AH8 A;  1UY8 A;  3O0I A;  4NH8 A;  4U7O A;  3WQ9 A;  1B62 A;  2BU7 A;  4ZKI A;  3B27 A;  2XAB A;  4U7N A;  2EXL A;  2XD6 A;  3B24 A;  3BM9 A;  3HZ1 A;  4R3M A;  1THN A;  1Z5A A;  1B63 A;  4EGH A;  1TBW A;  4FMT A;  3SL2 A;  2FXS A;  5FWK A;  4MBC A;  4E00 A;  4MPC A;  4EFU A;  1QY8 A;  4LP0 A;  3TTZ A;  4ASA A;  2YE8 A;  1I5C A;  1YC3 A;  4V26 A;  4DUH A;  3LNU A;  3H4L A;  3T0H A;  2XX5 A;  1GJV A;  5FNC A;  4O0B A;  4XKA A;  1TH8 A;  2H55 A;  2IOP A;  2XJG A;  4L90 A;  4LWH A;  4KP4 A;  2PNR A;  1UYM A;  1U0Z A;  1QZR A;  2FWY A;  2YK2 A;  2VCJ A;  2O1W A;  3CWV A;  2XDS A;  1S14 A;  3DGE A;  4YKX A;  1YET A;  3OPD A;  4WUD A;  4BIZ A;  3VHA A;  3R4N A;  2Q8H A;  2AKP A;  2Q2E B;  4LWG A;  3CGY A;  4WUB A;  4BQJ A;  1ZWH A;  3GIG B;  4CWO A;  4KFG A;  1TID A;  1YT1 A;  4EGK A;  3A0X A;  2WI7 A;  1UY9 A;  3EKO A;  4CWP A;  2VW5 A;  5F3K A;  2BU8 A;  2C2A A;  3G7B A;  4URM A;  4WUC A;  2HKJ A;  4XKK A;  3K99 A;  4EM7 A;  3U2D A;  3B28 A;  4PU9 A;  4GQT A;  2YEA A;  3T0Z A;  4HYP A;  4ASG A;  1UYC A;  3GIG A;  2BYI A;  3TZ5 A;  1YT0 A;  3D0B A;  2BYH A;  5CTW A;  2YI0 A;  1I58 A;  2YKJ A;  4MPN A;  4KSH A;  4XCL A;  3VHD A;  2WEP A;  1AH6 A;  2YE4 A;  4O09 A;  3TZ2 A;  4AWO A;  1Z5C A;  2BRC A;  3ZXQ A;  1KZN A;  1U2O A;  2BSM A;  5CF0 A;  1BYQ A;  1NHI A;  2BRE A;  3VHC A;  1TC6 A;  1L0O A;  3RKZ A;  4MPE A;  3B26 A;  4H81 A;  4U93 A;  1KIJ A;  4CE2 A;  2BU2 A;  3INX A;  3R4P A;  3BMY A;  1I5A A;  3OMU A;  1UYF A;  4FCQ A;  4HXW A;  4I3H A;  3IED A;  1YC1 A;  3VAD A;  1PVG A;  2YE2 A;  4L8Z A;  3CRL A;  1UY6 A;  2WI2 A;  3WHA A;  1S16 A;  2FYP A;  4QPJ A;  1JM6 A;  3QTF A;  1MX0 A;  2BTZ A;  4GEE A;  2YE5 A;  2IOQ A;  5GGZ A;  5M4M A;  5CTX A;  4GCZ A;  4XIQ A;  3OWD A;  3Q5K A;  1ZXM A;  1AMW A;  5C93 A;  1EI1 A;  4KQV A;  4Q20 A;  2BZ5 A;  2XHT A;  2YEJ A;  3HYZ A;  1I5B A;  5M4H A;  3EHF A;  5IDJ A;  1OSF A;  4EGI A;  5CTU A;  1NHJ A;  4CE3 A;  4K4O A;  4CWT A;  3R91 A;  3PEH A;  3JZ3 A;  1TC0 A;  3RLP A;  4URL A;  2XHR A;  2YI6 A;  1YSZ A;  2E0A A;  3HYY A; 
#chains in the Genus database with same CATH topology
 2YK9 A;  1UYH A;  4HYM A;  3LPS A;  2YI7 A;  2C1I A;  3T1K A;  4AS9 A;  3A0W A;  5J71 A;  3HHU A;  2QG0 A;  2WI3 A;  3HZ5 A;  5J6A A;  3T10 A;  4JQL A;  4YKQ A;  4EFT A;  4I5S A;  1GKZ A;  1US7 A;  2YE9 A;  2YE3 A;  3MNR P;  4ASF A;  5M4P A;  4DZY A;  3Q5L A;  2WI4 A;  4CWS A;  2CH4 A;  3O2F A;  4XD8 A;  3CGZ A;  4GT8 A;  2YGF A;  1I59 A;  2K5B A;  4O04 A;  3TUH A;  1Y8N A;  1YSR A;  5D6Q A;  1AM1 A;  4ASB A;  2IWS A;  5L3J A;  4MP7 A;  2YGE A;  4FCR A;  2H8M A;  5FND A;  4YKU A;  2WI6 A;  4L93 A;  2XDL A;  2ZKJ A;  4H85 A;  2YGA A;  4R1F A;  4XC0 A;  4EEH A;  1R62 A;  1YES A;  3EKR A;  1UYK A;  3U2K A;  2GQP A;  2VCI A;  1AJ6 A;  2YJX A;  5M4K A;  2XDX A;  4FPP A;  1UYL A;  5FNF A;  3R4M A;  4XIP A;  4MOT A;  5F5R A;  3K60 A;  2CCS A;  2ZDX A;  3G7E A;  3Q5J A;  3T2S A;  3TZ4 A;  1B3Q A;  4NH7 A;  3HEK A;  4HZ0 A;  4MB9 A;  2XDK A;  2YEC A;  4YKR A;  4BIU A;  4BXI A;  4XCJ A;  3OWB A;  2YEG A;  2XX4 A;  2GFD A;  2XJX A;  4CWQ A;  3CRK A;  3D36 A;  2E0A A;  1BXD A;  2CCU A;  3FT8 A;  3K97 A;  4KTN A;  4HZ5 A;  2YKB A;  4CWN A;  4E02 A;  1TIL A;  1YC4 A;  3GIF A;  3QDD A;  4GGL A;  1QYE A;  2CGF A;  2YED A;  3EHJ A;  2VWC A;  2XK2 A;  5CPH A;  4LWI A;  4CWR A;  3ZM7 A;  3A0Y A;  2FWZ A;  4V25 A;  3C11 A;  1YS3 A;  4JAV A;  4JAS A;  1UYG A;  2YI5 A;  1ZXN A;  2ESA A;  2WI5 A;  2YEH A;  4O07 A;  5JEN A;  3G75 A;  5IDM A;  4ZVI A;  5IN9 A;  3GIE A;  1MU5 A;  4YKW A;  5M4E A;  4XIR A;  4L94 A;  4NH9 A;  1ZW9 A;  2YEF A;  3S5T A;  4XIT A;  3NMQ A;  4HY1 A;  3FV5 A;  2HCH A;  1I5D A;  2BT0 A;  2QF6 A;  2Q8G A;  4H7Q A;  4URO A;  5BOC A;  1BGQ A;  4GFN A;  1Y4S A;  2YEE A;  5D7D A;  4P8O A;  3ZXO A;  4BAE A;  1YT2 A;  1GKX A;  1H7U A;  1ID0 A;  3FT5 A;  4YKZ A;  3LMM A;  2IWX A;  3INW A;  2XDU A;  2QG2 A;  4FCP A;  4E72 A;  1UYD A;  4O05 A;  4AWP A;  4E01 A;  4PRV A;  4LWE A;  2JKI A;  2UWD A;  3O6O A;  2BU5 A;  5D7R A;  1EA6 A;  3A0T A;  4JAU A;  2WER A;  3B25 A;  5D7C A;  2WEQ A;  2ZDY A;  3K98 A;  1A4H A;  2XHX A;  2YE6 A;  3R4O A;  4LPB A;  4XKO A;  3RLQ A;  5BOD A;  2YE7 A;  5CTY A;  4XDM A;  2Q8F A;  3ZKB A;  1UY7 A;  2JJC A;  2YEI A;  4B7P A;  3U67 A;  2WI1 A;  4MP2 A;  2IOR A;  2QFO A;  2IWU A;  4EMV A;  2YKC A;  4BQG A;  3ZKD A;  4LWF A;  3RLR A;  1H7S A;  2ZBK B;  2HG1 A;  1YER A;  1Y4U A;  2XCM A;  4X9L A;  5M4N A;  4W7T A;  1Y8P A;  4HXZ A;  2BU6 A;  2YEB A;  4KSG A;  3R92 A;  2YKI A;  1Z59 A;  3KE6 A;  1UYI A;  3D2R A;  4PRX A;  2O1V A;  3H80 A;  4HY6 A;  4XTJ A;  4L91 A;  2Q8I A;  2XJJ A;  4QPK A;  3PEJ A;  4B6C A;  3OW6 A;  5D6P A;  3A0Z A;  4XE2 A;  4AWQ A;  4URN A;  2CCT A;  1F51 A;  4CE1 A;  1BKN A;  4R3A A;  3TZ0 A;  2YKE A;  3EHG A;  4P7A A;  1Z5B A;  4PL9 A;  4YKT A;  1UYE A;  4YKY A;  2CG9 A;  3A0R A;  4CWF A;  3C0E A;  1NHH A;  3EHH A;  2XX2 A;  2O1U A;  1Y8O A;  2YJW A;  1AH8 A;  1UY8 A;  3O0I A;  4NH8 A;  4U7O A;  3WQ9 A;  1B62 A;  2BU7 A;  4ZKI A;  3B27 A;  2XAB A;  4U7N A;  2EXL A;  2XD6 A;  3B24 A;  3BM9 A;  3HZ1 A;  4R3M A;  1THN A;  1Z5A A;  1B63 A;  4EGH A;  1TBW A;  4FMT A;  3SL2 A;  2FXS A;  5FWK A;  4MBC A;  4E00 A;  4MPC A;  4EFU A;  1QY8 A;  4LP0 A;  3TTZ A;  4ASA A;  2YE8 A;  1I5C A;  1YC3 A;  4V26 A;  4DUH A;  3LNU A;  3H4L A;  3T0H A;  2XX5 A;  1GJV A;  5FNC A;  4O0B A;  4XKA A;  1TH8 A;  2H55 A;  2IOP A;  2XJG A;  4L90 A;  4LWH A;  4KP4 A;  2PNR A;  1UYM A;  1U0Z A;  1QZR A;  2FWY A;  2YK2 A;  2VCJ A;  2O1W A;  3CWV A;  2XDS A;  1S14 A;  3DGE A;  4YKX A;  1YET A;  3OPD A;  4WUD A;  4BIZ A;  3VHA A;  3R4N A;  2Q8H A;  2AKP A;  2Q2E B;  4LWG A;  3CGY A;  4WUB A;  4BQJ A;  1ZWH A;  3GIG B;  4CWO A;  4KFG A;  1TID A;  1YT1 A;  4EGK A;  3A0X A;  1IXM A;  2WI7 A;  1UY9 A;  3EKO A;  4CWP A;  2VW5 A;  5F3K A;  2BU8 A;  2C2A A;  3G7B A;  4URM A;  4WUC A;  2HKJ A;  4XKK A;  3K99 A;  4EM7 A;  3U2D A;  3B28 A;  4PU9 A;  4GQT A;  2YEA A;  3T0Z A;  4HYP A;  4ASG A;  1UYC A;  3GIG A;  2BYI A;  3TZ5 A;  1YT0 A;  3D0B A;  2BYH A;  5CTW A;  2YI0 A;  1I58 A;  2YKJ A;  4MPN A;  4KSH A;  4XCL A;  3VHD A;  2WEP A;  1AH6 A;  2YE4 A;  4O09 A;  3TZ2 A;  4AWO A;  2HHI A;  1Z5C A;  2BRC A;  3ZXQ A;  1KZN A;  1U2O A;  2BSM A;  5CF0 A;  1BYQ A;  1NHI A;  2BRE A;  3VHC A;  1TC6 A;  1L0O A;  3RKZ A;  4MPE A;  3B26 A;  4H81 A;  4U93 A;  1KIJ A;  4CE2 A;  2BU2 A;  3INX A;  2FTK A;  3R4P A;  3BMY A;  1I5A A;  3OMU A;  1UYF A;  4FCQ A;  4HXW A;  4I3H A;  3IED A;  1YC1 A;  3VAD A;  1PVG A;  2YE2 A;  4L8Z A;  3CRL A;  1UY6 A;  2WI2 A;  3WHA A;  1S16 A;  2FYP A;  4QPJ A;  1JM6 A;  3QTF A;  1MX0 A;  2BTZ A;  4GEE A;  2YE5 A;  2IOQ A;  5GGZ A;  5M4M A;  5CTX A;  4GCZ A;  4XIQ A;  3OWD A;  3Q5K A;  1ZXM A;  1AMW A;  5C93 A;  1EI1 A;  4KQV A;  4Q20 A;  2BZ5 A;  2XHT A;  2YEJ A;  3HYZ A;  1I5B A;  5M4H A;  3EHF A;  3CYG A;  5IDJ A;  1OSF A;  4EGI A;  5CTU A;  1NHJ A;  4CE3 A;  4K4O A;  4CWT A;  3R91 A;  3PEH A;  3JZ3 A;  1TC0 A;  3RLP A;  4URL A;  2XHR A;  2YI6 A;  1YSZ A;  2C1G A;  3HYY A; 
#chains in the Genus database with same CATH homology
 2YK9 A;  1UYH A;  4HYM A;  3LPS A;  2YI7 A;  3T1K A;  4AS9 A;  3A0W A;  5J71 A;  3HHU A;  2QG0 A;  2WI3 A;  3HZ5 A;  5J6A A;  3T10 A;  4JQL A;  4YKQ A;  4EFT A;  4I5S A;  1GKZ A;  1US7 A;  2YE9 A;  2YE3 A;  3MNR P;  4ASF A;  5M4P A;  4DZY A;  3Q5L A;  2WI4 A;  4CWS A;  2CH4 A;  3O2F A;  4XD8 A;  3CGZ A;  4GT8 A;  2YGF A;  1I59 A;  2K5B A;  4O04 A;  3TUH A;  1Y8N A;  1YSR A;  5D6Q A;  1AM1 A;  4ASB A;  2IWS A;  5L3J A;  4MP7 A;  2YGE A;  4FCR A;  2H8M A;  5FND A;  4YKU A;  2WI6 A;  4L93 A;  2XDL A;  2ZKJ A;  4H85 A;  2YGA A;  4R1F A;  4XC0 A;  4EEH A;  1R62 A;  1YES A;  3EKR A;  1UYK A;  3U2K A;  2GQP A;  2VCI A;  1AJ6 A;  2YJX A;  5M4K A;  2XDX A;  4FPP A;  1UYL A;  5FNF A;  3R4M A;  4XIP A;  4MOT A;  5F5R A;  3K60 A;  2CCS A;  2ZDX A;  3G7E A;  3Q5J A;  3T2S A;  3TZ4 A;  1B3Q A;  4NH7 A;  3HEK A;  4HZ0 A;  4MB9 A;  2XDK A;  2YEC A;  4YKR A;  4BIU A;  4BXI A;  4XCJ A;  3OWB A;  2YEG A;  2XX4 A;  2GFD A;  2XJX A;  4CWQ A;  3CRK A;  3D36 A;  1BXD A;  2CCU A;  3FT8 A;  3K97 A;  4KTN A;  4HZ5 A;  2YKB A;  4CWN A;  4E02 A;  1TIL A;  1YC4 A;  3GIF A;  3QDD A;  4GGL A;  1QYE A;  2CGF A;  2YED A;  3EHJ A;  2VWC A;  2XK2 A;  5CPH A;  4LWI A;  4CWR A;  3ZM7 A;  3A0Y A;  2FWZ A;  4V25 A;  3C11 A;  1YS3 A;  4JAV A;  4JAS A;  1UYG A;  2YI5 A;  1ZXN A;  2ESA A;  2WI5 A;  2YEH A;  4O07 A;  3G75 A;  5IDM A;  4ZVI A;  5IN9 A;  3GIE A;  1MU5 A;  4YKW A;  5M4E A;  4XIR A;  4L94 A;  4NH9 A;  1ZW9 A;  2YEF A;  4XIT A;  3NMQ A;  4HY1 A;  3FV5 A;  2HCH A;  1I5D A;  2BT0 A;  2QF6 A;  2Q8G A;  4H7Q A;  4URO A;  5BOC A;  1BGQ A;  4GFN A;  1Y4S A;  2YEE A;  5D7D A;  4P8O A;  3ZXO A;  4BAE A;  1YT2 A;  1GKX A;  1H7U A;  1ID0 A;  3FT5 A;  4YKZ A;  2IWX A;  3INW A;  2XDU A;  2QG2 A;  4FCP A;  1UYD A;  4O05 A;  4AWP A;  4E01 A;  4PRV A;  4LWE A;  2JKI A;  2UWD A;  3O6O A;  2BU5 A;  5D7R A;  1EA6 A;  3A0T A;  4JAU A;  2WER A;  3B25 A;  5D7C A;  2WEQ A;  2ZDY A;  3K98 A;  1A4H A;  2XHX A;  2YE6 A;  3R4O A;  4LPB A;  4XKO A;  3RLQ A;  5BOD A;  2YE7 A;  5CTY A;  4XDM A;  2Q8F A;  3ZKB A;  1UY7 A;  2JJC A;  2YEI A;  4B7P A;  3U67 A;  2WI1 A;  4MP2 A;  2IOR A;  2QFO A;  2IWU A;  4EMV A;  2YKC A;  4BQG A;  3ZKD A;  4LWF A;  3RLR A;  1H7S A;  2ZBK B;  2HG1 A;  1YER A;  1Y4U A;  2XCM A;  4X9L A;  5M4N A;  4W7T A;  1Y8P A;  4HXZ A;  2BU6 A;  2YEB A;  4KSG A;  3R92 A;  2YKI A;  1Z59 A;  3KE6 A;  1UYI A;  3D2R A;  4PRX A;  2O1V A;  3H80 A;  4HY6 A;  4XTJ A;  4L91 A;  2Q8I A;  2XJJ A;  4QPK A;  3PEJ A;  4B6C A;  3OW6 A;  5D6P A;  3A0Z A;  4XE2 A;  4AWQ A;  4URN A;  2CCT A;  4CE1 A;  1BKN A;  4R3A A;  3TZ0 A;  2YKE A;  3EHG A;  4P7A A;  1Z5B A;  4PL9 A;  4YKT A;  1UYE A;  4YKY A;  2CG9 A;  3A0R A;  4CWF A;  3C0E A;  1NHH A;  3EHH A;  2XX2 A;  2O1U A;  1Y8O A;  2YJW A;  1AH8 A;  1UY8 A;  3O0I A;  4NH8 A;  4U7O A;  3WQ9 A;  1B62 A;  2BU7 A;  4ZKI A;  3B27 A;  2XAB A;  4U7N A;  2EXL A;  2XD6 A;  3B24 A;  3BM9 A;  3HZ1 A;  4R3M A;  1THN A;  1Z5A A;  1B63 A;  4EGH A;  1TBW A;  4FMT A;  3SL2 A;  2FXS A;  5FWK A;  4MBC A;  4E00 A;  4MPC A;  4EFU A;  1QY8 A;  4LP0 A;  3TTZ A;  4ASA A;  2YE8 A;  1I5C A;  1YC3 A;  4V26 A;  4DUH A;  3LNU A;  3H4L A;  3T0H A;  2XX5 A;  1GJV A;  5FNC A;  4O0B A;  4XKA A;  1TH8 A;  2H55 A;  2IOP A;  2XJG A;  4L90 A;  4LWH A;  4KP4 A;  2PNR A;  1UYM A;  1U0Z A;  1QZR A;  2FWY A;  2YK2 A;  2VCJ A;  2O1W A;  3CWV A;  2XDS A;  1S14 A;  3DGE A;  4YKX A;  1YET A;  3OPD A;  4WUD A;  4BIZ A;  3VHA A;  3R4N A;  2Q8H A;  2AKP A;  2Q2E B;  4LWG A;  3CGY A;  4WUB A;  4BQJ A;  1ZWH A;  3GIG B;  4CWO A;  4KFG A;  1TID A;  1YT1 A;  4EGK A;  3A0X A;  2WI7 A;  1UY9 A;  3EKO A;  4CWP A;  2VW5 A;  5F3K A;  2BU8 A;  2C2A A;  3G7B A;  4URM A;  4WUC A;  2HKJ A;  4XKK A;  3K99 A;  4EM7 A;  3U2D A;  3B28 A;  4PU9 A;  4GQT A;  2YEA A;  3T0Z A;  4HYP A;  4ASG A;  1UYC A;  3GIG A;  2BYI A;  3TZ5 A;  1YT0 A;  3D0B A;  2BYH A;  5CTW A;  2YI0 A;  1I58 A;  2YKJ A;  4MPN A;  4KSH A;  4XCL A;  3VHD A;  2WEP A;  1AH6 A;  2YE4 A;  4O09 A;  3TZ2 A;  4AWO A;  1Z5C A;  2BRC A;  3ZXQ A;  1KZN A;  1U2O A;  2BSM A;  5CF0 A;  1BYQ A;  1NHI A;  2BRE A;  3VHC A;  1TC6 A;  1L0O A;  3RKZ A;  4MPE A;  3B26 A;  4H81 A;  4U93 A;  1KIJ A;  4CE2 A;  2BU2 A;  3INX A;  3R4P A;  3BMY A;  1I5A A;  3OMU A;  1UYF A;  4FCQ A;  4HXW A;  4I3H A;  3IED A;  1YC1 A;  3VAD A;  1PVG A;  2YE2 A;  4L8Z A;  3CRL A;  1UY6 A;  2WI2 A;  3WHA A;  1S16 A;  2FYP A;  4QPJ A;  1JM6 A;  3QTF A;  1MX0 A;  2BTZ A;  4GEE A;  2YE5 A;  2IOQ A;  5GGZ A;  5M4M A;  5CTX A;  4GCZ A;  4XIQ A;  3OWD A;  3Q5K A;  1ZXM A;  1AMW A;  5C93 A;  1EI1 A;  4KQV A;  4Q20 A;  2BZ5 A;  2XHT A;  2YEJ A;  3HYZ A;  1I5B A;  5M4H A;  3EHF A;  5IDJ A;  1OSF A;  4EGI A;  5CTU A;  1NHJ A;  4CE3 A;  4K4O A;  4CWT A;  3R91 A;  3PEH A;  3JZ3 A;  1TC0 A;  3RLP A;  4URL A;  2XHR A;  2YI6 A;  1YSZ A;  2E0A A;  3HYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...