1R6KA

Hpv11 e2 tad crystal structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
187
Chain Sequence
AIAKRLDACQDQLLELYEENSIDIHKHIMHWKCIRLESVLLHKAKQMGLSHIGLQVVPPLTVSETKGHNAIEMQMHLESLAKTQYGVEPWTLQDTSYEMWLTPPKRCFKKQGNTVEVKFVMEYVVWTHIYLQDNDSWVKVTSSVDAKGIYYTCGQFKTYYVNFNKEAQKYGSTNHWEVCYGSTVICS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HPV11 REGULATORY PROTEIN E2
publication title Crystal Structure of the E2 Transactivation Domain of Human Papillomavirus Type 11 Bound to a Protein Interaction Inhibitor
pubmed doi rcsb
source organism Human papillomavirus type 11
molecule tags Transcription, replication
total genus 61
structure length 187
sequence length 193
ec nomenclature
pdb deposition date 2003-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r6kA01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 1r6kA02
1R6NA 1QQHA 2JEXA 2JEUA 1TUEB 1DTOA 2NNUA 1R6KA
chains in the Genus database with same CATH superfamily
4DUZB 4DR3B 3LNNA 3JAKB 4NVPA 3RBZA 2XAHA 5ITZA 2JGDA 3CRMA 2R9RB 4DR6B 3VQVA 4IIJB 2QWPB 3CJHB 2A0LA 3D36C 4K8XA 4DR2B 1P49A 1NS1A 2P6JA 2JIZG 2DWEC 4BWAA 4GKKO 2YI8A 1GN4A 4Z1VA 4O4LA 1I08A 1QCEA 3APQA 4JGSA 2IJIA 5CMUA 5KA6A 4GX2A 1M90W 4EEQA 4MVOA 4MVZA 2F4VB 3ASNC 3K06A 1RPRA 2A3QA 2DYRC 5FPOA 4LWSA 4JI3O 4OXSA 5FPRA 4L87A 3VQWA 2PF4E 5KUMA 4FFBA 2BOCC 4YXWG 3HKEB 4C7UA 2W6JG 3R66A 4JI6B 1EM1A 2IBZH 1S5HC 3JCZA 1R6NA 4BW9A 2E74B 3FD9A 5IYZB 4DV2B 1D5AA 3OMIB 4DRXB 1MZFA 3J81N 1RFYA 2XAQA 4TV8A 3K0DA 1HDJA 4UCVA 3TGUH 4YHHB 1I5XA 4HBNA 5H9CA 3SPHA 3ZHSA 4F6EA 5B3SC 1TUEB 1XHXA 3ZHTA 2OTJV 2DE0X 1GK9A 1OCZB 4PA3A 4TV9A 4LCUC 4YJ2A 1SESA 4JAVA 1YTFD 1QQHA 4P2ZA 1YZBA 2ZE6A 1W2BU 1VQOV 4JAAA 4FLWA 1WPXA 2X6BA 4JI4O 2ZE7A 3SYAA 1B04A 4X1IB 1SETA 5LOVB 4K8ZA 5HFMA 5TISZ 2JJ2G 1NKDA 5JJNB 1K5SA 2P90A 3W7TA 1YITV 4Z2WA 4WFEA 4DUZO 4GX1A 5B1AB 3CXCU 1XDCA 2UUCB 5JVDA 2JRIA 5HFLA 5H6QA 5LMUO 4DR6O 2PGGA 4IHJB 4NR1A 5LXTB 3RGBA 3U0ZA 4RAIA 1TVKA 2UXCB 1Y74A 1Y66A 1NTKH 3SJBC 4LF4O 4DV0B 3OAAG 4KHPB 1VMGA 3U10A 4Z1MG 3M7MX 4KFMA 3ZMSA 1MOFA 4LBEC 4U7OA 3VQYA 1WP7A 1PL0A 2NNUA 4IT5A 1SF9A 4EKWA 2WLMA 2VWKA 2WLNA 3N2GA 1KMIZ 2EZOA 1Q6HA 3S3WA 1F4NA 1HNZB 3OMNB 2JS5A 5LHGA 3HKBB 1H2GA 4N23A 5KAIZ 1S5JA 2YI9A 1SZTA 1K97A 3UCSC 1DLBA 2FTKA 3JD3A 1JMKC 3L74H 1IXBA 3APOA 4LR3A 1A32A 2YEVB 5JJJB 1HWYA 2R9AA 2V1DA 3L71H 2WLIA 5DECA 2QWOB 4WFBV 4O4JA 2XOKG 4D7SA 4X1KA 1H2KA 2ZM6B 3FX7A 5K1PA 3G71V 2PYLA 2YIAA 3ZJZA 3CCSV 3IJ4A 2WSSG 4H13B 2JDIG 4X8AA 4UCSA 4YJ3A 2IH3C 3CCVV 1XREA 2Q69A 5LGTA 3N27A 1IBLO 2BSKA 3CCQV 4JZ2A 2E5LO 4I9WA 4MTFA 4NKGB 4I55B 1KQSU 5DN6G 1THZA 3JD0A 1JA8A 3CWBH 3K04A 1ZSPA 2DYSC 1AVMA 2HG5C 3ETGA 3ABLB 4DR4B 1J5EO 1ZX3A 2QWNB 5IYDO 4JI2B 1NI8A 4JF3A 3UT5A 4X20A 4IIJA 3ASOC 3E22A 1NTMH 4QGPA 1R3LC 3A8TA 3QO7A 5K1XA 4DV1O 5LMNB 5A2QN 1SQGA 1M57C 2W0FC 2JGUA 4X65B 4MTGA 5IYBO 1G1XB 2AHYA 1NZ6A 1NH2B 2P5OA 1FFXA 5H6RA 4NXMO 1XI1A 3ZN0A 4J11A 2IM9A 4DV6O 5EYPA 3K5NA 2YUAA 1PM9A 3HKEA 4RQEA 5JJEB 4RWUA 2GDSA 4FJCC 1YHQV 3TCUA 2ITDC 4MW3A 4PI2A 2Q6AA 2XUMA 4GLXA 2R9IA 2JVDA 2KSDA 2FB5A 3EXAA 2XAFA 1MNGA 5KAFZ 2ZM6O 1IBKB 2H94A 3JALA 3OTOO 3OD4A 1B3QA 2YXHA 1PNMA 5KX5A 5C8YA 5KHGA 3FYEB 2N74A 5CA1B 3K57A 3TK1A 2UU9B 4J9ZB 3U11A 2CTRA 2YSUB 3C90A 2WLJA 4CH3A 3AK3A 4NYKA 1XNRO 2YXYA 1EBOA 1AR1B 2VQFB 3DGEA 2LW7A 1IBMB 3B4SA 2RCVA 3CXHF 3FB6C 1KP3A 4LF8O 4FZ1A 1OZ0A 3CRQA 1TGOA 3AG2B 3MAQA 1FFTB 4JI8B 4JI1B 4G28B 3E8BA 4FLZA 2WAMA 2OTLV 2B9ZA 3AG4B 2IU3A 3CB2A 3GVMA 3K08A 4X62O 4X66O 3AG3B 2UUAB 4O4IA 3R65A 1PNLA 4XDLA 4LP8A 5CA0A 1X59A 3JASA 3KKYA 4K0KB 4K35A 5JQGB 1L0NH 3MHSC 4UVCA 1F23A 1MMMA 5AG2A 4JI7B 5BR8O 2CTWA 3P32A 3LNMB 4EB6B 2JEUA 2F43G 4MVSA 1XUQA 5LA6B 4O4HB 2MW2B 1K8AW 3F5TA 2M7WA 3EVKA 1R1BA 2GV9A 1S72V 2E75B 5IJ0B 3T1YO 2RN9A 3RN4A 1CPYA 2QWRB 3E86A 1OCZC 4XDJA 4PJ0Z 3B77A 2XT9A 3TXSA 1FKAO 4LF5B 4LFBB 5IDJA 1NBMG 3I5DA 1YCIA 2EILB 5LBQA 4B3MB 3BA9A 2GTAA 1SQPH 2BTQA 3SYOA 1NH2D 4KUMA 3L75H 3J7AU 3BAAA 3Q4HB 1OCRB 3BHPA 3GWOA 3B8NA 3SPIA 2EIMC 2HVKC 1U97A 3B2EE 1YF2A 3JAMN 1KKDA 1PPJH 1KKCA 4DUYO 2H8PC 2QR4A 2UXDO 5KUKA 1D5NA 1VP7A 1N34B 3H1LH 5LHIA 1XNQB 1N0JA 4FK5C 2AZ0A 2K1EA 4ZHQA 1AILA 4TT3G 2ATKC 1G8MA 3BEHA 4HNAA 4CH4A 2DN9A 1RM1B 1VF5B 1JCHA 1Q6UA 2LGWA 1Q8IA 3CCLV 1X4TA 4ICGA 4JI1O 2HP8A 1O9GA 1Q81W 1UFIA 1W0KG 1WN7A 4DV7B 4J7JA 3FAVA 3UO3A 1NT2B 3QVNA 1L1FA 3ZMZA 5FNVA 3SYPA 3S3XA 4R6ZA 1NTZH 2EZPA 4BAYA 3TETA 4I5SA 4F6RA 2VQEO 2FKXA 2Q0OC 1JJ2U 4TSFG 5EC2C 2Z3YA 2MK3A 4DR7B 2IW5A 5D5PA 2WLLA 1HNXB 4DYLA 4P9OA 1Y4MA 2OYQA 2EIKB 1FAFA 5IE9A 1NR7A 3H1KH 4RQFA 2XHBA 1TUBB 2R70A 2B1IA 3DSQA 5GW7A 1SA0A 2Z5UA 3D3IA 4W4LA 3DC6A 3CMEV 2NN4A 3T1HB 2GUZB 1F51A 1K9MW 4N21A 2ZNJA 4YIPA 1VQ4V 3TJTA 2ZDIC 4DV5B 3ABKB 4JV5O 1FJGB 4PD4F 5KHJA 1JX9A 2YICA 3QO8A 3I56V 4CH6A 2KKWA 4QPJA 2DQ3A 4WFHA 3BVOA 3DXRB 4DV3O 2QDOA 4DO2A 1EN6A 1JFFA 2NLJC 2YC0A 1EN4A 1VQLV 1RSOA 4NTYA 4EFBA 4MTOA 3ETEA 1BCCH 3B8MA 1YDXA 1M56B 1O9HA 3H1JH 3N2KB 1K92A 1OCCC 4EFEA 4FVMA 2HR3A 2ZINA 3LDCA 1BMFG 3ABLC 3OTFA 3CRCA 1BE3H 2VRZA 2ZQMA 4LNUA 1URFA 2UXBB 1N33B 3RYFB 2JK5C 2WA3A 2Y4TA 3ML0A 4LF9O 5F2VO 2FL4A 4LC1A 5IT9N 3OR7C 3OR6C 1PV0A 1TAEA 3OEHG 2ADQB 5A9GA 5JH7A 3RYIA 5BMVA 3CS5A 2QM4A 1MSDA 1XBLA 1VQ6V 4G2KA 4ASUG 3ABMB 1KYOF 3HKCA 3CX5F 4XBFA 1HNWO 2Y4UA 1SC5B 2QEXV 1R73A 1N32O 5FLXN 2QM7A 5D5QA 1EFRG 3K59A 5CA3A 2W6IG 1GM7A 4PA4A 3HR0A 4I4TB 5LYJA 2OIEA 1SQBH 2HHHB 3X2QB 3JATA 2ADPA 5IJ9B 3D8CA 3JAWB 4H44B 4PDVA 2DOSA 2P22C 4U3FH 1VQPV 1I94B 1AROP 4LF6O 5GONA 2WPDG 1IXMA 5JCOC 1QR9A 4X1YA 4DR3O 5CB4B 1SERA 4O2BA 1WAZA 3MHHC 3G6EV 1AI7A 3G80A 2RQ6A 3C3SA 3C3TA 4QIWF 3WB1A 2Y0IA 4UUJC 1GM9A 2Q5ZA 2LFSA 5IWAB 1WA8B 2R72A 2IH1C 1LUWA 2CAZC 3OGIB 2HKOA 1Y76B 4DR2O 3RYCA 3HKDB 3L9DA 2OT5A 2Z0AA 4MVUA 1L0LH 1MABG 4I50B 3RYHA 3TXQA 3E8FA 4MTXA 5L3DA 1V55B 2HJFC 2EINB 3E89A 2F4VO 4K3AA 4UCRA 4CZZA 1ORQC 3L73H 4WBNA 1N36B 5LP6B 3W7XA 1XMOB 1N8RW 1NR1A 1FXVA 3JSLA 3AG2C 4HZ3A 4ZI7B 2IJHA 4LH6A 1PD3A 3HPLC 3AG1C 1ZTEA 3K03A 1VQ8V 5L3EA 1VQ5V 4JI6O 4JZGA 4TUYA 4ZKIA 2Q4PA 5CBGA 3AG3C 3KCYA 1P7BA 4DV2O 2L35A 4GCZA 5J2TB 4FM2A 4QNHB 1DF4A 2YXLA 2PI5A 1WB7A 4JTDB 5H2FZ 5J2UA 4YHHO 4DR1B 3PJSK 4TOIA 5KA5A 1Q86W 3THOA 2LJ2A 4GX5A 1Y67A 2X0LA 3STZC 4JI5B 5B1BB 1ZL8B 4MW8A 1SS3A 2KG7B 5EZYA 1FXKA 1BT8A 3JD2A 1KD1W 1QBZA 4CH5A 2A7WA 2AHZA 1MG1A 4KL1A 3IC7A 1G6UA 1BZKA 1J95A 4B3SB 4GKJB 3HB3B 3ZEDA 2CGOA 3RW0A 2PTMA 3ZMTA 5JWPA 4WFGA 3LDEA 1BHBA 3JAKA 1K4DC 2UUCO 4RUFA 5IY5B 2A9HA 4OX9B 5DM6V 1XMQB 4O2AB 1DTOA 4FIPC 2DW4A 1RP3B 2YIBD 3SGIA 4BW5A 1QVFU 1SQVH 1OHHG 3CJHA 2UXCO 1K7DA 4OPHA 1AB3A 2A06H 2LW1A 3WG7B 3VOUA 4MT8A 1HR0B 3LDDA 4B7KA 2GTSA 4DV4B 2CK3G 5LGNA 1BQZA 4DV0O 4KHPO 1VEWA 3H1IH 1ROPA 5EBWC 4ZIBA 3H01A 4D6TH 4LFAB 3CCJV 2AW9A 2ZNIA 1KBHA 2H3OA 1S76D 4ABMA 4NXNB 2UUBB 2YS8A 4TWKA 4JYAB 1QLNA 1XHZA 3N2KA 1RM1C 4FMTA 4DW1A 2D2CB 2KQXA 4CC5A 2WLHA 1HNZO 4U3JB 5KMGB 4B08A 3RT3C 1SQFA 4MS2A 4LF7B 2JJ1G 3SPJA 3E35A 4PA9A 5IYZA 4B3RB 5KLVH 4DRXA 4YY3B 3K5OA 5LL6Y 4UCUA 1FXKC 1JVMA 5ITZB 1VF6C 2JGDB 4X64B 4FLUA 3IGAC 1Q43A 1QLEB 3EFFK 4ZBMA 2CTQA 2XTAA 1IDSA 1S5LZ 3W7UA 4WFAV 2OIGA 3SJCC 3LSSA 4IYIA 1QHTA 4DK1A 3P3PA 1AJQA 1K33A 1IZ3A 1YXBA 3SPGA 3CPWU 4O4LB 2EIKC 3G6BA 4UVAA 2E76B 1RPOA 1WNSA 4X89A 1QQCA 1B6QA 2X6AA 1JJOA 2PY5A 3OMAB 5L3GA 3ZRSA 1BS3A 2EBOA 4LWSB 4X1IA 3ZHQA 5LOVA 2QKSA 4UFZA 3BFRA 3K3WA 4I7ZB 2QKCA 4LFCB 4L8JA 4GKJO 4JI0B 3KZIZ 2EJRA 2F93B 1ENVA 4CS4A 3UQ8A 1E1RG 2GSMB 1E79G 4J42A 3T2MA 3FB8C 4J7KA 4DR4O 2V7QG 3QO5A 4DR5B 4H0LB 4JI2O 4QE9A 2LQTA 4FZ0A 3CCRV 1GAXA 4IHJA 4JASA 1CP9A 4GT1A 2W0XA 5LXTA 4AI8A 5LHHA 4B3TB 1M56C 4TV8B 3WU2Z 4JYBA 3MDSA 2Q68A 3D3QA 3MD0A 1Q6IA 5LMNO 1S77D 3BRCA 1H2SB 4X65O 4LFAO 3E8HA 4TV9B 4YJ2B 2ITCC 2RMKB 2LO1A 2EJ7A 4PDRA 3ETDA 3CCMV 3JARB 1VIBA 4NTWA 1T5EA 2KB1A 4A5UB 3LSQA 4OGQB 4P9PA 1UJWB 3AEIA 2UXNA 3ABMC 1YJWV 3HKBA 4J10A 4R7CA 1PP9H 4AQYB 3ZIAG 4YY3O 2DWDC 4AILC 4JAUA 2C2AA 4HYOA 3K9SA 4IL6Z 2YEVA 1Q3EA 1LNQA 5CBFA 2N05A 3B09A 4UCTA 1JQ0A 3X2QC 1TVKB 1Y74B 2HJDA 3OM3B 1FYJA 3JD4A 1IBKO 2BTOA 4QJFB 4GKKB 4XDKA 1PKXA 4Q20A 2ZDIA 5B1AC 1D2DA 3SYCA 3ZRWB 5KHHA 4J80A 3OFNG 2PYJA 4WCEV 2UU9O 1YI2V 2Q7GA 2GBOA 3CEIA 5L3CA 4LFCO 3CRAA 4I55A 2CGNA 1BHAA 3N2GB 2VQFO 4E2LA 1IBMO 1YJ9V 2P67A 3ZHVA 4PELA 2L6LA 2IJKA 2F95B 2JS3A 2O57A 2DJVA 4Q6GA 2ZE8A 2EINC 4JI8O 1QU7A 1KUQA 3K0GA 1VF7A 4CS2A 3FFQA 2UUAO 4QE7A 3LSUA 1SRYA 2WLIB 1KB9F 2CE4A 4O4JB 4DW0A 4X1KB 4K0KO 1SZXA 2EULA 2ZXWB 1VQ7V 2Y69B 4JI7O 3P30A 1AR5A 2RJZA 3CCUV 4H33A 1FPOA 1M5IA 3ZHRA 5H5NA 4YJ3B 1NQTA 2G38A 4JI4B 1HP8A 1OCOB 2BOBC 4X88A 2BSKB 4J41A 4MSWC 3FKSG 1KC8W 1V54B 3EHBB 1SQQH 5B1BC 5GTIZ 4WF9V 2DQ0A 4ZOLB 4LF5O 3CHXA 1F4MA 3CD6V 4LFBO 4NB5A 1F7YA 2RDCA 5JCOA 1Y6XA 3W7WA 4B3MO 1K3EA 5LMUB 4UV8A 2QWQB 3UT5B 4U7NA 2IJJA 4X20B 5E1AC 2NR5A 3E22B 2B1GA 4D7TA 3K5MA 2ETNA 2AGAA 1GN6A 1OV9A 3G67A 1I5YA 4HAMA 3KCXA 3ZX6A 1FS0G 2QM8A 4LF4B 4F4LA 2PUSA 4TQDA 3AG7A 3ZMVA 1AI5A 4JYCA 5CA1A 5IY5C 3ETQA 3RVYA 1R6TA 1ZAUA 3RVZA 1N34O 1FFXB 3UO2A 2Y0PA 3K5LA 2CTPA 1XNQO 1Q5OA 3WG7C 4IGGA 1JOYA 3T1CA 1AR4A 1VARA 3GB7C 3JSNA 2E3CA 5EYPB 1VQ9V 1AJNA 1YVWA 4BIZA 2F1MA 4UCOA 1Q82W 1WPBA 1K4CC 3UKMA 1BSMA 4FM1A 3ZHUA 3F5WC 2WA4A 5EC1C 3RWRD 2QA4V 2XNDG 2X7RB 4DV7O 3OT7A 3SYQA 1NJIW 1H2LA 5EIBD 1E1QG 1H38A 4W4KA 2QTOA 3ICXA 5GTHZ 4PV1B 1NVPB 4H37A 1GTOA 1GRJA 2XAJA 2ZR2A 5JQGA 1WJZA 3JALB 4BR6A 2EX3A 4LH7A 1BL8A 2D3OW 4DR7O 2P4KA 3DTUB 3E8GA 4PI0A 3SJAC 3FYIB 3OE7G 5C8YB 2OCCB 5KX5B 4EB6A 1HNXO 3JARA 1QLEC 1H2MA 2Q0AA 5LA6A 5CN0A 4O4HA 3CE2A 1K5QA 1IBLB 3NR7A 3GWKC 2Q9LA 5IJ0A 2E5LB 3PN1A 3FB7C 3AK2A 1AI4A 5B1OA 5DEDA 3T1HO 3CC4V 1XL6A 4PA7A 2EIMB 3K9AA 4DV5O 1AP6A 2CUGA 3AK1A 3H9VA 1FJGO 3NXSA 1J5EB 2WLKA 2WWWA 2HFEC 3QNEA 1XILA 1M1KW 3BCCH 2HLDG 3Q4HA 1CXZB 4I0XB 2IU0A 2EIJB 1FD9A 3DC5A 1H8HG 4O4IB 4J9YB 5CA0B 2RNBA 2X6CA 4DV1B 3JASB 3K58A 3I55V 2GHYA 3ZRWA 2K9PA 2QJ1A 1WP8A 2UXBO 3K79A 1N33O 5EBLC 1H2NA 2QTSA 2ZCEA 3CCEV 3AG4C 4NXMB 2JEXA 1H8EG 3CSXA 4J7ZA 1MZEA 3QTCA 4FLXA 5EBMC 3UM7A 3CC7V 1EZJA 1YSCA 4DV6B 2FMLA 2LGQA 2ZD9A 3T4ZA 3SR2C 1BGYH 2V4DA 1L8DA 3FB5C 4NTXA 5FL7G 1P4RA 2DMXA 3CMAV 1GN3A 1DGSA 3H1HH 2XASA 4E4EA 4R8CA 1IVSA 2HEPA 4DK0A 2OCHA 2BTQB 1VF6A 1QVGU 4MVRA 1M93A 1IURA 1G4YB 2Q7EA 3ZRXA 1MSWD 1SQXH 2HHHO 4FLTA 1M4UA 3OTOB 2LFRA 4I9QA 3CYOA 4UVBA 1I94O 5KHIA 2EILC 5B66Z 1S0VA 1K34A 1QNMA 3E83A 2YDEA 2Q67A 3P3NA 3ZRVA 1OCRC 1TUBA 1LUVA 4GUNA 1DK1A 3LUTB 3ASNB 5IWAO 1XNRB 2DYRB 1JR9A 4ZHQB 2N04A 4G27B 2CH7B 4YIOA 4HNAB 4QPKA 2GUZA 1Q90D 4ZOLA 4LF8B 1IX9A 1NVPD 1OCCB 3KG2A 3BY6A 5L3BA 1P7GA 5EIBC 2AXTZ 3DXRA 2B5UA 5BZBA 1HW7A 4X62B 4X66B 3ABUA 3FAVB 1V9PA 5J9PC 1EN5A 3SPCA 1I0HA 1COWG 3E2EA 4GYCB 3BA8A 1U96A 5FNVB 3G4SV 1N36O 1XMOO 1R3IC 3VQXA 4F6RB 1DF5A 4WFFA 4X9QA 4FLVA 5B3SB 5BR8B 4KP4A 3RYFA 2VWJA 2A79B 1UPGA 2WLLB 3STLC 1LR1A 2P4VA 4RUEA 1Z5WA 1M9NA 3A0RA 4PDMA 1EZVH 3ZN1A 1R3KC 2BCCH 3QG5A 1QR8A 3WFVA 3A0HZ 1SA0B 1GMGA 3T1YB 4DR1O 1BQ0A 2ZXWC 2Y69C 2PZSA 4GX0A 1FXHA 1GM8A 1ZLZA 1GN2A 4JI5O 4MVQA 4BIOA 4DXWA 3WB0A 2YIDA 1PNKA 4FM0A 3QF7A 2YIBA 4JYYA 3M8AA 1OCOC 2ZE5A 2Y48A 1JFFB 2M6YA 2Q73A 3F7YC 2QE7G 4JTAB 2ZIOA 1RSOB 1Q7YW 1V54C 4I4TA 5BY1A 1W0JG 5IJ9A 4B3SO 3JAWA 2QSAA 2F66C 3ABKC 1KU9A 5C93A 1YIJV 2QGNA 4LNUB 4FFBB 4DUYB 5CB4A 4UB6Z 3ZS8C 2UXDB 3OUSA 4OX9O 1XMQO 1XQ8A 1WA8A 1I7FA 5BXZA 2Q7HA 2ZT9B 5JH7B 3RYIB 1Y76A 2ZKOA 3HKDA 1YEWA 1WB8A 3J80N 3WB2A 1HR0O 5BMVB 1VQNV 1Z2GA 2HVJC 1YJNV 4I50A 4FPPA 4DV4O 1JPXA 3HKCB 3SDLA 4OPAA 3RFRA 3AG1B 3BABA 4CS3A 4I0XA 2VS0A 1GO3F 4TQFA 2OWOA 3O65A 1MA1A 3A2FA 4NXNO 1WLEA 2UUBO 3OGCC 5E79Z 4JYAO 4FFKA 1ZWIC 5LP6A 4R50A 5LYJB 1VQKV 4ZI7A 4UXNA 4FLYA 3ABTA 3JATB 2VQEB 4PA6A 2ZIMA 1OJHA 1TA8A 5GONB 3ZCCA 4LF7O 3O9OA 1S3JA 1ZUQA 4X1YB 4GZRB 2P7TC 1GH6A 4B3RO 5IYCO 4O2BB 5J2TA 1N0NA 3OW2U 3JYCA 5JVDB 4X64O 1PL4A 1R6KA 3ZMUA 2AZ2A 1NU1H 3IAYA 1XL4A 3IC9A 4CC6A 5L3FA 3F7VC 4JTCB 5B5EZ 3RYCB 4JV5B 5LGUA 5EK0A 1US6A 1Z5VA 2QKAA 2ZR3A 5KHKA 2OCCC 1ZL8A 3SJQC 3RYHB 2KG7A 2DYSB 4PDLA 3W7SA 4DV3B 2P06A 4UV9A 4BIUA 4JI3B 3ASOB 5B1NA 2BE3A 2ODMA 3D36A 3T4DA 4P30A 4WBNB 1P84F 4JI0O 4AHCA 4MVMA 2ILMA 2UXXA 1KP2A 1N4CA 2CDYA 1CEZA 1AI6A 3JCUZ 3L70H 1VQMV 1YTFB 4IYHA 1W59A 1M57B 4LF9B 2ARHA 4TUYB 1B06A 2EIJC 4DR5O 1V55C 2XAGA 4O2AA 3A0BZ 3CP1A 5CBHA 2CH7A 4B3TO 2Q8VA 4RO2A 5J2UB 5LP6C 1XEQA 3ZBHA 3JD1A 2FYUH 3L72H 3BPZA 4CBCA 3M99B 1K73W 1HNWB 4B7EA 1GKFA 3B40A 4KXRA 1R3JC 1N32B 2F23A 3CC2V 5EZYB 1SKVA 1FXKB 1XOUA 3OUFA 1AJPA 4UB8Z 4PHZA 1KECA 3VBBA 3IFXA 4U3JA 2LP7A 5KMGA 4LF6B 1AP5A 3CRRA 4JPRA 2PI4A 3OEEG 4AQYO
chains in the Genus database with same CATH topology
3P32A 2WLKA 1ROPA 2WWWA 2HFEC 5EBWC 3QNEA 3H01A 3LNMB 1M1KW 3RBZA 2JEUA 2XAHA 3CCJV 2F43G 4MVSA 2HLDG 1S76D 2IU0A 2R9RB 2EIJB 1K8AW 2M7WA 4TWKA 1H8HG 1QLNA 1RM1C 2A0LA 4J9YB 1S72V 4FMTA 2X6CA 1CPYA 3E86A 2P6JA 2JIZG 1OCZC 2WLHA 2DWEC 3I55V 4XDJA 3B77A 2GHYA 3ZRWA 5IDJA 1NBMG 4MS2A 1QCEA 2JJ1G 3K79A 3SPJA 4JGSA 2IJIA 3E35A 4PA9A 5EBLC 2EILB 5CMUA 3CCEV 5LBQA 5KA6A 3AG4C 1FXKC 4GX2A 1M90W 1JVMA 4MVOA 4MVZA 2JEXA 1H8EG 3ASNC 3K06A 1RPRA 3IGAC 4KUMA 2DYRC 3SYOA 1NH2D 1QLEB 3EFFK 1OCRB 4ZBMA 3GWOA 5EBMC 3UM7A 4OXSA 3CC7V 1EZJA 1YSCA 4L87A 3W7UA 2ZD9A 3B8NA 3T4ZA 4WFAV 3LSSA 3SPIA 2EIMC 3FB5C 2HVKC 5KUMA 1AJQA 5FL7G 1P4RA 1K33A 3CMAV 2BOCC 4YXWG 1KKDA 3SPGA 3CPWU 2W6JG 2EIKC 4UVAA 1S5HC 1RPOA 2H8PC 2XASA 3JCZA 4X89A 1R6NA 1B6QA 2X6AA 4R8CA 3OMIB 3OMAB 5KUKA 5L3GA 3ZRSA 5LHIA 2EBOA 1QVGU 4MVRA 2XAQA 3K0DA 4FK5C 1G4YB 2K1EA 2QKSA 1I5XA 3K3WA 4TT3G 5H9CA 3SPHA 3ZRXA 1MSWD 2ATKC 1G8MA 3BEHA 2EJRA 5B3SC 1RM1B 1TUEB 2LFRA 1JCHA 1ENVA 2OTJV 3CYOA 4UVBA 1E1RG 2GSMB 3CCLV 1E79G 3T2MA 1GK9A 3FB8C 1OCZB 2EILC 4PA3A 1S0VA 4LCUC 1K34A 1SESA 2V7QG 3QO5A 4JAVA 1W0KG 1Q81W 1YTFD 3E83A 1QQHA 4P2ZA 2Q67A 4QE9A 1W2BU 3CCRV 1VQOV 3ZRVA 1L1FA 1OCRC 1CP9A 4GT1A 4JASA 1WPXA 2X6BA 3ZMZA 5LHHA 3LUTB 1M56C 3ASNB 3SYAA 2DYRB 1SETA 4JYBA 5HFMA 4G27B 2Q68A 3SYPA 4QPKA 2EZPA 4R6ZA 4BAYA 2JJ2G 3MD0A 4I5SA 3TETA 1NKDA 1NVPD 1K5SA 1OCCB 2P90A 3W7TA 1YITV 1JJ2U 4TSFG 5EC2C 1S77D 2Z3YA 4WFEA 2MK3A 3KG2A 3BY6A 5L3BA 2IW5A 4GX1A 5B1AB 2WLLA 3CXCU 3E8HA 4P9OA 1Y4MA 2EIKB 2ITCC 5HFLA 2B5UA 4PDRA 5H6QA 3ETDA 5BZBA 3CCMV 1NR7A 3ABUA 4RQFA 5J9PC 2B1IA 2KB1A 4RAIA 3LSQA 5GW7A 3D3IA 2Z5UA 3SPCA 4P9PA 1COWG 3E2EA 1Y66A 1UJWB 3AEIA 2UXNA 3ABMC 3G4SV 3CMEV 1YJWV 1R3IC 1K9MW 1F51A 4N21A 1VQ4V 2ZDIC 3ABKB 1DF5A 4WFFA 5B3SB 4R7CA 3OAAG 4KP4A 4Z1MG 1JX9A 3QO8A 2A79B 3I56V 4KFMA 3ZIAG 2DWDC 4QPJA 2WLLB 3STLC 4JAUA 2C2AA 2DQ3A 3ZMSA 4WFHA 1MOFA 4HYOA 4LBEC 1M9NA 4RUEA 4U7OA 2YEVA 3A0RA 4PDMA 1LNQA 4DO2A 5CBFA 1PL0A 3ZN1A 2NLJC 2NNUA 1R3KC 1VQLV 1QR8A 3WFVA 4EKWA 4MTOA 1JQ0A 3X2QC 2WLMA 3ETEA 2WLNA 3B8MA 1GMGA 3OM3B 3JD4A 2EZOA 1M56B 2ZXWC 1K92A 1OCCC 2Y69C 4QJFB 1F4NA 2HR3A 3LDCA 1BMFG 3OMNB 1PKXA 1FXHA 3ABLC 4GX0A 4Q20A 1H2GA 4XDKA 5LHGA 1GM8A 2ZQMA 2ZDIA 4N23A 5B1AC 4MVQA 1SZTA 3SYCA 4DXWA 1K97A 2JK5C 3ML0A 3ZRWB 1PNKA 1DLBA 2FTKA 3JD3A 4LC1A 3OFNG 3OR7C 4WCEV 3OR6C 1OCOC 2YEVB 3OEHG 1YI2V 2Y48A 1HWYA 2V1DA 3F7YC 2QE7G 5L3CA 4JTAB 1Q7YW 1V54C 2WLIA 1W0JG 4WFBV 1BHAA 2XOKG 4E2LA 1YJ9V 2P67A 3ABKC 1VQ6V 3G71V 4G2KA 4ASUG 3ABMB 4XBFA 4PELA 3ZJZA 5C93A 3CCSV 1YIJV 2QEXV 2IJKA 1R73A 2WSSG 2EINC 2JDIG 4X8AA 3K0GA 2QM7A 3OUSA 1EFRG 2IH3C 3CCVV 2Q69A 5LGTA 5CA3A 2W6IG 4QE7A 3CCQV 1GM7A 4PA4A 1SRYA 2WLIB 4I9WA 4MTFA 1KQSU 3X2QB 5DN6G 1THZA 1VQNV 2HVJC 1YJNV 4PDVA 1VQPV 3JD0A 4FPPA 1AROP 1JPXA 2ZXWB 1VQ7V 2Y69B 3K04A 2DYSC 2WPDG 1IXMA 2HG5C 3AG1B 3P30A 3ETGA 1QR9A 3CCUV 3ABLB 4H33A 1SERA 5IYDO 1GO3F 3MHHC 3G6EV 4JF3A 1AI7A 4QIWF 1WLEA 1NQTA 3ASOC 4UUJC 3OGCC 1GM9A 2LFSA 1OCOB 2BOBC 4X88A 2IH1C 1R3LC 1ZWIC 4MSWC 3FKSG 3QO7A 1KC8W 2HKOA 4R50A 1VQKV 1V54B 3EHBB 4UXNA 3ABTA 5B1BC 4PA6A 4WF9V 2OT5A 4MVUA 2DQ0A 1M57C 2W0FC 1MABG 4MTGA 1F4MA 3CD6V 3ZCCA 5IYBO 1S3JA 2AHYA 3E8FA 2P7TC 4MTXA 5L3DA 5IYCO 1NH2B 3W7WA 1K3EA 4UV8A 1V55B 2HJFC 5H6RA 2EINB 3JYCA 3E89A 3OW2U 1R6KA 4CZZA 1ORQC 4U7NA 2IJJA 5E1AC 3ZMUA 2B1GA 3ZN0A 1XL4A 5L3FA 3F7VC 4JTCB 3W7XA 1N8RW 1NR1A 1FXVA 1I5YA 4HAMA 4RQEA 3AG2C 1FS0G 4HZ3A 2IJHA 2QM8A 5LGUA 5EK0A 1PD3A 2ZR3A 3HPLC 3AG1C 4FJCC 3K03A 2OCCC 4F4LA 1YHQV 1VQ8V 3TCUA 3SJQC 3ZMVA 5L3EA 1AI5A 1VQ5V 2ITDC 4JYCA 4MW3A 5IY5C 2Q6AA 4ZKIA 2DYSB 5CBGA 3RVYA 3AG3C 4PDLA 1P7BA 4GCZA 3W7SA 3RVZA 2R9IA 4QNHB 1DF4A 4UV9A 4BIUA 2PI5A 4JTDB 2XAFA 3WG7C 1JOYA 3T1CA 3ASOB 5B1NA 3D36A 3PJSK 3GB7C 4P30A 3T4DA 1VQ9V 5KA5A 1Q86W 1AJNA 2H94A 4MVMA 4BIZA 2UXXA 1KP2A 1CEZA 1AI6A 1Q82W 4GX5A 1VQMV 2X0LA 3STZC 5B1BB 1K4CC 1PNMA 3UKMA 1YTFB 3F5WC 1M57B 3FYEB 4MW8A 5EC1C 3TK1A 2EIJC 1V55C 2QA4V 2XNDG 2XAGA 3OEEG 1FXKA 2X7RB 3JD2A 4J9ZB 1KD1W 1QBZA 2YSUB 3CP1A 3SYQA 1NJIW 5CBHA 1E1QG 2WLJA 1H38A 2AHZA 2QTOA 4RO2A 1MG1A 3IC7A 1EBOA 1NVPB 4H37A 1AR1B 1GTOA 3JD1A 1J95A 3DGEA 4CBCA 3M99B 3FB6C 2ZR2A 1KP3A 2XAJA 3HB3B 1OZ0A 1K73W 3RW0A 1BL8A 3AG2B 1GKFA 3ZMTA 2D3OW 4WFGA 1FFTB 3LDEA 1BHBA 3DTUB 3E8GA 3FYIB 3OE7G 4G28B 2OCCB 1R3JC 1K4DC 3E8BA 2WAMA 2OTLV 1QLEC 3CC2V 4RUFA 5IY5B 2A9HA 5DM6V 3AG4B 1FXKB 2IU3A 5CN0A 1DTOA 3K08A 4FIPC 2DW4A 3AG3B 3OUFA 1AJPA 1K5QA 3R65A 1PNLA 4XDLA 4LP8A 4BW5A 1QVFU 1OHHG 1KECA 1K7DA 3FB7C 1AI4A 5B1OA 3VBBA 3WG7B 3VOUA 4MT8A 3LDDA 3IFXA 1XL6A 3CC4V 4PA7A 2LP7A 2EIMB 3K9AA 2CK3G 3MHSC 5LGNA 4JPRA 2PI4A 4UVCA 1F23A 3NXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6N A;  1QQH A;  2JEX A;  2JEU A;  1TUE B;  1DTO A;  2NNU A;  1R6K A; 
#chains in the Genus database with same CATH topology
 4DUZ B;  4DR3 B;  3LNN A;  3JAK B;  4NVP A;  3RBZ A;  2XAH A;  5ITZ A;  2JGD A;  3CRM A;  2R9R B;  4DR6 B;  3VQV A;  4IIJ B;  2QWP B;  3CJH B;  2A0L A;  3D36 C;  4K8X A;  4DR2 B;  1P49 A;  1NS1 A;  2P6J A;  2JIZ G;  2DWE C;  4BWA A;  4GKK O;  2YI8 A;  1GN4 A;  4Z1V A;  4O4L A;  1I08 A;  1QCE A;  3APQ A;  4JGS A;  2IJI A;  5CMU A;  5KA6 A;  4GX2 A;  1M90 W;  4EEQ A;  4MVO A;  4MVZ A;  2F4V B;  3ASN C;  3K06 A;  1RPR A;  2A3Q A;  2DYR C;  5FPO A;  4LWS A;  4JI3 O;  4OXS A;  5FPR A;  4L87 A;  3VQW A;  2PF4 E;  5KUM A;  4FFB A;  2BOC C;  4YXW G;  3HKE B;  4C7U A;  2W6J G;  3R66 A;  4JI6 B;  1EM1 A;  2IBZ H;  1S5H C;  3JCZ A;  1R6N A;  4BW9 A;  2E74 B;  3FD9 A;  5IYZ B;  4DV2 B;  1D5A A;  3OMI B;  4DRX B;  1MZF A;  3J81 N;  1RFY A;  2XAQ A;  4TV8 A;  3K0D A;  1HDJ A;  4UCV A;  3TGU H;  4YHH B;  1I5X A;  4HBN A;  5H9C A;  3SPH A;  3ZHS A;  4F6E A;  5B3S C;  1TUE B;  1XHX A;  3ZHT A;  2OTJ V;  2DE0 X;  1GK9 A;  1OCZ B;  4PA3 A;  4TV9 A;  4LCU C;  4YJ2 A;  1SES A;  4JAV A;  1YTF D;  1QQH A;  4P2Z A;  1YZB A;  2ZE6 A;  1W2B U;  1VQO V;  4JAA A;  4FLW A;  1WPX A;  2X6B A;  4JI4 O;  2ZE7 A;  3SYA A;  1B04 A;  4X1I B;  1SET A;  5LOV B;  4K8Z A;  5HFM A;  5TIS Z;  2JJ2 G;  1NKD A;  5JJN B;  1K5S A;  2P90 A;  3W7T A;  1YIT V;  4Z2W A;  4WFE A;  4DUZ O;  4GX1 A;  5B1A B;  3CXC U;  1XDC A;  2UUC B;  5JVD A;  2JRI A;  5HFL A;  5H6Q A;  5LMU O;  4DR6 O;  2PGG A;  4IHJ B;  4NR1 A;  5LXT B;  3RGB A;  3U0Z A;  4RAI A;  1TVK A;  2UXC B;  1Y74 A;  1Y66 A;  1NTK H;  3SJB C;  4LF4 O;  4DV0 B;  3OAA G;  4KHP B;  1VMG A;  3U10 A;  4Z1M G;  3M7M X;  4KFM A;  3ZMS A;  1MOF A;  4LBE C;  4U7O A;  3VQY A;  1WP7 A;  1PL0 A;  2NNU A;  4IT5 A;  1SF9 A;  4EKW A;  2WLM A;  2VWK A;  2WLN A;  3N2G A;  1KMI Z;  2EZO A;  1Q6H A;  3S3W A;  1F4N A;  1HNZ B;  3OMN B;  2JS5 A;  5LHG A;  3HKB B;  1H2G A;  4N23 A;  5KAI Z;  1S5J A;  2YI9 A;  1SZT A;  1K97 A;  3UCS C;  1DLB A;  2FTK A;  3JD3 A;  1JMK C;  3L74 H;  1IXB A;  3APO A;  4LR3 A;  1A32 A;  2YEV B;  5JJJ B;  1HWY A;  2R9A A;  2V1D A;  3L71 H;  2WLI A;  5DEC A;  2QWO B;  4WFB V;  4O4J A;  2XOK G;  4D7S A;  4X1K A;  1H2K A;  2ZM6 B;  3FX7 A;  5K1P A;  3G71 V;  2PYL A;  2YIA A;  3ZJZ A;  3CCS V;  3IJ4 A;  2WSS G;  4H13 B;  2JDI G;  4X8A A;  4UCS A;  4YJ3 A;  2IH3 C;  3CCV V;  1XRE A;  2Q69 A;  5LGT A;  3N27 A;  1IBL O;  2BSK A;  3CCQ V;  4JZ2 A;  2E5L O;  4I9W A;  4MTF A;  4NKG B;  4I55 B;  1KQS U;  5DN6 G;  1THZ A;  3JD0 A;  1JA8 A;  3CWB H;  3K04 A;  1ZSP A;  2DYS C;  1AVM A;  2HG5 C;  3ETG A;  3ABL B;  4DR4 B;  1J5E O;  1ZX3 A;  2QWN B;  5IYD O;  4JI2 B;  1NI8 A;  4JF3 A;  3UT5 A;  4X20 A;  4IIJ A;  3ASO C;  3E22 A;  1NTM H;  4QGP A;  1R3L C;  3A8T A;  3QO7 A;  5K1X A;  4DV1 O;  5LMN B;  5A2Q N;  1SQG A;  1M57 C;  2W0F C;  2JGU A;  4X65 B;  4MTG A;  5IYB O;  1G1X B;  2AHY A;  1NZ6 A;  1NH2 B;  2P5O A;  1FFX A;  5H6R A;  4NXM O;  1XI1 A;  3ZN0 A;  4J11 A;  2IM9 A;  4DV6 O;  5EYP A;  3K5N A;  2YUA A;  1PM9 A;  3HKE A;  4RQE A;  5JJE B;  4RWU A;  2GDS A;  4FJC C;  1YHQ V;  3TCU A;  2ITD C;  4MW3 A;  4PI2 A;  2Q6A A;  2XUM A;  4GLX A;  2R9I A;  2JVD A;  2KSD A;  2FB5 A;  3EXA A;  2XAF A;  1MNG A;  5KAF Z;  2ZM6 O;  1IBK B;  2H94 A;  3JAL A;  3OTO O;  3OD4 A;  1B3Q A;  2YXH A;  1PNM A;  5KX5 A;  5C8Y A;  5KHG A;  3FYE B;  2N74 A;  5CA1 B;  3K57 A;  3TK1 A;  2UU9 B;  4J9Z B;  3U11 A;  2CTR A;  2YSU B;  3C90 A;  2WLJ A;  4CH3 A;  3AK3 A;  4NYK A;  1XNR O;  2YXY A;  1EBO A;  1AR1 B;  2VQF B;  3DGE A;  2LW7 A;  1IBM B;  3B4S A;  2RCV A;  3CXH F;  3FB6 C;  1KP3 A;  4LF8 O;  4FZ1 A;  1OZ0 A;  3CRQ A;  1TGO A;  3AG2 B;  3MAQ A;  1FFT B;  4JI8 B;  4JI1 B;  4G28 B;  3E8B A;  4FLZ A;  2WAM A;  2OTL V;  2B9Z A;  3AG4 B;  2IU3 A;  3CB2 A;  3GVM A;  3K08 A;  4X62 O;  4X66 O;  3AG3 B;  2UUA B;  4O4I A;  3R65 A;  1PNL A;  4XDL A;  4LP8 A;  5CA0 A;  1X59 A;  3JAS A;  3KKY A;  4K0K B;  4K35 A;  5JQG B;  1L0N H;  3MHS C;  4UVC A;  1F23 A;  1MMM A;  5AG2 A;  4JI7 B;  5BR8 O;  2CTW A;  3P32 A;  3LNM B;  4EB6 B;  2JEU A;  2F43 G;  4MVS A;  1XUQ A;  5LA6 B;  4O4H B;  2MW2 B;  1K8A W;  3F5T A;  2M7W A;  3EVK A;  1R1B A;  2GV9 A;  1S72 V;  2E75 B;  5IJ0 B;  3T1Y O;  2RN9 A;  3RN4 A;  1CPY A;  2QWR B;  3E86 A;  1OCZ C;  4XDJ A;  4PJ0 Z;  3B77 A;  2XT9 A;  3TXS A;  1FKA O;  4LF5 B;  4LFB B;  5IDJ A;  1NBM G;  3I5D A;  1YCI A;  2EIL B;  5LBQ A;  4B3M B;  3BA9 A;  2GTA A;  1SQP H;  2BTQ A;  3SYO A;  1NH2 D;  4KUM A;  3L75 H;  3J7A U;  3BAA A;  3Q4H B;  1OCR B;  3BHP A;  3GWO A;  3B8N A;  3SPI A;  2EIM C;  2HVK C;  1U97 A;  3B2E E;  1YF2 A;  3JAM N;  1KKD A;  1PPJ H;  1KKC A;  4DUY O;  2H8P C;  2QR4 A;  2UXD O;  5KUK A;  1D5N A;  1VP7 A;  1N34 B;  3H1L H;  5LHI A;  1XNQ B;  1N0J A;  4FK5 C;  2AZ0 A;  2K1E A;  4ZHQ A;  1AIL A;  4TT3 G;  2ATK C;  1G8M A;  3BEH A;  4HNA A;  4CH4 A;  2DN9 A;  1RM1 B;  1VF5 B;  1JCH A;  1Q6U A;  2LGW A;  1Q8I A;  3CCL V;  1X4T A;  4ICG A;  4JI1 O;  2HP8 A;  1O9G A;  1Q81 W;  1UFI A;  1W0K G;  1WN7 A;  4DV7 B;  4J7J A;  3FAV A;  3UO3 A;  1NT2 B;  3QVN A;  1L1F A;  3ZMZ A;  5FNV A;  3SYP A;  3S3X A;  4R6Z A;  1NTZ H;  2EZP A;  4BAY A;  3TET A;  4I5S A;  4F6R A;  2VQE O;  2FKX A;  2Q0O C;  1JJ2 U;  4TSF G;  5EC2 C;  2Z3Y A;  2MK3 A;  4DR7 B;  2IW5 A;  5D5P A;  2WLL A;  1HNX B;  4DYL A;  4P9O A;  1Y4M A;  2OYQ A;  2EIK B;  1FAF A;  5IE9 A;  1NR7 A;  3H1K H;  4RQF A;  2XHB A;  1TUB B;  2R70 A;  2B1I A;  3DSQ A;  5GW7 A;  1SA0 A;  2Z5U A;  3D3I A;  4W4L A;  3DC6 A;  3CME V;  2NN4 A;  3T1H B;  2GUZ B;  1F51 A;  1K9M W;  4N21 A;  2ZNJ A;  4YIP A;  1VQ4 V;  3TJT A;  2ZDI C;  4DV5 B;  3ABK B;  4JV5 O;  1FJG B;  4PD4 F;  5KHJ A;  1JX9 A;  2YIC A;  3QO8 A;  3I56 V;  4CH6 A;  2KKW A;  4QPJ A;  2DQ3 A;  4WFH A;  3BVO A;  3DXR B;  4DV3 O;  2QDO A;  4DO2 A;  1EN6 A;  1JFF A;  2NLJ C;  2YC0 A;  1EN4 A;  1VQL V;  1RSO A;  4NTY A;  4EFB A;  4MTO A;  3ETE A;  1BCC H;  3B8M A;  1YDX A;  1M56 B;  1O9H A;  3H1J H;  3N2K B;  1K92 A;  1OCC C;  4EFE A;  4FVM A;  2HR3 A;  2ZIN A;  3LDC A;  1BMF G;  3ABL C;  3OTF A;  3CRC A;  1BE3 H;  2VRZ A;  2ZQM A;  4LNU A;  1URF A;  2UXB B;  1N33 B;  3RYF B;  2JK5 C;  2WA3 A;  2Y4T A;  3ML0 A;  4LF9 O;  5F2V O;  2FL4 A;  4LC1 A;  5IT9 N;  3OR7 C;  3OR6 C;  1PV0 A;  1TAE A;  3OEH G;  2ADQ B;  5A9G A;  5JH7 A;  3RYI A;  5BMV A;  3CS5 A;  2QM4 A;  1MSD A;  1XBL A;  1VQ6 V;  4G2K A;  4ASU G;  3ABM B;  1KYO F;  3HKC A;  3CX5 F;  4XBF A;  1HNW O;  2Y4U A;  1SC5 B;  2QEX V;  1R73 A;  1N32 O;  5FLX N;  2QM7 A;  5D5Q A;  1EFR G;  3K59 A;  5CA3 A;  2W6I G;  1GM7 A;  4PA4 A;  3HR0 A;  4I4T B;  5LYJ A;  2OIE A;  1SQB H;  2HHH B;  3X2Q B;  3JAT A;  2ADP A;  5IJ9 B;  3D8C A;  3JAW B;  4H44 B;  4PDV A;  2DOS A;  2P22 C;  4U3F H;  1VQP V;  1I94 B;  1ARO P;  4LF6 O;  5GON A;  2WPD G;  1IXM A;  5JCO C;  1QR9 A;  4X1Y A;  4DR3 O;  5CB4 B;  1SER A;  4O2B A;  1WAZ A;  3MHH C;  3G6E V;  1AI7 A;  3G80 A;  2RQ6 A;  3C3S A;  3C3T A;  4QIW F;  3WB1 A;  2Y0I A;  4UUJ C;  1GM9 A;  2Q5Z A;  2LFS A;  5IWA B;  1WA8 B;  2R72 A;  2IH1 C;  1LUW A;  2CAZ C;  3OGI B;  2HKO A;  1Y76 B;  4DR2 O;  3RYC A;  3HKD B;  3L9D A;  2OT5 A;  2Z0A A;  4MVU A;  1L0L H;  1MAB G;  4I50 B;  3RYH A;  3TXQ A;  3E8F A;  4MTX A;  5L3D A;  1V55 B;  2HJF C;  2EIN B;  3E89 A;  2F4V O;  4K3A A;  4UCR A;  4CZZ A;  1ORQ C;  3L73 H;  4WBN A;  1N36 B;  5LP6 B;  3W7X A;  1XMO B;  1N8R W;  1NR1 A;  1FXV A;  3JSL A;  3AG2 C;  4HZ3 A;  4ZI7 B;  2IJH A;  4LH6 A;  1PD3 A;  3HPL C;  3AG1 C;  1ZTE A;  3K03 A;  1VQ8 V;  5L3E A;  1VQ5 V;  4JI6 O;  4JZG A;  4TUY A;  4ZKI A;  2Q4P A;  5CBG A;  3AG3 C;  3KCY A;  1P7B A;  4DV2 O;  2L35 A;  4GCZ A;  5J2T B;  4FM2 A;  4QNH B;  1DF4 A;  2YXL A;  2PI5 A;  1WB7 A;  4JTD B;  5H2F Z;  5J2U A;  4YHH O;  4DR1 B;  3PJS K;  4TOI A;  5KA5 A;  1Q86 W;  3THO A;  2LJ2 A;  4GX5 A;  1Y67 A;  2X0L A;  3STZ C;  4JI5 B;  5B1B B;  1ZL8 B;  4MW8 A;  1SS3 A;  2KG7 B;  5EZY A;  1FXK A;  1BT8 A;  3JD2 A;  1KD1 W;  1QBZ A;  4CH5 A;  2A7W A;  2AHZ A;  1MG1 A;  4KL1 A;  3IC7 A;  1G6U A;  1BZK A;  1J95 A;  4B3S B;  4GKJ B;  3HB3 B;  3ZED A;  2CGO A;  3RW0 A;  2PTM A;  3ZMT A;  5JWP A;  4WFG A;  3LDE A;  1BHB A;  3JAK A;  1K4D C;  2UUC O;  4RUF A;  5IY5 B;  2A9H A;  4OX9 B;  5DM6 V;  1XMQ B;  4O2A B;  1DTO A;  4FIP C;  2DW4 A;  1RP3 B;  2YIB D;  3SGI A;  4BW5 A;  1QVF U;  1SQV H;  1OHH G;  3CJH A;  2UXC O;  1K7D A;  4OPH A;  1AB3 A;  2A06 H;  2LW1 A;  3WG7 B;  3VOU A;  4MT8 A;  1HR0 B;  3LDD A;  4B7K A;  2GTS A;  4DV4 B;  2CK3 G;  5LGN A;  1BQZ A;  4DV0 O;  4KHP O;  1VEW A;  3H1I H;  1ROP A;  5EBW C;  4ZIB A;  3H01 A;  4D6T H;  4LFA B;  3CCJ V;  2AW9 A;  2ZNI A;  1KBH A;  2H3O A;  1S76 D;  4ABM A;  4NXN B;  2UUB B;  2YS8 A;  4TWK A;  4JYA B;  1QLN A;  1XHZ A;  3N2K A;  1RM1 C;  4FMT A;  4DW1 A;  2D2C B;  2KQX A;  4CC5 A;  2WLH A;  1HNZ O;  4U3J B;  5KMG B;  4B08 A;  3RT3 C;  1SQF A;  4MS2 A;  4LF7 B;  2JJ1 G;  3SPJ A;  3E35 A;  4PA9 A;  5IYZ A;  4B3R B;  5KLV H;  4DRX A;  4YY3 B;  3K5O A;  5LL6 Y;  4UCU A;  1FXK C;  1JVM A;  5ITZ B;  1VF6 C;  2JGD B;  4X64 B;  4FLU A;  3IGA C;  1Q43 A;  1QLE B;  3EFF K;  4ZBM A;  2CTQ A;  2XTA A;  1IDS A;  1S5L Z;  3W7U A;  4WFA V;  2OIG A;  3SJC C;  3LSS A;  4IYI A;  1QHT A;  4DK1 A;  3P3P A;  1AJQ A;  1K33 A;  1IZ3 A;  1YXB A;  3SPG A;  3CPW U;  4O4L B;  2EIK C;  3G6B A;  4UVA A;  2E76 B;  1RPO A;  1WNS A;  4X89 A;  1QQC A;  1B6Q A;  2X6A A;  1JJO A;  2PY5 A;  3OMA B;  5L3G A;  3ZRS A;  1BS3 A;  2EBO A;  4LWS B;  4X1I A;  3ZHQ A;  5LOV A;  2QKS A;  4UFZ A;  3BFR A;  3K3W A;  4I7Z B;  2QKC A;  4LFC B;  4L8J A;  4GKJ O;  4JI0 B;  3KZI Z;  2EJR A;  2F93 B;  1ENV A;  4CS4 A;  3UQ8 A;  1E1R G;  2GSM B;  1E79 G;  4J42 A;  3T2M A;  3FB8 C;  4J7K A;  4DR4 O;  2V7Q G;  3QO5 A;  4DR5 B;  4H0L B;  4JI2 O;  4QE9 A;  2LQT A;  4FZ0 A;  3CCR V;  1GAX A;  4IHJ A;  4JAS A;  1CP9 A;  4GT1 A;  2W0X A;  5LXT A;  4AI8 A;  5LHH A;  4B3T B;  1M56 C;  4TV8 B;  3WU2 Z;  4JYB A;  3MDS A;  2Q68 A;  3D3Q A;  3MD0 A;  1Q6I A;  5LMN O;  1S77 D;  3BRC A;  1H2S B;  4X65 O;  4LFA O;  3E8H A;  4TV9 B;  4YJ2 B;  2ITC C;  2RMK B;  2LO1 A;  2EJ7 A;  4PDR A;  3ETD A;  3CCM V;  3JAR B;  1VIB A;  4NTW A;  1T5E A;  2KB1 A;  4A5U B;  3LSQ A;  4OGQ B;  4P9P A;  1UJW B;  3AEI A;  2UXN A;  3ABM C;  1YJW V;  3HKB A;  4J10 A;  4R7C A;  1PP9 H;  4AQY B;  3ZIA G;  4YY3 O;  2DWD C;  4AIL C;  4JAU A;  2C2A A;  4HYO A;  3K9S A;  4IL6 Z;  2YEV A;  1Q3E A;  1LNQ A;  5CBF A;  2N05 A;  3B09 A;  4UCT A;  1JQ0 A;  3X2Q C;  1TVK B;  1Y74 B;  2HJD A;  3OM3 B;  1FYJ A;  3JD4 A;  1IBK O;  2BTO A;  4QJF B;  4GKK B;  4XDK A;  1PKX A;  4Q20 A;  2ZDI A;  5B1A C;  1D2D A;  3SYC A;  3ZRW B;  5KHH A;  4J80 A;  3OFN G;  2PYJ A;  4WCE V;  2UU9 O;  1YI2 V;  2Q7G A;  2GBO A;  3CEI A;  5L3C A;  4LFC O;  3CRA A;  4I55 A;  2CGN A;  1BHA A;  3N2G B;  2VQF O;  4E2L A;  1IBM O;  1YJ9 V;  2P67 A;  3ZHV A;  4PEL A;  2L6L A;  2IJK A;  2F95 B;  2JS3 A;  2O57 A;  2DJV A;  4Q6G A;  2ZE8 A;  2EIN C;  4JI8 O;  1QU7 A;  1KUQ A;  3K0G A;  1VF7 A;  4CS2 A;  3FFQ A;  2UUA O;  4QE7 A;  3LSU A;  1SRY A;  2WLI B;  1KB9 F;  2CE4 A;  4O4J B;  4DW0 A;  4X1K B;  4K0K O;  1SZX A;  2EUL A;  2ZXW B;  1VQ7 V;  2Y69 B;  4JI7 O;  3P30 A;  1AR5 A;  2RJZ A;  3CCU V;  4H33 A;  1FPO A;  1M5I A;  3ZHR A;  5H5N A;  4YJ3 B;  1NQT A;  2G38 A;  4JI4 B;  1HP8 A;  1OCO B;  2BOB C;  4X88 A;  2BSK B;  4J41 A;  4MSW C;  3FKS G;  1KC8 W;  1V54 B;  3EHB B;  1SQQ H;  5B1B C;  5GTI Z;  4WF9 V;  2DQ0 A;  4ZOL B;  4LF5 O;  3CHX A;  1F4M A;  3CD6 V;  4LFB O;  4NB5 A;  1F7Y A;  2RDC A;  5JCO A;  1Y6X A;  3W7W A;  4B3M O;  1K3E A;  5LMU B;  4UV8 A;  2QWQ B;  3UT5 B;  4U7N A;  2IJJ A;  4X20 B;  5E1A C;  2NR5 A;  3E22 B;  2B1G A;  4D7T A;  3K5M A;  2ETN A;  2AGA A;  1GN6 A;  1OV9 A;  3G67 A;  1I5Y A;  4HAM A;  3KCX A;  3ZX6 A;  1FS0 G;  2QM8 A;  4LF4 B;  4F4L A;  2PUS A;  4TQD A;  3AG7 A;  3ZMV A;  1AI5 A;  4JYC A;  5CA1 A;  5IY5 C;  3ETQ A;  3RVY A;  1R6T A;  1ZAU A;  3RVZ A;  1N34 O;  1FFX B;  3UO2 A;  2Y0P A;  3K5L A;  2CTP A;  1XNQ O;  1Q5O A;  3WG7 C;  4IGG A;  1JOY A;  3T1C A;  1AR4 A;  1VAR A;  3GB7 C;  3JSN A;  2E3C A;  5EYP B;  1VQ9 V;  1AJN A;  1YVW A;  4BIZ A;  2F1M A;  4UCO A;  1Q82 W;  1WPB A;  1K4C C;  3UKM A;  1BSM A;  4FM1 A;  3ZHU A;  3F5W C;  2WA4 A;  5EC1 C;  3RWR D;  2QA4 V;  2XND G;  2X7R B;  4DV7 O;  3OT7 A;  3SYQ A;  1NJI W;  1H2L A;  5EIB D;  1E1Q G;  1H38 A;  4W4K A;  2QTO A;  3ICX A;  5GTH Z;  4PV1 B;  1NVP B;  4H37 A;  1GTO A;  1GRJ A;  2XAJ A;  2ZR2 A;  5JQG A;  1WJZ A;  3JAL B;  4BR6 A;  2EX3 A;  4LH7 A;  1BL8 A;  2D3O W;  4DR7 O;  2P4K A;  3DTU B;  3E8G A;  4PI0 A;  3SJA C;  3FYI B;  3OE7 G;  5C8Y B;  2OCC B;  5KX5 B;  4EB6 A;  1HNX O;  3JAR A;  1QLE C;  1H2M A;  2Q0A A;  5LA6 A;  5CN0 A;  4O4H A;  3CE2 A;  1K5Q A;  1IBL B;  3NR7 A;  3GWK C;  2Q9L A;  5IJ0 A;  2E5L B;  3PN1 A;  3FB7 C;  3AK2 A;  1AI4 A;  5B1O A;  5DED A;  3T1H O;  3CC4 V;  1XL6 A;  4PA7 A;  2EIM B;  3K9A A;  4DV5 O;  1AP6 A;  2CUG A;  3AK1 A;  3H9V A;  1FJG O;  3NXS A;  1J5E B;  2WLK A;  2WWW A;  2HFE C;  3QNE A;  1XIL A;  1M1K W;  3BCC H;  2HLD G;  3Q4H A;  1CXZ B;  4I0X B;  2IU0 A;  2EIJ B;  1FD9 A;  3DC5 A;  1H8H G;  4O4I B;  4J9Y B;  5CA0 B;  2RNB A;  2X6C A;  4DV1 B;  3JAS B;  3K58 A;  3I55 V;  2GHY A;  3ZRW A;  2K9P A;  2QJ1 A;  1WP8 A;  2UXB O;  3K79 A;  1N33 O;  5EBL C;  1H2N A;  2QTS A;  2ZCE A;  3CCE V;  3AG4 C;  4NXM B;  2JEX A;  1H8E G;  3CSX A;  4J7Z A;  1MZE A;  3QTC A;  4FLX A;  5EBM C;  3UM7 A;  3CC7 V;  1EZJ A;  1YSC A;  4DV6 B;  2FML A;  2LGQ A;  2ZD9 A;  3T4Z A;  3SR2 C;  1BGY H;  2V4D A;  1L8D A;  3FB5 C;  4NTX A;  5FL7 G;  1P4R A;  2DMX A;  3CMA V;  1GN3 A;  1DGS A;  3H1H H;  2XAS A;  4E4E A;  4R8C A;  1IVS A;  2HEP A;  4DK0 A;  2OCH A;  2BTQ B;  1VF6 A;  1QVG U;  4MVR A;  1M93 A;  1IUR A;  1G4Y B;  2Q7E A;  3ZRX A;  1MSW D;  1SQX H;  2HHH O;  4FLT A;  1M4U A;  3OTO B;  2LFR A;  4I9Q A;  3CYO A;  4UVB A;  1I94 O;  5KHI A;  2EIL C;  5B66 Z;  1S0V A;  1K34 A;  1QNM A;  3E83 A;  2YDE A;  2Q67 A;  3P3N A;  3ZRV A;  1OCR C;  1TUB A;  1LUV A;  4GUN A;  1DK1 A;  3LUT B;  3ASN B;  5IWA O;  1XNR B;  2DYR B;  1JR9 A;  4ZHQ B;  2N04 A;  4G27 B;  2CH7 B;  4YIO A;  4HNA B;  4QPK A;  2GUZ A;  1Q90 D;  4ZOL A;  4LF8 B;  1IX9 A;  1NVP D;  1OCC B;  3KG2 A;  3BY6 A;  5L3B A;  1P7G A;  5EIB C;  2AXT Z;  3DXR A;  2B5U A;  5BZB A;  1HW7 A;  4X62 B;  4X66 B;  3ABU A;  3FAV B;  1V9P A;  5J9P C;  1EN5 A;  3SPC A;  1I0H A;  1COW G;  3E2E A;  4GYC B;  3BA8 A;  1U96 A;  5FNV B;  3G4S V;  1N36 O;  1XMO O;  1R3I C;  3VQX A;  4F6R B;  1DF5 A;  4WFF A;  4X9Q A;  4FLV A;  5B3S B;  5BR8 B;  4KP4 A;  3RYF A;  2VWJ A;  2A79 B;  1UPG A;  2WLL B;  3STL C;  1LR1 A;  2P4V A;  4RUE A;  1Z5W A;  1M9N A;  3A0R A;  4PDM A;  1EZV H;  3ZN1 A;  1R3K C;  2BCC H;  3QG5 A;  1QR8 A;  3WFV A;  3A0H Z;  1SA0 B;  1GMG A;  3T1Y B;  4DR1 O;  1BQ0 A;  2ZXW C;  2Y69 C;  2PZS A;  4GX0 A;  1FXH A;  1GM8 A;  1ZLZ A;  1GN2 A;  4JI5 O;  4MVQ A;  4BIO A;  4DXW A;  3WB0 A;  2YID A;  1PNK A;  4FM0 A;  3QF7 A;  2YIB A;  4JYY A;  3M8A A;  1OCO C;  2ZE5 A;  2Y48 A;  1JFF B;  2M6Y A;  2Q73 A;  3F7Y C;  2QE7 G;  4JTA B;  2ZIO A;  1RSO B;  1Q7Y W;  1V54 C;  4I4T A;  5BY1 A;  1W0J G;  5IJ9 A;  4B3S O;  3JAW A;  2QSA A;  2F66 C;  3ABK C;  1KU9 A;  5C93 A;  1YIJ V;  2QGN A;  4LNU B;  4FFB B;  4DUY B;  5CB4 A;  4UB6 Z;  3ZS8 C;  2UXD B;  3OUS A;  4OX9 O;  1XMQ O;  1XQ8 A;  1WA8 A;  1I7F A;  5BXZ A;  2Q7H A;  2ZT9 B;  5JH7 B;  3RYI B;  1Y76 A;  2ZKO A;  3HKD A;  1YEW A;  1WB8 A;  3J80 N;  3WB2 A;  1HR0 O;  5BMV B;  1VQN V;  1Z2G A;  2HVJ C;  1YJN V;  4I50 A;  4FPP A;  4DV4 O;  1JPX A;  3HKC B;  3SDL A;  4OPA A;  3RFR A;  3AG1 B;  3BAB A;  4CS3 A;  4I0X A;  2VS0 A;  1GO3 F;  4TQF A;  2OWO A;  3O65 A;  1MA1 A;  3A2F A;  4NXN O;  1WLE A;  2UUB O;  3OGC C;  5E79 Z;  4JYA O;  4FFK A;  1ZWI C;  5LP6 A;  4R50 A;  5LYJ B;  1VQK V;  4ZI7 A;  4UXN A;  4FLY A;  3ABT A;  3JAT B;  2VQE B;  4PA6 A;  2ZIM A;  1OJH A;  1TA8 A;  5GON B;  3ZCC A;  4LF7 O;  3O9O A;  1S3J A;  1ZUQ A;  4X1Y B;  4GZR B;  2P7T C;  1GH6 A;  4B3R O;  5IYC O;  4O2B B;  5J2T A;  1N0N A;  3OW2 U;  3JYC A;  5JVD B;  4X64 O;  1PL4 A;  1R6K A;  3ZMU A;  2AZ2 A;  1NU1 H;  3IAY A;  1XL4 A;  3IC9 A;  4CC6 A;  5L3F A;  3F7V C;  4JTC B;  5B5E Z;  3RYC B;  4JV5 B;  5LGU A;  5EK0 A;  1US6 A;  1Z5V A;  2QKA A;  2ZR3 A;  5KHK A;  2OCC C;  1ZL8 A;  3SJQ C;  3RYH B;  2KG7 A;  2DYS B;  4PDL A;  3W7S A;  4DV3 B;  2P06 A;  4UV9 A;  4BIU A;  4JI3 B;  3ASO B;  5B1N A;  2BE3 A;  2ODM A;  3D36 A;  3T4D A;  4P30 A;  4WBN B;  1P84 F;  4JI0 O;  4AHC A;  4MVM A;  2ILM A;  2UXX A;  1KP2 A;  1N4C A;  2CDY A;  1CEZ A;  1AI6 A;  3JCU Z;  3L70 H;  1VQM V;  1YTF B;  4IYH A;  1W59 A;  1M57 B;  4LF9 B;  2ARH A;  4TUY B;  1B06 A;  2EIJ C;  4DR5 O;  1V55 C;  2XAG A;  4O2A A;  3A0B Z;  3CP1 A;  5CBH A;  2CH7 A;  4B3T O;  2Q8V A;  4RO2 A;  5J2U B;  5LP6 C;  1XEQ A;  3ZBH A;  3JD1 A;  2FYU H;  3L72 H;  3BPZ A;  4CBC A;  3M99 B;  1K73 W;  1HNW B;  4B7E A;  1GKF A;  3B40 A;  4KXR A;  1R3J C;  1N32 B;  2F23 A;  3CC2 V;  5EZY B;  1SKV A;  1FXK B;  1XOU A;  3OUF A;  1AJP A;  4UB8 Z;  4PHZ A;  1KEC A;  3VBB A;  3IFX A;  4U3J A;  2LP7 A;  5KMG A;  4LF6 B;  1AP5 A;  3CRR A;  4JPR A;  2PI4 A;  3OEE G;  4AQY O; 
#chains in the Genus database with same CATH homology
 3P32 A;  2WLK A;  1ROP A;  2WWW A;  2HFE C;  5EBW C;  3QNE A;  3H01 A;  3LNM B;  1M1K W;  3RBZ A;  2JEU A;  2XAH A;  3CCJ V;  2F43 G;  4MVS A;  2HLD G;  1S76 D;  2IU0 A;  2R9R B;  2EIJ B;  1K8A W;  2M7W A;  4TWK A;  1H8H G;  1QLN A;  1RM1 C;  2A0L A;  4J9Y B;  1S72 V;  4FMT A;  2X6C A;  1CPY A;  3E86 A;  2P6J A;  2JIZ G;  1OCZ C;  2WLH A;  2DWE C;  3I55 V;  4XDJ A;  3B77 A;  2GHY A;  3ZRW A;  5IDJ A;  1NBM G;  4MS2 A;  1QCE A;  2JJ1 G;  3K79 A;  3SPJ A;  4JGS A;  2IJI A;  3E35 A;  4PA9 A;  5EBL C;  2EIL B;  5CMU A;  3CCE V;  5LBQ A;  5KA6 A;  3AG4 C;  1FXK C;  4GX2 A;  1M90 W;  1JVM A;  4MVO A;  4MVZ A;  2JEX A;  1H8E G;  3ASN C;  3K06 A;  1RPR A;  3IGA C;  4KUM A;  2DYR C;  3SYO A;  1NH2 D;  1QLE B;  3EFF K;  1OCR B;  4ZBM A;  3GWO A;  5EBM C;  3UM7 A;  4OXS A;  3CC7 V;  1EZJ A;  1YSC A;  4L87 A;  3W7U A;  2ZD9 A;  3B8N A;  3T4Z A;  4WFA V;  3LSS A;  3SPI A;  2EIM C;  3FB5 C;  2HVK C;  5KUM A;  1AJQ A;  5FL7 G;  1P4R A;  1K33 A;  3CMA V;  2BOC C;  4YXW G;  1KKD A;  3SPG A;  3CPW U;  2W6J G;  2EIK C;  4UVA A;  1S5H C;  1RPO A;  2H8P C;  2XAS A;  3JCZ A;  4X89 A;  1R6N A;  1B6Q A;  2X6A A;  4R8C A;  3OMI B;  3OMA B;  5KUK A;  5L3G A;  3ZRS A;  5LHI A;  2EBO A;  1QVG U;  4MVR A;  2XAQ A;  3K0D A;  4FK5 C;  1G4Y B;  2K1E A;  2QKS A;  1I5X A;  3K3W A;  4TT3 G;  5H9C A;  3SPH A;  3ZRX A;  1MSW D;  2ATK C;  1G8M A;  3BEH A;  2EJR A;  5B3S C;  1RM1 B;  1TUE B;  2LFR A;  1JCH A;  1ENV A;  2OTJ V;  3CYO A;  4UVB A;  1E1R G;  2GSM B;  3CCL V;  1E79 G;  3T2M A;  1GK9 A;  3FB8 C;  1OCZ B;  2EIL C;  4PA3 A;  1S0V A;  4LCU C;  1K34 A;  1SES A;  2V7Q G;  3QO5 A;  4JAV A;  1W0K G;  1Q81 W;  1YTF D;  3E83 A;  1QQH A;  4P2Z A;  2Q67 A;  4QE9 A;  1W2B U;  3CCR V;  1VQO V;  3ZRV A;  1L1F A;  1OCR C;  1CP9 A;  4GT1 A;  4JAS A;  1WPX A;  2X6B A;  3ZMZ A;  5LHH A;  3LUT B;  1M56 C;  3ASN B;  3SYA A;  2DYR B;  1SET A;  4JYB A;  5HFM A;  4G27 B;  2Q68 A;  3SYP A;  4QPK A;  2EZP A;  4R6Z A;  4BAY A;  2JJ2 G;  3MD0 A;  4I5S A;  3TET A;  1NKD A;  1NVP D;  1K5S A;  1OCC B;  2P90 A;  3W7T A;  1YIT V;  1JJ2 U;  4TSF G;  5EC2 C;  1S77 D;  2Z3Y A;  4WFE A;  2MK3 A;  3KG2 A;  3BY6 A;  5L3B A;  2IW5 A;  4GX1 A;  5B1A B;  2WLL A;  3CXC U;  3E8H A;  4P9O A;  1Y4M A;  2EIK B;  2ITC C;  5HFL A;  2B5U A;  4PDR A;  5H6Q A;  3ETD A;  5BZB A;  3CCM V;  1NR7 A;  3ABU A;  4RQF A;  5J9P C;  2B1I A;  2KB1 A;  4RAI A;  3LSQ A;  5GW7 A;  3D3I A;  2Z5U A;  3SPC A;  4P9P A;  1COW G;  3E2E A;  1Y66 A;  1UJW B;  3AEI A;  2UXN A;  3ABM C;  3G4S V;  3CME V;  1YJW V;  1R3I C;  1K9M W;  1F51 A;  4N21 A;  1VQ4 V;  2ZDI C;  3ABK B;  1DF5 A;  4WFF A;  5B3S B;  4R7C A;  3OAA G;  4KP4 A;  4Z1M G;  1JX9 A;  3QO8 A;  2A79 B;  3I56 V;  4KFM A;  3ZIA G;  2DWD C;  4QPJ A;  2WLL B;  3STL C;  4JAU A;  2C2A A;  2DQ3 A;  3ZMS A;  4WFH A;  1MOF A;  4HYO A;  4LBE C;  1M9N A;  4RUE A;  4U7O A;  2YEV A;  3A0R A;  4PDM A;  1LNQ A;  4DO2 A;  5CBF A;  1PL0 A;  3ZN1 A;  2NLJ C;  2NNU A;  1R3K C;  1VQL V;  1QR8 A;  3WFV A;  4EKW A;  4MTO A;  1JQ0 A;  3X2Q C;  2WLM A;  3ETE A;  2WLN A;  3B8M A;  1GMG A;  3OM3 B;  3JD4 A;  2EZO A;  1M56 B;  2ZXW C;  1K92 A;  1OCC C;  2Y69 C;  4QJF B;  1F4N A;  2HR3 A;  3LDC A;  1BMF G;  3OMN B;  1PKX A;  1FXH A;  3ABL C;  4GX0 A;  4Q20 A;  1H2G A;  4XDK A;  5LHG A;  1GM8 A;  2ZQM A;  2ZDI A;  4N23 A;  5B1A C;  4MVQ A;  1SZT A;  3SYC A;  4DXW A;  1K97 A;  2JK5 C;  3ML0 A;  3ZRW B;  1PNK A;  1DLB A;  2FTK A;  3JD3 A;  4LC1 A;  3OFN G;  3OR7 C;  4WCE V;  3OR6 C;  1OCO C;  2YEV B;  3OEH G;  1YI2 V;  2Y48 A;  1HWY A;  2V1D A;  3F7Y C;  2QE7 G;  5L3C A;  4JTA B;  1Q7Y W;  1V54 C;  2WLI A;  1W0J G;  4WFB V;  1BHA A;  2XOK G;  4E2L A;  1YJ9 V;  2P67 A;  3ABK C;  1VQ6 V;  3G71 V;  4G2K A;  4ASU G;  3ABM B;  4XBF A;  4PEL A;  3ZJZ A;  5C93 A;  3CCS V;  1YIJ V;  2QEX V;  2IJK A;  1R73 A;  2WSS G;  2EIN C;  2JDI G;  4X8A A;  3K0G A;  2QM7 A;  3OUS A;  1EFR G;  2IH3 C;  3CCV V;  2Q69 A;  5LGT A;  5CA3 A;  2W6I G;  4QE7 A;  3CCQ V;  1GM7 A;  4PA4 A;  1SRY A;  2WLI B;  4I9W A;  4MTF A;  1KQS U;  3X2Q B;  5DN6 G;  1THZ A;  1VQN V;  2HVJ C;  1YJN V;  4PDV A;  1VQP V;  3JD0 A;  4FPP A;  1ARO P;  1JPX A;  2ZXW B;  1VQ7 V;  2Y69 B;  3K04 A;  2DYS C;  2WPD G;  1IXM A;  2HG5 C;  3AG1 B;  3P30 A;  3ETG A;  1QR9 A;  3CCU V;  3ABL B;  4H33 A;  1SER A;  5IYD O;  1GO3 F;  3MHH C;  3G6E V;  4JF3 A;  1AI7 A;  4QIW F;  1WLE A;  1NQT A;  3ASO C;  4UUJ C;  3OGC C;  1GM9 A;  2LFS A;  1OCO B;  2BOB C;  4X88 A;  2IH1 C;  1R3L C;  1ZWI C;  4MSW C;  3FKS G;  3QO7 A;  1KC8 W;  2HKO A;  4R50 A;  1VQK V;  1V54 B;  3EHB B;  4UXN A;  3ABT A;  5B1B C;  4PA6 A;  4WF9 V;  2OT5 A;  4MVU A;  2DQ0 A;  1M57 C;  2W0F C;  1MAB G;  4MTG A;  1F4M A;  3CD6 V;  3ZCC A;  5IYB O;  1S3J A;  2AHY A;  3E8F A;  2P7T C;  4MTX A;  5L3D A;  5IYC O;  1NH2 B;  3W7W A;  1K3E A;  4UV8 A;  1V55 B;  2HJF C;  5H6R A;  2EIN B;  3JYC A;  3E89 A;  3OW2 U;  1R6K A;  4CZZ A;  1ORQ C;  4U7N A;  2IJJ A;  5E1A C;  3ZMU A;  2B1G A;  3ZN0 A;  1XL4 A;  5L3F A;  3F7V C;  4JTC B;  3W7X A;  1N8R W;  1NR1 A;  1FXV A;  1I5Y A;  4HAM A;  4RQE A;  3AG2 C;  1FS0 G;  4HZ3 A;  2IJH A;  2QM8 A;  5LGU A;  5EK0 A;  1PD3 A;  2ZR3 A;  3HPL C;  3AG1 C;  4FJC C;  3K03 A;  2OCC C;  4F4L A;  1YHQ V;  1VQ8 V;  3TCU A;  3SJQ C;  3ZMV A;  5L3E A;  1AI5 A;  1VQ5 V;  2ITD C;  4JYC A;  4MW3 A;  5IY5 C;  2Q6A A;  4ZKI A;  2DYS B;  5CBG A;  3RVY A;  3AG3 C;  4PDL A;  1P7B A;  4GCZ A;  3W7S A;  3RVZ A;  2R9I A;  4QNH B;  1DF4 A;  4UV9 A;  4BIU A;  2PI5 A;  4JTD B;  2XAF A;  3WG7 C;  1JOY A;  3T1C A;  3ASO B;  5B1N A;  3D36 A;  3PJS K;  3GB7 C;  4P30 A;  3T4D A;  1VQ9 V;  5KA5 A;  1Q86 W;  1AJN A;  2H94 A;  4MVM A;  4BIZ A;  2UXX A;  1KP2 A;  1CEZ A;  1AI6 A;  1Q82 W;  4GX5 A;  1VQM V;  2X0L A;  3STZ C;  5B1B B;  1K4C C;  1PNM A;  3UKM A;  1YTF B;  3F5W C;  1M57 B;  3FYE B;  4MW8 A;  5EC1 C;  3TK1 A;  2EIJ C;  1V55 C;  2QA4 V;  2XND G;  2XAG A;  3OEE G;  1FXK A;  2X7R B;  3JD2 A;  4J9Z B;  1KD1 W;  1QBZ A;  2YSU B;  3CP1 A;  3SYQ A;  1NJI W;  5CBH A;  1E1Q G;  2WLJ A;  1H38 A;  2AHZ A;  2QTO A;  4RO2 A;  1MG1 A;  3IC7 A;  1EBO A;  1NVP B;  4H37 A;  1AR1 B;  1GTO A;  3JD1 A;  1J95 A;  3DGE A;  4CBC A;  3M99 B;  3FB6 C;  2ZR2 A;  1KP3 A;  2XAJ A;  3HB3 B;  1OZ0 A;  1K73 W;  3RW0 A;  1BL8 A;  3AG2 B;  1GKF A;  3ZMT A;  2D3O W;  4WFG A;  1FFT B;  3LDE A;  1BHB A;  3DTU B;  3E8G A;  3FYI B;  3OE7 G;  4G28 B;  2OCC B;  1R3J C;  1K4D C;  3E8B A;  2WAM A;  2OTL V;  1QLE C;  3CC2 V;  4RUF A;  5IY5 B;  2A9H A;  5DM6 V;  3AG4 B;  1FXK B;  2IU3 A;  5CN0 A;  1DTO A;  3K08 A;  4FIP C;  2DW4 A;  3AG3 B;  3OUF A;  1AJP A;  1K5Q A;  3R65 A;  1PNL A;  4XDL A;  4LP8 A;  4BW5 A;  1QVF U;  1OHH G;  1KEC A;  1K7D A;  3FB7 C;  1AI4 A;  5B1O A;  3VBB A;  3WG7 B;  3VOU A;  4MT8 A;  3LDD A;  3IFX A;  1XL6 A;  3CC4 V;  4PA7 A;  2LP7 A;  2EIM B;  3K9A A;  2CK3 G;  3MHS C;  5LGN A;  4JPR A;  2PI4 A;  4UVC A;  1F23 A;  3NXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...