1R6KA

Hpv11 e2 tad crystal structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
187
Chain Sequence
AIAKRLDACQDQLLELYEENSIDIHKHIMHWKCIRLESVLLHKAKQMGLSHIGLQVVPPLTVSETKGHNAIEMQMHLESLAKTQYGVEPWTLQDTSYEMWLTPPKRCFKKQGNTVEVKFVMEYVVWTHIYLQDNDSWVKVTSSVDAKGIYYTCGQFKTYYVNFNKEAQKYGSTNHWEVCYGSTVICS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the E2 Transactivation Domain of Human Papillomavirus Type 11 Bound to a Protein Interaction Inhibitor
pubmed doi rcsb
source organism Human papillomavirus type 11
molecule tags Transcription, replication
molecule keywords HPV11 REGULATORY PROTEIN E2
total genus 61
structure length 187
sequence length 193
ec nomenclature
pdb deposition date 2003-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r6kA01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 1r6kA02
2NNUA 2JEXA 1R6KA 1R6NA 1TUEB 1DTOA 2JEUA 1QQHA
chains in the Genus database with same CATH superfamily
1Q8IA 2WAMA 3IGAC 4TT3G 4NB5A 3ZBHA 1OHHG 3SPCA 3HKCB 1S72V 1M4UA 4JI6B 5HFMA 3AEIA 4FM2A 4UCSA 2IU0A 4GZRB 2P4KA 3A0RA 3OMIB 3ASNC 5KA5A 4ZI7B 2Y0IA 3LDDA 2EBOA 1XMOO 1N32O 2QM7A 4LFCB 5BXZA 3RYIB 2ZNIA 1D5AA 4X8AA 3AG1C 3JATA 4OX9O 1QR9A 2UXBO 4FFKA 1VF6C 4JYAO 3SJCC 3JYCA 1F23A 3O9OA 3CRQA 1HNZO 3BFRA 5J2TA 1IBMB 1QU7A 1Y74A 2ETNA 3OGCC 1HNWO 3E35A 2F93B 3EVKA 4UXNA 3OUSA 3CEIA 4FLVA 2CTQA 2A79B 2QGNA 2XOKG 1R73A 3AG7A 4MVQA 5IJ9A 3LUTB 3ZHVA 2F43G 3JASA 3LSUA 1XNQB 1MABG 1KD1W 2CGNA 4FPPA 4MVSA 4NTYA 2WA4A 4RO2A 1F51A 3MDSA 4BIOA 1SKVA 3KCYA 2IJKA 4JAUA 1K4DC 4B3SB 3RYHB 5JCOC 1H38A 2JIZG 4LF4B 3TXSA 5EBLC 1JA8A 4Q6GA 1KKDA 3A8TA 1YF2A 3GVMA 5BMVB 1BE3H 3CS5A 4W4KA 2XAGA 3E8HA 4HBNA 3ZHQA 3OTOO 5LGUA 1MSDA 4PD4F 4NTWA 3CC4V 4UCTA 4ZOLB 3QF7A 2Q67A 3APQA 2UXDO 1ROPA 4NKGB 4JTAB 5LA6A 1PKXA 1VQLV 1S5HC 3K5MA 3ABTA 4NR1A 5JWPA 4DR5B 1ZWIC 4PDRA 4EB6B 1EBOA 2A9HA 5CBFA 4J42A 1PNMA 3J80N 4UB6Z 2WWWA 5KHJA 4YIOA 3MHHC 2LO1A 3CP1A 4DUYB 3VQXA 2X0LA 3SDLA 5BZBA 4CC6A 4MT8A 1AILA 3SPHA 1CXZB 5J2UA 2BOBC 2H3OA 1U96A 1XREA 3RYHA 2IW5A 4EFBA 3A0HZ 3JD2A 2RN9A 4RWUA 1COWG 2ZDIC 1IXMA 3K3WA 5JJJB 2BOCC 4UVCA 3B77A 2VS0A 5CA0B 2JGUA 3ML0A 3I5DA 1W0KG 2UXCB 1M56C 2VWKA 4ZHQB 4YJ2B 3ABKB 5IY5B 4DUZO 4PA9A 2V7QG 2A0LA 4UV9A 1IVSA 1PV0A 3CJHB 3CCUV 1Q86W 1BHAA 2G38A 3EFFK 5LMUB 3P3NA 2DOSA 5LOVA 5E1AC 2QEXV 2JJ2G 1YXBA 3RYCB 2AW9A 1WB8A 1AI4A 2LFSA 1FXVA 3MHSC 4KXRA 4MW8A 1LUWA 3N2KA 2YUAA 5HFLA 4HAMA 1KYOF 3K03A 4DV0B 4K8ZA 2F66C 1NVPD 4IIJA 2PZSA 3RT3C 3E89A 1KP3A 4GKKO 1KC8W 4F6RA 1XL6A 1N0JA 1GN3A 4J11A 1FYJA 5GW7A 3THOA 4D6TH 3CHXA 3QO7A 2F1MA 1P7BA 1HW7A 2Q8VA 1XOUA 2RDCA 4TV9A 1NT2B 5BMVA 5IE9A 1IURA 1VF5B 5IWAO 1RSOB 1K5SA 1H2NA 4JI2O 3ABMB 5L3GA 4L87A 2Q7HA 1OCRC 2JS3A 2EZPA 5KX5A 2QKSA 2QSAA 5EIBC 5CBGA 2HEPA 2VQEO 2YSUB 1R1BA 5JVDA 1F4NA 4DR7O 3UT5B 2YEVB 5IJ0A 4Z2WA 1OZ0A 5LXTA 4J41A 3L70H 1H2MA 4J7ZA 5LHHA 1AR4A 5LMNB 1ENVA 1MNGA 1QQHA 3L9DA 2X6BA 3D36A 2HJDA 4JI1O 4X1IA 1F4MA 2RCVA 2KG7B 3W7XA 2Q69A 5IYDO 1UFIA 3JAMN 2EINB 4B3RO 4LF4O 4FFBB 4P30A 2ADQB 4NXNB 1IBMO 3VBBA 1QBZA 3CXHF 4FM0A 2Y69C 1XILA 3K06A 2DQ0A 3ABKC 5FPOA 3UCSC 4R7CA 5LHGA 4QE9A 4JF3A 4NTXA 2QWOB 5K1PA 1RPRA 1HNXO 3ZMVA 1LUVA 3SPJA 1BQZA 4NYKA 5TISZ 2OYQA 1Q43A 1MG1A 3J7AU 1PNLA 2EX3A 3KKYA 1R6NA 4G2KA 2E75B 3TETA 4J10A 1NJIW 3C90A 1ZL8B 3ZS8C 4GLXA 3K79A 3E2EA 2E74B 4U7NA 5B3SC 2RMKB 5B1AB 4XBFA 4YJ3A 4HNAA 2M6YA 2EIJB 4UCUA 3F5TA 3K04A 1EZVH 4EEQA 1QNMA 4FJCC 4X1KA 4BR6A 2EIJC 3CCJV 1HNXB 3C3TA 3BEHA 2ITCC 1L0LH 5ITZB 1E1RG 1VIBA 4ICGA 1SC5B 2YDEA 5B1AC 3B8NA 1UJWB 1KU9A 3RYCA 2QJ1A 4K3AA 3N2GA 1G1XB 3SYOA 2UUAB 4Q20A 2R9IA 1K33A 4LF5O 4FZ1A 3FB5C 3K0GA 1XL4A 1Q90D 3GWKC 2HFEC 3JALA 4D7TA 4CC5A 2H8PC 1VARA 3IJ4A 1Q81W 3ZMUA 1JCHA 1QHTA 4OXSA 1Q7YW 3AG3B 4X65B 3D3IA 3ASOC 2ZCEA 4LC1A 4MTFA 2R70A 4WFAV 3SGIA 5LBQA 1IX9A 2LGWA 2EINC 1SQPH 1B04A 3LNMB 3JD4A 3BA8A 1NBMG 1L8DA 1YJ9V 2DYRB 1H8EG 1IZ3A 3E86A 1M1KW 2PYJA 1MSWD 5DM6V 2L6LA 4LNUA 4O2BB 4U3JB 4UFZA 4TSFG 2HJFC 3E8GA 2WPDG 5F2VO 2WLKA 3WU2Z 1GK9A 2Q9LA 2IU3A 4DXWA 1IXBA 2ZXWC 2LW7A 2Y4TA 2YS8A 5EK0A 1M90W 1FJGB 1AB3A 3FFQA 1FXKA 1OCCC 1OCRB 2YIDA 4LF9B 3RBZA 3OR7C 5FPRA 3ABMC 1I7FA 5H2FZ 4TOIA 2QTOA 3CCEV 1TVKB 2UXBB 4LF6B 3B2EE 3TK1A 4IIJB 1NVPB 2XAJA 2VQEB 4YIPA 2JRIA 1RFYA 2YEVA 2XNDG 2XTAA 2BSKA 3M7MX 5IJ0B 3O65A 1HDJA 1YEWA 4CH6A 3JD3A 4WF9V 1Y76A 2PYLA 2YICA 2N04A 5EBWC 2GHYA 2W6IG 1XEQA 2QM8A 5B1NA 1FXKB 2N05A 5CB4B 3VQWA 2DE0X 4DV5B 1AR1B 3F5WC 2UUBB 2EILC 3ETEA 4X88A 5GTHZ 1ZTEA 1BGYH 3BA9A 3DC6A 4MVOA 2JS5A 1EN4A 5CN0A 2XAQA 3DXRA 1DF4A 1ZAUA 2UXXA 4DUYO 5KA6A 3S3XA 4CS2A 4JTDB 3HKDB 3CRRA 4GX0A 4X89A 1AVMA 3E8FA 4LWSA 5IYCO 3ZX6A 1VQNV 2QKCA 4LFAO 2DJVA 2NR5A 3OMAB 3H1KH 3DTUB 3N27A 2YIAA 3MD0A 4LF8O 2JGDA 1GAXA 1EN5A 3ETDA 3ZIAG 3HKDA 2KG7A 2HLDG 4DV4B 3CCSV 5KAFZ 3FB6C 2OCCC 4W4LA 1H2KA 3W7WA 2UXDB 4I55B 3I56V 3E8BA 1XQ8A 1GMGA 1GTOA 1G4YB 1GN4A 1I94O 2ATKC 4PJ0Z 4TUYA 1W0JG 4HNAB 4UCVA 3JARB 3SJBC 4J9YB 3ZHTA 2QWNB 1S3JA 2DW4A 4I9QA 1N34O 4AHCA 3ZHSA 1OCZC 2NLJC 3ABLB 4BW9A 1XNRB 3RN4A 5ITZA 1O9GA 4BAYA 1RSOA 4LF8B 5DECA 3FKSG 2IM9A 4X64O 4ZKIA 1VQ7V 2CAZC 1VMGA 4DV2B 1YJNV 2EULA 2ARHA 2F4VB 2GUZB 3TGUH 4DR2O 3L72H 2QTSA 1KKCA 3M99B 2DWEC 2UXCO 5EZYA 4JAVA 2V4DA 4B3SO 1PL4A 1BMFG 4EFEA 3DGEA 4RQFA 3JCZA 3LNNA 5KUKA 2YIBA 1N34B 2Z5UA 3QO8A 3G6BA 5L3DA 2WA3A 5LMUO 4FM1A 3OTOB 2ZDIA 1J5EB 1EFRG 5D5QA 1MZFA 2BTQA 4LH6A 4HZ3A 2O57A 3T1CA 2ZE8A 2DN9A 4MTOA 4LWSB 3BPZA 3F7VC 3LSQA 3VQVA 4JI4B 1GO3F 4DR5O 2YI9A 2HVKC 2EIMC 5JQGA 5LGTA 4K0KB 4DR3O 2X7RB 2OCCB 2BSKB 3SPIA 4I0XA 3C3SA 4ZI7A 4Z1VA 4DRXA 4WBNA 2Q7GA 2BTQB 5IWAB 3K5LA 1K4CC 3HKBB 4YJ2A 2OCHA 4YY3O 3VQYA 3KCXA 4CZZA 1YVWA 3UO2A 5KUMA 3T1HB 3ZJZA 4QIWF 4X1YB 3K59A 5KX5B 2ZINA 2XUMA 2EILB 1L0NH 3T1YO 2W6JG 1U97A 3STZC 4AI8A 2LFRA 2IBZH 2F23A 1TVKA 1WPBA 2HKOA 3UQ8A 2OIEA 3CXCU 2UU9B 2JK5C 2FTKA 2DYSC 1Z5WA 1BCCH 4QPKA 4UVBA 2QM4A 4TV8B 3R66A 2JDIG 1GH6A 2HHHO 5H5NA 2N74A 2GBOA 1HWYA 4DRXB 5LXTB 3AG2C 4JI3B 5B66Z 5JJNB 1H2GA 3AK1A 1URFA 1P49A 2PGGA 1PL0A 1WP8A 4DW0A 3RFRA 1DGSA 4QGPA 1AP6A 2FL4A 5FNVA 2ZE7A 1QVFU 2MW2B 3WG7B 4LF9O 1JJOA 3G6EV 3OT7A 4GCZA 3L74H 4GKKB 1K3EA 1P4RA 4TUYB 4GX1A 1GM9A 4X1KB 4PDVA 1LR1A 2P90A 4O4HB 1OCOC 4H37A 3UKMA 3RVYA 1VF6A 2P7TC 2P06A 1A32A 1N33O 2K1EA 4CBCA 2ZR2A 3L73H 2XASA 1SETA 4O4JA 3U0ZA 2OT5A 1NS1A 3OM3B 4I5SA 1QLNA 4O4IA 5J2TB 4B3MO 1SQVH 5LGNA 1VQPV 4RAIA 3P30A 3HKEA 4UCOA 2ILMA 4R6ZA 3P32A 2Q4PA 2DYSB 2AGAA 2RNBA 3E22A 1EN6A 2Q68A 2WLNA 1G8MA 2E76B 1B6QA 1N8RW 2ZQMA 1VQOV 3CB2A 4MTGA 5IYBO 4DW1A 1VQ4V 2FB5A 5H6QA 4H13B 4GUNA 1QLEC 4FLWA 3JAWA 1Y66A 1JX9A 3JAWB 1JVMA 1NKDA 4X65O 3K08A 2ZM6B 4I50B 1YJWV 4UUJC 2YI8A 1YDXA 4G27B 3RVZA 4MVRA 3JARA 1THZA 1XUQA 1WNSA 3OEHG 1FPOA 4GYCB 4B3TB 3CCMV 4NXNO 3Q4HB 2XHBA 3EHBB 2Z0AA 2HVJC 3ETGA 2ODMA 5J2UB 2XT9A 1YTFB 4BIZA 1E79G 3NXSA 4JPRA 5DEDA 3OMNB 1V54C 3JSNA 4LP8A 2LJ2A 5JVDB 1RPOA 2KB1A 3D3QA 1WAZA 1M5IA 3OEEG 2CH7B 2PUSA 1GN2A 1WN7A 3LDCA 2AZ2A 1FS0G 4YHHB 1IBKO 1I5XA 3LSSA 4PA7A 5KHGA 4J80A 1HR0O 4GT1A 3FYEB 3F7YC 4A5UB 5C93A 1ZL8A 2FYUH 3BAAA 3ZMSA 4LNUB 1K34A 1PP9H 4X20A 2D3OW 4RQEA 4JYCA 1Z2GA 4DYLA 5EYPB 2JEXA 5IYZA 5C8YB 5KHIA 1XMQB 2Q7EA 1AJQA 2V1DA 3W7SA 1P84F 4PA3A 3FYIB 3JD0A 1YITV 4JI8B 3WG7C 3SYPA 1Q6HA 2AHZA 1M57B 4JTCB 1EZJA 3H1JH 1S5JA 1PD3A 2KQXA 3FAVA 3K9AA 4E4EA 4AILC 1YSCA 3G80A 1I94B 1RM1B 4RUFA 4CH5A 5JJEB 2QKAA 1JFFA 2A7WA 1N0NA 2XAFA 3X2QC 2YXHA 1QCEA 4YXWG 4DV1B 2WLJA 1DTOA 1QVGU 3KZIZ 2IJIA 2P22C 4AQYO 1WP7A 1XNRO 3ZN0A 2E5LO 5CA3A 1K73W 1K8AW 2Y0PA 1NI8A 4DV7B 1GN6A 1OCOB 4I7ZB 1WA8B 5KAIZ 2F4VO 3QNEA 1V55C 2HHHB 2AZ0A 1BQ0A 3RYIA 3T2MA 1PNKA 4YJ3B 4B7KA 4XDLA 2JVDA 4IL6Z 3R65A 1XHXA 2ZE6A 2AHYA 2B1IA 4DV1O 3CRCA 4U3FH 5LL6Y 3CD6V 4OGQB 1S5LZ 3E83A 1BS3A 4X62B 1SERA 3FB7C 3T1HO 1D5NA 4KFMA 1NZ6A 5L3CA 1X4TA 2R72A 1M9NA 5BR8O 4WFFA 1JMKC 3HPLC 2IJHA 4O4IB 4BWAA 3JAKB 4JI4O 1K97A 3JD1A 1KECA 4WFGA 5EYPA 4ABMA 5FNVB 3OE7G 4F6EA 2CE4A 1Y6XA 4QE7A 4NXMB 2EIMB 4CH3A 4RUEA 4H44B 3SR2C 3FAVB 4JV5B 2YC0A 4I50A 2UUBO 1SF9A 1QR8A 2RQ6A 2UUAO 4OX9B 3WB2A 3HB3B 2P67A 5CB4A 1V9PA 4YHHO 2JEUA 1NTMH 3CSXA 2P5OA 3IC7A 5LP6C 1AI6A 2PI4A 3BHPA 3MAQA 3G67A 1US6A 2KKWA 3CRMA 1WA8A 5FL7G 4DV6O 4MW3A 1Q82W 5L3BA 4DO2A 4WFEA 2HR3A 1JOYA 4MS2A 1ZUQA 4I4TB 3G4SV 2X6CA 1K7DA 3FX7A 1DLBA 3CRAA 1SQXH 2ZD9A 3DSQA 4K8XA 2UU9O 3AG4C 4JAAA 2OTLV 5B1BC 3JALB 3OD4A 4MTXA 4B3TO 3H01A 5CA1A 2YIBD 4DR1O 2EJ7A 1L1FA 2ZNJA 4GX5A 1I5YA 4O4HA 3CJHA 3ZHRA 2Y48A 4FLXA 3B40A 3FD9A 3A0BZ 3IFXA 4FIPC 2WLLA 4IYIA 4JGSA 3N2GB 1OCZB 4DV6B 4DR6B 1XNQO 5LP6B 2HG5C 1RP3B 3UT5A 1Y74B 1ZLZA 1GM7A 3A2FA 3HKBA 4CS3A 3J81N 2P6JA 5EZYB 3RYFA 5L3FA 2BCCH 3AG3C 2QWRB 2ZIOA 3L71H 4XDJA 4YY3B 4DV2O 3K58A 3T4ZA 3Q4HA 4X1YA 4U7OA 1BZKA 3IC9A 2B1GA 2C2AA 4J9ZB 5CMUA 2ZIMA 3BVOA 1S76D 4OPHA 1IBLB 5IT9N 4J7KA 4JI5O 3U10A 1FXHA 1JFFB 2PF4E 4EB6A 1P7GA 4GKJO 3JASB 1WB7A 4DR3B 3CCQV 3W7UA 1AP5A 2ZE5A 1XMQO 3AK2A 3AG1B 4LFCO 4IYHA 3PJSK 3QVNA 5B3SB 1S0VA 1FAFA 4QJFB 1NH2B 4PA6A 3H1HH 3I55V 4F4LA 2PY5A 1VF7A 1BT8A 3B8MA 1IBKB 4H33A 4P9PA 1VQ8V 1TGOA 5BR8B 4X9QA 3ZEDA 4DK0A 4DR4B 2CTWA 4PA4A 4DV3O 1K9MW 1H2SB 1FXKC 5EBMC 4Z1MG 4JYBA 2QA4V 5EC1C 1H2LA 1FFXA 4LF7O 1YI2V 1CEZA 1R6KA 3UO3A 4FZ0A 4QNHB 2EIKC 1YCIA 3FB8C 1IDSA 1TUEB 3P3PA 1J5EO 4TQFA 1B3QA 2Q6AA 3CX5F 4WBNB 1BL8A 3WB1A 5EC2C 2LP7A 4TV8A 3STLC 4E2LA 1UPGA 3M8AA 4X64B 3OAAG 1CP9A 1OCCB 4TQDA 5CA0A 1AJPA 3D36C 1XHZA 4DR2B 4MVZA 1TAEA 2OIGA 4JV5O 3S3WA 3APOA 1H8HG 2FKXA 4OPAA 2VRZA 4K35A 3OTFA 4H0LB 1K92A 4MVUA 2EJRA 5A2QN 3JATB 1W59A 5LP6A 4EKWA 3ZRSA 2FMLA 3GB7C 1YTFD 3CYOA 3BCCH 1KBHA 2UUCB 1SZXA 4PI0A 3TCUA 5KLVH 4UB8Z 2Q73A 1HNZB 1YIJV 4FLUA 5LYJA 1VQ9V 3UM7A 3N2KB 1DK1A 2QR4A 3TJTA 4DK1A 1YHQV 2JGDB 3NR7A 3CMAV 4PDMA 3CMEV 1S77D 4CS4A 3X2QB 3T1YB 2Q0AA 2W0XA 4NXMO 1JJ2U 1NTKH 4K0KO 1AROP 3B4SA 3W7TA 1X59A 4UCRA 4JI2B 2ZXWB 3CE2A 1M57C 4C7UA 3AG4B 2UUCO 3ZN1A 1V54B 2K9PA 2BE3A 2LGQA 1XDCA 1CPYA 4O4JB 2CGOA 2L35A 1TUBB 1OV9A 1VP7A 2GTAA 3OUFA 4MVMA 2IH3C 4BW5A 2AXTZ 4UV8A 4UVAA 1J95A 1Q6UA 2DYRC 1SZTA 3ZMTA 3H1LH 3SJAC 1N33B 1SQQH 1Y67A 5CBHA 1Q6IA 5JH7B 4N23A 2W0FC 4PHZA 4LFAB 5A9GA 1MMMA 3H9VA 1VQKV 2KSDA 1KQSU 3ICXA 1R3KC 3CCVV 2F95B 4FLYA 3ASOB 4JYAB 1QLEB 2GUZA 2R9RB 4LBEC 3RWRD 3TXQA 5C8YA 3ZMZA 1WJZA 1IBLO 3JAKA 1SS3A 3QO5A 4DV7O 3ABUA 1SA0B 4O4LA 3QTCA 4WFHA 1OJHA 4L8JA 2GDSA 1HNWB 4JI8O 4GKJB 4JI6O 2P4VA 4DV3B 1Y4MA 2VQFB 1JQ0A 5K1XA 5LOVB 5LHIA 1XI1A 1SRYA 3CPWU 2WLMA 4PV1B 1B06A 5D5PA 3ZCCA 3OW2U 3LDEA 1N32B 2PI5A 4B08A 2Y69B 4U3JA 3SYCA 4D7SA 1N36O 5KMGA 4DV5O 4LH7A 4B3MB 4PI2A 4I55A 2MK3A 3L75H 2E5LB 3RGBA 3ZRWA 1R6TA 3JSLA 1AI5A 4KHPO 1Z5VA 4B7EA 4LF7B 5GONA 1KP2A 4DR1B 1KB9F 3BY6A 3CC7V 3B09A 1XBLA 1D2DA 4FLTA 5GONB 2H94A 4IGGA 1FD9A 5LYJB 2VWJA 2Q0OC 2WLIB 4O2AB 2DQ3A 3ZHUA 5IJ9B 1V55B 3VOUA 2WLLB 4P9OA 1M93A 1SQBH 1DF5A 4G28B 1MOFA 4KL1A 2GSMB 1HR0B 4DV4O 2DMXA 2WLIA 4O2AA 1AR5A 3SJQC 4FLZA 1EM1A 2CUGA 4KHPB 4DR6O 1I0HA 4DR7B 5DN6G 2CDYA 1VQMV 1W2BU 4LFBO 4KUMA 4NVPA 3CC2V 1RM1C 4ZIBA 4O4LB 1VQ5V 2ZR3A 2QWQB 4JI7O 2D2CB 2QDOA 4IHJA 3OGIB 4JZGA 2CTRA 4TV9B 3RYFB 3G71V 3IAYA 1MZEA 4J7JA 1R3JC 3PN1A 4ZHQA 5B1OA 4DUZB 2GV9A 2YXLA 3RW0A 2RJZA 2ADPA 2UXNA 1JR9A 4P2ZA 4JI0O 1O9HA 4TWKA 5JQGB 2OWOA 1F7YA 5FLXN 2CH7A 1NR7A 4F6RB 5GTIZ 1FJGO 4FVMA 3BABA 2Y4UA 2XAHA 2JJ1G 3AG2B 1SQGA 2CTPA 5KHHA 4IHJB 4BIUA 5IY5C 4I4TA 5AG2A 1M56B 4DV0O 3K0DA 2M7WA 1MA1A 2Q5ZA 1TA8A 4FK5C 2WSSG 1BHBA 4X1IB 5J9PC 1R3IC 4JI3O 3WFVA 5KMGB 3CCRV 4X20B 5CA1B 1LNQA 1WLEA 4JI5B 3CWBH 2VQFO 4MSWC 2OTJV 2HP8A 4I0XB 4CH4A 3K57A 2WLHA 2QWPB 4JYYA 1VEWA 4PELA 1FFTB 3HKCA 4JI1B 1N4CA 1SQFA 3OR6C 4AQYB 4X62O 3ETQA 2GTSA 1VQ6V 4X66B 1ZX3A 4JASA 3T4DA 5L3EA 2CK3G 5LMNO 5H6RA 1AJNA 1N36B 4PDLA 2QE7G 1GKFA 1JPXA 3KG2A 1T5EA 5BY1A 1HP8A 2IJJA 3D8CA 2B9ZA 1NH2D 3HKEB 2IH1C 1I08A 1E1QG 4XDKA 3OFNG 1KMIZ 3DXRB 5JCOA 3SPGA 2NN4A 1QQCA 3GWOA 1G6UA 1NU1H 2EZOA 3SYAA 4WCEV 1FFXB 4X66O 2A06H 4LR3A 1WPXA 3ZRXA 5LA6B 1ZSPA 5H9CA 3K5NA 3HR0A 4O2BA 1YZBA 2X6AA 3AK3A 1ORQC 4ASUG 2B5UA 3ZRWB 3CCLV 3DC5A 4HYOA 4LCUC 5B5EZ 5B1BB 1BSMA 3E22B 3EXAA 3WB0A 4R50A 2PTMA 3BRCA 2R9AA 4ZBMA 1Q3EA 2LW1A 2ZM6O 1AI7A 1GRJA 1NTZH 1PPJH 4JI7B 1NR1A 4IT5A 3SYQA 1FKAO 4LF6O 2ZT9B 4FFBA 3K9SA 1PM9A 1KUQA 2E3CA 4I9WA 5JH7A 4FMTA 3K5OA 4QPJA 4DR4O 4LFBB 3H1IH 1Y76B 5E79Z 1Q5OA 4LF5B 1NQTA 3ABLC 1SA0A 4R8CA 5KHKA 1TUBA 2ZKOA 4JI0B 4GX2A 3U11A 2BTOA 2NNUA 5EIBD 2YXYA 2ITDC 1XMOB 1GM8A 4WFBV 3JCUZ 4ZOLA 2A3QA 5IDJA 2Z3YA 2DWDC 3QG5A 3ASNB 4N21A 3ZRVA 4KP4A 1SESA 2LQTA 2EIKB 5IYZB 4JZ2A 1R3LC 1K5QA 4B3RB
chains in the Genus database with same CATH topology
1THZA 3GB7C 3OEHG 2WAMA 3IGAC 1YTFD 3CYOA 3LNMB 4TT3G 3JD4A 3CCMV 1OHHG 3SPCA 3TCUA 1NBMG 1YJ9V 2DYRB 3EHBB 1S72V 1H8EG 5HFMA 3AEIA 2HVJC 3E86A 1M1KW 2IU0A 3ETGA 1YIJV 1MSWD 1VQ9V 1YTFB 3UM7A 3A0RA 5DM6V 4BIZA 3OMIB 1YHQV 1E79G 3ASNC 3NXSA 5KA5A 4JPRA 3RVZA 4TSFG 3CMAV 4PDMA 3CMEV 1S77D 2HJFC 3OMNB 1V54C 3E8GA 4LP8A 3LDDA 2WPDG 3X2QB 2EBOA 2WLKA 1GK9A 1RPOA 2KB1A 2IU3A 4DXWA 2ZXWC 1JJ2U 2QM7A 3OEEG 1AROP 4X8AA 3AG1C 5EK0A 3W7TA 1M90W 1FXKA 1OCCC 3LDCA 1QR9A 1OCRB 3RBZA 3OR7C 3ABMC 1FS0G 2ZXWB 1M57C 2QTOA 1I5XA 3AG4B 3CCEV 3LSSA 4PA7A 3JYCA 1F23A 3ZN1A 4GT1A 3FYEB 3F7YC 1V54B 3TK1A 5C93A 1NVPB 2XAJA 1CPYA 3ZMSA 3OGCC 2YEVA 2XNDG 3OUFA 4MVMA 2IH3C 4BW5A 3E35A 4UV8A 4UVAA 1J95A 2DYRC 1K34A 3JD3A 4UXNA 1SZTA 2D3OW 3ZMTA 4WF9V 4RQEA 4JYCA 3OUSA 5CBHA 2XOKG 2A79B 4MVQA 1R73A 3LUTB 5EBWC 4N23A 2F43G 2GHYA 2W0FC 4MVRA 2W6IG 2QM8A 2JEXA 1FXKB 1MABG 5B1NA 1KD1W 1VQKV 4FPPA 1KQSU 4MVSA 4RO2A 1AJQA 1R3KC 3CCVV 2V1DA 3W7SA 1F51A 3ASOB 4PA3A 1QLEB 2R9RB 3FYIB 4LBEC 3JD0A 1AR1B 1YITV 3ZMZA 3F5WC 3WG7C 3SYPA 2EILC 3ETEA 4X88A 2AHZA 1M57B 3QO5A 2IJKA 4JAUA 3ABUA 4JTCB 4WFHA 1K4DC 1EZJA 4MVOA 1PD3A 3K9AA 1YSCA 5CN0A 2JIZG 1H38A 2XAQA 1Y4MA 1RM1B 1JQ0A 4RUFA 5LHIA 5EBLC 1KKDA 1DF4A 1SRYA 3CPWU 2UXXA 5KA6A 2WLMA 2XAFA 4JTDB 4GX0A 3X2QC 4X89A 1QCEA 4YXWG 3E8FA 3ZCCA 2XAGA 3E8HA 2WLJA 5IYCO 3OW2U 1VQNV 5LGUA 1DTOA 3OMAB 1QVGU 3LDEA 3CC4V 2PI5A 2IJIA 3DTUB 2Y69B 3MD0A 2Q67A 3ZN0A 3ETDA 3SYCA 3ZIAG 1ROPA 5CA3A 1K73W 4JTAB 1K8AW 2HLDG 3CCSV 1PKXA 1VQLV 1S5HC 3FB6C 2OCCC 2MK3A 3W7WA 3ABTA 1OCOB 3I56V 1ZWIC 3E8BA 4PDRA 3ZRWA 1GMGA 1GTOA 1EBOA 2A9HA 5CBFA 1PNMA 1AI5A 1G4YB 3QNEA 1V55C 2ATKC 3T2MA 1PNKA 1KP2A 1W0JG 2WWWA 3BY6A 3MHHC 3CC7V 3CP1A 4J9YB 2X0LA 1S3JA 4XDLA 5BZBA 2DW4A 3R65A 4MT8A 2H94A 2AHYA 2B1IA 3SPHA 1OCZC 2NLJC 3ABLB 2WLIB 3CD6V 2BOBC 2DQ3A 1V55B 3VOUA 2WLLB 4P9OA 4BAYA 1DF5A 3FKSG 2IW5A 3E83A 4G28B 1MOFA 3JD2A 2GSMB 1SERA 1COWG 3FB7C 2ZDIC 1IXMA 3K3WA 4ZKIA 1VQ7V 2BOCC 4KFMA 4UVCA 3B77A 2WLIA 1YJNV 3ML0A 5L3CA 1W0KG 1M9NA 1M56C 3SJQC 4WFFA 3HPLC 2IJHA 3ABKB 3M99B 5IY5B 2DWEC 1K97A 3JD1A 2V7QG 4PA9A 2A0LA 4JAVA 4UV9A 1KECA 5DN6G 1VQMV 1W2BU 1BMFG 3CCUV 4WFGA 4KUMA 1Q86W 1BHAA 3DGEA 3OE7G 4RQFA 3EFFK 3JCZA 4QE7A 5KUKA 3CC2V 1RM1C 2Z5UA 3QO8A 5L3DA 2EIMB 5E1AC 2QEXV 4RUEA 2JJ2G 1VQ5V 2ZR3A 2ZDIA 1EFRG 1QR8A 2LFSA 1AI4A 1FXVA 4HZ3A 3MHSC 3HB3B 2P67A 4MW8A 3T1CA 4MTOA 2JEUA 3G71V 5HFLA 3IC7A 3K03A 4HAMA 1R3JC 3F7VC 1AI6A 3LSQA 2PI4A 5B1OA 1NVPD 3RW0A 1GO3F 3E89A 1KP3A 2HVKC 2UXNA 4P2ZA 4TWKA 5FL7G 1KC8W 2EIMC 4MW3A 1Q82W 5L3BA 5LGTA 4DO2A 1XL6A 2X7RB 1NR7A 2OCCB 4WFEA 2HR3A 1JOYA 4MS2A 5GW7A 3SPIA 2XAHA 2JJ1G 3G4SV 2X6CA 1K7DA 3AG2B 3QO7A 5IY5C 4BIUA 1DLBA 1K4CC 1P7BA 2ZD9A 4CZZA 1M56B 3AG4C 2OTLV 1K5SA 5B1BC 3K0DA 2M7WA 4MTXA 3H01A 3ABMB 5KUMA 5L3GA 4L87A 3ZJZA 1OCRC 4FK5C 1L1FA 2WSSG 4GX5A 1I5YA 2EZPA 1BHBA 2QKSA 4QIWF 2Y48A 5J9PC 1R3IC 3WFVA 3IFXA 5CBGA 4FIPC 2WLLA 3CCRV 4JGSA 1OCZB 2YSUB 1LNQA 2EILB 1F4NA 1WLEA 2HG5C 4MSWC 2OTJV 1GM7A 2P6JA 2YEVB 1OZ0A 5L3FA 2WLHA 2W6JG 3AG3C 2LFRA 3STZC 5LHHA 1FFTB 4PELA 3OR6C 1ENVA 4XDJA 2HKOA 1VQ6V 1QQHA 4JASA 3T4DA 5L3EA 2X6BA 3D36A 3CXCU 3T4ZA 2JK5C 2CK3G 2FTKA 1F4MA 4U7OA 1AJNA 2DYSC 4PDLA 5H6RA 3W7XA 2Q69A 5IYDO 2B1GA 2QE7G 2C2AA 1GKFA 1JPXA 4QPKA 4UVBA 3KG2A 2EINB 4J9ZB 2IJJA 5CMUA 1S76D 2JDIG 4P30A 1NH2D 3VBBA 1QBZA 2Y69C 2IH1C 3K06A 1HWYA 2DQ0A 3ABKC 3AG2C 1E1QG 4XDKA 4R7CA 3OFNG 1FXHA 5LHGA 1H2GA 4QE9A 4JF3A 1PL0A 3SPGA 1RPRA 3CCQV 3ZMVA 3GWOA 3W7UA 3SPJA 2EZOA 3SYAA 1MG1A 1PNLA 4WCEV 3AG1B 1R6NA 4G2KA 3PJSK 1WPXA 3TETA 1QVFU 3ZRXA 5B3SB 1NJIW 1S0VA 3WG7B 4QJFB 5H9CA 1NH2B 4PA6A 3G6EV 3I55V 3K79A 3E2EA 4GCZA 4F4LA 3B8MA 4H33A 4P9PA 4U7NA 1VQ8V 5B3SC 2X6AA 1K3EA 5B1AB 1P4RA 4XBFA 4GX1A 1GM9A 4PA4A 1ORQC 4PDVA 1K9MW 2EIJB 1FXKC 5EBMC 2P90A 2B5UA 4ASUG 4JYBA 4Z1MG 2QA4V 3ZRWB 1OCOC 5EC1C 3CCLV 4HYOA 4H37A 1YI2V 3UKMA 3RVYA 3K04A 4LCUC 1CEZA 5B1BB 4FJCC 1R6KA 2P7TC 4R50A 2EIJC 3CCJV 4QNHB 3BEHA 2EIKC 2K1EA 2ITCC 4ZBMA 2ZR2A 4CBCA 1E1RG 2XASA 1SETA 3FB8C 1AI7A 1TUEB 5B1AC 2OT5A 3B8NA 1UJWB 4I5SA 3OM3B 1QLNA 2Q6AA 1NR1A 3SYQA 1BL8A 5EC2C 2LP7A 3SYOA 4Q20A 2R9IA 5LGNA 1K33A 3STLC 4I9WA 4FMTA 1VQPV 4E2LA 4RAIA 3P30A 4R6ZA 3P32A 3FB5C 4QPJA 3K0GA 1XL4A 3OAAG 2DYSB 2HFEC 1CP9A 1OCCB 2Q68A 2WLNA 2H8PC 1AJPA 1G8MA 1Q81W 3ZMUA 1B6QA 1NQTA 3ABLC 1N8RW 4R8CA 1JCHA 2ZQMA 4GX2A 4OXSA 1VQOV 4MVZA 1Q7YW 2NNUA 3AG3B 4MTGA 2ITDC 5IYBO 1GM8A 4WFBV 1VQ4V 5H6QA 3D3IA 1H8HG 3ASOC 1QLEC 5IDJA 1Y66A 2Z3YA 1JX9A 1K92A 2DWDC 4LC1A 3ASNB 4MVUA 1JVMA 1NKDA 2EJRA 4MTFA 4N21A 3K08A 3ZRVA 4KP4A 4WFAV 1SESA 1YJWV 4UUJC 2EIKB 5LBQA 4G27B 1R3LC 4EKWA 1K5QA 3ZRSA 2EINC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NNU A;  2JEX A;  1R6K A;  1R6N A;  1TUE B;  1DTO A;  2JEU A;  1QQH A; 
#chains in the Genus database with same CATH topology
 1Q8I A;  2WAM A;  3IGA C;  4TT3 G;  4NB5 A;  3ZBH A;  1OHH G;  3SPC A;  3HKC B;  1S72 V;  1M4U A;  4JI6 B;  5HFM A;  3AEI A;  4FM2 A;  4UCS A;  2IU0 A;  4GZR B;  2P4K A;  3A0R A;  3OMI B;  3ASN C;  5KA5 A;  4ZI7 B;  2Y0I A;  3LDD A;  2EBO A;  1XMO O;  1N32 O;  2QM7 A;  4LFC B;  5BXZ A;  3RYI B;  2ZNI A;  1D5A A;  4X8A A;  3AG1 C;  3JAT A;  4OX9 O;  1QR9 A;  2UXB O;  4FFK A;  1VF6 C;  4JYA O;  3SJC C;  3JYC A;  1F23 A;  3O9O A;  3CRQ A;  1HNZ O;  3BFR A;  5J2T A;  1IBM B;  1QU7 A;  1Y74 A;  2ETN A;  3OGC C;  1HNW O;  3E35 A;  2F93 B;  3EVK A;  4UXN A;  3OUS A;  3CEI A;  4FLV A;  2CTQ A;  2A79 B;  2QGN A;  2XOK G;  1R73 A;  3AG7 A;  4MVQ A;  5IJ9 A;  3LUT B;  3ZHV A;  2F43 G;  3JAS A;  3LSU A;  1XNQ B;  1MAB G;  1KD1 W;  2CGN A;  4FPP A;  4MVS A;  4NTY A;  2WA4 A;  4RO2 A;  1F51 A;  3MDS A;  4BIO A;  1SKV A;  3KCY A;  2IJK A;  4JAU A;  1K4D C;  4B3S B;  3RYH B;  5JCO C;  1H38 A;  2JIZ G;  4LF4 B;  3TXS A;  5EBL C;  1JA8 A;  4Q6G A;  1KKD A;  3A8T A;  1YF2 A;  3GVM A;  5BMV B;  1BE3 H;  3CS5 A;  4W4K A;  2XAG A;  3E8H A;  4HBN A;  3ZHQ A;  3OTO O;  5LGU A;  1MSD A;  4PD4 F;  4NTW A;  3CC4 V;  4UCT A;  4ZOL B;  3QF7 A;  2Q67 A;  3APQ A;  2UXD O;  1ROP A;  4NKG B;  4JTA B;  5LA6 A;  1PKX A;  1VQL V;  1S5H C;  3K5M A;  3ABT A;  4NR1 A;  5JWP A;  4DR5 B;  1ZWI C;  4PDR A;  4EB6 B;  1EBO A;  2A9H A;  5CBF A;  4J42 A;  1PNM A;  3J80 N;  4UB6 Z;  2WWW A;  5KHJ A;  4YIO A;  3MHH C;  2LO1 A;  3CP1 A;  4DUY B;  3VQX A;  2X0L A;  3SDL A;  5BZB A;  4CC6 A;  4MT8 A;  1AIL A;  3SPH A;  1CXZ B;  5J2U A;  2BOB C;  2H3O A;  1U96 A;  1XRE A;  3RYH A;  2IW5 A;  4EFB A;  3A0H Z;  3JD2 A;  2RN9 A;  4RWU A;  1COW G;  2ZDI C;  1IXM A;  3K3W A;  5JJJ B;  2BOC C;  4UVC A;  3B77 A;  2VS0 A;  5CA0 B;  2JGU A;  3ML0 A;  3I5D A;  1W0K G;  2UXC B;  1M56 C;  2VWK A;  4ZHQ B;  4YJ2 B;  3ABK B;  5IY5 B;  4DUZ O;  4PA9 A;  2V7Q G;  2A0L A;  4UV9 A;  1IVS A;  1PV0 A;  3CJH B;  3CCU V;  1Q86 W;  1BHA A;  2G38 A;  3EFF K;  5LMU B;  3P3N A;  2DOS A;  5LOV A;  5E1A C;  2QEX V;  2JJ2 G;  1YXB A;  3RYC B;  2AW9 A;  1WB8 A;  1AI4 A;  2LFS A;  1FXV A;  3MHS C;  4KXR A;  4MW8 A;  1LUW A;  3N2K A;  2YUA A;  5HFL A;  4HAM A;  1KYO F;  3K03 A;  4DV0 B;  4K8Z A;  2F66 C;  1NVP D;  4IIJ A;  2PZS A;  3RT3 C;  3E89 A;  1KP3 A;  4GKK O;  1KC8 W;  4F6R A;  1XL6 A;  1N0J A;  1GN3 A;  4J11 A;  1FYJ A;  5GW7 A;  3THO A;  4D6T H;  3CHX A;  3QO7 A;  2F1M A;  1P7B A;  1HW7 A;  2Q8V A;  1XOU A;  2RDC A;  4TV9 A;  1NT2 B;  5BMV A;  5IE9 A;  1IUR A;  1VF5 B;  5IWA O;  1RSO B;  1K5S A;  1H2N A;  4JI2 O;  3ABM B;  5L3G A;  4L87 A;  2Q7H A;  1OCR C;  2JS3 A;  2EZP A;  5KX5 A;  2QKS A;  2QSA A;  5EIB C;  5CBG A;  2HEP A;  2VQE O;  2YSU B;  1R1B A;  5JVD A;  1F4N A;  4DR7 O;  3UT5 B;  2YEV B;  5IJ0 A;  4Z2W A;  1OZ0 A;  5LXT A;  4J41 A;  3L70 H;  1H2M A;  4J7Z A;  5LHH A;  1AR4 A;  5LMN B;  1ENV A;  1MNG A;  1QQH A;  3L9D A;  2X6B A;  3D36 A;  2HJD A;  4JI1 O;  4X1I A;  1F4M A;  2RCV A;  2KG7 B;  3W7X A;  2Q69 A;  5IYD O;  1UFI A;  3JAM N;  2EIN B;  4B3R O;  4LF4 O;  4FFB B;  4P30 A;  2ADQ B;  4NXN B;  1IBM O;  3VBB A;  1QBZ A;  3CXH F;  4FM0 A;  2Y69 C;  1XIL A;  3K06 A;  2DQ0 A;  3ABK C;  5FPO A;  3UCS C;  4R7C A;  5LHG A;  4QE9 A;  4JF3 A;  4NTX A;  2QWO B;  5K1P A;  1RPR A;  1HNX O;  3ZMV A;  1LUV A;  3SPJ A;  1BQZ A;  4NYK A;  5TIS Z;  2OYQ A;  1Q43 A;  1MG1 A;  3J7A U;  1PNL A;  2EX3 A;  3KKY A;  1R6N A;  4G2K A;  2E75 B;  3TET A;  4J10 A;  1NJI W;  3C90 A;  1ZL8 B;  3ZS8 C;  4GLX A;  3K79 A;  3E2E A;  2E74 B;  4U7N A;  5B3S C;  2RMK B;  5B1A B;  4XBF A;  4YJ3 A;  4HNA A;  2M6Y A;  2EIJ B;  4UCU A;  3F5T A;  3K04 A;  1EZV H;  4EEQ A;  1QNM A;  4FJC C;  4X1K A;  4BR6 A;  2EIJ C;  3CCJ V;  1HNX B;  3C3T A;  3BEH A;  2ITC C;  1L0L H;  5ITZ B;  1E1R G;  1VIB A;  4ICG A;  1SC5 B;  2YDE A;  5B1A C;  3B8N A;  1UJW B;  1KU9 A;  3RYC A;  2QJ1 A;  4K3A A;  3N2G A;  1G1X B;  3SYO A;  2UUA B;  4Q20 A;  2R9I A;  1K33 A;  4LF5 O;  4FZ1 A;  3FB5 C;  3K0G A;  1XL4 A;  1Q90 D;  3GWK C;  2HFE C;  3JAL A;  4D7T A;  4CC5 A;  2H8P C;  1VAR A;  3IJ4 A;  1Q81 W;  3ZMU A;  1JCH A;  1QHT A;  4OXS A;  1Q7Y W;  3AG3 B;  4X65 B;  3D3I A;  3ASO C;  2ZCE A;  4LC1 A;  4MTF A;  2R70 A;  4WFA V;  3SGI A;  5LBQ A;  1IX9 A;  2LGW A;  2EIN C;  1SQP H;  1B04 A;  3LNM B;  3JD4 A;  3BA8 A;  1NBM G;  1L8D A;  1YJ9 V;  2DYR B;  1H8E G;  1IZ3 A;  3E86 A;  1M1K W;  2PYJ A;  1MSW D;  5DM6 V;  2L6L A;  4LNU A;  4O2B B;  4U3J B;  4UFZ A;  4TSF G;  2HJF C;  3E8G A;  2WPD G;  5F2V O;  2WLK A;  3WU2 Z;  1GK9 A;  2Q9L A;  2IU3 A;  4DXW A;  1IXB A;  2ZXW C;  2LW7 A;  2Y4T A;  2YS8 A;  5EK0 A;  1M90 W;  1FJG B;  1AB3 A;  3FFQ A;  1FXK A;  1OCC C;  1OCR B;  2YID A;  4LF9 B;  3RBZ A;  3OR7 C;  5FPR A;  3ABM C;  1I7F A;  5H2F Z;  4TOI A;  2QTO A;  3CCE V;  1TVK B;  2UXB B;  4LF6 B;  3B2E E;  3TK1 A;  4IIJ B;  1NVP B;  2XAJ A;  2VQE B;  4YIP A;  2JRI A;  1RFY A;  2YEV A;  2XND G;  2XTA A;  2BSK A;  3M7M X;  5IJ0 B;  3O65 A;  1HDJ A;  1YEW A;  4CH6 A;  3JD3 A;  4WF9 V;  1Y76 A;  2PYL A;  2YIC A;  2N04 A;  5EBW C;  2GHY A;  2W6I G;  1XEQ A;  2QM8 A;  5B1N A;  1FXK B;  2N05 A;  5CB4 B;  3VQW A;  2DE0 X;  4DV5 B;  1AR1 B;  3F5W C;  2UUB B;  2EIL C;  3ETE A;  4X88 A;  5GTH Z;  1ZTE A;  1BGY H;  3BA9 A;  3DC6 A;  4MVO A;  2JS5 A;  1EN4 A;  5CN0 A;  2XAQ A;  3DXR A;  1DF4 A;  1ZAU A;  2UXX A;  4DUY O;  5KA6 A;  3S3X A;  4CS2 A;  4JTD B;  3HKD B;  3CRR A;  4GX0 A;  4X89 A;  1AVM A;  3E8F A;  4LWS A;  5IYC O;  3ZX6 A;  1VQN V;  2QKC A;  4LFA O;  2DJV A;  2NR5 A;  3OMA B;  3H1K H;  3DTU B;  3N27 A;  2YIA A;  3MD0 A;  4LF8 O;  2JGD A;  1GAX A;  1EN5 A;  3ETD A;  3ZIA G;  3HKD A;  2KG7 A;  2HLD G;  4DV4 B;  3CCS V;  5KAF Z;  3FB6 C;  2OCC C;  4W4L A;  1H2K A;  3W7W A;  2UXD B;  4I55 B;  3I56 V;  3E8B A;  1XQ8 A;  1GMG A;  1GTO A;  1G4Y B;  1GN4 A;  1I94 O;  2ATK C;  4PJ0 Z;  4TUY A;  1W0J G;  4HNA B;  4UCV A;  3JAR B;  3SJB C;  4J9Y B;  3ZHT A;  2QWN B;  1S3J A;  2DW4 A;  4I9Q A;  1N34 O;  4AHC A;  3ZHS A;  1OCZ C;  2NLJ C;  3ABL B;  4BW9 A;  1XNR B;  3RN4 A;  5ITZ A;  1O9G A;  4BAY A;  1RSO A;  4LF8 B;  5DEC A;  3FKS G;  2IM9 A;  4X64 O;  4ZKI A;  1VQ7 V;  2CAZ C;  1VMG A;  4DV2 B;  1YJN V;  2EUL A;  2ARH A;  2F4V B;  2GUZ B;  3TGU H;  4DR2 O;  3L72 H;  2QTS A;  1KKC A;  3M99 B;  2DWE C;  2UXC O;  5EZY A;  4JAV A;  2V4D A;  4B3S O;  1PL4 A;  1BMF G;  4EFE A;  3DGE A;  4RQF A;  3JCZ A;  3LNN A;  5KUK A;  2YIB A;  1N34 B;  2Z5U A;  3QO8 A;  3G6B A;  5L3D A;  2WA3 A;  5LMU O;  4FM1 A;  3OTO B;  2ZDI A;  1J5E B;  1EFR G;  5D5Q A;  1MZF A;  2BTQ A;  4LH6 A;  4HZ3 A;  2O57 A;  3T1C A;  2ZE8 A;  2DN9 A;  4MTO A;  4LWS B;  3BPZ A;  3F7V C;  3LSQ A;  3VQV A;  4JI4 B;  1GO3 F;  4DR5 O;  2YI9 A;  2HVK C;  2EIM C;  5JQG A;  5LGT A;  4K0K B;  4DR3 O;  2X7R B;  2OCC B;  2BSK B;  3SPI A;  4I0X A;  3C3S A;  4ZI7 A;  4Z1V A;  4DRX A;  4WBN A;  2Q7G A;  2BTQ B;  5IWA B;  3K5L A;  1K4C C;  3HKB B;  4YJ2 A;  2OCH A;  4YY3 O;  3VQY A;  3KCX A;  4CZZ A;  1YVW A;  3UO2 A;  5KUM A;  3T1H B;  3ZJZ A;  4QIW F;  4X1Y B;  3K59 A;  5KX5 B;  2ZIN A;  2XUM A;  2EIL B;  1L0N H;  3T1Y O;  2W6J G;  1U97 A;  3STZ C;  4AI8 A;  2LFR A;  2IBZ H;  2F23 A;  1TVK A;  1WPB A;  2HKO A;  3UQ8 A;  2OIE A;  3CXC U;  2UU9 B;  2JK5 C;  2FTK A;  2DYS C;  1Z5W A;  1BCC H;  4QPK A;  4UVB A;  2QM4 A;  4TV8 B;  3R66 A;  2JDI G;  1GH6 A;  2HHH O;  5H5N A;  2N74 A;  2GBO A;  1HWY A;  4DRX B;  5LXT B;  3AG2 C;  4JI3 B;  5B66 Z;  5JJN B;  1H2G A;  3AK1 A;  1URF A;  1P49 A;  2PGG A;  1PL0 A;  1WP8 A;  4DW0 A;  3RFR A;  1DGS A;  4QGP A;  1AP6 A;  2FL4 A;  5FNV A;  2ZE7 A;  1QVF U;  2MW2 B;  3WG7 B;  4LF9 O;  1JJO A;  3G6E V;  3OT7 A;  4GCZ A;  3L74 H;  4GKK B;  1K3E A;  1P4R A;  4TUY B;  4GX1 A;  1GM9 A;  4X1K B;  4PDV A;  1LR1 A;  2P90 A;  4O4H B;  1OCO C;  4H37 A;  3UKM A;  3RVY A;  1VF6 A;  2P7T C;  2P06 A;  1A32 A;  1N33 O;  2K1E A;  4CBC A;  2ZR2 A;  3L73 H;  2XAS A;  1SET A;  4O4J A;  3U0Z A;  2OT5 A;  1NS1 A;  3OM3 B;  4I5S A;  1QLN A;  4O4I A;  5J2T B;  4B3M O;  1SQV H;  5LGN A;  1VQP V;  4RAI A;  3P30 A;  3HKE A;  4UCO A;  2ILM A;  4R6Z A;  3P32 A;  2Q4P A;  2DYS B;  2AGA A;  2RNB A;  3E22 A;  1EN6 A;  2Q68 A;  2WLN A;  1G8M A;  2E76 B;  1B6Q A;  1N8R W;  2ZQM A;  1VQO V;  3CB2 A;  4MTG A;  5IYB O;  4DW1 A;  1VQ4 V;  2FB5 A;  5H6Q A;  4H13 B;  4GUN A;  1QLE C;  4FLW A;  3JAW A;  1Y66 A;  1JX9 A;  3JAW B;  1JVM A;  1NKD A;  4X65 O;  3K08 A;  2ZM6 B;  4I50 B;  1YJW V;  4UUJ C;  2YI8 A;  1YDX A;  4G27 B;  3RVZ A;  4MVR A;  3JAR A;  1THZ A;  1XUQ A;  1WNS A;  3OEH G;  1FPO A;  4GYC B;  4B3T B;  3CCM V;  4NXN O;  3Q4H B;  2XHB A;  3EHB B;  2Z0A A;  2HVJ C;  3ETG A;  2ODM A;  5J2U B;  2XT9 A;  1YTF B;  4BIZ A;  1E79 G;  3NXS A;  4JPR A;  5DED A;  3OMN B;  1V54 C;  3JSN A;  4LP8 A;  2LJ2 A;  5JVD B;  1RPO A;  2KB1 A;  3D3Q A;  1WAZ A;  1M5I A;  3OEE G;  2CH7 B;  2PUS A;  1GN2 A;  1WN7 A;  3LDC A;  2AZ2 A;  1FS0 G;  4YHH B;  1IBK O;  1I5X A;  3LSS A;  4PA7 A;  5KHG A;  4J80 A;  1HR0 O;  4GT1 A;  3FYE B;  3F7Y C;  4A5U B;  5C93 A;  1ZL8 A;  2FYU H;  3BAA A;  3ZMS A;  4LNU B;  1K34 A;  1PP9 H;  4X20 A;  2D3O W;  4RQE A;  4JYC A;  1Z2G A;  4DYL A;  5EYP B;  2JEX A;  5IYZ A;  5C8Y B;  5KHI A;  1XMQ B;  2Q7E A;  1AJQ A;  2V1D A;  3W7S A;  1P84 F;  4PA3 A;  3FYI B;  3JD0 A;  1YIT V;  4JI8 B;  3WG7 C;  3SYP A;  1Q6H A;  2AHZ A;  1M57 B;  4JTC B;  1EZJ A;  3H1J H;  1S5J A;  1PD3 A;  2KQX A;  3FAV A;  3K9A A;  4E4E A;  4AIL C;  1YSC A;  3G80 A;  1I94 B;  1RM1 B;  4RUF A;  4CH5 A;  5JJE B;  2QKA A;  1JFF A;  2A7W A;  1N0N A;  2XAF A;  3X2Q C;  2YXH A;  1QCE A;  4YXW G;  4DV1 B;  2WLJ A;  1DTO A;  1QVG U;  3KZI Z;  2IJI A;  2P22 C;  4AQY O;  1WP7 A;  1XNR O;  3ZN0 A;  2E5L O;  5CA3 A;  1K73 W;  1K8A W;  2Y0P A;  1NI8 A;  4DV7 B;  1GN6 A;  1OCO B;  4I7Z B;  1WA8 B;  5KAI Z;  2F4V O;  3QNE A;  1V55 C;  2HHH B;  2AZ0 A;  1BQ0 A;  3RYI A;  3T2M A;  1PNK A;  4YJ3 B;  4B7K A;  4XDL A;  2JVD A;  4IL6 Z;  3R65 A;  1XHX A;  2ZE6 A;  2AHY A;  2B1I A;  4DV1 O;  3CRC A;  4U3F H;  5LL6 Y;  3CD6 V;  4OGQ B;  1S5L Z;  3E83 A;  1BS3 A;  4X62 B;  1SER A;  3FB7 C;  3T1H O;  1D5N A;  4KFM A;  1NZ6 A;  5L3C A;  1X4T A;  2R72 A;  1M9N A;  5BR8 O;  4WFF A;  1JMK C;  3HPL C;  2IJH A;  4O4I B;  4BWA A;  3JAK B;  4JI4 O;  1K97 A;  3JD1 A;  1KEC A;  4WFG A;  5EYP A;  4ABM A;  5FNV B;  3OE7 G;  4F6E A;  2CE4 A;  1Y6X A;  4QE7 A;  4NXM B;  2EIM B;  4CH3 A;  4RUE A;  4H44 B;  3SR2 C;  3FAV B;  4JV5 B;  2YC0 A;  4I50 A;  2UUB O;  1SF9 A;  1QR8 A;  2RQ6 A;  2UUA O;  4OX9 B;  3WB2 A;  3HB3 B;  2P67 A;  5CB4 A;  1V9P A;  4YHH O;  2JEU A;  1NTM H;  3CSX A;  2P5O A;  3IC7 A;  5LP6 C;  1AI6 A;  2PI4 A;  3BHP A;  3MAQ A;  3G67 A;  1US6 A;  2KKW A;  3CRM A;  1WA8 A;  5FL7 G;  4DV6 O;  4MW3 A;  1Q82 W;  5L3B A;  4DO2 A;  4WFE A;  2HR3 A;  1JOY A;  4MS2 A;  1ZUQ A;  4I4T B;  3G4S V;  2X6C A;  1K7D A;  3FX7 A;  1DLB A;  3CRA A;  1SQX H;  2ZD9 A;  3DSQ A;  4K8X A;  2UU9 O;  3AG4 C;  4JAA A;  2OTL V;  5B1B C;  3JAL B;  3OD4 A;  4MTX A;  4B3T O;  3H01 A;  5CA1 A;  2YIB D;  4DR1 O;  2EJ7 A;  1L1F A;  2ZNJ A;  4GX5 A;  1I5Y A;  4O4H A;  3CJH A;  3ZHR A;  2Y48 A;  4FLX A;  3B40 A;  3FD9 A;  3A0B Z;  3IFX A;  4FIP C;  2WLL A;  4IYI A;  4JGS A;  3N2G B;  1OCZ B;  4DV6 B;  4DR6 B;  1XNQ O;  5LP6 B;  2HG5 C;  1RP3 B;  3UT5 A;  1Y74 B;  1ZLZ A;  1GM7 A;  3A2F A;  3HKB A;  4CS3 A;  3J81 N;  2P6J A;  5EZY B;  3RYF A;  5L3F A;  2BCC H;  3AG3 C;  2QWR B;  2ZIO A;  3L71 H;  4XDJ A;  4YY3 B;  4DV2 O;  3K58 A;  3T4Z A;  3Q4H A;  4X1Y A;  4U7O A;  1BZK A;  3IC9 A;  2B1G A;  2C2A A;  4J9Z B;  5CMU A;  2ZIM A;  3BVO A;  1S76 D;  4OPH A;  1IBL B;  5IT9 N;  4J7K A;  4JI5 O;  3U10 A;  1FXH A;  1JFF B;  2PF4 E;  4EB6 A;  1P7G A;  4GKJ O;  3JAS B;  1WB7 A;  4DR3 B;  3CCQ V;  3W7U A;  1AP5 A;  2ZE5 A;  1XMQ O;  3AK2 A;  3AG1 B;  4LFC O;  4IYH A;  3PJS K;  3QVN A;  5B3S B;  1S0V A;  1FAF A;  4QJF B;  1NH2 B;  4PA6 A;  3H1H H;  3I55 V;  4F4L A;  2PY5 A;  1VF7 A;  1BT8 A;  3B8M A;  1IBK B;  4H33 A;  4P9P A;  1VQ8 V;  1TGO A;  5BR8 B;  4X9Q A;  3ZED A;  4DK0 A;  4DR4 B;  2CTW A;  4PA4 A;  4DV3 O;  1K9M W;  1H2S B;  1FXK C;  5EBM C;  4Z1M G;  4JYB A;  2QA4 V;  5EC1 C;  1H2L A;  1FFX A;  4LF7 O;  1YI2 V;  1CEZ A;  1R6K A;  3UO3 A;  4FZ0 A;  4QNH B;  2EIK C;  1YCI A;  3FB8 C;  1IDS A;  1TUE B;  3P3P A;  1J5E O;  4TQF A;  1B3Q A;  2Q6A A;  3CX5 F;  4WBN B;  1BL8 A;  3WB1 A;  5EC2 C;  2LP7 A;  4TV8 A;  3STL C;  4E2L A;  1UPG A;  3M8A A;  4X64 B;  3OAA G;  1CP9 A;  1OCC B;  4TQD A;  5CA0 A;  1AJP A;  3D36 C;  1XHZ A;  4DR2 B;  4MVZ A;  1TAE A;  2OIG A;  4JV5 O;  3S3W A;  3APO A;  1H8H G;  2FKX A;  4OPA A;  2VRZ A;  4K35 A;  3OTF A;  4H0L B;  1K92 A;  4MVU A;  2EJR A;  5A2Q N;  3JAT B;  1W59 A;  5LP6 A;  4EKW A;  3ZRS A;  2FML A;  3GB7 C;  1YTF D;  3CYO A;  3BCC H;  1KBH A;  2UUC B;  1SZX A;  4PI0 A;  3TCU A;  5KLV H;  4UB8 Z;  2Q73 A;  1HNZ B;  1YIJ V;  4FLU A;  5LYJ A;  1VQ9 V;  3UM7 A;  3N2K B;  1DK1 A;  2QR4 A;  3TJT A;  4DK1 A;  1YHQ V;  2JGD B;  3NR7 A;  3CMA V;  4PDM A;  3CME V;  1S77 D;  4CS4 A;  3X2Q B;  3T1Y B;  2Q0A A;  2W0X A;  4NXM O;  1JJ2 U;  1NTK H;  4K0K O;  1ARO P;  3B4S A;  3W7T A;  1X59 A;  4UCR A;  4JI2 B;  2ZXW B;  3CE2 A;  1M57 C;  4C7U A;  3AG4 B;  2UUC O;  3ZN1 A;  1V54 B;  2K9P A;  2BE3 A;  2LGQ A;  1XDC A;  1CPY A;  4O4J B;  2CGO A;  2L35 A;  1TUB B;  1OV9 A;  1VP7 A;  2GTA A;  3OUF A;  4MVM A;  2IH3 C;  4BW5 A;  2AXT Z;  4UV8 A;  4UVA A;  1J95 A;  1Q6U A;  2DYR C;  1SZT A;  3ZMT A;  3H1L H;  3SJA C;  1N33 B;  1SQQ H;  1Y67 A;  5CBH A;  1Q6I A;  5JH7 B;  4N23 A;  2W0F C;  4PHZ A;  4LFA B;  5A9G A;  1MMM A;  3H9V A;  1VQK V;  2KSD A;  1KQS U;  3ICX A;  1R3K C;  3CCV V;  2F95 B;  4FLY A;  3ASO B;  4JYA B;  1QLE B;  2GUZ A;  2R9R B;  4LBE C;  3RWR D;  3TXQ A;  5C8Y A;  3ZMZ A;  1WJZ A;  1IBL O;  3JAK A;  1SS3 A;  3QO5 A;  4DV7 O;  3ABU A;  1SA0 B;  4O4L A;  3QTC A;  4WFH A;  1OJH A;  4L8J A;  2GDS A;  1HNW B;  4JI8 O;  4GKJ B;  4JI6 O;  2P4V A;  4DV3 B;  1Y4M A;  2VQF B;  1JQ0 A;  5K1X A;  5LOV B;  5LHI A;  1XI1 A;  1SRY A;  3CPW U;  2WLM A;  4PV1 B;  1B06 A;  5D5P A;  3ZCC A;  3OW2 U;  3LDE A;  1N32 B;  2PI5 A;  4B08 A;  2Y69 B;  4U3J A;  3SYC A;  4D7S A;  1N36 O;  5KMG A;  4DV5 O;  4LH7 A;  4B3M B;  4PI2 A;  4I55 A;  2MK3 A;  3L75 H;  2E5L B;  3RGB A;  3ZRW A;  1R6T A;  3JSL A;  1AI5 A;  4KHP O;  1Z5V A;  4B7E A;  4LF7 B;  5GON A;  1KP2 A;  4DR1 B;  1KB9 F;  3BY6 A;  3CC7 V;  3B09 A;  1XBL A;  1D2D A;  4FLT A;  5GON B;  2H94 A;  4IGG A;  1FD9 A;  5LYJ B;  2VWJ A;  2Q0O C;  2WLI B;  4O2A B;  2DQ3 A;  3ZHU A;  5IJ9 B;  1V55 B;  3VOU A;  2WLL B;  4P9O A;  1M93 A;  1SQB H;  1DF5 A;  4G28 B;  1MOF A;  4KL1 A;  2GSM B;  1HR0 B;  4DV4 O;  2DMX A;  2WLI A;  4O2A A;  1AR5 A;  3SJQ C;  4FLZ A;  1EM1 A;  2CUG A;  4KHP B;  4DR6 O;  1I0H A;  4DR7 B;  5DN6 G;  2CDY A;  1VQM V;  1W2B U;  4LFB O;  4KUM A;  4NVP A;  3CC2 V;  1RM1 C;  4ZIB A;  4O4L B;  1VQ5 V;  2ZR3 A;  2QWQ B;  4JI7 O;  2D2C B;  2QDO A;  4IHJ A;  3OGI B;  4JZG A;  2CTR A;  4TV9 B;  3RYF B;  3G71 V;  3IAY A;  1MZE A;  4J7J A;  1R3J C;  3PN1 A;  4ZHQ A;  5B1O A;  4DUZ B;  2GV9 A;  2YXL A;  3RW0 A;  2RJZ A;  2ADP A;  2UXN A;  1JR9 A;  4P2Z A;  4JI0 O;  1O9H A;  4TWK A;  5JQG B;  2OWO A;  1F7Y A;  5FLX N;  2CH7 A;  1NR7 A;  4F6R B;  5GTI Z;  1FJG O;  4FVM A;  3BAB A;  2Y4U A;  2XAH A;  2JJ1 G;  3AG2 B;  1SQG A;  2CTP A;  5KHH A;  4IHJ B;  4BIU A;  5IY5 C;  4I4T A;  5AG2 A;  1M56 B;  4DV0 O;  3K0D A;  2M7W A;  1MA1 A;  2Q5Z A;  1TA8 A;  4FK5 C;  2WSS G;  1BHB A;  4X1I B;  5J9P C;  1R3I C;  4JI3 O;  3WFV A;  5KMG B;  3CCR V;  4X20 B;  5CA1 B;  1LNQ A;  1WLE A;  4JI5 B;  3CWB H;  2VQF O;  4MSW C;  2OTJ V;  2HP8 A;  4I0X B;  4CH4 A;  3K57 A;  2WLH A;  2QWP B;  4JYY A;  1VEW A;  4PEL A;  1FFT B;  3HKC A;  4JI1 B;  1N4C A;  1SQF A;  3OR6 C;  4AQY B;  4X62 O;  3ETQ A;  2GTS A;  1VQ6 V;  4X66 B;  1ZX3 A;  4JAS A;  3T4D A;  5L3E A;  2CK3 G;  5LMN O;  5H6R A;  1AJN A;  1N36 B;  4PDL A;  2QE7 G;  1GKF A;  1JPX A;  3KG2 A;  1T5E A;  5BY1 A;  1HP8 A;  2IJJ A;  3D8C A;  2B9Z A;  1NH2 D;  3HKE B;  2IH1 C;  1I08 A;  1E1Q G;  4XDK A;  3OFN G;  1KMI Z;  3DXR B;  5JCO A;  3SPG A;  2NN4 A;  1QQC A;  3GWO A;  1G6U A;  1NU1 H;  2EZO A;  3SYA A;  4WCE V;  1FFX B;  4X66 O;  2A06 H;  4LR3 A;  1WPX A;  3ZRX A;  5LA6 B;  1ZSP A;  5H9C A;  3K5N A;  3HR0 A;  4O2B A;  1YZB A;  2X6A A;  3AK3 A;  1ORQ C;  4ASU G;  2B5U A;  3ZRW B;  3CCL V;  3DC5 A;  4HYO A;  4LCU C;  5B5E Z;  5B1B B;  1BSM A;  3E22 B;  3EXA A;  3WB0 A;  4R50 A;  2PTM A;  3BRC A;  2R9A A;  4ZBM A;  1Q3E A;  2LW1 A;  2ZM6 O;  1AI7 A;  1GRJ A;  1NTZ H;  1PPJ H;  4JI7 B;  1NR1 A;  4IT5 A;  3SYQ A;  1FKA O;  4LF6 O;  2ZT9 B;  4FFB A;  3K9S A;  1PM9 A;  1KUQ A;  2E3C A;  4I9W A;  5JH7 A;  4FMT A;  3K5O A;  4QPJ A;  4DR4 O;  4LFB B;  3H1I H;  1Y76 B;  5E79 Z;  1Q5O A;  4LF5 B;  1NQT A;  3ABL C;  1SA0 A;  4R8C A;  5KHK A;  1TUB A;  2ZKO A;  4JI0 B;  4GX2 A;  3U11 A;  2BTO A;  2NNU A;  5EIB D;  2YXY A;  2ITD C;  1XMO B;  1GM8 A;  4WFB V;  3JCU Z;  4ZOL A;  2A3Q A;  5IDJ A;  2Z3Y A;  2DWD C;  3QG5 A;  3ASN B;  4N21 A;  3ZRV A;  4KP4 A;  1SES A;  2LQT A;  2EIK B;  5IYZ B;  4JZ2 A;  1R3L C;  1K5Q A;  4B3R B; 
#chains in the Genus database with same CATH homology
 1THZ A;  3GB7 C;  3OEH G;  2WAM A;  3IGA C;  1YTF D;  3CYO A;  3LNM B;  4TT3 G;  3JD4 A;  3CCM V;  1OHH G;  3SPC A;  3TCU A;  1NBM G;  1YJ9 V;  2DYR B;  3EHB B;  1S72 V;  1H8E G;  5HFM A;  3AEI A;  2HVJ C;  3E86 A;  1M1K W;  2IU0 A;  3ETG A;  1YIJ V;  1MSW D;  1VQ9 V;  1YTF B;  3UM7 A;  3A0R A;  5DM6 V;  4BIZ A;  3OMI B;  1YHQ V;  1E79 G;  3ASN C;  3NXS A;  5KA5 A;  4JPR A;  3RVZ A;  4TSF G;  3CMA V;  4PDM A;  3CME V;  1S77 D;  2HJF C;  3OMN B;  1V54 C;  3E8G A;  4LP8 A;  3LDD A;  2WPD G;  3X2Q B;  2EBO A;  2WLK A;  1GK9 A;  1RPO A;  2KB1 A;  2IU3 A;  4DXW A;  2ZXW C;  1JJ2 U;  2QM7 A;  3OEE G;  1ARO P;  4X8A A;  3AG1 C;  5EK0 A;  3W7T A;  1M90 W;  1FXK A;  1OCC C;  3LDC A;  1QR9 A;  1OCR B;  3RBZ A;  3OR7 C;  3ABM C;  1FS0 G;  2ZXW B;  1M57 C;  2QTO A;  1I5X A;  3AG4 B;  3CCE V;  3LSS A;  4PA7 A;  3JYC A;  1F23 A;  3ZN1 A;  4GT1 A;  3FYE B;  3F7Y C;  1V54 B;  3TK1 A;  5C93 A;  1NVP B;  2XAJ A;  1CPY A;  3ZMS A;  3OGC C;  2YEV A;  2XND G;  3OUF A;  4MVM A;  2IH3 C;  4BW5 A;  3E35 A;  4UV8 A;  4UVA A;  1J95 A;  2DYR C;  1K34 A;  3JD3 A;  4UXN A;  1SZT A;  2D3O W;  3ZMT A;  4WF9 V;  4RQE A;  4JYC A;  3OUS A;  5CBH A;  2XOK G;  2A79 B;  4MVQ A;  1R73 A;  3LUT B;  5EBW C;  4N23 A;  2F43 G;  2GHY A;  2W0F C;  4MVR A;  2W6I G;  2QM8 A;  2JEX A;  1FXK B;  1MAB G;  5B1N A;  1KD1 W;  1VQK V;  4FPP A;  1KQS U;  4MVS A;  4RO2 A;  1AJQ A;  1R3K C;  3CCV V;  2V1D A;  3W7S A;  1F51 A;  3ASO B;  4PA3 A;  1QLE B;  2R9R B;  3FYI B;  4LBE C;  3JD0 A;  1AR1 B;  1YIT V;  3ZMZ A;  3F5W C;  3WG7 C;  3SYP A;  2EIL C;  3ETE A;  4X88 A;  2AHZ A;  1M57 B;  3QO5 A;  2IJK A;  4JAU A;  3ABU A;  4JTC B;  4WFH A;  1K4D C;  1EZJ A;  4MVO A;  1PD3 A;  3K9A A;  1YSC A;  5CN0 A;  2JIZ G;  1H38 A;  2XAQ A;  1Y4M A;  1RM1 B;  1JQ0 A;  4RUF A;  5LHI A;  5EBL C;  1KKD A;  1DF4 A;  1SRY A;  3CPW U;  2UXX A;  5KA6 A;  2WLM A;  2XAF A;  4JTD B;  4GX0 A;  3X2Q C;  4X89 A;  1QCE A;  4YXW G;  3E8F A;  3ZCC A;  2XAG A;  3E8H A;  2WLJ A;  5IYC O;  3OW2 U;  1VQN V;  5LGU A;  1DTO A;  3OMA B;  1QVG U;  3LDE A;  3CC4 V;  2PI5 A;  2IJI A;  3DTU B;  2Y69 B;  3MD0 A;  2Q67 A;  3ZN0 A;  3ETD A;  3SYC A;  3ZIA G;  1ROP A;  5CA3 A;  1K73 W;  4JTA B;  1K8A W;  2HLD G;  3CCS V;  1PKX A;  1VQL V;  1S5H C;  3FB6 C;  2OCC C;  2MK3 A;  3W7W A;  3ABT A;  1OCO B;  3I56 V;  1ZWI C;  3E8B A;  4PDR A;  3ZRW A;  1GMG A;  1GTO A;  1EBO A;  2A9H A;  5CBF A;  1PNM A;  1AI5 A;  1G4Y B;  3QNE A;  1V55 C;  2ATK C;  3T2M A;  1PNK A;  1KP2 A;  1W0J G;  2WWW A;  3BY6 A;  3MHH C;  3CC7 V;  3CP1 A;  4J9Y B;  2X0L A;  1S3J A;  4XDL A;  5BZB A;  2DW4 A;  3R65 A;  4MT8 A;  2H94 A;  2AHY A;  2B1I A;  3SPH A;  1OCZ C;  2NLJ C;  3ABL B;  2WLI B;  3CD6 V;  2BOB C;  2DQ3 A;  1V55 B;  3VOU A;  2WLL B;  4P9O A;  4BAY A;  1DF5 A;  3FKS G;  2IW5 A;  3E83 A;  4G28 B;  1MOF A;  3JD2 A;  2GSM B;  1SER A;  1COW G;  3FB7 C;  2ZDI C;  1IXM A;  3K3W A;  4ZKI A;  1VQ7 V;  2BOC C;  4KFM A;  4UVC A;  3B77 A;  2WLI A;  1YJN V;  3ML0 A;  5L3C A;  1W0K G;  1M9N A;  1M56 C;  3SJQ C;  4WFF A;  3HPL C;  2IJH A;  3ABK B;  3M99 B;  5IY5 B;  2DWE C;  1K97 A;  3JD1 A;  2V7Q G;  4PA9 A;  2A0L A;  4JAV A;  4UV9 A;  1KEC A;  5DN6 G;  1VQM V;  1W2B U;  1BMF G;  3CCU V;  4WFG A;  4KUM A;  1Q86 W;  1BHA A;  3DGE A;  3OE7 G;  4RQF A;  3EFF K;  3JCZ A;  4QE7 A;  5KUK A;  3CC2 V;  1RM1 C;  2Z5U A;  3QO8 A;  5L3D A;  2EIM B;  5E1A C;  2QEX V;  4RUE A;  2JJ2 G;  1VQ5 V;  2ZR3 A;  2ZDI A;  1EFR G;  1QR8 A;  2LFS A;  1AI4 A;  1FXV A;  4HZ3 A;  3MHS C;  3HB3 B;  2P67 A;  4MW8 A;  3T1C A;  4MTO A;  2JEU A;  3G71 V;  5HFL A;  3IC7 A;  3K03 A;  4HAM A;  1R3J C;  3F7V C;  1AI6 A;  3LSQ A;  2PI4 A;  5B1O A;  1NVP D;  3RW0 A;  1GO3 F;  3E89 A;  1KP3 A;  2HVK C;  2UXN A;  4P2Z A;  4TWK A;  5FL7 G;  1KC8 W;  2EIM C;  4MW3 A;  1Q82 W;  5L3B A;  5LGT A;  4DO2 A;  1XL6 A;  2X7R B;  1NR7 A;  2OCC B;  4WFE A;  2HR3 A;  1JOY A;  4MS2 A;  5GW7 A;  3SPI A;  2XAH A;  2JJ1 G;  3G4S V;  2X6C A;  1K7D A;  3AG2 B;  3QO7 A;  5IY5 C;  4BIU A;  1DLB A;  1K4C C;  1P7B A;  2ZD9 A;  4CZZ A;  1M56 B;  3AG4 C;  2OTL V;  1K5S A;  5B1B C;  3K0D A;  2M7W A;  4MTX A;  3H01 A;  3ABM B;  5KUM A;  5L3G A;  4L87 A;  3ZJZ A;  1OCR C;  4FK5 C;  1L1F A;  2WSS G;  4GX5 A;  1I5Y A;  2EZP A;  1BHB A;  2QKS A;  4QIW F;  2Y48 A;  5J9P C;  1R3I C;  3WFV A;  3IFX A;  5CBG A;  4FIP C;  2WLL A;  3CCR V;  4JGS A;  1OCZ B;  2YSU B;  1LNQ A;  2EIL B;  1F4N A;  1WLE A;  2HG5 C;  4MSW C;  2OTJ V;  1GM7 A;  2P6J A;  2YEV B;  1OZ0 A;  5L3F A;  2WLH A;  2W6J G;  3AG3 C;  2LFR A;  3STZ C;  5LHH A;  1FFT B;  4PEL A;  3OR6 C;  1ENV A;  4XDJ A;  2HKO A;  1VQ6 V;  1QQH A;  4JAS A;  3T4D A;  5L3E A;  2X6B A;  3D36 A;  3CXC U;  3T4Z A;  2JK5 C;  2CK3 G;  2FTK A;  1F4M A;  4U7O A;  1AJN A;  2DYS C;  4PDL A;  5H6R A;  3W7X A;  2Q69 A;  5IYD O;  2B1G A;  2QE7 G;  2C2A A;  1GKF A;  1JPX A;  4QPK A;  4UVB A;  3KG2 A;  2EIN B;  4J9Z B;  2IJJ A;  5CMU A;  1S76 D;  2JDI G;  4P30 A;  1NH2 D;  3VBB A;  1QBZ A;  2Y69 C;  2IH1 C;  3K06 A;  1HWY A;  2DQ0 A;  3ABK C;  3AG2 C;  1E1Q G;  4XDK A;  4R7C A;  3OFN G;  1FXH A;  5LHG A;  1H2G A;  4QE9 A;  4JF3 A;  1PL0 A;  3SPG A;  1RPR A;  3CCQ V;  3ZMV A;  3GWO A;  3W7U A;  3SPJ A;  2EZO A;  3SYA A;  1MG1 A;  1PNL A;  4WCE V;  3AG1 B;  1R6N A;  4G2K A;  3PJS K;  1WPX A;  3TET A;  1QVF U;  3ZRX A;  5B3S B;  1NJI W;  1S0V A;  3WG7 B;  4QJF B;  5H9C A;  1NH2 B;  4PA6 A;  3G6E V;  3I55 V;  3K79 A;  3E2E A;  4GCZ A;  4F4L A;  3B8M A;  4H33 A;  4P9P A;  4U7N A;  1VQ8 V;  5B3S C;  2X6A A;  1K3E A;  5B1A B;  1P4R A;  4XBF A;  4GX1 A;  1GM9 A;  4PA4 A;  1ORQ C;  4PDV A;  1K9M W;  2EIJ B;  1FXK C;  5EBM C;  2P90 A;  2B5U A;  4ASU G;  4JYB A;  4Z1M G;  2QA4 V;  3ZRW B;  1OCO C;  5EC1 C;  3CCL V;  4HYO A;  4H37 A;  1YI2 V;  3UKM A;  3RVY A;  3K04 A;  4LCU C;  1CEZ A;  5B1B B;  4FJC C;  1R6K A;  2P7T C;  4R50 A;  2EIJ C;  3CCJ V;  4QNH B;  3BEH A;  2EIK C;  2K1E A;  2ITC C;  4ZBM A;  2ZR2 A;  4CBC A;  1E1R G;  2XAS A;  1SET A;  3FB8 C;  1AI7 A;  1TUE B;  5B1A C;  2OT5 A;  3B8N A;  1UJW B;  4I5S A;  3OM3 B;  1QLN A;  2Q6A A;  1NR1 A;  3SYQ A;  1BL8 A;  5EC2 C;  2LP7 A;  3SYO A;  4Q20 A;  2R9I A;  5LGN A;  1K33 A;  3STL C;  4I9W A;  4FMT A;  1VQP V;  4E2L A;  4RAI A;  3P30 A;  4R6Z A;  3P32 A;  3FB5 C;  4QPJ A;  3K0G A;  1XL4 A;  3OAA G;  2DYS B;  2HFE C;  1CP9 A;  1OCC B;  2Q68 A;  2WLN A;  2H8P C;  1AJP A;  1G8M A;  1Q81 W;  3ZMU A;  1B6Q A;  1NQT A;  3ABL C;  1N8R W;  4R8C A;  1JCH A;  2ZQM A;  4GX2 A;  4OXS A;  1VQO V;  4MVZ A;  1Q7Y W;  2NNU A;  3AG3 B;  4MTG A;  2ITD C;  5IYB O;  1GM8 A;  4WFB V;  1VQ4 V;  5H6Q A;  3D3I A;  1H8H G;  3ASO C;  1QLE C;  5IDJ A;  1Y66 A;  2Z3Y A;  1JX9 A;  1K92 A;  2DWD C;  4LC1 A;  3ASN B;  4MVU A;  1JVM A;  1NKD A;  2EJR A;  4MTF A;  4N21 A;  3K08 A;  3ZRV A;  4KP4 A;  4WFA V;  1SES A;  1YJW V;  4UUJ C;  2EIK B;  5LBQ A;  4G27 B;  1R3L C;  4EKW A;  1K5Q A;  3ZRS A;  2EIN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...