1R6KA

Hpv11 e2 tad crystal structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
187
Chain Sequence
b'AIAKRLDACQDQLLELYEENSIDIHKHIMHWKCIRLESVLLHKAKQMGLSHIGLQVVPPLTVSETKGHNAIEMQMHLESLAKTQYGVEPWTLQDTSYEMWLTPPKRCFKKQGNTVEVKFVMEYVVWTHIYLQDNDSWVKVTSSVDAKGIYYTCGQFKTYYVNFNKEAQKYGSTNHWEVCYGSTVICS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HPV11 REGULATORY PROTEIN E2
publication title Crystal Structure of the E2 Transactivation Domain of Human Papillomavirus Type 11 Bound to a Protein Interaction Inhibitor
pubmed doi rcsb
source organism Human papillomavirus type 11
molecule tags Transcription, replication
total genus 61
structure length 187
sequence length 193
ec nomenclature
pdb deposition date 2003-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r6kA01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 1r6kA02
1DTOA 2JEXA 2NNUA 1R6KA 2JEUA 1R6NA 1QQHA 1TUEB
chains in the Genus database with same CATH superfamily
1H2NA 3M7MX 3Q4HB 4CH3A 1WPBA 1MABG 4DV5O 2IJHA 1KKDA 4X62O 1HR0B 4TUYA 2VQFB 4TSFG 3ETGA 4X20B 4O4LA 4YXWG 3RYFB 4DV2O 3FX7A 3MHHC 5CA3A 4B3RB 4PI0A 4MTOA 5C8YA 3SPCA 2Y69C 1TUBA 1H2GA 1MG1A 3ZX6A 4PA6A 3X2QC 2A9HA 3JARA 5LYJA 2V4DA 5EYPB 2Y0IA 1N34B 1BGYH 3R66A 1UFIA 2RDCA 4L87A 1JFFB 3BVOA 4PHZA 1ZSPA 3CCJV 5J2UB 1OCRB 1QLEB 3G80A 4PA4A 5ITZB 3CCMV 3BA9A 3UO2A 4LF5B 2N74A 2CTWA 1U97A 3BABA 1J95A 4K3AA 1G8MA 3L9DA 5IYZA 1P84F 4DV6O 1WA8B 1ZL8A 5GONB 4B3TB 1XNRO 3RYCB 1AVMA 1Q90D 2HLDG 5KHHA 1SZTA 1QNMA 2OIGA 2WLIA 3JAMN 3MD0A 3OUSA 1FS0G 4LF6B 1Y66A 5FNVA 1IXBA 3OFNG 3SDLA 1N0NA 4X64B 4N23A 4IIJB 5EIBD 1VMGA 2JEUA 3D8CA 3CYOA 1YCIA 2UXCO 2BOCC 5KHIA 4PDLA 5CA1A 4XDKA 1Y4MA 2XHBA 2CAZC 4OGQB 1XMOB 3HKBB 1PNKA 1NH2B 1GN4A 4JAUA 1F51A 3M8AA 4JI3O 4H37A 2P06A 1SA0B 4J7KA 1IBKB 1GM7A 4FZ1A 2IM9A 3CRQA 4MTGA 1S72V 2A06H 1B6QA 2Z5UA 1QHTA 2YEVA 3P3PA 1Q7YW 4WFAV 4MVUA 5DM6V 1GRJA 1YTFD 3OEHG 1NI8A 1N32B 1S5HC 4G2KA 1G1XB 4MVQA 2HKOA 2Y69B 1H2LA 1MZFA 4DR1B 1IBMO 2QM8A 2RMKB 1Y76B 1K33A 4YHHO 3CCVV 1KC8W 1VQ6V 3X2QB 1JQ0A 3ABKC 5EZYA 2GTAA 1FAFA 2JS5A 4B7KA 3KCXA 2RCVA 2Y0PA 3RYHA 2HJDA 1KKCA 1JR9A 5KAIZ 4AILC 4DV7B 4J7JA 4BW5A 2X6BA 5F2VO 2Y4UA 4X1KB 1AJNA 1O9GA 3BPZA 2VWKA 4O2BB 5LGTA 1P4RA 2QSAA 2XAQA 2JJ2G 2HVJC 5JVDA 2DWEC 3I5DA 1JJOA 3TXQA 3CC2V 5IJ0B 4RQEA 4JV5B 2XAJA 1KP3A 3B8MA 1EM1A 4CS3A 3QO7A 3FB7C 1VQ8V 4JPRA 3P30A 2ZNIA 5B1OA 3ZS8C 3W7TA 2ITDC 1BHAA 1DGSA 1XDCA 4KHPB 1PNMA 2P7TC 2F23A 3E89A 2BTOA 3ZHUA 2QKCA 4LFBB 3AG2C 5KHJA 2LFSA 1VQLV 4JASA 4NB5A 1LUVA 2XOKG 5B66Z 4OPHA 2FTKA 1GTOA 5H9CA 3OTOO 1PPJH 4IYIA 1BMFG 3JD2A 1Q43A 1FXHA 3JALA 2C2AA 3L73H 1H2KA 2OIEA 4HYOA 1XHZA 1Q3EA 1NVPB 1T5EA 2P67A 3PJSK 3WB1A 4DUZO 1CEZA 1KYOF 2DMXA 4I5SA 2PF4E 2HP8A 4KFMA 1WLEA 1VIBA 3CCSV 4DV4O 1GM8A 4H33A 4JYAO 3AG1B 3VQWA 2ZE7A 5FNVB 4KP4A 2ZR3A 4DK1A 3ABKB 4JI5B 5EBWC 2ZNJA 3HKCA 2KQXA 4I4TA 4RQFA 2DOSA 5KA5A 2AHYA 3JD4A 3H1KH 3CCLV 2XUMA 5DEDA 3HR0A 2WLNA 4DV5B 3JASB 5K1XA 3ZN1A 5KX5A 4X62B 4DR3O 4MTXA 3AG4C 4FLTA 1OCOC 2ZIOA 1VF6A 3THOA 4DV2B 3N2KB 4FFBB 2GHYA 1QQHA 4Q20A 3GWOA 1KUQA 3KCYA 5B1AC 3T1HO 2QJ1A 3LUTB 2D3OW 3W7XA 1M57C 2LJ2A 4P30A 3W7WA 5KMGA 4CC5A 2QWOB 5JH7B 4LNUA 4TV9A 4J9YB 3HB3B 3AG2B 3CCQV 2B1IA 1ZAUA 4MVSA 2DYRC 1VQ7V 1L0NH 1AILA 1XBLA 1VQ9V 3QVNA 4TV8B 1NTZH 2E3CA 3IC9A 2BTQB 2KB1A 2OTJV 3FAVA 1K3EA 1WB8A 4X1YA 3DC6A 3M99B 1XNRB 3K57A 4K35A 4J10A 4QJFB 2CGOA 3JAWB 4X9QA 1MNGA 1M4UA 4YIPA 4ZHQA 3CD6V 2ODMA 3JAKB 4BWAA 3ASNC 4XDJA 2OCCC 1Q81W 4FLUA 1P7GA 2UXCB 3IC7A 3OT7A 4JTAB 4DUYB 5GW7A 2WAMA 1XOUA 4WFFA 5B1BC 1HNXB 4OX9O 3AG7A 3F5TA 4DYLA 1FD9A 1KU9A 4JI3B 3TJTA 3OGIB 2NR5A 3CMEV 4EKWA 2YI8A 1BT8A 3ICXA 2PTMA 1S5LZ 2ZXWC 3RVZA 1QCEA 3GB7C 4IGGA 4LF8O 1IBLB 4LFAO 1NQTA 1N4CA 4I0XA 4OPAA 4X1IB 1OCOB 2W6IG 3CXHF 3T1YO 2PI5A 1AI6A 3SPIA 5CMUA 3CSXA 3VQYA 2DJVA 1RPRA 4YIOA 1SESA 1LR1A 4B3SO 2ZM6O 5EBMC 1LNQA 5LOVB 2QKAA 1PL4A 1KD1W 5IYDO 4FPPA 5E79Z 3UKMA 2P4VA 2ARHA 2KG7B 2Q7HA 5DN6G 5CBFA 4BR6A 3APQA 4JGSA 3K58A 4FLXA 4LWSB 4JI6O 2RJZA 5IYBO 1BSMA 2EIMC 4P9OA 3RVYA 3L74H 1YJNV 4AQYO 3STZC 4CH6A 3STLC 1IZ3A 4LH6A 3QO5A 1F4MA 2CH7A 3N2GA 4Q6GA 4J7ZA 4ZI7B 2UUBO 1I94O 1EN5A 3SJBC 5J2TA 3AG3B 3HKDA 3CMAV 1M1KW 2QWRB 3GWKC 2CGNA 3B77A 1FXKA 5CN0A 5JQGB 3K5LA 2A79B 5CB4B 1GK9A 2KSDA 3L72H 2QM7A 1XI1A 3CC7V 1S3JA 1V9PA 2OCHA 4WFGA 2JK5C 3ASNB 3K04A 2QEXV 1EZJA 1WAZA 2OCCB 5J9PC 3D3QA 4I55A 4JI8O 4JI0O 3KKYA 4JI1B 3K9SA 2YIAA 2G38A 2F93B 5LHGA 5B3SC 4EB6B 4FM2A 1VQNV 3UO3A 1BL8A 2FL4A 4JTDB 1WP7A 1NTMH 1I5YA 4MTFA 4DR2O 3CE2A 3UT5B 4GYCB 4EFBA 4NTWA 4EFEA 1M56B 4NTYA 2V1DA 2A7WA 1NH2D 4I50A 2WPDG 4JI2O 1FXKC 2H8PC 1K9MW 1QBZA 1Q6UA 2XAGA 2QWNB 4F6RB 3MHSC 4O4IA 1NJIW 4U7NA 4MT8A 2X0LA 4DV4B 4JYAB 4RUEA 4FJCC 4G27B 1K97A 2ITCC 1B04A 1FXVA 2JGDA 3LDEA 1E1QG 4MS2A 4O4JA 2ZT9B 2EIMB 2VWJA 3P3NA 1VEWA 3T4ZA 3BFRA 1E79G 4FMTA 4U3JA 3OE7G 2IW5A 1EN6A 1GN2A 1N0JA 3C3SA 3OM3B 2DN9A 5JCOA 4HBNA 4O2AB 3SYCA 2B5UA 3K59A 1BQZA 1A32A 4DR3B 2Q68A 1VF5B 2QDOA 2Q67A 2AZ0A 5KUMA 2ZCEA 1NR7A 1HP8A 3OMIB 4YJ2A 3QTCA 2PYLA 2PI4A 4H13B 5BMVB 3T1HB 2OT5A 2GBOA 2P4KA 3BY6A 2LP7A 2QTSA 4IL6Z 3J81N 4RUFA 4UVCA 4RWUA 5GTHZ 1JA8A 2IJKA 3G67A 5LHIA 4FLWA 4PELA 2GUZB 3OMNB 4F6EA 3FB6C 1DF4A 1KQSU 1Q6IA 3K3WA 1TAEA 1IURA 4JAAA 1THZA 2Y48A 1US6A 2M6YA 3WG7C 3L75H 5LBQA 1M93A 2EJ7A 2EBOA 4UCTA 1XILA 4R8CA 1MSWD 4FM1A 2XNDG 1AP6A 2QTOA 1CP9A 2WA4A 3ABUA 2OWOA 3J80N 1WB7A 2AZ2A 4DV0O 4W4KA 2WLLA 4LF9B 3J7AU 3CHXA 3OD4A 5BZBA 1NVPD 3P32A 3RW0A 5IDJA 2K9PA 4OX9B 4FFKA 1GN3A 1VQMV 1SC5B 2XTAA 1X59A 1L0LH 3OEEG 3TXSA 2MW2B 3SJCC 2YIDA 4AHCA 1R6TA 1RSOA 5JJEB 3F7YC 2WLJA 4LF8B 3K06A 4HZ3A 4LFAB 3TCUA 4B3MO 1JPXA 4MSWC 3BA8A 3K9AA 3RWRD 4NXMO 4IHJB 4LFCB 3T1YB 2OYQA 4QGPA 4JZGA 4NXNB 2E75B 1AJPA 4W4LA 2EILC 1NBMG 1LUWA 3UM7A 3RYIA 1SS3A 3ZHRA 2D2CB 2CK3G 2JS3A 1OCZC 3E22B 4HNAB 3K5NA 3D36A 3SJQC 4DR7B 3ZHVA 2AGAA 4ZOLA 4JI6B 4K0KO 3CJHB 1M9NA 5LXTB 5BR8O 2Q73A 4Z1MG 2IU3A 3HKEA 1BHBA 3IGAC 1SQGA 4AQYB 2F1MA 2Q9LA 1R3JC 2AW9A 3ZRWA 2UUBB 1I94B 4UCUA 1WNSA 5CA0A 4GUNA 5LMUO 1Z5WA 1BZKA 1MA1A 4TUYB 4PA7A 2JIZG 4J11A 3ZRSA 3CPWU 1Z2GA 4JYYA 4O4LB 2Q6AA 1Q82W 3ZRXA 1GM9A 3N27A 5C8YB 4UCVA 2HFEC 2F95B 1TUBB 1WPXA 2EIJC 2Q7EA 1GMGA 2Y4TA 4JI0B 3JARB 1QQCA 2DYSC 5B5EZ 4J41A 2WLHA 5LYJB 2RN9A 3G4SV 1RPOA 2ZD9A 1R3KC 3FB5C 5IJ9A 3VOUA 3GVMA 2HHHB 1Q8IA 1XMQB 5KAFZ 4YY3O 1K5SA 2BSKA 3DXRA 4YJ3A 5EC2C 1M90W 3APOA 5HFLA 2ZINA 1EZVH 1UPGA 4DR2B 4ZIBA 1Y74A 4NKGB 4JF3A 4GX2A 4C7UA 5IYZB 2PGGA 2QR4A 4JI2B 1ZL8B 1YF2A 2RNBA 5LGUA 1JX9A 3ZHQA 1OCZB 1PD3A 2QA4V 1G6UA 2WLIB 5L3BA 5KLVH 2BOBC 1HNWO 1HNZO 5E1AC 4BAYA 5LP6A 3ZBHA 2E5LO 5CA1B 4Z2WA 3JD1A 1OZ0A 4H44B 2EZOA 2B9ZA 2DW4A 4O4HA 5A9GA 1G4YB 1SRYA 1Y6XA 3G71V 3A0HZ 1K5QA 2YI9A 2AXTZ 5KHKA 1IXMA 1FFTB 4G28B 1NS1A 3OMAB 2YEVB 2VQFO 1FFXA 3QF7A 2P5OA 1VARA 1GAXA 1P7BA 1PKXA 1EFRG 2VRZA 3SPJA 1R73A 1W0KG 1H38A 2ZIMA 4B3RO 3EFFK 2ZE6A 2EIJB 2P6JA 1E1RG 4DRXA 4H0LB 1AJQA 2DYSB 3UCSC 2BE3A 3ZMVA 2F4VO 2R9IA 5EZYB 5JJNB 5IWAO 1N34O 2GTSA 5LP6C 3RYHB 3CCEV 1GH6A 3JATA 1XNQO 1PL0A 4NTXA 3JYCA 2IH1C 4DV6B 2H94A 3B8NA 1XHXA 5JWPA 4X65O 2QE7G 2VS0A 2W6JG 3ZN0A 1BS3A 4BW9A 4LF5O 2BCCH 1VF6C 4K8XA 5JVDB 2UUAO 1ZLZA 2EIKC 3CB2A 1AI4A 4D7TA 5L3FA 1W2BU 4DV0B 3CX5F 3LSUA 4DW0A 4CH4A 4B3TO 2ZKOA 4BIUA 1VP7A 3OTFA 3TK1A 1QVGU 3SYQA 1NU1H 4WBNA 4CBCA 3FB8C 1WJZA 5D5PA 1TVKA 2ETNA 4ABMA 2PZSA 4QPJA 1OCCC 4LF6O 2EJRA 2YUAA 2QKSA 4KL1A 3CCRV 2PY5A 2EINC 1ZX3A 2HR3A 1VQ4V 3Q4HA 1F23A 1L8DA 5EC1C 3AG4B 4NXMB 2IU0A 5L3DA 2O57A 4IYHA 4X20A 3JALB 3L70H 3KG2A 2Q8VA 3RYFA 4WF9V 2CUGA 5B1AB 3LNMB 2HJFC 4DW1A 2HG5C 1J5EO 1K73W 3SYPA 1M57B 1IBMB 4BIOA 4D7SA 4YHHB 1XQ8A 1N8RW 4JZ2A 3JSLA 3SPHA 4I9QA 4R7CA 3K03A 2ZDIA 4ZKIA 4UV9A 4WFHA 3ZRVA 4K0KB 3WU2Z 5EYPA 5BR8B 1YXBA 1K7DA 3B4SA 3QNEA 5LA6A 2X7RB 1ORQC 1AI7A 1JFFA 1KECA 2DYRB 4UXNA 5J2UA 2CTPA 3HKCB 2YSUB 1XL6A 2ADQB 2VQEO 3DSQA 4I4TB 4FLVA 5ITZA 4J80A 2WLMA 3SGIA 5A2QN 3JD0A 1COWG 4Z1VA 5KX5B 4DV7O 3PN1A 1S76D 4FM0A 1DLBA 1WA8A 4UV8A 5GONA 3RYCA 3AEIA 3LNNA 1L1FA 2LGQA 4LBEC 3DC5A 2PYJA 4U7OA 2W0XA 1TGOA 1FYJA 4PDMA 2XAFA 5FLXN 4IIJA 2YS8A 3H01A 3FD9A 4X89A 5LHHA 1DTOA 5KMGB 3E8BA 4BIZA 5B1BB 2ZDIC 1HDJA 1OCCB 3B2EE 4LF4O 2YIBA 1OV9A 4LNUB 3I55V 4TV9B 3HKBA 2UUCO 3OTOB 5HFMA 3ZJZA 4CH5A 2EINB 2ZXWB 3ABMC 1SA0A 1BQ0A 1D2DA 4PDVA 2WA3A 4LR3A 3ETDA 1VQKV 2W0FC 3FAVB 4DR5O 2OTLV 4DUZB 4X1YB 4LH7A 5AG2A 3B09A 3TETA 2L6LA 1AROP 1SQPH 3EXAA 4WFEA 1YJWV 1S77D 1FJGO 1N36O 4ZHQB 2FKXA 4J42A 4K8ZA 3SYAA 1SETA 3D3IA 1SQXH 2YC0A 1HNWB 1HNZB 2CDYA 1Y76A 1JVMA 1YHQV 1YJ9V 3IJ4A 2IJIA 2GV9A 3G6EV 2E5LB 1SERA 3LDCA 5TISZ 4TOIA 4DR4O 3AK1A 4FK5C 4CZZA 2FMLA 2DQ3A 3K5MA 4P9PA 3TGUH 2IJJA 2JEXA 1NKDA 4RO2A 4X1KA 4O2BA 3H1LH 4X66O 3ASOC 2FB5A 5IT9N 1DK1A 4I0XB 1W0JG 2P22C 5IJ0A 4JYBA 2NN4A 5LGNA 4PI2A 4UVAA 1MOFA 4ASUG 4EEQA 4DV3O 5KHGA 2JDIG 2N04A 4A5UB 4I9WA 3CRMA 3WB0A 2UXDO 2X6CA 3ZMZA 1X4TA 4PDRA 1SKVA 2Q5ZA 2F4VB 3IFXA 5B3SB 5IWAB 3RGBA 2LFRA 1R1BA 2WLKA 1V55C 1AB3A 1VF7A 5LA6B 1XNQB 2QGNA 5JCOC 2UXNA 2E74B 1XL4A 3ABTA 3ABMB 2CH7B 3N2GB 2YXYA 4B7EA 1YSCA 4X65B 5BY1A 4E4EA 5J2TB 1S5JA 3FFQA 3I56V 3HKDB 4FLZA 4CC6A 4X8AA 5L3GA 1FXKB 2UXXA 4UB6Z 3F7VC 2A0LA 2UUAB 1FKAO 3ETQA 4WCEV 2ZQMA 3NXSA 1F4NA 4MVMA 1IVSA 1XUQA 1Q5OA 4PV1B 4GKJO 1JJ2U 5B1NA 1H8EG 1O9HA 4I55B 3BEHA 4UCSA 4RAIA 3K0DA 4QE7A 1I7FA 3LSSA 5LMNO 1BE3H 2B1GA 3W7SA 4TWKA 3ZHTA 4DUYO 1HNXO 3JASA 2ILMA 1WP8A 5L3CA 3CRCA 3OR7C 1K8AW 1CPYA 3ZCCA 2X6AA 2PUSA 3ASOB 3A0BZ 5H6QA 5LL6Y 5EIBC 1CXZB 1YZBA 3OW2U 2EULA 3N2KA 4B3SB 4FFBA 1BCCH 2ZM6B 5C93A 1J5EB 2QWPB 1IBLO 4TQFA 3VBBA 4I50B 3OR6C 4O4IB 2WWWA 3C3TA 2KKWA 1R3IC 3EVKA 4GKKO 5FL7G 1H2MA 3A8TA 4PA3A 3O9OA 4NVPA 5JH7A 5BXZA 3CCUV 2JGDB 2NNUA 4O4JB 1M5IA 2M7WA 3AG1C 1NT2B 2ZR2A 2LW1A 1V55B 2VQEB 4GCZA 4U3JB 1GKFA 3WG7B 4TV8A 4DV1O 1B3QA 3FYEB 3S3XA 2BTQA 3CXCU 2Q69A 3DTUB 5K1PA 4LF7O 4CS4A 1ROPA 2JJ1G 2R70A 1R6KA 4AI8A 2YDEA 5DECA 5IYCO 4TT3G 1YIJV 2XASA 3CS5A 4UFZA 3VQXA 4YJ2B 1P49A 3JAWA 1N33O 3JAKA 2Z0AA 3K5OA 1D5NA 5CBGA 1S0VA 1KB9F 4JI8B 5EK0A 3AK3A 1EN4A 3D36C 2LQTA 4R6ZA 2UU9O 2P90A 2R72A 4LF4B 3SPGA 3ZMUA 3RFRA 3H1JH 2ADPA 3G6BA 1IX9A 4TQDA 2UUCB 2R9AA 3NR7A 2UXBO 3JCUZ 3E2EA 1XREA 3F5WC 3K79A 3E83A 1K34A 2EX3A 2LGWA 3BHPA 4JI1O 1PV0A 4D6TH 2IBZH 1JOYA 4GX1A 1D5AA 1K4CC 3WB2A 2R9RB 4X1IA 4DR5B 2Q0AA 3CRRA 3KZIZ 3LSQA 2EILB 3ETEA 4OXSA 3JCZA 2JGUA 3EHBB 3MAQA 3CP1A 3ABLC 3DGEA 3FYIB 3QO8A 1IDSA 1FJGB 1N36B 4DR6O 5LOVA 4FIPC 1RM1C 1W59A 1TUEB 1B06A 2KG7A 1YITV 3ZMTA 2WLLB 1K92A 4LWSA 4JI4O 1NTKH 2L35A 5D5QA 4ZBMA 4KUMA 1K4DC 4FVMA 3ZIAG 1QR8A 4DR4B 4UVBA 3ZHSA 1TA8A 2YICA 1PM9A 2CTQA 2Q0OC 3ML0A 3OGCC 1H2SB 1YTFB 4ZI7A 2ZE8A 4JI7O 3A0RA 1RSOB 4JYCA 4X66B 1AR4A 1I0HA 2V7QG 1YDXA 1FPOA 4E2LA 3C90A 1JMKC 1HR0O 5H6RA 5JQGA 4QNHB 1U96A 3CC4V 3MDSA 1R3LC 5CB4A 1SQFA 1SQVH 5IY5C 1I08A 4DV3B 1YEWA 3RYIB 3QG5A 1SQBH 4UB8Z 5KUKA 1V54C 3H9VA 2YXHA 4MVZA 1UJWB 2IH3C 2UXDB 3H1IH 1QU7A 1AP5A 4ZOLB 4HAMA 3E86A 4MVRA 2LO1A 4JAVA 2Q4PA 3HKEB 2GSMB 3JSNA 4PA9A 1AR1B 4EB6A 3SJAC 4XDLA 2XAHA 3ZRWB 3RT3C 4L8JA 1NZ6A 1R6NA 2H3OA 3WFVA 1ENVA 4NR1A 1ZTEA 2WSSG 4X88A 3UT5A 5CA0B 3AG3C 1AR5A 2CE4A 1KMIZ 3ABLB 4F6RA 1JCHA 3ZEDA 1QLNA 1RM1B 4GKJB 1H8HG 3K0GA 2AHZA 3L71H 4GT1A 2MK3A 4X64O 1HW7A 3U0ZA 4LF9O 3SYOA 4DXWA 5LMNB 3OAAG 4I7ZB 5H5NA 5EBLC 4O2AA 5IJ9B 1XMOO 4B3MB 4YJ3B 2BSKB 3DXRB 2Z3YA 4GX0A 4FZ0A 5IE9A 3CRAA 2QM4A 1IBKO 3U10A 1Y74B 2DE0X 4ICGA 3E8GA 4WFBV 3A2FA 4UUJC 1F7YA 5BMVA 1GO3F 1SZXA 4LFCO 5IY5B 2Q7GA 4KXRA 1M56C 3ZMSA 4NXNO 1OHHG 4FLYA 1N32O 1DF5A 4GX5A 1V54B 4GKKB 3E8HA 1ZUQA 1VQOV 1RP3B 3AK2A 3BCCH 2A3QA 3O65A 4DR1O 3IAYA 4LP8A 4DK0A 4UCRA 4DR7O 2F66C 5LP6B 2GUZA 4LC1A 3HPLC 2E76B 2EZPA 3OUFA 5CBHA 3T1CA 4DV1B 2GDSA 5LMUB 4O4HB 1PNLA 1AI5A 3K08A 4N21A 4QE9A 2HVKC 1NR1A 1VQ5V 1Q86W 4LF7B 2ATKC 1PP9H 5KA6A 2EIKB 4QPKA 3T4DA 4QIWF 5FPRA 1QR9A 4R50A 1N33B 3JD3A 3UQ8A 4B08A 1FFXB 3VQVA 1SQQH 1MZEA 4JV5O 4XBFA 4MVOA 3LDDA 4P2ZA 1HWYA 2UU9B 4DO2A 3SR2C 3BAAA 4U3FH 4PD4F 4DRXB 3CWBH 4KHPO 4YY3B 1QVFU 2UXBB 3E35A 3S3WA 4LFBO 1ZWIC 2YXLA 1OCRC 1QLEC 1SF9A 1RFYA 3U11A 3CEIA 3JATB 4GZRB 1Q6HA 3RN4A 5JJJB 2NLJC 5FPOA 4MW8A 2HHHO 2JVDA 1XMQO 1GN6A 4GLXA 4IHJA 2DQ0A 4JTCB 1YVWA 2N05A 1OJHA 2YIBD 2JRIA 4IT5A 4PJ0Z 4UCOA 1URFA 2RQ6A 4DR6B 1I5XA 3E22A 3E8FA 4HNAA 1KBHA 1MMMA 5GTIZ 1KP2A 1VQPV 1EBOA 3T2MA 4F4LA 4J9ZB 4JI4B 3R65A 2DWDC 4CS2A 2FYUH 3CJHA 4LCUC 4WBNB 2XT9A 5LXTA 1WN7A 1Z5VA 3H1HH 3W7UA 1TVKB 1XEQA 4MW3A 2QWQB 1Y67A 1YI2V 1MSDA 5L3EA 3RBZA 2F43G 4JI5O 3FKSG 2K1EA 2ZE5A 5H2FZ 4NYKA 2LW7A 3BRCA 2CTRA 2HEPA 4JI7B 3B40A
chains in the Genus database with same CATH topology
5FL7G 1K5QA 4PA3A 1MABG 5DN6G 2IJHA 5CBFA 1KKDA 4JGSA 4TSFG 1IXMA 3CCUV 3ETGA 5IYBO 1FFTB 2NNUA 2EIMC 4YXWG 4G28B 4P9OA 3RVYA 3AG1C 2M7WA 3OMAB 2YEVB 1YJNV 3MHHC 5CA3A 2ZR2A 3STZC 1V55B 1P7BA 3STLC 4GCZA 1PKXA 1GKFA 1EFRG 4MTOA 3WG7B 3SPJA 1R73A 3QO5A 1F4MA 3SPCA 3FYEB 2Y69C 1W0KG 1H38A 1H2GA 3CXCU 3EFFK 3AG3B 2Q69A 3DTUB 2EIJB 1MG1A 2P6JA 4PA6A 3X2QC 2A9HA 3CMAV 1M1KW 1E1RG 1ROPA 1FXKA 1AJQA 2DYSB 2JJ1G 3B77A 5CN0A 3ZMVA 1R6KA 5IYCO 4TT3G 1YIJV 2A79B 2XASA 2R9IA 1GK9A 4L87A 2QM7A 3CCJV 1OCRB 1QLEB 3CCEV 3CC7V 1S0VA 4PA4A 5CBGA 3CCMV 1S3JA 5EK0A 4WFGA 1PL0A 2JK5C 3ASNB 3K04A 3JYCA 2QEXV 2IH1C 1EZJA 4R6ZA 2OCCB 5J9PC 2H94A 3B8NA 2P90A 2QE7G 2W6JG 1J95A 1G8MA 3SPGA 3ZN0A 3ZMUA 5LHGA 2EIKC 5B3SC 3E2EA 1AI4A 3F5WC 3K79A 3E83A 2HLDG 1K34A 5L3FA 1SZTA 1W2BU 2WLIA 1VQNV 3MD0A 4BIUA 1JOYA 3OUSA 1FS0G 3TK1A 1BL8A 1Y66A 1QVGU 4JTDB 3SYQA 3OFNG 4GX1A 1I5YA 1K4CC 4N23A 4CBCA 3FB8C 2R9RB 2JEUA 4MTFA 3CYOA 2BOCC 4QPJA 3LSQA 1OCCC 2EILB 3ETEA 4PDLA 4OXSA 3JCZA 4XDKA 1Y4MA 3EHBB 1M56B 2EJRA 2V1DA 2QKSA 3ABLC 3CP1A 3DGEA 3FYIB 1NH2D 2WPDG 3QO8A 1FXKC 2H8PC 1K9MW 1QBZA 3CCRV 1PNKA 2XAGA 2EINC 1NH2B 3MHSC 4JAUA 1F51A 2HR3A 4FIPC 1RM1C 1NJIW 4H37A 1VQ4V 4U7NA 4MT8A 1TUEB 2X0LA 1F23A 5EC1C 1YITV 3AG4B 3ZMTA 2WLLB 1K92A 2IU0A 1GM7A 4RUEA 5L3DA 4FJCC 4G27B 1K97A 2ITCC 1FXVA 4MTGA 1S72V 3LDEA 1E1QG 1B6QA 2Z5UA 3KG2A 4MS2A 4WF9V 4ZBMA 4KUMA 2EIMB 2YEVA 1Q7YW 5B1AB 3LNMB 1K4DC 3T4ZA 4WFAV 4MVUA 3ZIAG 2HJFC 5DM6V 1QR8A 2HG5C 1E79G 4FMTA 1K73W 1YTFD 4UVBA 3OEHG 3OE7G 3SYPA 2IW5A 1M57B 3OM3B 3ML0A 3SYCA 2B5UA 3OGCC 1YTFB 1N8RW 1S5HC 4G2KA 4MVQA 3SPHA 2HKOA 3K03A 2Y69B 4R7CA 2ZDIA 3A0RA 4JYCA 4ZKIA 4UV9A 2Q68A 2V7QG 4WFHA 2QM8A 3ZRVA 4E2LA 1K33A 1KC8W 2Q67A 3CCVV 1VQ6V 3X2QB 5KUMA 5H6RA 1K7DA 3QNEA 4QNHB 3CC4V 1NR7A 2X7RB 1R3LC 1JQ0A 1ORQC 3ABKC 3OMIB 1AI7A 1KECA 2PI4A 2DYRB 4UXNA 5IY5C 2YSUB 1XL6A 2OT5A 5KUKA 1V54C 2WLMA 4BW5A 3BY6A 2X6BA 4MVZA 2LP7A 1UJWB 3JD0A 2IH3C 1COWG 1AJNA 5LGTA 4RUFA 4UVCA 1P4RA 4HAMA 2XAQA 3E86A 4MVRA 2IJKA 1S76D 1DLBA 2JJ2G 4UV8A 4JAVA 3AEIA 2HVJC 1L1FA 2DWEC 2GSMB 4PA9A 5LHIA 3CC2V 4PELA 1AR1B 3OMNB 4RQEA 3FB6C 1DF4A 2XAJA 4XDLA 4LBEC 1KQSU 1KP3A 3B8MA 2XAHA 4U7OA 3ZRWB 3K3WA 3QO7A 3FB7C 1VQ8V 4JPRA 3P30A 4PDMA 1THZA 2Y48A 1R6NA 2XAFA 5B1OA 3WG7C 3H01A 3WFVA 5LBQA 1ENVA 2ITDC 4X89A 3W7TA 1BHAA 5LHHA 1DTOA 2WSSG 3E8BA 4X88A 4BIZA 5B1BB 2ZDIC 1PNMA 2P7TC 3AG3C 1OCCB 2EBOA 3E89A 4R8CA 1MSWD 3AG2C 3I55V 3ABLB 2XNDG 2QTOA 2LFSA 1CP9A 4JASA 1VQLV 3ABUA 1JCHA 5HFMA 2XOKG 3ZJZA 2EINB 2ZXWB 1QLNA 2FTKA 1RM1B 3ABMC 2WLLA 1GTOA 1H8HG 5H9CA 3K0GA 2AHZA 1BMFG 3JD2A 4GT1A 2MK3A 4PDVA 5BZBA 1FXHA 1NVPD 3P32A 2C2AA 3RW0A 3ETDA 4HYOA 2W0FC 1VQKV 2OTLV 3SYOA 4DXWA 5IDJA 1VQMV 3OAAG 3TETA 1NVPB 1AROP 3OEEG 5EBLC 2P67A 3PJSK 4WFEA 1YJWV 1S77D 1CEZA 4I5SA 3SYAA 1SETA 3D3IA 3F7YC 2Z3YA 4GX0A 4KFMA 2WLJA 1WLEA 3K06A 4HZ3A 3TCUA 1JVMA 3CCSV 1JPXA 1GM8A 4H33A 4MSWC 1YHQV 1YJ9V 3K9AA 2IJIA 3AG1B 3G6EV 4KP4A 3E8GA 4WFBV 1SERA 2ZR3A 4UUJC 3ABKB 1AJPA 3LDCA 5EBWC 2EILC 1GO3F 1NBMG 3UM7A 5IY5B 1M56C 2CK3G 3ZMSA 4RQFA 1OCZC 5KA5A 4FK5C 4CZZA 1OHHG 1DF5A 2AHYA 2DQ3A 3JD4A 1V54B 4GX5A 3CCLV 3E8HA 3D36A 4P9PA 1VQOV 2IJJA 2WLNA 2JEXA 3SJQC 1NKDA 4RO2A 3ZN1A 4MTXA 4LP8A 3ASOC 1M9NA 3AG4C 1OCOC 4Z1MG 2IU3A 1BHBA 3IGAC 1W0JG 2GHYA 1QQHA 4JYBA 4Q20A 4LC1A 3GWOA 1R3JC 3HPLC 2EZPA 3OUFA 3ZRWA 5LGNA 5B1AC 4UVAA 5CBHA 1MOFA 3T1CA 4ASUG 3LUTB 2JDIG 1PNLA 1AI5A 3K08A 4N21A 2D3OW 3W7XA 1M57C 4QE9A 4I9WA 2HVKC 1NR1A 4P30A 3W7WA 1VQ5V 1Q86W 2ATKC 2X6CA 3ZMZA 4PA7A 4PDRA 2JIZG 2EIKB 3IFXA 4QPKA 5B3SB 5KA6A 3T4DA 4QIWF 3ZRSA 3CPWU 1QR9A 4R50A 4J9YB 2LFRA 3HB3B 3AG2B 2Q6AA 2WLKA 3CCQV 1V55C 2B1IA 3JD3A 1Q82W 3ZRXA 4MVSA 4XBFA 1GM9A 2DYRC 4MVOA 1VQ7V 2UXNA 1VQ9V 3LDDA 1XL4A 4P2ZA 3ABTA 1HWYA 3ABMB 2HFEC 1YSCA 4DO2A 2KB1A 1WPXA 2EIJC 2OTJV 1GMGA 3I56V 1K3EA 2DYSC 2WLHA 4X8AA 3M99B 5L3GA 1FXKB 2UXXA 3F7VC 2A0LA 3G4SV 1QVFU 1RPOA 2ZD9A 3E35A 1R3KC 4WCEV 3FB5C 4QJFB 3VOUA 1ZWIC 1OCRC 2ZQMA 1QLEC 3CD6V 3NXSA 1F4NA 1K5SA 4MVMA 5EC2C 3ASNC 1M90W 4XDJA 1JJ2U 2NLJC 2OCCC 4MW8A 5HFLA 5B1NA 1Q81W 1H8EG 2DQ0A 3IC7A 4JTCB 4JTAB 4JF3A 3BEHA 4RAIA 4GX2A 3K0DA 4QE7A 5GW7A 2WAMA 4WFFA 5B1BC 3LSSA 5LGUA 1JX9A 1I5XA 2B1GA 3E8FA 4TWKA 3W7SA 1OCZB 1PD3A 2QA4V 3CMEV 2WLIB 1KP2A 4EKWA 1VQPV 5L3BA 1EBOA 3T2MA 2BOBC 4F4LA 2ZXWC 5L3CA 4J9ZB 3OR7C 3RVZA 1QCEA 3GB7C 3R65A 2DWDC 1K8AW 1CPYA 4LCUC 5E1AC 3ZCCA 2X6AA 4BAYA 1NQTA 3ASOB 3W7UA 5H6QA 1OCOB 2W6IG 4MW3A 3OW2U 1YI2V 2PI5A 1AI6A 5C93A 3SPIA 5CMUA 5L3EA 3RBZA 2F43G 3JD1A 3VBBA 1RPRA 1OZ0A 1SESA 3FKSG 2EZOA 2K1EA 2DW4A 3OR6C 1G4YB 5EBMC 1SRYA 1LNQA 1KD1W 2WWWA 5IYDO 3G71V 4FPPA 3UKMA 1R3IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DTO A;  2JEX A;  2NNU A;  1R6K A;  2JEU A;  1R6N A;  1QQH A;  1TUE B; 
#chains in the Genus database with same CATH topology
 1H2N A;  3M7M X;  3Q4H B;  4CH3 A;  1WPB A;  1MAB G;  4DV5 O;  2IJH A;  1KKD A;  4X62 O;  1HR0 B;  4TUY A;  2VQF B;  4TSF G;  3ETG A;  4X20 B;  4O4L A;  4YXW G;  3RYF B;  4DV2 O;  3FX7 A;  3MHH C;  5CA3 A;  4B3R B;  4PI0 A;  4MTO A;  5C8Y A;  3SPC A;  2Y69 C;  1TUB A;  1H2G A;  1MG1 A;  3ZX6 A;  4PA6 A;  3X2Q C;  2A9H A;  3JAR A;  5LYJ A;  2V4D A;  5EYP B;  2Y0I A;  1N34 B;  1BGY H;  3R66 A;  1UFI A;  2RDC A;  4L87 A;  1JFF B;  3BVO A;  4PHZ A;  1ZSP A;  3CCJ V;  5J2U B;  1OCR B;  1QLE B;  3G80 A;  4PA4 A;  5ITZ B;  3CCM V;  3BA9 A;  3UO2 A;  4LF5 B;  2N74 A;  2CTW A;  1U97 A;  3BAB A;  1J95 A;  4K3A A;  1G8M A;  3L9D A;  5IYZ A;  1P84 F;  4DV6 O;  1WA8 B;  1ZL8 A;  5GON B;  4B3T B;  1XNR O;  3RYC B;  1AVM A;  1Q90 D;  2HLD G;  5KHH A;  1SZT A;  1QNM A;  2OIG A;  2WLI A;  3JAM N;  3MD0 A;  3OUS A;  1FS0 G;  4LF6 B;  1Y66 A;  5FNV A;  1IXB A;  3OFN G;  3SDL A;  1N0N A;  4X64 B;  4N23 A;  4IIJ B;  5EIB D;  1VMG A;  2JEU A;  3D8C A;  3CYO A;  1YCI A;  2UXC O;  2BOC C;  5KHI A;  4PDL A;  5CA1 A;  4XDK A;  1Y4M A;  2XHB A;  2CAZ C;  4OGQ B;  1XMO B;  3HKB B;  1PNK A;  1NH2 B;  1GN4 A;  4JAU A;  1F51 A;  3M8A A;  4JI3 O;  4H37 A;  2P06 A;  1SA0 B;  4J7K A;  1IBK B;  1GM7 A;  4FZ1 A;  2IM9 A;  3CRQ A;  4MTG A;  1S72 V;  2A06 H;  1B6Q A;  2Z5U A;  1QHT A;  2YEV A;  3P3P A;  1Q7Y W;  4WFA V;  4MVU A;  5DM6 V;  1GRJ A;  1YTF D;  3OEH G;  1NI8 A;  1N32 B;  1S5H C;  4G2K A;  1G1X B;  4MVQ A;  2HKO A;  2Y69 B;  1H2L A;  1MZF A;  4DR1 B;  1IBM O;  2QM8 A;  2RMK B;  1Y76 B;  1K33 A;  4YHH O;  3CCV V;  1KC8 W;  1VQ6 V;  3X2Q B;  1JQ0 A;  3ABK C;  5EZY A;  2GTA A;  1FAF A;  2JS5 A;  4B7K A;  3KCX A;  2RCV A;  2Y0P A;  3RYH A;  2HJD A;  1KKC A;  1JR9 A;  5KAI Z;  4AIL C;  4DV7 B;  4J7J A;  4BW5 A;  2X6B A;  5F2V O;  2Y4U A;  4X1K B;  1AJN A;  1O9G A;  3BPZ A;  2VWK A;  4O2B B;  5LGT A;  1P4R A;  2QSA A;  2XAQ A;  2JJ2 G;  2HVJ C;  5JVD A;  2DWE C;  3I5D A;  1JJO A;  3TXQ A;  3CC2 V;  5IJ0 B;  4RQE A;  4JV5 B;  2XAJ A;  1KP3 A;  3B8M A;  1EM1 A;  4CS3 A;  3QO7 A;  3FB7 C;  1VQ8 V;  4JPR A;  3P30 A;  2ZNI A;  5B1O A;  3ZS8 C;  3W7T A;  2ITD C;  1BHA A;  1DGS A;  1XDC A;  4KHP B;  1PNM A;  2P7T C;  2F23 A;  3E89 A;  2BTO A;  3ZHU A;  2QKC A;  4LFB B;  3AG2 C;  5KHJ A;  2LFS A;  1VQL V;  4JAS A;  4NB5 A;  1LUV A;  2XOK G;  5B66 Z;  4OPH A;  2FTK A;  1GTO A;  5H9C A;  3OTO O;  1PPJ H;  4IYI A;  1BMF G;  3JD2 A;  1Q43 A;  1FXH A;  3JAL A;  2C2A A;  3L73 H;  1H2K A;  2OIE A;  4HYO A;  1XHZ A;  1Q3E A;  1NVP B;  1T5E A;  2P67 A;  3PJS K;  3WB1 A;  4DUZ O;  1CEZ A;  1KYO F;  2DMX A;  4I5S A;  2PF4 E;  2HP8 A;  4KFM A;  1WLE A;  1VIB A;  3CCS V;  4DV4 O;  1GM8 A;  4H33 A;  4JYA O;  3AG1 B;  3VQW A;  2ZE7 A;  5FNV B;  4KP4 A;  2ZR3 A;  4DK1 A;  3ABK B;  4JI5 B;  5EBW C;  2ZNJ A;  3HKC A;  2KQX A;  4I4T A;  4RQF A;  2DOS A;  5KA5 A;  2AHY A;  3JD4 A;  3H1K H;  3CCL V;  2XUM A;  5DED A;  3HR0 A;  2WLN A;  4DV5 B;  3JAS B;  5K1X A;  3ZN1 A;  5KX5 A;  4X62 B;  4DR3 O;  4MTX A;  3AG4 C;  4FLT A;  1OCO C;  2ZIO A;  1VF6 A;  3THO A;  4DV2 B;  3N2K B;  4FFB B;  2GHY A;  1QQH A;  4Q20 A;  3GWO A;  1KUQ A;  3KCY A;  5B1A C;  3T1H O;  2QJ1 A;  3LUT B;  2D3O W;  3W7X A;  1M57 C;  2LJ2 A;  4P30 A;  3W7W A;  5KMG A;  4CC5 A;  2QWO B;  5JH7 B;  4LNU A;  4TV9 A;  4J9Y B;  3HB3 B;  3AG2 B;  3CCQ V;  2B1I A;  1ZAU A;  4MVS A;  2DYR C;  1VQ7 V;  1L0N H;  1AIL A;  1XBL A;  1VQ9 V;  3QVN A;  4TV8 B;  1NTZ H;  2E3C A;  3IC9 A;  2BTQ B;  2KB1 A;  2OTJ V;  3FAV A;  1K3E A;  1WB8 A;  4X1Y A;  3DC6 A;  3M99 B;  1XNR B;  3K57 A;  4K35 A;  4J10 A;  4QJF B;  2CGO A;  3JAW B;  4X9Q A;  1MNG A;  1M4U A;  4YIP A;  4ZHQ A;  3CD6 V;  2ODM A;  3JAK B;  4BWA A;  3ASN C;  4XDJ A;  2OCC C;  1Q81 W;  4FLU A;  1P7G A;  2UXC B;  3IC7 A;  3OT7 A;  4JTA B;  4DUY B;  5GW7 A;  2WAM A;  1XOU A;  4WFF A;  5B1B C;  1HNX B;  4OX9 O;  3AG7 A;  3F5T A;  4DYL A;  1FD9 A;  1KU9 A;  4JI3 B;  3TJT A;  3OGI B;  2NR5 A;  3CME V;  4EKW A;  2YI8 A;  1BT8 A;  3ICX A;  2PTM A;  1S5L Z;  2ZXW C;  3RVZ A;  1QCE A;  3GB7 C;  4IGG A;  4LF8 O;  1IBL B;  4LFA O;  1NQT A;  1N4C A;  4I0X A;  4OPA A;  4X1I B;  1OCO B;  2W6I G;  3CXH F;  3T1Y O;  2PI5 A;  1AI6 A;  3SPI A;  5CMU A;  3CSX A;  3VQY A;  2DJV A;  1RPR A;  4YIO A;  1SES A;  1LR1 A;  4B3S O;  2ZM6 O;  5EBM C;  1LNQ A;  5LOV B;  2QKA A;  1PL4 A;  1KD1 W;  5IYD O;  4FPP A;  5E79 Z;  3UKM A;  2P4V A;  2ARH A;  2KG7 B;  2Q7H A;  5DN6 G;  5CBF A;  4BR6 A;  3APQ A;  4JGS A;  3K58 A;  4FLX A;  4LWS B;  4JI6 O;  2RJZ A;  5IYB O;  1BSM A;  2EIM C;  4P9O A;  3RVY A;  3L74 H;  1YJN V;  4AQY O;  3STZ C;  4CH6 A;  3STL C;  1IZ3 A;  4LH6 A;  3QO5 A;  1F4M A;  2CH7 A;  3N2G A;  4Q6G A;  4J7Z A;  4ZI7 B;  2UUB O;  1I94 O;  1EN5 A;  3SJB C;  5J2T A;  3AG3 B;  3HKD A;  3CMA V;  1M1K W;  2QWR B;  3GWK C;  2CGN A;  3B77 A;  1FXK A;  5CN0 A;  5JQG B;  3K5L A;  2A79 B;  5CB4 B;  1GK9 A;  2KSD A;  3L72 H;  2QM7 A;  1XI1 A;  3CC7 V;  1S3J A;  1V9P A;  2OCH A;  4WFG A;  2JK5 C;  3ASN B;  3K04 A;  2QEX V;  1EZJ A;  1WAZ A;  2OCC B;  5J9P C;  3D3Q A;  4I55 A;  4JI8 O;  4JI0 O;  3KKY A;  4JI1 B;  3K9S A;  2YIA A;  2G38 A;  2F93 B;  5LHG A;  5B3S C;  4EB6 B;  4FM2 A;  1VQN V;  3UO3 A;  1BL8 A;  2FL4 A;  4JTD B;  1WP7 A;  1NTM H;  1I5Y A;  4MTF A;  4DR2 O;  3CE2 A;  3UT5 B;  4GYC B;  4EFB A;  4NTW A;  4EFE A;  1M56 B;  4NTY A;  2V1D A;  2A7W A;  1NH2 D;  4I50 A;  2WPD G;  4JI2 O;  1FXK C;  2H8P C;  1K9M W;  1QBZ A;  1Q6U A;  2XAG A;  2QWN B;  4F6R B;  3MHS C;  4O4I A;  1NJI W;  4U7N A;  4MT8 A;  2X0L A;  4DV4 B;  4JYA B;  4RUE A;  4FJC C;  4G27 B;  1K97 A;  2ITC C;  1B04 A;  1FXV A;  2JGD A;  3LDE A;  1E1Q G;  4MS2 A;  4O4J A;  2ZT9 B;  2EIM B;  2VWJ A;  3P3N A;  1VEW A;  3T4Z A;  3BFR A;  1E79 G;  4FMT A;  4U3J A;  3OE7 G;  2IW5 A;  1EN6 A;  1GN2 A;  1N0J A;  3C3S A;  3OM3 B;  2DN9 A;  5JCO A;  4HBN A;  4O2A B;  3SYC A;  2B5U A;  3K59 A;  1BQZ A;  1A32 A;  4DR3 B;  2Q68 A;  1VF5 B;  2QDO A;  2Q67 A;  2AZ0 A;  5KUM A;  2ZCE A;  1NR7 A;  1HP8 A;  3OMI B;  4YJ2 A;  3QTC A;  2PYL A;  2PI4 A;  4H13 B;  5BMV B;  3T1H B;  2OT5 A;  2GBO A;  2P4K A;  3BY6 A;  2LP7 A;  2QTS A;  4IL6 Z;  3J81 N;  4RUF A;  4UVC A;  4RWU A;  5GTH Z;  1JA8 A;  2IJK A;  3G67 A;  5LHI A;  4FLW A;  4PEL A;  2GUZ B;  3OMN B;  4F6E A;  3FB6 C;  1DF4 A;  1KQS U;  1Q6I A;  3K3W A;  1TAE A;  1IUR A;  4JAA A;  1THZ A;  2Y48 A;  1US6 A;  2M6Y A;  3WG7 C;  3L75 H;  5LBQ A;  1M93 A;  2EJ7 A;  2EBO A;  4UCT A;  1XIL A;  4R8C A;  1MSW D;  4FM1 A;  2XND G;  1AP6 A;  2QTO A;  1CP9 A;  2WA4 A;  3ABU A;  2OWO A;  3J80 N;  1WB7 A;  2AZ2 A;  4DV0 O;  4W4K A;  2WLL A;  4LF9 B;  3J7A U;  3CHX A;  3OD4 A;  5BZB A;  1NVP D;  3P32 A;  3RW0 A;  5IDJ A;  2K9P A;  4OX9 B;  4FFK A;  1GN3 A;  1VQM V;  1SC5 B;  2XTA A;  1X59 A;  1L0L H;  3OEE G;  3TXS A;  2MW2 B;  3SJC C;  2YID A;  4AHC A;  1R6T A;  1RSO A;  5JJE B;  3F7Y C;  2WLJ A;  4LF8 B;  3K06 A;  4HZ3 A;  4LFA B;  3TCU A;  4B3M O;  1JPX A;  4MSW C;  3BA8 A;  3K9A A;  3RWR D;  4NXM O;  4IHJ B;  4LFC B;  3T1Y B;  2OYQ A;  4QGP A;  4JZG A;  4NXN B;  2E75 B;  1AJP A;  4W4L A;  2EIL C;  1NBM G;  1LUW A;  3UM7 A;  3RYI A;  1SS3 A;  3ZHR A;  2D2C B;  2CK3 G;  2JS3 A;  1OCZ C;  3E22 B;  4HNA B;  3K5N A;  3D36 A;  3SJQ C;  4DR7 B;  3ZHV A;  2AGA A;  4ZOL A;  4JI6 B;  4K0K O;  3CJH B;  1M9N A;  5LXT B;  5BR8 O;  2Q73 A;  4Z1M G;  2IU3 A;  3HKE A;  1BHB A;  3IGA C;  1SQG A;  4AQY B;  2F1M A;  2Q9L A;  1R3J C;  2AW9 A;  3ZRW A;  2UUB B;  1I94 B;  4UCU A;  1WNS A;  5CA0 A;  4GUN A;  5LMU O;  1Z5W A;  1BZK A;  1MA1 A;  4TUY B;  4PA7 A;  2JIZ G;  4J11 A;  3ZRS A;  3CPW U;  1Z2G A;  4JYY A;  4O4L B;  2Q6A A;  1Q82 W;  3ZRX A;  1GM9 A;  3N27 A;  5C8Y B;  4UCV A;  2HFE C;  2F95 B;  1TUB B;  1WPX A;  2EIJ C;  2Q7E A;  1GMG A;  2Y4T A;  4JI0 B;  3JAR B;  1QQC A;  2DYS C;  5B5E Z;  4J41 A;  2WLH A;  5LYJ B;  2RN9 A;  3G4S V;  1RPO A;  2ZD9 A;  1R3K C;  3FB5 C;  5IJ9 A;  3VOU A;  3GVM A;  2HHH B;  1Q8I A;  1XMQ B;  5KAF Z;  4YY3 O;  1K5S A;  2BSK A;  3DXR A;  4YJ3 A;  5EC2 C;  1M90 W;  3APO A;  5HFL A;  2ZIN A;  1EZV H;  1UPG A;  4DR2 B;  4ZIB A;  1Y74 A;  4NKG B;  4JF3 A;  4GX2 A;  4C7U A;  5IYZ B;  2PGG A;  2QR4 A;  4JI2 B;  1ZL8 B;  1YF2 A;  2RNB A;  5LGU A;  1JX9 A;  3ZHQ A;  1OCZ B;  1PD3 A;  2QA4 V;  1G6U A;  2WLI B;  5L3B A;  5KLV H;  2BOB C;  1HNW O;  1HNZ O;  5E1A C;  4BAY A;  5LP6 A;  3ZBH A;  2E5L O;  5CA1 B;  4Z2W A;  3JD1 A;  1OZ0 A;  4H44 B;  2EZO A;  2B9Z A;  2DW4 A;  4O4H A;  5A9G A;  1G4Y B;  1SRY A;  1Y6X A;  3G71 V;  3A0H Z;  1K5Q A;  2YI9 A;  2AXT Z;  5KHK A;  1IXM A;  1FFT B;  4G28 B;  1NS1 A;  3OMA B;  2YEV B;  2VQF O;  1FFX A;  3QF7 A;  2P5O A;  1VAR A;  1GAX A;  1P7B A;  1PKX A;  1EFR G;  2VRZ A;  3SPJ A;  1R73 A;  1W0K G;  1H38 A;  2ZIM A;  4B3R O;  3EFF K;  2ZE6 A;  2EIJ B;  2P6J A;  1E1R G;  4DRX A;  4H0L B;  1AJQ A;  2DYS B;  3UCS C;  2BE3 A;  3ZMV A;  2F4V O;  2R9I A;  5EZY B;  5JJN B;  5IWA O;  1N34 O;  2GTS A;  5LP6 C;  3RYH B;  3CCE V;  1GH6 A;  3JAT A;  1XNQ O;  1PL0 A;  4NTX A;  3JYC A;  2IH1 C;  4DV6 B;  2H94 A;  3B8N A;  1XHX A;  5JWP A;  4X65 O;  2QE7 G;  2VS0 A;  2W6J G;  3ZN0 A;  1BS3 A;  4BW9 A;  4LF5 O;  2BCC H;  1VF6 C;  4K8X A;  5JVD B;  2UUA O;  1ZLZ A;  2EIK C;  3CB2 A;  1AI4 A;  4D7T A;  5L3F A;  1W2B U;  4DV0 B;  3CX5 F;  3LSU A;  4DW0 A;  4CH4 A;  4B3T O;  2ZKO A;  4BIU A;  1VP7 A;  3OTF A;  3TK1 A;  1QVG U;  3SYQ A;  1NU1 H;  4WBN A;  4CBC A;  3FB8 C;  1WJZ A;  5D5P A;  1TVK A;  2ETN A;  4ABM A;  2PZS A;  4QPJ A;  1OCC C;  4LF6 O;  2EJR A;  2YUA A;  2QKS A;  4KL1 A;  3CCR V;  2PY5 A;  2EIN C;  1ZX3 A;  2HR3 A;  1VQ4 V;  3Q4H A;  1F23 A;  1L8D A;  5EC1 C;  3AG4 B;  4NXM B;  2IU0 A;  5L3D A;  2O57 A;  4IYH A;  4X20 A;  3JAL B;  3L70 H;  3KG2 A;  2Q8V A;  3RYF A;  4WF9 V;  2CUG A;  5B1A B;  3LNM B;  2HJF C;  4DW1 A;  2HG5 C;  1J5E O;  1K73 W;  3SYP A;  1M57 B;  1IBM B;  4BIO A;  4D7S A;  4YHH B;  1XQ8 A;  1N8R W;  4JZ2 A;  3JSL A;  3SPH A;  4I9Q A;  4R7C A;  3K03 A;  2ZDI A;  4ZKI A;  4UV9 A;  4WFH A;  3ZRV A;  4K0K B;  3WU2 Z;  5EYP A;  5BR8 B;  1YXB A;  1K7D A;  3B4S A;  3QNE A;  5LA6 A;  2X7R B;  1ORQ C;  1AI7 A;  1JFF A;  1KEC A;  2DYR B;  4UXN A;  5J2U A;  2CTP A;  3HKC B;  2YSU B;  1XL6 A;  2ADQ B;  2VQE O;  3DSQ A;  4I4T B;  4FLV A;  5ITZ A;  4J80 A;  2WLM A;  3SGI A;  5A2Q N;  3JD0 A;  1COW G;  4Z1V A;  5KX5 B;  4DV7 O;  3PN1 A;  1S76 D;  4FM0 A;  1DLB A;  1WA8 A;  4UV8 A;  5GON A;  3RYC A;  3AEI A;  3LNN A;  1L1F A;  2LGQ A;  4LBE C;  3DC5 A;  2PYJ A;  4U7O A;  2W0X A;  1TGO A;  1FYJ A;  4PDM A;  2XAF A;  5FLX N;  4IIJ A;  2YS8 A;  3H01 A;  3FD9 A;  4X89 A;  5LHH A;  1DTO A;  5KMG B;  3E8B A;  4BIZ A;  5B1B B;  2ZDI C;  1HDJ A;  1OCC B;  3B2E E;  4LF4 O;  2YIB A;  1OV9 A;  4LNU B;  3I55 V;  4TV9 B;  3HKB A;  2UUC O;  3OTO B;  5HFM A;  3ZJZ A;  4CH5 A;  2EIN B;  2ZXW B;  3ABM C;  1SA0 A;  1BQ0 A;  1D2D A;  4PDV A;  2WA3 A;  4LR3 A;  3ETD A;  1VQK V;  2W0F C;  3FAV B;  4DR5 O;  2OTL V;  4DUZ B;  4X1Y B;  4LH7 A;  5AG2 A;  3B09 A;  3TET A;  2L6L A;  1ARO P;  1SQP H;  3EXA A;  4WFE A;  1YJW V;  1S77 D;  1FJG O;  1N36 O;  4ZHQ B;  2FKX A;  4J42 A;  4K8Z A;  3SYA A;  1SET A;  3D3I A;  1SQX H;  2YC0 A;  1HNW B;  1HNZ B;  2CDY A;  1Y76 A;  1JVM A;  1YHQ V;  1YJ9 V;  3IJ4 A;  2IJI A;  2GV9 A;  3G6E V;  2E5L B;  1SER A;  3LDC A;  5TIS Z;  4TOI A;  4DR4 O;  3AK1 A;  4FK5 C;  4CZZ A;  2FML A;  2DQ3 A;  3K5M A;  4P9P A;  3TGU H;  2IJJ A;  2JEX A;  1NKD A;  4RO2 A;  4X1K A;  4O2B A;  3H1L H;  4X66 O;  3ASO C;  2FB5 A;  5IT9 N;  1DK1 A;  4I0X B;  1W0J G;  2P22 C;  5IJ0 A;  4JYB A;  2NN4 A;  5LGN A;  4PI2 A;  4UVA A;  1MOF A;  4ASU G;  4EEQ A;  4DV3 O;  5KHG A;  2JDI G;  2N04 A;  4A5U B;  4I9W A;  3CRM A;  3WB0 A;  2UXD O;  2X6C A;  3ZMZ A;  1X4T A;  4PDR A;  1SKV A;  2Q5Z A;  2F4V B;  3IFX A;  5B3S B;  5IWA B;  3RGB A;  2LFR A;  1R1B A;  2WLK A;  1V55 C;  1AB3 A;  1VF7 A;  5LA6 B;  1XNQ B;  2QGN A;  5JCO C;  2UXN A;  2E74 B;  1XL4 A;  3ABT A;  3ABM B;  2CH7 B;  3N2G B;  2YXY A;  4B7E A;  1YSC A;  4X65 B;  5BY1 A;  4E4E A;  5J2T B;  1S5J A;  3FFQ A;  3I56 V;  3HKD B;  4FLZ A;  4CC6 A;  4X8A A;  5L3G A;  1FXK B;  2UXX A;  4UB6 Z;  3F7V C;  2A0L A;  2UUA B;  1FKA O;  3ETQ A;  4WCE V;  2ZQM A;  3NXS A;  1F4N A;  4MVM A;  1IVS A;  1XUQ A;  1Q5O A;  4PV1 B;  4GKJ O;  1JJ2 U;  5B1N A;  1H8E G;  1O9H A;  4I55 B;  3BEH A;  4UCS A;  4RAI A;  3K0D A;  4QE7 A;  1I7F A;  3LSS A;  5LMN O;  1BE3 H;  2B1G A;  3W7S A;  4TWK A;  3ZHT A;  4DUY O;  1HNX O;  3JAS A;  2ILM A;  1WP8 A;  5L3C A;  3CRC A;  3OR7 C;  1K8A W;  1CPY A;  3ZCC A;  2X6A A;  2PUS A;  3ASO B;  3A0B Z;  5H6Q A;  5LL6 Y;  5EIB C;  1CXZ B;  1YZB A;  3OW2 U;  2EUL A;  3N2K A;  4B3S B;  4FFB A;  1BCC H;  2ZM6 B;  5C93 A;  1J5E B;  2QWP B;  1IBL O;  4TQF A;  3VBB A;  4I50 B;  3OR6 C;  4O4I B;  2WWW A;  3C3T A;  2KKW A;  1R3I C;  3EVK A;  4GKK O;  5FL7 G;  1H2M A;  3A8T A;  4PA3 A;  3O9O A;  4NVP A;  5JH7 A;  5BXZ A;  3CCU V;  2JGD B;  2NNU A;  4O4J B;  1M5I A;  2M7W A;  3AG1 C;  1NT2 B;  2ZR2 A;  2LW1 A;  1V55 B;  2VQE B;  4GCZ A;  4U3J B;  1GKF A;  3WG7 B;  4TV8 A;  4DV1 O;  1B3Q A;  3FYE B;  3S3X A;  2BTQ A;  3CXC U;  2Q69 A;  3DTU B;  5K1P A;  4LF7 O;  4CS4 A;  1ROP A;  2JJ1 G;  2R70 A;  1R6K A;  4AI8 A;  2YDE A;  5DEC A;  5IYC O;  4TT3 G;  1YIJ V;  2XAS A;  3CS5 A;  4UFZ A;  3VQX A;  4YJ2 B;  1P49 A;  3JAW A;  1N33 O;  3JAK A;  2Z0A A;  3K5O A;  1D5N A;  5CBG A;  1S0V A;  1KB9 F;  4JI8 B;  5EK0 A;  3AK3 A;  1EN4 A;  3D36 C;  2LQT A;  4R6Z A;  2UU9 O;  2P90 A;  2R72 A;  4LF4 B;  3SPG A;  3ZMU A;  3RFR A;  3H1J H;  2ADP A;  3G6B A;  1IX9 A;  4TQD A;  2UUC B;  2R9A A;  3NR7 A;  2UXB O;  3JCU Z;  3E2E A;  1XRE A;  3F5W C;  3K79 A;  3E83 A;  1K34 A;  2EX3 A;  2LGW A;  3BHP A;  4JI1 O;  1PV0 A;  4D6T H;  2IBZ H;  1JOY A;  4GX1 A;  1D5A A;  1K4C C;  3WB2 A;  2R9R B;  4X1I A;  4DR5 B;  2Q0A A;  3CRR A;  3KZI Z;  3LSQ A;  2EIL B;  3ETE A;  4OXS A;  3JCZ A;  2JGU A;  3EHB B;  3MAQ A;  3CP1 A;  3ABL C;  3DGE A;  3FYI B;  3QO8 A;  1IDS A;  1FJG B;  1N36 B;  4DR6 O;  5LOV A;  4FIP C;  1RM1 C;  1W59 A;  1TUE B;  1B06 A;  2KG7 A;  1YIT V;  3ZMT A;  2WLL B;  1K92 A;  4LWS A;  4JI4 O;  1NTK H;  2L35 A;  5D5Q A;  4ZBM A;  4KUM A;  1K4D C;  4FVM A;  3ZIA G;  1QR8 A;  4DR4 B;  4UVB A;  3ZHS A;  1TA8 A;  2YIC A;  1PM9 A;  2CTQ A;  2Q0O C;  3ML0 A;  3OGC C;  1H2S B;  1YTF B;  4ZI7 A;  2ZE8 A;  4JI7 O;  3A0R A;  1RSO B;  4JYC A;  4X66 B;  1AR4 A;  1I0H A;  2V7Q G;  1YDX A;  1FPO A;  4E2L A;  3C90 A;  1JMK C;  1HR0 O;  5H6R A;  5JQG A;  4QNH B;  1U96 A;  3CC4 V;  3MDS A;  1R3L C;  5CB4 A;  1SQF A;  1SQV H;  5IY5 C;  1I08 A;  4DV3 B;  1YEW A;  3RYI B;  3QG5 A;  1SQB H;  4UB8 Z;  5KUK A;  1V54 C;  3H9V A;  2YXH A;  4MVZ A;  1UJW B;  2IH3 C;  2UXD B;  3H1I H;  1QU7 A;  1AP5 A;  4ZOL B;  4HAM A;  3E86 A;  4MVR A;  2LO1 A;  4JAV A;  2Q4P A;  3HKE B;  2GSM B;  3JSN A;  4PA9 A;  1AR1 B;  4EB6 A;  3SJA C;  4XDL A;  2XAH A;  3ZRW B;  3RT3 C;  4L8J A;  1NZ6 A;  1R6N A;  2H3O A;  3WFV A;  1ENV A;  4NR1 A;  1ZTE A;  2WSS G;  4X88 A;  3UT5 A;  5CA0 B;  3AG3 C;  1AR5 A;  2CE4 A;  1KMI Z;  3ABL B;  4F6R A;  1JCH A;  3ZED A;  1QLN A;  1RM1 B;  4GKJ B;  1H8H G;  3K0G A;  2AHZ A;  3L71 H;  4GT1 A;  2MK3 A;  4X64 O;  1HW7 A;  3U0Z A;  4LF9 O;  3SYO A;  4DXW A;  5LMN B;  3OAA G;  4I7Z B;  5H5N A;  5EBL C;  4O2A A;  5IJ9 B;  1XMO O;  4B3M B;  4YJ3 B;  2BSK B;  3DXR B;  2Z3Y A;  4GX0 A;  4FZ0 A;  5IE9 A;  3CRA A;  2QM4 A;  1IBK O;  3U10 A;  1Y74 B;  2DE0 X;  4ICG A;  3E8G A;  4WFB V;  3A2F A;  4UUJ C;  1F7Y A;  5BMV A;  1GO3 F;  1SZX A;  4LFC O;  5IY5 B;  2Q7G A;  4KXR A;  1M56 C;  3ZMS A;  4NXN O;  1OHH G;  4FLY A;  1N32 O;  1DF5 A;  4GX5 A;  1V54 B;  4GKK B;  3E8H A;  1ZUQ A;  1VQO V;  1RP3 B;  3AK2 A;  3BCC H;  2A3Q A;  3O65 A;  4DR1 O;  3IAY A;  4LP8 A;  4DK0 A;  4UCR A;  4DR7 O;  2F66 C;  5LP6 B;  2GUZ A;  4LC1 A;  3HPL C;  2E76 B;  2EZP A;  3OUF A;  5CBH A;  3T1C A;  4DV1 B;  2GDS A;  5LMU B;  4O4H B;  1PNL A;  1AI5 A;  3K08 A;  4N21 A;  4QE9 A;  2HVK C;  1NR1 A;  1VQ5 V;  1Q86 W;  4LF7 B;  2ATK C;  1PP9 H;  5KA6 A;  2EIK B;  4QPK A;  3T4D A;  4QIW F;  5FPR A;  1QR9 A;  4R50 A;  1N33 B;  3JD3 A;  3UQ8 A;  4B08 A;  1FFX B;  3VQV A;  1SQQ H;  1MZE A;  4JV5 O;  4XBF A;  4MVO A;  3LDD A;  4P2Z A;  1HWY A;  2UU9 B;  4DO2 A;  3SR2 C;  3BAA A;  4U3F H;  4PD4 F;  4DRX B;  3CWB H;  4KHP O;  4YY3 B;  1QVF U;  2UXB B;  3E35 A;  3S3W A;  4LFB O;  1ZWI C;  2YXL A;  1OCR C;  1QLE C;  1SF9 A;  1RFY A;  3U11 A;  3CEI A;  3JAT B;  4GZR B;  1Q6H A;  3RN4 A;  5JJJ B;  2NLJ C;  5FPO A;  4MW8 A;  2HHH O;  2JVD A;  1XMQ O;  1GN6 A;  4GLX A;  4IHJ A;  2DQ0 A;  4JTC B;  1YVW A;  2N05 A;  1OJH A;  2YIB D;  2JRI A;  4IT5 A;  4PJ0 Z;  4UCO A;  1URF A;  2RQ6 A;  4DR6 B;  1I5X A;  3E22 A;  3E8F A;  4HNA A;  1KBH A;  1MMM A;  5GTI Z;  1KP2 A;  1VQP V;  1EBO A;  3T2M A;  4F4L A;  4J9Z B;  4JI4 B;  3R65 A;  2DWD C;  4CS2 A;  2FYU H;  3CJH A;  4LCU C;  4WBN B;  2XT9 A;  5LXT A;  1WN7 A;  1Z5V A;  3H1H H;  3W7U A;  1TVK B;  1XEQ A;  4MW3 A;  2QWQ B;  1Y67 A;  1YI2 V;  1MSD A;  5L3E A;  3RBZ A;  2F43 G;  4JI5 O;  3FKS G;  2K1E A;  2ZE5 A;  5H2F Z;  4NYK A;  2LW7 A;  3BRC A;  2CTR A;  2HEP A;  4JI7 B;  3B40 A; 
#chains in the Genus database with same CATH homology
 5FL7 G;  1K5Q A;  4PA3 A;  1MAB G;  5DN6 G;  2IJH A;  5CBF A;  1KKD A;  4JGS A;  4TSF G;  1IXM A;  3CCU V;  3ETG A;  5IYB O;  1FFT B;  2NNU A;  2EIM C;  4YXW G;  4G28 B;  4P9O A;  3RVY A;  3AG1 C;  2M7W A;  3OMA B;  2YEV B;  1YJN V;  3MHH C;  5CA3 A;  2ZR2 A;  3STZ C;  1V55 B;  1P7B A;  3STL C;  4GCZ A;  1PKX A;  1GKF A;  1EFR G;  4MTO A;  3WG7 B;  3SPJ A;  1R73 A;  3QO5 A;  1F4M A;  3SPC A;  3FYE B;  2Y69 C;  1W0K G;  1H38 A;  1H2G A;  3CXC U;  3EFF K;  3AG3 B;  2Q69 A;  3DTU B;  2EIJ B;  1MG1 A;  2P6J A;  4PA6 A;  3X2Q C;  2A9H A;  3CMA V;  1M1K W;  1E1R G;  1ROP A;  1FXK A;  1AJQ A;  2DYS B;  2JJ1 G;  3B77 A;  5CN0 A;  3ZMV A;  1R6K A;  5IYC O;  4TT3 G;  1YIJ V;  2A79 B;  2XAS A;  2R9I A;  1GK9 A;  4L87 A;  2QM7 A;  3CCJ V;  1OCR B;  1QLE B;  3CCE V;  3CC7 V;  1S0V A;  4PA4 A;  5CBG A;  3CCM V;  1S3J A;  5EK0 A;  4WFG A;  1PL0 A;  2JK5 C;  3ASN B;  3K04 A;  3JYC A;  2QEX V;  2IH1 C;  1EZJ A;  4R6Z A;  2OCC B;  5J9P C;  2H94 A;  3B8N A;  2P90 A;  2QE7 G;  2W6J G;  1J95 A;  1G8M A;  3SPG A;  3ZN0 A;  3ZMU A;  5LHG A;  2EIK C;  5B3S C;  3E2E A;  1AI4 A;  3F5W C;  3K79 A;  3E83 A;  2HLD G;  1K34 A;  5L3F A;  1SZT A;  1W2B U;  2WLI A;  1VQN V;  3MD0 A;  4BIU A;  1JOY A;  3OUS A;  1FS0 G;  3TK1 A;  1BL8 A;  1Y66 A;  1QVG U;  4JTD B;  3SYQ A;  3OFN G;  4GX1 A;  1I5Y A;  1K4C C;  4N23 A;  4CBC A;  3FB8 C;  2R9R B;  2JEU A;  4MTF A;  3CYO A;  2BOC C;  4QPJ A;  3LSQ A;  1OCC C;  2EIL B;  3ETE A;  4PDL A;  4OXS A;  3JCZ A;  4XDK A;  1Y4M A;  3EHB B;  1M56 B;  2EJR A;  2V1D A;  2QKS A;  3ABL C;  3CP1 A;  3DGE A;  3FYI B;  1NH2 D;  2WPD G;  3QO8 A;  1FXK C;  2H8P C;  1K9M W;  1QBZ A;  3CCR V;  1PNK A;  2XAG A;  2EIN C;  1NH2 B;  3MHS C;  4JAU A;  1F51 A;  2HR3 A;  4FIP C;  1RM1 C;  1NJI W;  4H37 A;  1VQ4 V;  4U7N A;  4MT8 A;  1TUE B;  2X0L A;  1F23 A;  5EC1 C;  1YIT V;  3AG4 B;  3ZMT A;  2WLL B;  1K92 A;  2IU0 A;  1GM7 A;  4RUE A;  5L3D A;  4FJC C;  4G27 B;  1K97 A;  2ITC C;  1FXV A;  4MTG A;  1S72 V;  3LDE A;  1E1Q G;  1B6Q A;  2Z5U A;  3KG2 A;  4MS2 A;  4WF9 V;  4ZBM A;  4KUM A;  2EIM B;  2YEV A;  1Q7Y W;  5B1A B;  3LNM B;  1K4D C;  3T4Z A;  4WFA V;  4MVU A;  3ZIA G;  2HJF C;  5DM6 V;  1QR8 A;  2HG5 C;  1E79 G;  4FMT A;  1K73 W;  1YTF D;  4UVB A;  3OEH G;  3OE7 G;  3SYP A;  2IW5 A;  1M57 B;  3OM3 B;  3ML0 A;  3SYC A;  2B5U A;  3OGC C;  1YTF B;  1N8R W;  1S5H C;  4G2K A;  4MVQ A;  3SPH A;  2HKO A;  3K03 A;  2Y69 B;  4R7C A;  2ZDI A;  3A0R A;  4JYC A;  4ZKI A;  4UV9 A;  2Q68 A;  2V7Q G;  4WFH A;  2QM8 A;  3ZRV A;  4E2L A;  1K33 A;  1KC8 W;  2Q67 A;  3CCV V;  1VQ6 V;  3X2Q B;  5KUM A;  5H6R A;  1K7D A;  3QNE A;  4QNH B;  3CC4 V;  1NR7 A;  2X7R B;  1R3L C;  1JQ0 A;  1ORQ C;  3ABK C;  3OMI B;  1AI7 A;  1KEC A;  2PI4 A;  2DYR B;  4UXN A;  5IY5 C;  2YSU B;  1XL6 A;  2OT5 A;  5KUK A;  1V54 C;  2WLM A;  4BW5 A;  3BY6 A;  2X6B A;  4MVZ A;  2LP7 A;  1UJW B;  3JD0 A;  2IH3 C;  1COW G;  1AJN A;  5LGT A;  4RUF A;  4UVC A;  1P4R A;  4HAM A;  2XAQ A;  3E86 A;  4MVR A;  2IJK A;  1S76 D;  1DLB A;  2JJ2 G;  4UV8 A;  4JAV A;  3AEI A;  2HVJ C;  1L1F A;  2DWE C;  2GSM B;  4PA9 A;  5LHI A;  3CC2 V;  4PEL A;  1AR1 B;  3OMN B;  4RQE A;  3FB6 C;  1DF4 A;  2XAJ A;  4XDL A;  4LBE C;  1KQS U;  1KP3 A;  3B8M A;  2XAH A;  4U7O A;  3ZRW B;  3K3W A;  3QO7 A;  3FB7 C;  1VQ8 V;  4JPR A;  3P30 A;  4PDM A;  1THZ A;  2Y48 A;  1R6N A;  2XAF A;  5B1O A;  3WG7 C;  3H01 A;  3WFV A;  5LBQ A;  1ENV A;  2ITD C;  4X89 A;  3W7T A;  1BHA A;  5LHH A;  1DTO A;  2WSS G;  3E8B A;  4X88 A;  4BIZ A;  5B1B B;  2ZDI C;  1PNM A;  2P7T C;  3AG3 C;  1OCC B;  2EBO A;  3E89 A;  4R8C A;  1MSW D;  3AG2 C;  3I55 V;  3ABL B;  2XND G;  2QTO A;  2LFS A;  1CP9 A;  4JAS A;  1VQL V;  3ABU A;  1JCH A;  5HFM A;  2XOK G;  3ZJZ A;  2EIN B;  2ZXW B;  1QLN A;  2FTK A;  1RM1 B;  3ABM C;  2WLL A;  1GTO A;  1H8H G;  5H9C A;  3K0G A;  2AHZ A;  1BMF G;  3JD2 A;  4GT1 A;  2MK3 A;  4PDV A;  5BZB A;  1FXH A;  1NVP D;  3P32 A;  2C2A A;  3RW0 A;  3ETD A;  4HYO A;  2W0F C;  1VQK V;  2OTL V;  3SYO A;  4DXW A;  5IDJ A;  1VQM V;  3OAA G;  3TET A;  1NVP B;  1ARO P;  3OEE G;  5EBL C;  2P67 A;  3PJS K;  4WFE A;  1YJW V;  1S77 D;  1CEZ A;  4I5S A;  3SYA A;  1SET A;  3D3I A;  3F7Y C;  2Z3Y A;  4GX0 A;  4KFM A;  2WLJ A;  1WLE A;  3K06 A;  4HZ3 A;  3TCU A;  1JVM A;  3CCS V;  1JPX A;  1GM8 A;  4H33 A;  4MSW C;  1YHQ V;  1YJ9 V;  3K9A A;  2IJI A;  3AG1 B;  3G6E V;  4KP4 A;  3E8G A;  4WFB V;  1SER A;  2ZR3 A;  4UUJ C;  3ABK B;  1AJP A;  3LDC A;  5EBW C;  2EIL C;  1GO3 F;  1NBM G;  3UM7 A;  5IY5 B;  1M56 C;  2CK3 G;  3ZMS A;  4RQF A;  1OCZ C;  5KA5 A;  4FK5 C;  4CZZ A;  1OHH G;  1DF5 A;  2AHY A;  2DQ3 A;  3JD4 A;  1V54 B;  4GX5 A;  3CCL V;  3E8H A;  3D36 A;  4P9P A;  1VQO V;  2IJJ A;  2WLN A;  2JEX A;  3SJQ C;  1NKD A;  4RO2 A;  3ZN1 A;  4MTX A;  4LP8 A;  3ASO C;  1M9N A;  3AG4 C;  1OCO C;  4Z1M G;  2IU3 A;  1BHB A;  3IGA C;  1W0J G;  2GHY A;  1QQH A;  4JYB A;  4Q20 A;  4LC1 A;  3GWO A;  1R3J C;  3HPL C;  2EZP A;  3OUF A;  3ZRW A;  5LGN A;  5B1A C;  4UVA A;  5CBH A;  1MOF A;  3T1C A;  4ASU G;  3LUT B;  2JDI G;  1PNL A;  1AI5 A;  3K08 A;  4N21 A;  2D3O W;  3W7X A;  1M57 C;  4QE9 A;  4I9W A;  2HVK C;  1NR1 A;  4P30 A;  3W7W A;  1VQ5 V;  1Q86 W;  2ATK C;  2X6C A;  3ZMZ A;  4PA7 A;  4PDR A;  2JIZ G;  2EIK B;  3IFX A;  4QPK A;  5B3S B;  5KA6 A;  3T4D A;  4QIW F;  3ZRS A;  3CPW U;  1QR9 A;  4R50 A;  4J9Y B;  2LFR A;  3HB3 B;  3AG2 B;  2Q6A A;  2WLK A;  3CCQ V;  1V55 C;  2B1I A;  3JD3 A;  1Q82 W;  3ZRX A;  4MVS A;  4XBF A;  1GM9 A;  2DYR C;  4MVO A;  1VQ7 V;  2UXN A;  1VQ9 V;  3LDD A;  1XL4 A;  4P2Z A;  3ABT A;  1HWY A;  3ABM B;  2HFE C;  1YSC A;  4DO2 A;  2KB1 A;  1WPX A;  2EIJ C;  2OTJ V;  1GMG A;  3I56 V;  1K3E A;  2DYS C;  2WLH A;  4X8A A;  3M99 B;  5L3G A;  1FXK B;  2UXX A;  3F7V C;  2A0L A;  3G4S V;  1QVF U;  1RPO A;  2ZD9 A;  3E35 A;  1R3K C;  4WCE V;  3FB5 C;  4QJF B;  3VOU A;  1ZWI C;  1OCR C;  2ZQM A;  1QLE C;  3CD6 V;  3NXS A;  1F4N A;  1K5S A;  4MVM A;  5EC2 C;  3ASN C;  1M90 W;  4XDJ A;  1JJ2 U;  2NLJ C;  2OCC C;  4MW8 A;  5HFL A;  5B1N A;  1Q81 W;  1H8E G;  2DQ0 A;  3IC7 A;  4JTC B;  4JTA B;  4JF3 A;  3BEH A;  4RAI A;  4GX2 A;  3K0D A;  4QE7 A;  5GW7 A;  2WAM A;  4WFF A;  5B1B C;  3LSS A;  5LGU A;  1JX9 A;  1I5X A;  2B1G A;  3E8F A;  4TWK A;  3W7S A;  1OCZ B;  1PD3 A;  2QA4 V;  3CME V;  2WLI B;  1KP2 A;  4EKW A;  1VQP V;  5L3B A;  1EBO A;  3T2M A;  2BOB C;  4F4L A;  2ZXW C;  5L3C A;  4J9Z B;  3OR7 C;  3RVZ A;  1QCE A;  3GB7 C;  3R65 A;  2DWD C;  1K8A W;  1CPY A;  4LCU C;  5E1A C;  3ZCC A;  2X6A A;  4BAY A;  1NQT A;  3ASO B;  3W7U A;  5H6Q A;  1OCO B;  2W6I G;  4MW3 A;  3OW2 U;  1YI2 V;  2PI5 A;  1AI6 A;  5C93 A;  3SPI A;  5CMU A;  5L3E A;  3RBZ A;  2F43 G;  3JD1 A;  3VBB A;  1RPR A;  1OZ0 A;  1SES A;  3FKS G;  2EZO A;  2K1E A;  2DW4 A;  3OR6 C;  1G4Y B;  5EBM C;  1SRY A;  1LNQ A;  1KD1 W;  2WWW A;  5IYD O;  3G71 V;  4FPP A;  3UKM A;  1R3I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...