1R6KA

Hpv11 e2 tad crystal structure
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
187
Chain Sequence
AIAKRLDACQDQLLELYEENSIDIHKHIMHWKCIRLESVLLHKAKQMGLSHIGLQVVPPLTVSETKGHNAIEMQMHLESLAKTQYGVEPWTLQDTSYEMWLTPPKRCFKKQGNTVEVKFVMEYVVWTHIYLQDNDSWVKVTSSVDAKGIYYTCGQFKTYYVNFNKEAQKYGSTNHWEVCYGSTVICS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the E2 Transactivation Domain of Human Papillomavirus Type 11 Bound to a Protein Interaction Inhibitor
pubmed doi rcsb
source organism Human papillomavirus type 11
molecule tags Transcription, replication
molecule keywords HPV11 REGULATORY PROTEIN E2
total genus 61
structure length 187
sequence length 193
ec nomenclature
pdb deposition date 2003-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1r6kA01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 1r6kA02
1QQHA 1R6KA 2JEUA 1TUEB 1R6NA 2JEXA 1DTOA 2NNUA
chains in the Genus database with same CATH superfamily
2GTAA 4JYBA 2ZE5A 4PA6A 1D5AA 1ZSPA 2IM9A 4JYYA 2FTKA 2JRIA 2Y4TA 4AQYO 4X88A 3ZHUA 4ABMA 4ZHQB 1Z5WA 1SERA 1RM1C 1VQ7V 1URFA 4WFAV 1YJ9V 4YIPA 3OUSA 3PN1A 2R9IA 2LGQA 2RN9A 2Q6AA 4UCOA 2AGAA 1B6QA 5CN0A 5LOVA 1YXBA 1ZX3A 1HDJA 4CBCA 3FB5C 4LFCB 3QO5A 4B3RB 4UVCA 4GYCB 1OCCC 5EC2C 1AP5A 2KG7A 1K7DA 2R9AA 4R50A 4UVBA 1LNQA 1AI4A 3N2GA 3ASOC 4UB8Z 3OMAB 2XAHA 1Y66A 2EINB 3STZC 1H2GA 4NXMB 1VF5B 2ZDIC 2B9ZA 2JK5C 2OCHA 2UUBO 3IC7A 1UJWB 3T1HB 4MSWC 4G27B 3WG7C 3T1YB 2HJDA 1QLEB 3JAKA 3TK1A 2MW2B 4JI8B 4PDMA 5FL7G 3K03A 5GTHZ 3RWRD 5C8YA 4JZ2A 3OMNB 4DR3B 4NXMO 3KG2A 4I4TA 5F2VO 1WA8A 1N32B 1VQ5V 1WJZA 4DR5O 4K0KB 5IT9N 1BZKA 3THOA 1GN2A 3ICXA 3HKBA 4CH3A 2XTAA 4J9YB 3D3IA 3W7UA 2DJVA 4RUFA 2ZR2A 3WG7B 5GONB 1WNSA 5GONA 1I7FA 1HNWO 4LWSB 5JVDA 1NTMH 4MW8A 1YJNV 3ASOB 4PA9A 4AHCA 4JI2O 2ZNIA 1QQHA 5B1BC 3RYCA 1OHHG 4GKJB 4OPAA 2W0FC 1YI2V 1XHXA 3K58A 1W0KG 3VQWA 3EFFK 3ZRWA 1K8AW 1SS3A 2QM8A 2ODMA 1Y74B 3PJSK 4MVMA 1H38A 2P6JA 4DR7O 2WLLA 2QA4V 3JSLA 1ZL8A 1I94O 1NR1A 2RNBA 2HFEC 4DUZB 2CGOA 1Q86W 1M5IA 1FJGB 2DOSA 4K8ZA 3SYCA 1MOFA 3HPLC 1ZWIC 1MG1A 2CAZC 2ZD9A 1H2SB 3AG4B 1H8EG 4LF4O 3K9SA 1S5LZ 5IY5C 4JAUA 3K06A 2UXCO 3ZMTA 1TAEA 4FFBA 1M9NA 4BIZA 4FLWA 3TGUH 4WFGA 2RDCA 3MHSC 5L3EA 1BT8A 4ZIBA 1BE3H 3CB2A 4P9OA 4GKKB 5JWPA 5LGNA 4HNAA 3DXRA 2GBOA 3ABMC 1FJGO 1NI8A 4JTDB 1EZVH 3BABA 5B3SB 3RBZA 3B09A 2UXBB 1JR9A 2DWDC 3JD3A 1SESA 1W0JG 5B5EZ 4DRXB 1KBHA 1QLEC 4CH4A 1UFIA 4PI0A 4FM1A 4YJ2A 2YS8A 3NR7A 2VRZA 3WB2A 1R3KC 2QJ1A 3QVNA 1GM9A 4UCUA 3APQA 1VQ9V 2XHBA 2PGGA 3ABKC 5LL6Y 2OTLV 4KHPB 2B1GA 3CCSV 4X9QA 2CH7A 2X6CA 2FYUH 5LP6B 4FLTA 2OIGA 4PDLA 1NZ6A 1K33A 1AJQA 4H33A 2ZM6O 1FS0G 2VQFO 4X20B 3CCQV 1OJHA 2UUAO 3OAAG 4ZOLA 1WAZA 4ZOLB 5JCOC 1PP9H 2DYSB 4I0XB 1JCHA 1QVGU 3KCXA 1N8RW 2RJZA 3OT7A 2WLIA 4J7ZA 2PY5A 4PELA 1G4YB 1IXBA 1BL8A 1H2LA 4JYAB 4UCVA 4LFAO 4DV1O 2HHHO 4E2LA 1DF4A 4B08A 1VF6C 4BAYA 3VQYA 2CUGA 2QWOB 1S0VA 3RYFA 2QE7G 2UUCO 4K0KO 3OEHG 3L71H 4MVOA 3ZIAG 5KHGA 1K5SA 2ZM6B 1VEWA 3HKDB 2A0LA 4DV7O 4AI8A 4LWSA 1HP8A 4H0LB 1GN4A 4F6RB 2FKXA 1N33O 5J2UB 1CPYA 1QNMA 4W4KA 4J7KA 4NB5A 1GO3F 1DLBA 4O2AB 2XASA 3RYHB 3ZHQA 3DGEA 4O2AA 3RYHA 4O4LA 2X0LA 4PHZA 2AHZA 3CRRA 4R6ZA 3CE2A 2WLKA 1BS3A 3CC7V 5B66Z 4DUYO 4X1IA 2FB5A 1IBLB 1XOUA 3GWKC 2JJ1G 5JQGB 1EM1A 1QBZA 1B06A 2ITDC 4IYIA 4TSFG 4GZRB 3HKDA 1S5HC 2BSKB 1O9GA 4DK1A 3OR6C 2ZE6A 1G8MA 2XAJA 3ZHVA 2GUZB 2FL4A 3RYIA 4UCTA 1F4MA 2NLJC 3CJHB 1F4NA 4U3JB 2V7QG 4DUZO 1S5JA 2BTOA 2ZIOA 2CTRA 4J9ZB 4LF9B 4FMTA 3JCUZ 5B1NA 2PUSA 2W6IG 4JV5B 4B3TO 5K1XA 3BA8A 4MTGA 2DW4A 1XMQB 3L73H 1TVKA 3CEIA 5JH7A 3GVMA 2QWPB 2DYSC 4BW5A 3RVYA 1SQVH 3TXSA 1VMGA 3JASA 4DXWA 5LP6A 1VQ8V 2PYLA 1KB9F 1KKCA 2YEVB 1YTFD 3I55V 4JI4O 4LF7O 2OTJV 4PJ0Z 1XDCA 2WLJA 3J80N 2Q7HA 3LDEA 3OE7G 3JARA 3ABTA 2YIDA 2HJFC 4KXRA 4TV8B 1N32O 3CHXA 4NYKA 4JI2B 4I0XA 4IL6Z 1BQ0A 2CE4A 5A9GA 3ABLC 1R1BA 2CTQA 2QWNB 5LHGA 4X64O 5LGTA 3SPGA 4DV3O 5LMUO 4G2KA 4JI6B 4O2BB 1AR1B 3CC4V 5IYZB 2YC0A 2L35A 5CA0B 1JFFA 5DEDA 3CCJV 2XUMA 4FPPA 1XREA 4OPHA 3RVZA 1Q6UA 2UUBB 1XL4A 3HKBB 1JJ2U 2P5OA 3JAWA 3SYPA 2VS0A 1F51A 3WB1A 4DR6O 4TUYA 4DV0O 5EK0A 3TXQA 5IDJA 2GV9A 5J2TA 5CBFA 1IZ3A 4LFAB 2OWOA 4DV0B 3W7XA 4DV2O 5LYJB 1S3JA 3FAVB 2EJ7A 3B2EE 4YHHO 4LH7A 3RYCB 3L74H 4J80A 4PA3A 1KMIZ 1DF5A 3OUFA 5H6RA 5B1BB 2EILB 3OM3B 1G1XB 4LC1A 2Z0AA 4I9WA 4FLXA 5JQGA 1N0NA 1Y76B 4IYHA 4O4HA 2EIMB 2V1DA 4NTXA 2DE0X 3JD4A 2EIKB 3SPCA 3B77A 3TCUA 1GAXA 4U7NA 1BQZA 4TQFA 3RFRA 1VQLV 1Y74A 3ETQA 3HKCA 3A0BZ 5H5NA 4B3SB 2WSSG 2QWRB 4PDRA 2GTSA 3C90A 4CS4A 1EZJA 3SPJA 2P06A 4MVRA 1SQGA 5FNVA 4KUMA 3JALB 5AG2A 1Q7YW 1XUQA 1HNZB 2WWWA 5ITZA 1FAFA 3P30A 3K04A 1YJWV 1JA8A 4PI2A 4QE9A 1BHBA 3TJTA 4F4LA 5L3DA 1FXHA 3EXAA 1MSDA 3K08A 1M57C 2Q73A 4JI7B 3A2FA 4HAMA 3JD1A 2IBZH 2F95B 4FM2A 3GB7C 3ZMVA 3AK3A 5L3GA 1OCOB 1K4DC 5EZYA 4JV5O 2XNDG 2ZCEA 3FYIB 1VQNV 1WB8A 3P32A 1IVSA 3E83A 4PA7A 3K9AA 2E75B 1ZLZA 1R6TA 3B40A 4DR4O 4WFBV 1XHZA 4DRXA 2EIKC 1V55C 1SQXH 1S76D 1TUBB 4WFHA 3F7VC 4PA4A 3L70H 5EIBD 3ZRXA 1HWYA 2R9RB 1FXKA 2ZXWB 5L3CA 3G6EV 3SPHA 3H1HH 4YJ3A 3SYAA 3IJ4A 3T1YO 4DUYB 1IBLO 2Q9LA 2CH7B 1P7GA 3FFQA 2ZR3A 4CH6A 2UXCB 2JS3A 3BY6A 3UO2A 3IAYA 1FYJA 1FKAO 2P4VA 4Q6GA 1BCCH 1Q90D 4P9PA 3HKEB 1Q6HA 1KP3A 4X1KB 2JVDA 1CEZA 1I08A 5CB4A 1I5YA 1K97A 2HR3A 5J2UA 3CRAA 4DV1B 4OXSA 1GRJA 3H1JH 5KHIA 4FLYA 4L8JA 1SQBH 1AJPA 5IE9A 4MS2A 2VWJA 5LA6B 3ZBHA 2YXHA 2VQFB 2KQXA 5ITZB 4QPKA 1RM1B 1J95A 5FLXN 4KFMA 5LBQA 4YHHB 2PI4A 4GX1A 5IJ0B 4NKGB 2DN9A 1JPXA 2HP8A 4DR2O 3UM7A 1Z5VA 3U10A 4P2ZA 3ZN1A 4I9QA 2BSKA 2YXLA 2JS5A 1S72V 2WLNA 1K92A 1XNQO 3K79A 3K0DA 1EFRG 4AILC 4EFEA 4J7JA 4RWUA 5EC1C 2P22C 2DWEC 4EEQA 2F66C 3HKCB 2RQ6A 1SQPH 3OEEG 3AK1A 1XMOO 2IH3C 1HNXB 2QKAA 3BEHA 2UXBO 3OR7C 2JEXA 3ZRSA 4RQFA 3APOA 2IH1C 3A8TA 4UB6Z 3H01A 1ZAUA 2UXDB 4I55B 2ZXWC 2LP7A 1UPGA 4LBEC 3ABKB 3ZMZA 1R6KA 1BMFG 5CA1B 2VQEB 1F7YA 5IWAB 1M57B 1YF2A 3M7MX 3ZMSA 3K0GA 4BIOA 3DXRB 1COWG 2YEVA 4DV5O 2XAQA 2IU3A 3E8HA 3LDDA 3FX7A 1H2NA 3BA9A 5EBMC 1OCCB 1YEWA 2QTSA 4IHJA 3G80A 1YVWA 3ZMUA 1TGOA 2Q69A 4UCRA 2Y4UA 3SGIA 1VP7A 1EN4A 2B1IA 2ITCC 3W7WA 1IBKO 3W7SA 2Q68A 5KHKA 4D7SA 1Q6IA 1NS1A 4DV4B 2N05A 4MTXA 1RPRA 3CX5F 1WN7A 1VARA 1QU7A 2GSMB 4DW1A 2CTWA 2ZKOA 2DQ3A 1GK9A 2A7WA 2R72A 5D5QA 1MABG 1EBOA 1R6NA 5J9PC 2ZE8A 3MDSA 4FLVA 2OYQA 3J81N 1XEQA 2EZOA 5LMNO 1JFFB 4LFBB 3UCSC 3JD2A 2UUCB 4UUJC 3MHHC 2IJJA 2Q7GA 3FYEB 2BOBC 3O65A 4FLUA 4EKWA 3FAVA 2WLHA 4Z1MG 3GWOA 2BE3A 3HR0A 3X2QB 3WFVA 1NT2B 3BHPA 1MMMA 2A9HA 1MZEA 5JJNB 2JGDA 2M6YA 4DR6B 1RFYA 1IDSA 1SQQH 2Y69B 2P4KA 5BR8B 4IGGA 1QCEA 1ROPA 4TV9A 1J5EO 2UUAB 1NR7A 1LUVA 1QLNA 4WFEA 2UXXA 5EYPB 4CH5A 2OCCB 4LF8O 2A79B 2K9PA 3T1CA 1BGYH 4KHPO 4WFFA 1YCIA 2OIEA 3CJHA 4H37A 3CXCU 4CS2A 5E79Z 4GX2A 3WB0A 3G6BA 3ETEA 5HFLA 1R3LC 3SJAC 3K5LA 2LGWA 4JI3O 4JI1B 1I0HA 4DR4B 2HLDG 3BPZA 3X2QC 1FPOA 4CZZA 4X65O 3UQ8A 4J41A 3B4SA 3E2EA 1V54C 5CBGA 5CA1A 4JPRA 1RP3B 2EIJB 2NR5A 4DV2B 4FM0A 2DYRC 1MNGA 1FXKC 4I55A 1AROP 3A0HZ 4LCUC 1OCRB 1HNXO 3BFRA 3R65A 3CCMV 1QQCA 1FXVA 1VQKV 1XL6A 3CRCA 5CBHA 2H94A 4ZKIA 2Q8VA 2XT9A 1TA8A 3AG2B 3P3PA 3SYQA 1YZBA 4NXNO 1ZL8B 2VWKA 4NVPA 1Q82W 4LF8B 4U3JA 1PNKA 3KCYA 4IHJB 4ZBMA 2CTPA 1SETA 4JYAO 1KUQA 2BTQB 2B5UA 2DYRB 3E8GA 4HYOA 2LQTA 3CPWU 1VQPV 1JQ0A 1SZXA 1VIBA 4LF5O 2QKSA 3D3QA 3EVKA 3K59A 3ABUA 4GLXA 2E3CA 2ZIMA 1AILA 1KP2A 3JAKB 2CGNA 1EN6A 3UKMA 4FFKA 1K34A 3K57A 1LUWA 3AG7A 5JH7B 3NXSA 3ZHRA 5IJ9B 1M90W 4MW3A 4JTCB 2IJHA 1P49A 1O9HA 4JAVA 2OCCC 5LMNB 4LFBO 1XNRO 5KHJA 1A32A 5IYDO 4QPJA 1GKFA 2KKWA 1XMQO 3ZEDA 2WA4A 5JJJB 3JATB 4F6EA 3I56V 4LF5B 3CWBH 4LNUB 3KZIZ 4EB6B 4QNHB 3WU2Z 2YSUB 1E79G 2WAMA 3SDLA 2EZPA 3E22A 5LXTB 5LP6C 4UV9A 5LA6A 4XBFA 2Z3YA 2MK3A 3DSQA 4PV1B 4DR3O 1U96A 4NXNB 5D5PA 3G4SV 5LGUA 4UVAA 4XDJA 1KU9A 4TV9B 2Q67A 3S3XA 4JI6O 3ETDA 1WLEA 3STLC 2LO1A 5BXZA 2EIJC 1BSMA 4JI3B 4K3AA 5LYJA 4DR2B 3L75H 1S77D 1L1FA 3J7AU 1YDXA 2YIAA 5BY1A 4N21A 2VQEO 3FB8C 5GTIZ 1W59A 1AR4A 4YY3B 3ABMB 5BMVA 3CMAV 4B3MB 5LOVB 2WA3A 1RPOA 4JI5O 3D36C 1OCZC 1GTOA 2JEUA 3CCEV 5EBWC 3CSXA 2F4VO 2DQ0A 4DV3B 1TVKB 4JI8O 4L87A 1JOYA 3A0RA 4FZ1A 4X64B 4WBNB 2L6LA 1JMKC 5C93A 1K9MW 3QO7A 4FVMA 1THZA 2QR4A 2EILC 4WBNA 1E1RG 1VF7A 2QEXV 3N2GB 1B3QA 3G71V 3OTOB 2YI9A 4D7TA 4YXWG 2E76B 3T2MA 3CXHF 3K5OA 4JI4B 3C3TA 3OD4A 5IYBO 3E35A 4W4LA 3E86A 5L3FA 4JTAB 2Z5UA 2Y48A 1VF6A 4DK0A 1N34B 4HZ3A 3ABLB 2Q7EA 1FD9A 3SJQC 3FD9A 2GDSA 1VQMV 3ZJZA 3RT3C 4P30A 1AI6A 3AG3C 5KLVH 1QR8A 4DR1B 2AHYA 4X89A 1WP8A 1GM8A 4CS3A 4J42A 1SQFA 1AP6A 3ML0A 1TUEB 2QTOA 1NVPB 4DYLA 3B8NA 4YIOA 2LJ2A 3QF7A 5KX5B 3LNNA 3E22B 3C3SA 1JVMA 2NN4A 2RMKB 5LMUB 1N33B 1Q43A 3AG1C 1SKVA 2Y0IA 5JVDB 4O4JA 2KB1A 5B1AC 1PV0A 4QJFB 4H13B 2AZ0A 5LHHA 2Q0OC 2Y0PA 3E89A 1XQ8A 4FK5C 5IYZA 3HB3B 2LW7A 4JASA 2JGDB 3UO3A 1NU1H 4Z1VA 1XI1A 4OX9O 4UCSA 1SZTA 1AJNA 5J2TB 3D36A 3OFNG 2N04A 1OCRC 3OMIB 5GW7A 4X66B 4MVQA 2ILMA 1XNRB 4JAAA 4CC5A 2WLLB 4MVZA 1Y67A 2BOCC 4KP4A 4JI0O 3I5DA 3H1LH 4TQDA 4XDKA 3CP1A 3ZHSA 1E1QG 1KYOF 3F5TA 4ZI7A 1H2MA 1XNQB 1D5NA 2QDOA 4LH6A 4O4HB 4ZHQA 1G6UA 2Y69C 1AVMA 1N4CA 2EINC 3JAWB 2JGUA 2A3QA 3DC5A 3IGAC 3RN4A 4ICGA 4QGPA 4BW9A 2QM4A 3CC2V 2GUZA 4X65B 4A5UB 5H6QA 1DGSA 4N23A 4Z2WA 5A2QN 3IFXA 1ENVA 5KA6A 3ETGA 3CMEV 4NR1A 5DECA 3R66A 3SR2C 4U7OA 5KHHA 3SJCC 2PTMA 1ORQC 2BTQA 3T1HO 5KX5A 1GMGA 3BRCA 3M99B 1R73A 1VQ4V 4QIWF 2FMLA 4MTFA 3RW0A 4YJ2B 1OZ0A 1PL4A 2P90A 2XAFA 4CC6A 2YI8A 4C7UA 2RCVA 1P4RA 3JASB 3ASNC 4DV7B 2DMXA 1DK1A 4YY3O 3ZRVA 4JF3A 4DW0A 2IJIA 2CDYA 2ZNJA 3TETA 2YIBD 1HR0B 2F93B 2ATKC 2AXTZ 2ETNA 1K5QA 3LSQA 1QHTA 4D6TH 4GKKO 3K5MA 4K8XA 3L72H 3O9OA 1OCOC 5B1OA 2IU0A 4LNUA 2GHYA 5KUMA 5IY5B 4RAIA 1MA1A 3JAMN 1HNZO 1R3JC 1VQOV 1F23A 1SA0B 5C8YB 3CRMA 2ZE7A 5KAIZ 1FFTB 2HEPA 2X7RB 1JJOA 1V55B 4PD4F 1SF9A 4O4LB 2WLIB 1X4TA 3BCCH 4QE7A 1PPJH 4LR3A 1NH2B 3KKYA 3F7YC 1NVPD 4LF7B 4GUNA 2E74B 3FB6C 3OTOO 4AQYB 1CXZB 4K35A 5BZBA 2P7TC 4B3TB 1YTFB 5CB4B 4ASUG 3CYOA 3RYFB 1GN3A 3UT5B 5KMGA 3JATA 1HNWB 4EB6A 2EULA 3RGBA 1K4CC 1H2KA 5H2FZ 4UV8A 2QSAA 4LP8A 3U0ZA 2HVJC 3JYCA 1YIJV 3AK2A 4X1IB 1Q8IA 4NTYA 3ZN0A 4RO2A 4B3SO 2YICA 3JD0A 3AG4C 1HR0O 3N27A 3CRQA 4JGSA 4GT1A 3H1IH 3QNEA 3S3WA 1KD1W 5IJ0A 2ZT9B 3E8BA 3G67A 1N0JA 3B8MA 3QG5A 3MAQA 2F23A 1Y6XA 4DR1O 5DM6V 1Q3EA 4H44B 4I50A 4J10A 3SJBC 5KA5A 1L0NH 4HNAB 1Q81W 1GH6A 1IBMB 2UXDO 4F6RA 4PDVA 2QM7A 2H3OA 2JDIG 3RYIB 5L3BA 3P3NA 2AW9A 1AR5A 3JSNA 1AB3A 5BMVB 5JCOA 3T4DA 2W0XA 4MTOA 2ADPA 5IWAO 1PNLA 1PL0A 3LNMB 4ZI7B 3CD6V 2W6JG 4JI1O 2LFSA 2UU9B 2LFRA 2OT5A 4HBNA 3LSSA 3W7TA 3K5NA 1K73W 2JJ2G 4U3FH 3OTFA 1J5EB 2LW1A 2PI5A 1PNMA 1EN5A 2V4DA 3VOUA 1I94B 4UFZA 4TT3G 1P7BA 4EFBA 1CP9A 2PYJA 3SPIA 5IYCO 4FIPC 1SC5B 1NKDA 2P67A 5BR8O 4TUYB 4X20A 3OGIB 2HHHB 1PM9A 4JZGA 1N36B 3SYOA 3ASNB 3CCLV 3VQVA 1KC8W 1V54B 1ZTEA 4DV6B 2WPDG 1QVFU 4LFCO 4X66O 1OCZB 4OGQB 4X1YB 1Y4MA 1HW7A 2PZSA 3FKSG 1PKXA 1LR1A 1W2BU 3LDCA 1L8DA 5CA0A 3N2KA 1FXKB 3AG2C 4MT8A 1Q5OA 4BIUA 1RSOA 1IBKB 1Y76A 2XOKG 1AI7A 2R70A 4JYCA 4KL1A 3Q4HA 1IXMA 3Q4HB 3E8FA 4FZ0A 3ZRWB 2A06H 4XDLA 5KUKA 1NH2D 4R8CA 4TV8A 2ZQMA 4TOIA 4J11A 2ARHA 3HKEA 5CA3A 2K1EA 2N74A 4IIJA 2EIMC 3VQXA 3ZX6A 5B1AB 1ZUQA 5DN6G 2HVKC 2F1MA 3N2KB 2ZINA 1FFXA 4O4IB 1FFXB 1V9PA 4O4IA 1SRYA 4FLZA 4TWKA 3LUTB 1MSWD 2G38A 1WB7A 3BVOA 4LF6O 1KECA 3UT5A 5KMGB 1M1KW 1YITV 2YIBA 4LF4B 3AG3B 3MD0A 5EYPA 5FPRA 2WLMA 2KG7B 1VQ6V 1XMOB 5FNVB 4I50B 1YHQV 2UXNA 4I5SA 2E5LB 3U11A 1D2DA 1IX9A 1WP7A 3JALA 2YDEA 1R3IC 2KSDA 1NTKH 1K3EA 3OGCC 4GX5A 1M93A 3DTUB 2YXYA 4DR7B 1N34O 4UXNA 5HFMA 5EIBC 3CS5A 2M7WA 3L9DA 3ZHTA 4GKJO 5B3SC 3DC6A 4FFBB 2NNUA 3EHBB 1NJIW 2F4VB 4I4TB 1U97A 4DV6O 2JIZG 3ZS8C 3T4ZA 3CCUV 4B7EA 3QTCA 1WPBA 2XAGA 2IJKA 2YUAA 1T5EA 4DO2A 1M56B 1DTOA 1L0LH 1WA8B 1N36O 1US6A 2EX3A 1BHAA 3CCRV 2UU9O 2HKOA 1H8HG 3JARB 1X59A 3FB7C 3AG1B 1RSOB 2X6AA 5JJEB 3OW2U 3ZCCA 2D3OW 4IT5A 2BCCH 3IC9A 2AZ2A 4JI5B 1TUBA 5TISZ 4WF9V 1P84F 4B3MO 1JX9A 1GN6A 5EBLC 1IBMO 2PF4E 4O4JB 2D2CB 4X1YA 4DV4O 2H8PC 2QWQB 3D8CA 4MVSA 4I7ZB 3CCVV 2ZDIA 2CK3G 2EJRA 4Q20A 1MZFA 4RQEA 1NBMG 1QR9A 5K1PA 2ADQB 4O2BA 4X62O 4LF6B 1SA0A 5EZYB 2IW5A 4DR5B 5IJ9A 4RUEA 4GCZA 1NQTA 1B04A 4FJCC 5CMUA 5E1AC 4YJ3B 1PD3A 1M4UA 3H1KH 4DV5B 5LHIA 2E5LO 1OV9A 4BR6A 4GX0A 3BAAA 3JCZA 4X1KA 2F43G 3M8AA 4BWAA 2X6BA 4X62B 1IURA 1YSCA 4MVUA 1Z2GA 3LSUA 1KQSU 3F5WC 1GM7A 1XBLA 5LXTA 1AI5A 2QKCA 4WCEV 3QO8A 3AEIA 4G28B 3VBBA 1M56C 2Q5ZA 1NTZH 2O57A 5KAFZ 4NTWA 4JI0B 4IIJB 2C2AA 2Q4PA 2QGNA 2EBOA 5H9CA 1XILA 3K3WA 4JI7O 4B3RO 1I5XA 4B7KA 3H9VA 4R7CA 5FPOA 4X8AA 2Q0AA 1WPXA 4LF9O 1KKDA 4OX9B 4E4EA 2HG5C
chains in the Genus database with same CATH topology
2WLJA 4WFFA 3LDEA 4JYBA 3OE7G 4H37A 3CXCU 2ATKC 4PA6A 3ABTA 4GX2A 1K5QA 3LSQA 3ETEA 5HFLA 1R3LC 2HJFC 2FTKA 1OCOC 5B1OA 2IU0A 4X88A 2HLDG 2GHYA 5KUMA 3X2QC 5IY5B 4CZZA 4RAIA 1SERA 3ABLC 1VQ7V 1RM1C 1R3JC 4WFAV 1VQOV 1YJ9V 1F23A 1V54C 3E2EA 3OUSA 5CBGA 4JPRA 2R9IA 2EIJB 2Q6AA 1FFTB 5LHGA 2X7RB 1B6QA 5CN0A 2DYRC 5LGTA 3SPGA 1FXKC 1AROP 4CBCA 1V55B 4LCUC 1OCRB 3CCMV 3R65A 3FB5C 1FXVA 4G2KA 1VQKV 1XL6A 2WLIB 4QE7A 5CBHA 1AR1B 3CC4V 2H94A 3QO5A 4UVCA 3CCJV 4ZKIA 4FPPA 1NH2B 1OCCC 3AG2B 3F7YC 5EC2C 3RVZA 3SYQA 1NVPD 1XL4A 1JJ2U 4UVBA 1K7DA 3SYPA 4R50A 1F51A 1LNQA 3FB6C 1AI4A 1Q82W 5EK0A 5BZBA 1PNKA 2P7TC 5IDJA 5CBFA 1YTFB 3ASOC 4ASUG 4ZBMA 3OMAB 3CYOA 2XAHA 1Y66A 2EINB 3STZC 1H2GA 3W7XA 1SETA 2ZDIC 2JK5C 3IC7A 1UJWB 1S3JA 2B5UA 2DYRB 3E8GA 4MSWC 2OTJV 4G27B 4HYOA 3WG7C 3CPWU 1VQPV 1JQ0A 1K4CC 1QLEB 3TK1A 2QKSA 4UV8A 4PA3A 4LP8A 3ABUA 1DF5A 3OUFA 4PDMA 2HVJC 3JYCA 5H6RA 1YIJV 5FL7G 1KP2A 3ZN0A 5B1BB 3K03A 4RO2A 3JD0A 3AG4C 2EILB 3UKMA 3OMNB 3OM3B 4LC1A 1K34A 4JGSA 4GT1A 3QNEA 3KG2A 1KD1W 4I9WA 3NXSA 1M90W 4MW3A 4JTCB 1VQ5V 2IJHA 3E8BA 3B8MA 2EIMB 2V1DA 3JD4A 2EIKB 3SPCA 5DM6V 3B77A 3TCUA 4U7NA 4JAVA 1VQLV 2OCCC 2WSSG 4QPJA 5KA5A 5IYDO 4J9YB 4PDRA 1GKFA 1Q81W 1EZJA 3D3IA 3SPJA 3I56V 3W7UA 4PDVA 4RUFA 2ZR2A 2QM7A 4MVRA 2JDIG 3WG7B 4KUMA 5L3BA 4QNHB 1Q7YW 2YSUB 3T4DA 2WWWA 1E79G 4MTOA 2WAMA 2EZPA 4MW8A 3ASOB 1YJNV 4PA9A 1PNLA 1PL0A 3LNMB 3K04A 3P30A 1YJWV 3CD6V 1QQHA 2W6JG 5B1BC 4QE9A 4UV9A 4XBFA 1OHHG 2Z3YA 2LFSA 2LFRA 2MK3A 2OT5A 2W0FC 3LSSA 3W7TA 1BHBA 1K73W 2JJ2G 4F4LA 5L3DA 1YI2V 1FXHA 3G4SV 5LGUA 3K08A 1M57C 4UVAA 4XDJA 1W0KG 2PI5A 4HAMA 1PNMA 2Q67A 3JD1A 3VOUA 3ETDA 1WLEA 3EFFK 3GB7C 3STLC 3ZRWA 3ZMVA 1K8AW 2EIJC 5L3GA 1OCOB 1K4DC 4TT3G 1P7BA 2QM8A 2XNDG 3FYIB 1CP9A 3PJSK 4MVMA 1H38A 2P6JA 1VQNV 3SPIA 3P32A 5IYCO 3E83A 4PA7A 2WLLA 2QA4V 1S77D 3K9AA 4FIPC 1L1FA 1NKDA 2P67A 1NR1A 2HFEC 1Q86W 4WFBV 4N21A 3FB8C 2EIKC 1V55C 1S76D 3SYCA 4WFHA 3ABMB 3F7VC 3SYOA 4PA4A 3CMAV 3ASNB 1MOFA 3HPLC 1RPOA 3ZRXA 3CCLV 1OCZC 1GTOA 1ZWIC 1MG1A 1KC8W 1V54B 1HWYA 2ZD9A 2JEUA 2WPDG 3AG4B 1H8EG 3CCEV 5EBWC 1QVFU 5IY5C 2R9RB 2DQ0A 4JAUA 3K06A 2ZXWB 1FXKA 1OCZB 5L3CA 3ZMTA 1Y4MA 4L87A 3G6EV 1JOYA 3SPHA 3A0RA 3FKSG 1PKXA 3SYAA 1M9NA 1W2BU 3LDCA 4BIZA 5C93A 1FXKB 1K9MW 3QO7A 4WFGA 3AG2C 4MT8A 2ZR3A 1THZA 3MHSC 3BY6A 4BIUA 2EILC 5L3EA 1E1RG 2QEXV 2XOKG 1AI7A 4P9OA 3G71V 4JYCA 1IXMA 3E8FA 3ZRWB 5LGNA 4P9PA 4XDLA 4YXWG 5KUKA 3ABMC 1KP3A 3T2MA 1CEZA 1NH2D 4R8CA 4JTDB 1I5YA 1K97A 2HR3A 2ZQMA 5IYBO 5B3SB 3E35A 3RBZA 4OXSA 5CA3A 3E86A 2K1EA 2DWDC 3JD3A 1AJPA 1SESA 5L3FA 4JTAB 2Z5UA 1W0JG 2EIMC 2Y48A 4MS2A 5B1AB 1QLEC 5DN6G 2HVKC 4HZ3A 3ABLB 4QPKA 1RM1B 1J95A 3SJQC 1R3KC 4KFMA 5LBQA 1VQMV 3ZJZA 2PI4A 1SRYA 4GX1A 1GM9A 4TWKA 3LUTB 1JPXA 4P30A 1VQ9V 1MSWD 1AI6A 3AG3C 3ABKC 3UM7A 3TETA 1QR8A 4P2ZA 2AHYA 1KECA 3ZN1A 4X89A 2OTLV 1GM8A 1M1KW 1YITV 2B1GA 3AG3B 3MD0A 3ML0A 1S72V 3CCSV 2WLNA 1TUEB 1K92A 2QTOA 1NVPB 3K79A 3K0DA 1EFRG 2WLMA 2X6CA 3B8NA 4PDLA 1K33A 1AJQA 4H33A 5EC1C 1VQ6V 1FS0G 2DWEC 1YHQV 3CCQV 2UXNA 3OEEG 3OAAG 1JVMA 4I5SA 2IH3C 3AG1C 2DYSB 3BEHA 1R3IC 3OR7C 1JCHA 2KB1A 1QVGU 2JEXA 1K3EA 3OGCC 4GX5A 1N8RW 5B1AC 3DTUB 3ZRSA 4RQFA 2WLIA 4QJFB 4UXNA 5HFMA 2IH1C 4PELA 5LHHA 1G4YB 3H01A 2ZXWC 2LP7A 1BL8A 2M7WA 3ABKB 4LBEC 3ZMZA 3E89A 4FK5C 1R6KA 5B3SC 2NNUA 3EHBB 1NJIW 1BMFG 3HB3B 4JASA 4E2LA 2JIZG 3T4ZA 3CCUV 1DF4A 2XAGA 2IJKA 4BAYA 1M57B 1S0VA 4DO2A 2QE7G 3ZMSA 1M56B 1DTOA 3K0GA 1BHAA 1COWG 1SZTA 3CCRV 1AJNA 2HKOA 3OEHG 3D36A 3OFNG 4MVOA 1OCRC 2YEVA 3ZIAG 2XAQA 1K5SA 3E8HA 2IU3A 3LDDA 3OMIB 5GW7A 1H8HG 2A0LA 3FB7C 3AG1B 2X6AA 3OW2U 4MVQA 3ZCCA 5EBMC 1OCCB 2D3OW 2WLLB 4MVZA 3ZMUA 2BOCC 4KP4A 2Q69A 1CPYA 4WF9V 1JX9A 5EBLC 4XDKA 3CP1A 1E1QG 1GO3F 1DLBA 2B1IA 2ITCC 2H8PC 2XASA 4MVSA 3DGEA 3W7WA 2X0LA 2AHZA 3W7SA 2Q68A 4R6ZA 3CCVV 2ZDIA 2CK3G 2EJRA 4MTXA 4Q20A 1RPRA 4RQEA 2GSMB 2WLKA 2Y69C 3CC7V 1NBMG 1QR9A 2DQ3A 2EINC 1GK9A 2IW5A 2JJ1G 4RUEA 1MABG 1EBOA 1R6NA 5J9PC 4GCZA 1QBZA 1NQTA 2ITDC 4TSFG 3IGAC 1S5HC 4FJCC 3OR6C 5CMUA 5E1AC 1PD3A 2EZOA 3CC2V 1G8MA 5LHIA 2XAJA 5H6QA 3JD2A 4N23A 1F4MA 3IFXA 4UUJC 4GX0A 3MHHC 1ENVA 2NLJC 3JCZA 2IJJA 5KA6A 3FYEB 1F4NA 2BOBC 4EKWA 3ETGA 2F43G 3CMEV 2WLHA 2V7QG 2X6BA 4Z1MG 1YSCA 3GWOA 4MVUA 4U7OA 1ORQC 3F5WC 1KQSU 1GMGA 1GM7A 3WFVA 3X2QB 3M99B 1AI5A 4J9ZB 1R73A 1VQ4V 2A9HA 4WCEV 4FMTA 5B1NA 3QO8A 3AEIA 2W6IG 4QIWF 4G28B 1M56C 3VBBA 4MTFA 3RW0A 4MTGA 2DW4A 1OZ0A 2P90A 2XAFA 2Y69B 2C2AA 1QCEA 2EBOA 2DYSC 5H9CA 4BW5A 1ROPA 3RVYA 3K3WA 1P4RA 1I5XA 1NR7A 3ASNC 4DXWA 3ZRVA 1VQ8V 1QLNA 4JF3A 4R7CA 4X8AA 4WFEA 2UXXA 2OCCB 1WPXA 2YEVB 1YTFD 3I55V 1KKDA 2A79B 2IJIA 3T1CA 2HG5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQH A;  1R6K A;  2JEU A;  1TUE B;  1R6N A;  2JEX A;  1DTO A;  2NNU A; 
#chains in the Genus database with same CATH topology
 2GTA A;  4JYB A;  2ZE5 A;  4PA6 A;  1D5A A;  1ZSP A;  2IM9 A;  4JYY A;  2FTK A;  2JRI A;  2Y4T A;  4AQY O;  4X88 A;  3ZHU A;  4ABM A;  4ZHQ B;  1Z5W A;  1SER A;  1RM1 C;  1VQ7 V;  1URF A;  4WFA V;  1YJ9 V;  4YIP A;  3OUS A;  3PN1 A;  2R9I A;  2LGQ A;  2RN9 A;  2Q6A A;  4UCO A;  2AGA A;  1B6Q A;  5CN0 A;  5LOV A;  1YXB A;  1ZX3 A;  1HDJ A;  4CBC A;  3FB5 C;  4LFC B;  3QO5 A;  4B3R B;  4UVC A;  4GYC B;  1OCC C;  5EC2 C;  1AP5 A;  2KG7 A;  1K7D A;  2R9A A;  4R50 A;  4UVB A;  1LNQ A;  1AI4 A;  3N2G A;  3ASO C;  4UB8 Z;  3OMA B;  2XAH A;  1Y66 A;  2EIN B;  3STZ C;  1H2G A;  4NXM B;  1VF5 B;  2ZDI C;  2B9Z A;  2JK5 C;  2OCH A;  2UUB O;  3IC7 A;  1UJW B;  3T1H B;  4MSW C;  4G27 B;  3WG7 C;  3T1Y B;  2HJD A;  1QLE B;  3JAK A;  3TK1 A;  2MW2 B;  4JI8 B;  4PDM A;  5FL7 G;  3K03 A;  5GTH Z;  3RWR D;  5C8Y A;  4JZ2 A;  3OMN B;  4DR3 B;  4NXM O;  3KG2 A;  4I4T A;  5F2V O;  1WA8 A;  1N32 B;  1VQ5 V;  1WJZ A;  4DR5 O;  4K0K B;  5IT9 N;  1BZK A;  3THO A;  1GN2 A;  3ICX A;  3HKB A;  4CH3 A;  2XTA A;  4J9Y B;  3D3I A;  3W7U A;  2DJV A;  4RUF A;  2ZR2 A;  3WG7 B;  5GON B;  1WNS A;  5GON A;  1I7F A;  1HNW O;  4LWS B;  5JVD A;  1NTM H;  4MW8 A;  1YJN V;  3ASO B;  4PA9 A;  4AHC A;  4JI2 O;  2ZNI A;  1QQH A;  5B1B C;  3RYC A;  1OHH G;  4GKJ B;  4OPA A;  2W0F C;  1YI2 V;  1XHX A;  3K58 A;  1W0K G;  3VQW A;  3EFF K;  3ZRW A;  1K8A W;  1SS3 A;  2QM8 A;  2ODM A;  1Y74 B;  3PJS K;  4MVM A;  1H38 A;  2P6J A;  4DR7 O;  2WLL A;  2QA4 V;  3JSL A;  1ZL8 A;  1I94 O;  1NR1 A;  2RNB A;  2HFE C;  4DUZ B;  2CGO A;  1Q86 W;  1M5I A;  1FJG B;  2DOS A;  4K8Z A;  3SYC A;  1MOF A;  3HPL C;  1ZWI C;  1MG1 A;  2CAZ C;  2ZD9 A;  1H2S B;  3AG4 B;  1H8E G;  4LF4 O;  3K9S A;  1S5L Z;  5IY5 C;  4JAU A;  3K06 A;  2UXC O;  3ZMT A;  1TAE A;  4FFB A;  1M9N A;  4BIZ A;  4FLW A;  3TGU H;  4WFG A;  2RDC A;  3MHS C;  5L3E A;  1BT8 A;  4ZIB A;  1BE3 H;  3CB2 A;  4P9O A;  4GKK B;  5JWP A;  5LGN A;  4HNA A;  3DXR A;  2GBO A;  3ABM C;  1FJG O;  1NI8 A;  4JTD B;  1EZV H;  3BAB A;  5B3S B;  3RBZ A;  3B09 A;  2UXB B;  1JR9 A;  2DWD C;  3JD3 A;  1SES A;  1W0J G;  5B5E Z;  4DRX B;  1KBH A;  1QLE C;  4CH4 A;  1UFI A;  4PI0 A;  4FM1 A;  4YJ2 A;  2YS8 A;  3NR7 A;  2VRZ A;  3WB2 A;  1R3K C;  2QJ1 A;  3QVN A;  1GM9 A;  4UCU A;  3APQ A;  1VQ9 V;  2XHB A;  2PGG A;  3ABK C;  5LL6 Y;  2OTL V;  4KHP B;  2B1G A;  3CCS V;  4X9Q A;  2CH7 A;  2X6C A;  2FYU H;  5LP6 B;  4FLT A;  2OIG A;  4PDL A;  1NZ6 A;  1K33 A;  1AJQ A;  4H33 A;  2ZM6 O;  1FS0 G;  2VQF O;  4X20 B;  3CCQ V;  1OJH A;  2UUA O;  3OAA G;  4ZOL A;  1WAZ A;  4ZOL B;  5JCO C;  1PP9 H;  2DYS B;  4I0X B;  1JCH A;  1QVG U;  3KCX A;  1N8R W;  2RJZ A;  3OT7 A;  2WLI A;  4J7Z A;  2PY5 A;  4PEL A;  1G4Y B;  1IXB A;  1BL8 A;  1H2L A;  4JYA B;  4UCV A;  4LFA O;  4DV1 O;  2HHH O;  4E2L A;  1DF4 A;  4B08 A;  1VF6 C;  4BAY A;  3VQY A;  2CUG A;  2QWO B;  1S0V A;  3RYF A;  2QE7 G;  2UUC O;  4K0K O;  3OEH G;  3L71 H;  4MVO A;  3ZIA G;  5KHG A;  1K5S A;  2ZM6 B;  1VEW A;  3HKD B;  2A0L A;  4DV7 O;  4AI8 A;  4LWS A;  1HP8 A;  4H0L B;  1GN4 A;  4F6R B;  2FKX A;  1N33 O;  5J2U B;  1CPY A;  1QNM A;  4W4K A;  4J7K A;  4NB5 A;  1GO3 F;  1DLB A;  4O2A B;  2XAS A;  3RYH B;  3ZHQ A;  3DGE A;  4O2A A;  3RYH A;  4O4L A;  2X0L A;  4PHZ A;  2AHZ A;  3CRR A;  4R6Z A;  3CE2 A;  2WLK A;  1BS3 A;  3CC7 V;  5B66 Z;  4DUY O;  4X1I A;  2FB5 A;  1IBL B;  1XOU A;  3GWK C;  2JJ1 G;  5JQG B;  1EM1 A;  1QBZ A;  1B06 A;  2ITD C;  4IYI A;  4TSF G;  4GZR B;  3HKD A;  1S5H C;  2BSK B;  1O9G A;  4DK1 A;  3OR6 C;  2ZE6 A;  1G8M A;  2XAJ A;  3ZHV A;  2GUZ B;  2FL4 A;  3RYI A;  4UCT A;  1F4M A;  2NLJ C;  3CJH B;  1F4N A;  4U3J B;  2V7Q G;  4DUZ O;  1S5J A;  2BTO A;  2ZIO A;  2CTR A;  4J9Z B;  4LF9 B;  4FMT A;  3JCU Z;  5B1N A;  2PUS A;  2W6I G;  4JV5 B;  4B3T O;  5K1X A;  3BA8 A;  4MTG A;  2DW4 A;  1XMQ B;  3L73 H;  1TVK A;  3CEI A;  5JH7 A;  3GVM A;  2QWP B;  2DYS C;  4BW5 A;  3RVY A;  1SQV H;  3TXS A;  1VMG A;  3JAS A;  4DXW A;  5LP6 A;  1VQ8 V;  2PYL A;  1KB9 F;  1KKC A;  2YEV B;  1YTF D;  3I55 V;  4JI4 O;  4LF7 O;  2OTJ V;  4PJ0 Z;  1XDC A;  2WLJ A;  3J80 N;  2Q7H A;  3LDE A;  3OE7 G;  3JAR A;  3ABT A;  2YID A;  2HJF C;  4KXR A;  4TV8 B;  1N32 O;  3CHX A;  4NYK A;  4JI2 B;  4I0X A;  4IL6 Z;  1BQ0 A;  2CE4 A;  5A9G A;  3ABL C;  1R1B A;  2CTQ A;  2QWN B;  5LHG A;  4X64 O;  5LGT A;  3SPG A;  4DV3 O;  5LMU O;  4G2K A;  4JI6 B;  4O2B B;  1AR1 B;  3CC4 V;  5IYZ B;  2YC0 A;  2L35 A;  5CA0 B;  1JFF A;  5DED A;  3CCJ V;  2XUM A;  4FPP A;  1XRE A;  4OPH A;  3RVZ A;  1Q6U A;  2UUB B;  1XL4 A;  3HKB B;  1JJ2 U;  2P5O A;  3JAW A;  3SYP A;  2VS0 A;  1F51 A;  3WB1 A;  4DR6 O;  4TUY A;  4DV0 O;  5EK0 A;  3TXQ A;  5IDJ A;  2GV9 A;  5J2T A;  5CBF A;  1IZ3 A;  4LFA B;  2OWO A;  4DV0 B;  3W7X A;  4DV2 O;  5LYJ B;  1S3J A;  3FAV B;  2EJ7 A;  3B2E E;  4YHH O;  4LH7 A;  3RYC B;  3L74 H;  4J80 A;  4PA3 A;  1KMI Z;  1DF5 A;  3OUF A;  5H6R A;  5B1B B;  2EIL B;  3OM3 B;  1G1X B;  4LC1 A;  2Z0A A;  4I9W A;  4FLX A;  5JQG A;  1N0N A;  1Y76 B;  4IYH A;  4O4H A;  2EIM B;  2V1D A;  4NTX A;  2DE0 X;  3JD4 A;  2EIK B;  3SPC A;  3B77 A;  3TCU A;  1GAX A;  4U7N A;  1BQZ A;  4TQF A;  3RFR A;  1VQL V;  1Y74 A;  3ETQ A;  3HKC A;  3A0B Z;  5H5N A;  4B3S B;  2WSS G;  2QWR B;  4PDR A;  2GTS A;  3C90 A;  4CS4 A;  1EZJ A;  3SPJ A;  2P06 A;  4MVR A;  1SQG A;  5FNV A;  4KUM A;  3JAL B;  5AG2 A;  1Q7Y W;  1XUQ A;  1HNZ B;  2WWW A;  5ITZ A;  1FAF A;  3P30 A;  3K04 A;  1YJW V;  1JA8 A;  4PI2 A;  4QE9 A;  1BHB A;  3TJT A;  4F4L A;  5L3D A;  1FXH A;  3EXA A;  1MSD A;  3K08 A;  1M57 C;  2Q73 A;  4JI7 B;  3A2F A;  4HAM A;  3JD1 A;  2IBZ H;  2F95 B;  4FM2 A;  3GB7 C;  3ZMV A;  3AK3 A;  5L3G A;  1OCO B;  1K4D C;  5EZY A;  4JV5 O;  2XND G;  2ZCE A;  3FYI B;  1VQN V;  1WB8 A;  3P32 A;  1IVS A;  3E83 A;  4PA7 A;  3K9A A;  2E75 B;  1ZLZ A;  1R6T A;  3B40 A;  4DR4 O;  4WFB V;  1XHZ A;  4DRX A;  2EIK C;  1V55 C;  1SQX H;  1S76 D;  1TUB B;  4WFH A;  3F7V C;  4PA4 A;  3L70 H;  5EIB D;  3ZRX A;  1HWY A;  2R9R B;  1FXK A;  2ZXW B;  5L3C A;  3G6E V;  3SPH A;  3H1H H;  4YJ3 A;  3SYA A;  3IJ4 A;  3T1Y O;  4DUY B;  1IBL O;  2Q9L A;  2CH7 B;  1P7G A;  3FFQ A;  2ZR3 A;  4CH6 A;  2UXC B;  2JS3 A;  3BY6 A;  3UO2 A;  3IAY A;  1FYJ A;  1FKA O;  2P4V A;  4Q6G A;  1BCC H;  1Q90 D;  4P9P A;  3HKE B;  1Q6H A;  1KP3 A;  4X1K B;  2JVD A;  1CEZ A;  1I08 A;  5CB4 A;  1I5Y A;  1K97 A;  2HR3 A;  5J2U A;  3CRA A;  4DV1 B;  4OXS A;  1GRJ A;  3H1J H;  5KHI A;  4FLY A;  4L8J A;  1SQB H;  1AJP A;  5IE9 A;  4MS2 A;  2VWJ A;  5LA6 B;  3ZBH A;  2YXH A;  2VQF B;  2KQX A;  5ITZ B;  4QPK A;  1RM1 B;  1J95 A;  5FLX N;  4KFM A;  5LBQ A;  4YHH B;  2PI4 A;  4GX1 A;  5IJ0 B;  4NKG B;  2DN9 A;  1JPX A;  2HP8 A;  4DR2 O;  3UM7 A;  1Z5V A;  3U10 A;  4P2Z A;  3ZN1 A;  4I9Q A;  2BSK A;  2YXL A;  2JS5 A;  1S72 V;  2WLN A;  1K92 A;  1XNQ O;  3K79 A;  3K0D A;  1EFR G;  4AIL C;  4EFE A;  4J7J A;  4RWU A;  5EC1 C;  2P22 C;  2DWE C;  4EEQ A;  2F66 C;  3HKC B;  2RQ6 A;  1SQP H;  3OEE G;  3AK1 A;  1XMO O;  2IH3 C;  1HNX B;  2QKA A;  3BEH A;  2UXB O;  3OR7 C;  2JEX A;  3ZRS A;  4RQF A;  3APO A;  2IH1 C;  3A8T A;  4UB6 Z;  3H01 A;  1ZAU A;  2UXD B;  4I55 B;  2ZXW C;  2LP7 A;  1UPG A;  4LBE C;  3ABK B;  3ZMZ A;  1R6K A;  1BMF G;  5CA1 B;  2VQE B;  1F7Y A;  5IWA B;  1M57 B;  1YF2 A;  3M7M X;  3ZMS A;  3K0G A;  4BIO A;  3DXR B;  1COW G;  2YEV A;  4DV5 O;  2XAQ A;  2IU3 A;  3E8H A;  3LDD A;  3FX7 A;  1H2N A;  3BA9 A;  5EBM C;  1OCC B;  1YEW A;  2QTS A;  4IHJ A;  3G80 A;  1YVW A;  3ZMU A;  1TGO A;  2Q69 A;  4UCR A;  2Y4U A;  3SGI A;  1VP7 A;  1EN4 A;  2B1I A;  2ITC C;  3W7W A;  1IBK O;  3W7S A;  2Q68 A;  5KHK A;  4D7S A;  1Q6I A;  1NS1 A;  4DV4 B;  2N05 A;  4MTX A;  1RPR A;  3CX5 F;  1WN7 A;  1VAR A;  1QU7 A;  2GSM B;  4DW1 A;  2CTW A;  2ZKO A;  2DQ3 A;  1GK9 A;  2A7W A;  2R72 A;  5D5Q A;  1MAB G;  1EBO A;  1R6N A;  5J9P C;  2ZE8 A;  3MDS A;  4FLV A;  2OYQ A;  3J81 N;  1XEQ A;  2EZO A;  5LMN O;  1JFF B;  4LFB B;  3UCS C;  3JD2 A;  2UUC B;  4UUJ C;  3MHH C;  2IJJ A;  2Q7G A;  3FYE B;  2BOB C;  3O65 A;  4FLU A;  4EKW A;  3FAV A;  2WLH A;  4Z1M G;  3GWO A;  2BE3 A;  3HR0 A;  3X2Q B;  3WFV A;  1NT2 B;  3BHP A;  1MMM A;  2A9H A;  1MZE A;  5JJN B;  2JGD A;  2M6Y A;  4DR6 B;  1RFY A;  1IDS A;  1SQQ H;  2Y69 B;  2P4K A;  5BR8 B;  4IGG A;  1QCE A;  1ROP A;  4TV9 A;  1J5E O;  2UUA B;  1NR7 A;  1LUV A;  1QLN A;  4WFE A;  2UXX A;  5EYP B;  4CH5 A;  2OCC B;  4LF8 O;  2A79 B;  2K9P A;  3T1C A;  1BGY H;  4KHP O;  4WFF A;  1YCI A;  2OIE A;  3CJH A;  4H37 A;  3CXC U;  4CS2 A;  5E79 Z;  4GX2 A;  3WB0 A;  3G6B A;  3ETE A;  5HFL A;  1R3L C;  3SJA C;  3K5L A;  2LGW A;  4JI3 O;  4JI1 B;  1I0H A;  4DR4 B;  2HLD G;  3BPZ A;  3X2Q C;  1FPO A;  4CZZ A;  4X65 O;  3UQ8 A;  4J41 A;  3B4S A;  3E2E A;  1V54 C;  5CBG A;  5CA1 A;  4JPR A;  1RP3 B;  2EIJ B;  2NR5 A;  4DV2 B;  4FM0 A;  2DYR C;  1MNG A;  1FXK C;  4I55 A;  1ARO P;  3A0H Z;  4LCU C;  1OCR B;  1HNX O;  3BFR A;  3R65 A;  3CCM V;  1QQC A;  1FXV A;  1VQK V;  1XL6 A;  3CRC A;  5CBH A;  2H94 A;  4ZKI A;  2Q8V A;  2XT9 A;  1TA8 A;  3AG2 B;  3P3P A;  3SYQ A;  1YZB A;  4NXN O;  1ZL8 B;  2VWK A;  4NVP A;  1Q82 W;  4LF8 B;  4U3J A;  1PNK A;  3KCY A;  4IHJ B;  4ZBM A;  2CTP A;  1SET A;  4JYA O;  1KUQ A;  2BTQ B;  2B5U A;  2DYR B;  3E8G A;  4HYO A;  2LQT A;  3CPW U;  1VQP V;  1JQ0 A;  1SZX A;  1VIB A;  4LF5 O;  2QKS A;  3D3Q A;  3EVK A;  3K59 A;  3ABU A;  4GLX A;  2E3C A;  2ZIM A;  1AIL A;  1KP2 A;  3JAK B;  2CGN A;  1EN6 A;  3UKM A;  4FFK A;  1K34 A;  3K57 A;  1LUW A;  3AG7 A;  5JH7 B;  3NXS A;  3ZHR A;  5IJ9 B;  1M90 W;  4MW3 A;  4JTC B;  2IJH A;  1P49 A;  1O9H A;  4JAV A;  2OCC C;  5LMN B;  4LFB O;  1XNR O;  5KHJ A;  1A32 A;  5IYD O;  4QPJ A;  1GKF A;  2KKW A;  1XMQ O;  3ZED A;  2WA4 A;  5JJJ B;  3JAT B;  4F6E A;  3I56 V;  4LF5 B;  3CWB H;  4LNU B;  3KZI Z;  4EB6 B;  4QNH B;  3WU2 Z;  2YSU B;  1E79 G;  2WAM A;  3SDL A;  2EZP A;  3E22 A;  5LXT B;  5LP6 C;  4UV9 A;  5LA6 A;  4XBF A;  2Z3Y A;  2MK3 A;  3DSQ A;  4PV1 B;  4DR3 O;  1U96 A;  4NXN B;  5D5P A;  3G4S V;  5LGU A;  4UVA A;  4XDJ A;  1KU9 A;  4TV9 B;  2Q67 A;  3S3X A;  4JI6 O;  3ETD A;  1WLE A;  3STL C;  2LO1 A;  5BXZ A;  2EIJ C;  1BSM A;  4JI3 B;  4K3A A;  5LYJ A;  4DR2 B;  3L75 H;  1S77 D;  1L1F A;  3J7A U;  1YDX A;  2YIA A;  5BY1 A;  4N21 A;  2VQE O;  3FB8 C;  5GTI Z;  1W59 A;  1AR4 A;  4YY3 B;  3ABM B;  5BMV A;  3CMA V;  4B3M B;  5LOV B;  2WA3 A;  1RPO A;  4JI5 O;  3D36 C;  1OCZ C;  1GTO A;  2JEU A;  3CCE V;  5EBW C;  3CSX A;  2F4V O;  2DQ0 A;  4DV3 B;  1TVK B;  4JI8 O;  4L87 A;  1JOY A;  3A0R A;  4FZ1 A;  4X64 B;  4WBN B;  2L6L A;  1JMK C;  5C93 A;  1K9M W;  3QO7 A;  4FVM A;  1THZ A;  2QR4 A;  2EIL C;  4WBN A;  1E1R G;  1VF7 A;  2QEX V;  3N2G B;  1B3Q A;  3G71 V;  3OTO B;  2YI9 A;  4D7T A;  4YXW G;  2E76 B;  3T2M A;  3CXH F;  3K5O A;  4JI4 B;  3C3T A;  3OD4 A;  5IYB O;  3E35 A;  4W4L A;  3E86 A;  5L3F A;  4JTA B;  2Z5U A;  2Y48 A;  1VF6 A;  4DK0 A;  1N34 B;  4HZ3 A;  3ABL B;  2Q7E A;  1FD9 A;  3SJQ C;  3FD9 A;  2GDS A;  1VQM V;  3ZJZ A;  3RT3 C;  4P30 A;  1AI6 A;  3AG3 C;  5KLV H;  1QR8 A;  4DR1 B;  2AHY A;  4X89 A;  1WP8 A;  1GM8 A;  4CS3 A;  4J42 A;  1SQF A;  1AP6 A;  3ML0 A;  1TUE B;  2QTO A;  1NVP B;  4DYL A;  3B8N A;  4YIO A;  2LJ2 A;  3QF7 A;  5KX5 B;  3LNN A;  3E22 B;  3C3S A;  1JVM A;  2NN4 A;  2RMK B;  5LMU B;  1N33 B;  1Q43 A;  3AG1 C;  1SKV A;  2Y0I A;  5JVD B;  4O4J A;  2KB1 A;  5B1A C;  1PV0 A;  4QJF B;  4H13 B;  2AZ0 A;  5LHH A;  2Q0O C;  2Y0P A;  3E89 A;  1XQ8 A;  4FK5 C;  5IYZ A;  3HB3 B;  2LW7 A;  4JAS A;  2JGD B;  3UO3 A;  1NU1 H;  4Z1V A;  1XI1 A;  4OX9 O;  4UCS A;  1SZT A;  1AJN A;  5J2T B;  3D36 A;  3OFN G;  2N04 A;  1OCR C;  3OMI B;  5GW7 A;  4X66 B;  4MVQ A;  2ILM A;  1XNR B;  4JAA A;  4CC5 A;  2WLL B;  4MVZ A;  1Y67 A;  2BOC C;  4KP4 A;  4JI0 O;  3I5D A;  3H1L H;  4TQD A;  4XDK A;  3CP1 A;  3ZHS A;  1E1Q G;  1KYO F;  3F5T A;  4ZI7 A;  1H2M A;  1XNQ B;  1D5N A;  2QDO A;  4LH6 A;  4O4H B;  4ZHQ A;  1G6U A;  2Y69 C;  1AVM A;  1N4C A;  2EIN C;  3JAW B;  2JGU A;  2A3Q A;  3DC5 A;  3IGA C;  3RN4 A;  4ICG A;  4QGP A;  4BW9 A;  2QM4 A;  3CC2 V;  2GUZ A;  4X65 B;  4A5U B;  5H6Q A;  1DGS A;  4N23 A;  4Z2W A;  5A2Q N;  3IFX A;  1ENV A;  5KA6 A;  3ETG A;  3CME V;  4NR1 A;  5DEC A;  3R66 A;  3SR2 C;  4U7O A;  5KHH A;  3SJC C;  2PTM A;  1ORQ C;  2BTQ A;  3T1H O;  5KX5 A;  1GMG A;  3BRC A;  3M99 B;  1R73 A;  1VQ4 V;  4QIW F;  2FML A;  4MTF A;  3RW0 A;  4YJ2 B;  1OZ0 A;  1PL4 A;  2P90 A;  2XAF A;  4CC6 A;  2YI8 A;  4C7U A;  2RCV A;  1P4R A;  3JAS B;  3ASN C;  4DV7 B;  2DMX A;  1DK1 A;  4YY3 O;  3ZRV A;  4JF3 A;  4DW0 A;  2IJI A;  2CDY A;  2ZNJ A;  3TET A;  2YIB D;  1HR0 B;  2F93 B;  2ATK C;  2AXT Z;  2ETN A;  1K5Q A;  3LSQ A;  1QHT A;  4D6T H;  4GKK O;  3K5M A;  4K8X A;  3L72 H;  3O9O A;  1OCO C;  5B1O A;  2IU0 A;  4LNU A;  2GHY A;  5KUM A;  5IY5 B;  4RAI A;  1MA1 A;  3JAM N;  1HNZ O;  1R3J C;  1VQO V;  1F23 A;  1SA0 B;  5C8Y B;  3CRM A;  2ZE7 A;  5KAI Z;  1FFT B;  2HEP A;  2X7R B;  1JJO A;  1V55 B;  4PD4 F;  1SF9 A;  4O4L B;  2WLI B;  1X4T A;  3BCC H;  4QE7 A;  1PPJ H;  4LR3 A;  1NH2 B;  3KKY A;  3F7Y C;  1NVP D;  4LF7 B;  4GUN A;  2E74 B;  3FB6 C;  3OTO O;  4AQY B;  1CXZ B;  4K35 A;  5BZB A;  2P7T C;  4B3T B;  1YTF B;  5CB4 B;  4ASU G;  3CYO A;  3RYF B;  1GN3 A;  3UT5 B;  5KMG A;  3JAT A;  1HNW B;  4EB6 A;  2EUL A;  3RGB A;  1K4C C;  1H2K A;  5H2F Z;  4UV8 A;  2QSA A;  4LP8 A;  3U0Z A;  2HVJ C;  3JYC A;  1YIJ V;  3AK2 A;  4X1I B;  1Q8I A;  4NTY A;  3ZN0 A;  4RO2 A;  4B3S O;  2YIC A;  3JD0 A;  3AG4 C;  1HR0 O;  3N27 A;  3CRQ A;  4JGS A;  4GT1 A;  3H1I H;  3QNE A;  3S3W A;  1KD1 W;  5IJ0 A;  2ZT9 B;  3E8B A;  3G67 A;  1N0J A;  3B8M A;  3QG5 A;  3MAQ A;  2F23 A;  1Y6X A;  4DR1 O;  5DM6 V;  1Q3E A;  4H44 B;  4I50 A;  4J10 A;  3SJB C;  5KA5 A;  1L0N H;  4HNA B;  1Q81 W;  1GH6 A;  1IBM B;  2UXD O;  4F6R A;  4PDV A;  2QM7 A;  2H3O A;  2JDI G;  3RYI B;  5L3B A;  3P3N A;  2AW9 A;  1AR5 A;  3JSN A;  1AB3 A;  5BMV B;  5JCO A;  3T4D A;  2W0X A;  4MTO A;  2ADP A;  5IWA O;  1PNL A;  1PL0 A;  3LNM B;  4ZI7 B;  3CD6 V;  2W6J G;  4JI1 O;  2LFS A;  2UU9 B;  2LFR A;  2OT5 A;  4HBN A;  3LSS A;  3W7T A;  3K5N A;  1K73 W;  2JJ2 G;  4U3F H;  3OTF A;  1J5E B;  2LW1 A;  2PI5 A;  1PNM A;  1EN5 A;  2V4D A;  3VOU A;  1I94 B;  4UFZ A;  4TT3 G;  1P7B A;  4EFB A;  1CP9 A;  2PYJ A;  3SPI A;  5IYC O;  4FIP C;  1SC5 B;  1NKD A;  2P67 A;  5BR8 O;  4TUY B;  4X20 A;  3OGI B;  2HHH B;  1PM9 A;  4JZG A;  1N36 B;  3SYO A;  3ASN B;  3CCL V;  3VQV A;  1KC8 W;  1V54 B;  1ZTE A;  4DV6 B;  2WPD G;  1QVF U;  4LFC O;  4X66 O;  1OCZ B;  4OGQ B;  4X1Y B;  1Y4M A;  1HW7 A;  2PZS A;  3FKS G;  1PKX A;  1LR1 A;  1W2B U;  3LDC A;  1L8D A;  5CA0 A;  3N2K A;  1FXK B;  3AG2 C;  4MT8 A;  1Q5O A;  4BIU A;  1RSO A;  1IBK B;  1Y76 A;  2XOK G;  1AI7 A;  2R70 A;  4JYC A;  4KL1 A;  3Q4H A;  1IXM A;  3Q4H B;  3E8F A;  4FZ0 A;  3ZRW B;  2A06 H;  4XDL A;  5KUK A;  1NH2 D;  4R8C A;  4TV8 A;  2ZQM A;  4TOI A;  4J11 A;  2ARH A;  3HKE A;  5CA3 A;  2K1E A;  2N74 A;  4IIJ A;  2EIM C;  3VQX A;  3ZX6 A;  5B1A B;  1ZUQ A;  5DN6 G;  2HVK C;  2F1M A;  3N2K B;  2ZIN A;  1FFX A;  4O4I B;  1FFX B;  1V9P A;  4O4I A;  1SRY A;  4FLZ A;  4TWK A;  3LUT B;  1MSW D;  2G38 A;  1WB7 A;  3BVO A;  4LF6 O;  1KEC A;  3UT5 A;  5KMG B;  1M1K W;  1YIT V;  2YIB A;  4LF4 B;  3AG3 B;  3MD0 A;  5EYP A;  5FPR A;  2WLM A;  2KG7 B;  1VQ6 V;  1XMO B;  5FNV B;  4I50 B;  1YHQ V;  2UXN A;  4I5S A;  2E5L B;  3U11 A;  1D2D A;  1IX9 A;  1WP7 A;  3JAL A;  2YDE A;  1R3I C;  2KSD A;  1NTK H;  1K3E A;  3OGC C;  4GX5 A;  1M93 A;  3DTU B;  2YXY A;  4DR7 B;  1N34 O;  4UXN A;  5HFM A;  5EIB C;  3CS5 A;  2M7W A;  3L9D A;  3ZHT A;  4GKJ O;  5B3S C;  3DC6 A;  4FFB B;  2NNU A;  3EHB B;  1NJI W;  2F4V B;  4I4T B;  1U97 A;  4DV6 O;  2JIZ G;  3ZS8 C;  3T4Z A;  3CCU V;  4B7E A;  3QTC A;  1WPB A;  2XAG A;  2IJK A;  2YUA A;  1T5E A;  4DO2 A;  1M56 B;  1DTO A;  1L0L H;  1WA8 B;  1N36 O;  1US6 A;  2EX3 A;  1BHA A;  3CCR V;  2UU9 O;  2HKO A;  1H8H G;  3JAR B;  1X59 A;  3FB7 C;  3AG1 B;  1RSO B;  2X6A A;  5JJE B;  3OW2 U;  3ZCC A;  2D3O W;  4IT5 A;  2BCC H;  3IC9 A;  2AZ2 A;  4JI5 B;  1TUB A;  5TIS Z;  4WF9 V;  1P84 F;  4B3M O;  1JX9 A;  1GN6 A;  5EBL C;  1IBM O;  2PF4 E;  4O4J B;  2D2C B;  4X1Y A;  4DV4 O;  2H8P C;  2QWQ B;  3D8C A;  4MVS A;  4I7Z B;  3CCV V;  2ZDI A;  2CK3 G;  2EJR A;  4Q20 A;  1MZF A;  4RQE A;  1NBM G;  1QR9 A;  5K1P A;  2ADQ B;  4O2B A;  4X62 O;  4LF6 B;  1SA0 A;  5EZY B;  2IW5 A;  4DR5 B;  5IJ9 A;  4RUE A;  4GCZ A;  1NQT A;  1B04 A;  4FJC C;  5CMU A;  5E1A C;  4YJ3 B;  1PD3 A;  1M4U A;  3H1K H;  4DV5 B;  5LHI A;  2E5L O;  1OV9 A;  4BR6 A;  4GX0 A;  3BAA A;  3JCZ A;  4X1K A;  2F43 G;  3M8A A;  4BWA A;  2X6B A;  4X62 B;  1IUR A;  1YSC A;  4MVU A;  1Z2G A;  3LSU A;  1KQS U;  3F5W C;  1GM7 A;  1XBL A;  5LXT A;  1AI5 A;  2QKC A;  4WCE V;  3QO8 A;  3AEI A;  4G28 B;  3VBB A;  1M56 C;  2Q5Z A;  1NTZ H;  2O57 A;  5KAF Z;  4NTW A;  4JI0 B;  4IIJ B;  2C2A A;  2Q4P A;  2QGN A;  2EBO A;  5H9C A;  1XIL A;  3K3W A;  4JI7 O;  4B3R O;  1I5X A;  4B7K A;  3H9V A;  4R7C A;  5FPO A;  4X8A A;  2Q0A A;  1WPX A;  4LF9 O;  1KKD A;  4OX9 B;  4E4E A;  2HG5 C; 
#chains in the Genus database with same CATH homology
 2WLJ A;  4WFF A;  3LDE A;  4JYB A;  3OE7 G;  4H37 A;  3CXC U;  2ATK C;  4PA6 A;  3ABT A;  4GX2 A;  1K5Q A;  3LSQ A;  3ETE A;  5HFL A;  1R3L C;  2HJF C;  2FTK A;  1OCO C;  5B1O A;  2IU0 A;  4X88 A;  2HLD G;  2GHY A;  5KUM A;  3X2Q C;  5IY5 B;  4CZZ A;  4RAI A;  1SER A;  3ABL C;  1VQ7 V;  1RM1 C;  1R3J C;  4WFA V;  1VQO V;  1YJ9 V;  1F23 A;  1V54 C;  3E2E A;  3OUS A;  5CBG A;  4JPR A;  2R9I A;  2EIJ B;  2Q6A A;  1FFT B;  5LHG A;  2X7R B;  1B6Q A;  5CN0 A;  2DYR C;  5LGT A;  3SPG A;  1FXK C;  1ARO P;  4CBC A;  1V55 B;  4LCU C;  1OCR B;  3CCM V;  3R65 A;  3FB5 C;  1FXV A;  4G2K A;  1VQK V;  1XL6 A;  2WLI B;  4QE7 A;  5CBH A;  1AR1 B;  3CC4 V;  2H94 A;  3QO5 A;  4UVC A;  3CCJ V;  4ZKI A;  4FPP A;  1NH2 B;  1OCC C;  3AG2 B;  3F7Y C;  5EC2 C;  3RVZ A;  3SYQ A;  1NVP D;  1XL4 A;  1JJ2 U;  4UVB A;  1K7D A;  3SYP A;  4R50 A;  1F51 A;  1LNQ A;  3FB6 C;  1AI4 A;  1Q82 W;  5EK0 A;  5BZB A;  1PNK A;  2P7T C;  5IDJ A;  5CBF A;  1YTF B;  3ASO C;  4ASU G;  4ZBM A;  3OMA B;  3CYO A;  2XAH A;  1Y66 A;  2EIN B;  3STZ C;  1H2G A;  3W7X A;  1SET A;  2ZDI C;  2JK5 C;  3IC7 A;  1UJW B;  1S3J A;  2B5U A;  2DYR B;  3E8G A;  4MSW C;  2OTJ V;  4G27 B;  4HYO A;  3WG7 C;  3CPW U;  1VQP V;  1JQ0 A;  1K4C C;  1QLE B;  3TK1 A;  2QKS A;  4UV8 A;  4PA3 A;  4LP8 A;  3ABU A;  1DF5 A;  3OUF A;  4PDM A;  2HVJ C;  3JYC A;  5H6R A;  1YIJ V;  5FL7 G;  1KP2 A;  3ZN0 A;  5B1B B;  3K03 A;  4RO2 A;  3JD0 A;  3AG4 C;  2EIL B;  3UKM A;  3OMN B;  3OM3 B;  4LC1 A;  1K34 A;  4JGS A;  4GT1 A;  3QNE A;  3KG2 A;  1KD1 W;  4I9W A;  3NXS A;  1M90 W;  4MW3 A;  4JTC B;  1VQ5 V;  2IJH A;  3E8B A;  3B8M A;  2EIM B;  2V1D A;  3JD4 A;  2EIK B;  3SPC A;  5DM6 V;  3B77 A;  3TCU A;  4U7N A;  4JAV A;  1VQL V;  2OCC C;  2WSS G;  4QPJ A;  5KA5 A;  5IYD O;  4J9Y B;  4PDR A;  1GKF A;  1Q81 W;  1EZJ A;  3D3I A;  3SPJ A;  3I56 V;  3W7U A;  4PDV A;  4RUF A;  2ZR2 A;  2QM7 A;  4MVR A;  2JDI G;  3WG7 B;  4KUM A;  5L3B A;  4QNH B;  1Q7Y W;  2YSU B;  3T4D A;  2WWW A;  1E79 G;  4MTO A;  2WAM A;  2EZP A;  4MW8 A;  3ASO B;  1YJN V;  4PA9 A;  1PNL A;  1PL0 A;  3LNM B;  3K04 A;  3P30 A;  1YJW V;  3CD6 V;  1QQH A;  2W6J G;  5B1B C;  4QE9 A;  4UV9 A;  4XBF A;  1OHH G;  2Z3Y A;  2LFS A;  2LFR A;  2MK3 A;  2OT5 A;  2W0F C;  3LSS A;  3W7T A;  1BHB A;  1K73 W;  2JJ2 G;  4F4L A;  5L3D A;  1YI2 V;  1FXH A;  3G4S V;  5LGU A;  3K08 A;  1M57 C;  4UVA A;  4XDJ A;  1W0K G;  2PI5 A;  4HAM A;  1PNM A;  2Q67 A;  3JD1 A;  3VOU A;  3ETD A;  1WLE A;  3EFF K;  3GB7 C;  3STL C;  3ZRW A;  3ZMV A;  1K8A W;  2EIJ C;  5L3G A;  1OCO B;  1K4D C;  4TT3 G;  1P7B A;  2QM8 A;  2XND G;  3FYI B;  1CP9 A;  3PJS K;  4MVM A;  1H38 A;  2P6J A;  1VQN V;  3SPI A;  3P32 A;  5IYC O;  3E83 A;  4PA7 A;  2WLL A;  2QA4 V;  1S77 D;  3K9A A;  4FIP C;  1L1F A;  1NKD A;  2P67 A;  1NR1 A;  2HFE C;  1Q86 W;  4WFB V;  4N21 A;  3FB8 C;  2EIK C;  1V55 C;  1S76 D;  3SYC A;  4WFH A;  3ABM B;  3F7V C;  3SYO A;  4PA4 A;  3CMA V;  3ASN B;  1MOF A;  3HPL C;  1RPO A;  3ZRX A;  3CCL V;  1OCZ C;  1GTO A;  1ZWI C;  1MG1 A;  1KC8 W;  1V54 B;  1HWY A;  2ZD9 A;  2JEU A;  2WPD G;  3AG4 B;  1H8E G;  3CCE V;  5EBW C;  1QVF U;  5IY5 C;  2R9R B;  2DQ0 A;  4JAU A;  3K06 A;  2ZXW B;  1FXK A;  1OCZ B;  5L3C A;  3ZMT A;  1Y4M A;  4L87 A;  3G6E V;  1JOY A;  3SPH A;  3A0R A;  3FKS G;  1PKX A;  3SYA A;  1M9N A;  1W2B U;  3LDC A;  4BIZ A;  5C93 A;  1FXK B;  1K9M W;  3QO7 A;  4WFG A;  3AG2 C;  4MT8 A;  2ZR3 A;  1THZ A;  3MHS C;  3BY6 A;  4BIU A;  2EIL C;  5L3E A;  1E1R G;  2QEX V;  2XOK G;  1AI7 A;  4P9O A;  3G71 V;  4JYC A;  1IXM A;  3E8F A;  3ZRW B;  5LGN A;  4P9P A;  4XDL A;  4YXW G;  5KUK A;  3ABM C;  1KP3 A;  3T2M A;  1CEZ A;  1NH2 D;  4R8C A;  4JTD B;  1I5Y A;  1K97 A;  2HR3 A;  2ZQM A;  5IYB O;  5B3S B;  3E35 A;  3RBZ A;  4OXS A;  5CA3 A;  3E86 A;  2K1E A;  2DWD C;  3JD3 A;  1AJP A;  1SES A;  5L3F A;  4JTA B;  2Z5U A;  1W0J G;  2EIM C;  2Y48 A;  4MS2 A;  5B1A B;  1QLE C;  5DN6 G;  2HVK C;  4HZ3 A;  3ABL B;  4QPK A;  1RM1 B;  1J95 A;  3SJQ C;  1R3K C;  4KFM A;  5LBQ A;  1VQM V;  3ZJZ A;  2PI4 A;  1SRY A;  4GX1 A;  1GM9 A;  4TWK A;  3LUT B;  1JPX A;  4P30 A;  1VQ9 V;  1MSW D;  1AI6 A;  3AG3 C;  3ABK C;  3UM7 A;  3TET A;  1QR8 A;  4P2Z A;  2AHY A;  1KEC A;  3ZN1 A;  4X89 A;  2OTL V;  1GM8 A;  1M1K W;  1YIT V;  2B1G A;  3AG3 B;  3MD0 A;  3ML0 A;  1S72 V;  3CCS V;  2WLN A;  1TUE B;  1K92 A;  2QTO A;  1NVP B;  3K79 A;  3K0D A;  1EFR G;  2WLM A;  2X6C A;  3B8N A;  4PDL A;  1K33 A;  1AJQ A;  4H33 A;  5EC1 C;  1VQ6 V;  1FS0 G;  2DWE C;  1YHQ V;  3CCQ V;  2UXN A;  3OEE G;  3OAA G;  1JVM A;  4I5S A;  2IH3 C;  3AG1 C;  2DYS B;  3BEH A;  1R3I C;  3OR7 C;  1JCH A;  2KB1 A;  1QVG U;  2JEX A;  1K3E A;  3OGC C;  4GX5 A;  1N8R W;  5B1A C;  3DTU B;  3ZRS A;  4RQF A;  2WLI A;  4QJF B;  4UXN A;  5HFM A;  2IH1 C;  4PEL A;  5LHH A;  1G4Y B;  3H01 A;  2ZXW C;  2LP7 A;  1BL8 A;  2M7W A;  3ABK B;  4LBE C;  3ZMZ A;  3E89 A;  4FK5 C;  1R6K A;  5B3S C;  2NNU A;  3EHB B;  1NJI W;  1BMF G;  3HB3 B;  4JAS A;  4E2L A;  2JIZ G;  3T4Z A;  3CCU V;  1DF4 A;  2XAG A;  2IJK A;  4BAY A;  1M57 B;  1S0V A;  4DO2 A;  2QE7 G;  3ZMS A;  1M56 B;  1DTO A;  3K0G A;  1BHA A;  1COW G;  1SZT A;  3CCR V;  1AJN A;  2HKO A;  3OEH G;  3D36 A;  3OFN G;  4MVO A;  1OCR C;  2YEV A;  3ZIA G;  2XAQ A;  1K5S A;  3E8H A;  2IU3 A;  3LDD A;  3OMI B;  5GW7 A;  1H8H G;  2A0L A;  3FB7 C;  3AG1 B;  2X6A A;  3OW2 U;  4MVQ A;  3ZCC A;  5EBM C;  1OCC B;  2D3O W;  2WLL B;  4MVZ A;  3ZMU A;  2BOC C;  4KP4 A;  2Q69 A;  1CPY A;  4WF9 V;  1JX9 A;  5EBL C;  4XDK A;  3CP1 A;  1E1Q G;  1GO3 F;  1DLB A;  2B1I A;  2ITC C;  2H8P C;  2XAS A;  4MVS A;  3DGE A;  3W7W A;  2X0L A;  2AHZ A;  3W7S A;  2Q68 A;  4R6Z A;  3CCV V;  2ZDI A;  2CK3 G;  2EJR A;  4MTX A;  4Q20 A;  1RPR A;  4RQE A;  2GSM B;  2WLK A;  2Y69 C;  3CC7 V;  1NBM G;  1QR9 A;  2DQ3 A;  2EIN C;  1GK9 A;  2IW5 A;  2JJ1 G;  4RUE A;  1MAB G;  1EBO A;  1R6N A;  5J9P C;  4GCZ A;  1QBZ A;  1NQT A;  2ITD C;  4TSF G;  3IGA C;  1S5H C;  4FJC C;  3OR6 C;  5CMU A;  5E1A C;  1PD3 A;  2EZO A;  3CC2 V;  1G8M A;  5LHI A;  2XAJ A;  5H6Q A;  3JD2 A;  4N23 A;  1F4M A;  3IFX A;  4UUJ C;  4GX0 A;  3MHH C;  1ENV A;  2NLJ C;  3JCZ A;  2IJJ A;  5KA6 A;  3FYE B;  1F4N A;  2BOB C;  4EKW A;  3ETG A;  2F43 G;  3CME V;  2WLH A;  2V7Q G;  2X6B A;  4Z1M G;  1YSC A;  3GWO A;  4MVU A;  4U7O A;  1ORQ C;  3F5W C;  1KQS U;  1GMG A;  1GM7 A;  3WFV A;  3X2Q B;  3M99 B;  1AI5 A;  4J9Z B;  1R73 A;  1VQ4 V;  2A9H A;  4WCE V;  4FMT A;  5B1N A;  3QO8 A;  3AEI A;  2W6I G;  4QIW F;  4G28 B;  1M56 C;  3VBB A;  4MTF A;  3RW0 A;  4MTG A;  2DW4 A;  1OZ0 A;  2P90 A;  2XAF A;  2Y69 B;  2C2A A;  1QCE A;  2EBO A;  2DYS C;  5H9C A;  4BW5 A;  1ROP A;  3RVY A;  3K3W A;  1P4R A;  1I5X A;  1NR7 A;  3ASN C;  4DXW A;  3ZRV A;  1VQ8 V;  1QLN A;  4JF3 A;  4R7C A;  4X8A A;  4WFE A;  2UXX A;  2OCC B;  1WPX A;  2YEV B;  1YTF D;  3I55 V;  1KKD A;  2A79 B;  2IJI A;  3T1C A;  2HG5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...